WorldWideScience

Sample records for bismuth 209 reactions

  1. Experimental study of the cross-sections of alpha-particle induced reactions on $^{209}$Bi

    CERN Document Server

    Hermanne, A; Shubin, Yu N; Szucs, Z; Takács, S; Tarkanyi, F; 10.1016/j.apradiso.2005.01.015

    2005-01-01

    alpha -particle-induced nuclear reactions for generation of /sup 211 /At used in therapeutic nuclear medicine and possible contaminants were investigated with the stacked foil activation technique on natural bismuth targets up to E/sub alpha /=39 MeV. Excitation functions are reported for the reactions /sup 209/Bi( alpha ,2n)/sup 211/At, /sup 209/Bi( alpha ,3n)/sup 210/At and /sup 209/Bi( alpha , x)/sup 210/Po. Results obtained from direct alpha -emission measurements and gamma -spectra from decay products are compared and correspond well with earlier literature values. Thick target yields have been deduced from the experimental cross-sections and optimised production pathways for minimal contamination are presented. A comparison with the results of the theoretical model code ALICE-IPPE is discussed.

  2. High-energy Neutron-induced Fission Cross Sections of Natural Lead and Bismuth-209

    CERN Document Server

    Tarrio, D; Carrapico, C; Eleftheriadis, C; Leeb, H; Calvino, F; Herrera-Martinez, A; Savvidis, I; Vlachoudis, V; Haas, B; Koehler, P; Vannini, G; Oshima, M; Le Naour, C; Gramegna, F; Wiescher, M; Pigni, M T; Audouin, L; Mengoni, A; Quesada, J; Becvar, F; Plag, R; Cennini, P; Mosconi, M; Rauscher, T; Couture, A; Capote, R; Sarchiapone, L; Vlastou, R; Domingo-Pardo, C; Dillmann, I; Pavlopoulos, P; Karamanis, D; Krticka, M; Jericha, E; Ferrari, A; Martinez, T; Trubert, D; Oberhummer, H; Karadimos, D; Plompen, A; Isaev, S; Terlizzi, R; Cortes, G; Cox, J; Cano-Ott, D; Pretel, C; Colonna, N; Berthoumieux, E; Vaz, P; Heil, M; Lopes, I; Lampoudis, C; Walter, S; Calviani, M; Gonzalez-Romero, E; Embid-Segura, M; Stephan, C; Igashira, M; Papachristodoulou, C; Aerts, G; Tavora, L; Berthier, B; Rudolf, G; Andrzejewski, J; Villamarin, D; Ferreira-Marques, R; Tain, J L; O'Brien, S; Reifarth, R; Kadi, Y; Neves, F; Poch, A; Kerveno, M; Rubbia, C; Lazano, M; Dahlfors, M; Wisshak, K; Salgado, J; Dridi, W; Ventura, A; Andriamonje, S; Assimakopoulos, P; Santos, C; Voss, F; Ferrant, L; Patronis, N; Chiaveri, E; Guerrero, C; Perrot, L; Vicente, M C; Lindote, A; Praena, J; Baumann, P; Kappeler, F; Rullhusen, P; Furman, W; David, S; Marrone, S; Tassan-Got, L; Gunsig, F; Alvarez-Velarde, F; Massimi, C; Mastinu, P; Pancin, J; Papadopoulos, C; Tagliente, G; Haight, R; Chepel, V; Kossionides, E; Badurek, G; Marganiec, J; Lukic, S; Pavlik, A; Goncalves, I; Duran, I; Alvarez, H; Abbondanno, U; Fujii, K; Milazzo, P M; Moreau, C

    2011-01-01

    The CERN Neutron Time-Of-Flight (n\\_TOF) facility is well suited to measure small neutron-induced fission cross sections, as those of subactinides. The cross section ratios of (nat)Pb and (209)Bi relative to (235)U and (238)U were measured using PPAC detectors. The fragment coincidence method allows to unambiguously identify the fission events. The present experiment provides the first results for neutron-induced fission up to 1 GeV for (nat)Pb and (209)Bi. A good agreement with previous experimental data below 200 MeV is shown. The comparison with proton-induced fission indicates that the limiting regime where neutron-induced and proton-induced fission reach equal cross section is close to 1 GeV.

  3. Investigation of corrosion, water reaction, polonium evaporation and bismuth resource in liquid metal lead-bismuth technology

    Energy Technology Data Exchange (ETDEWEB)

    Takano, Hideki; Takizuka, Takakazu [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kitano, Teruaki [Mitsui Shipbuilding and Engineering Co. Ltd., Tokyo (Japan)

    2000-10-01

    Lead-bismuth is the first candidate material for liquid metal target find coolant of fueled blanket system in accelerator-driven system (ADS) studied at JAERI. Advantages of the lead-bismuth utilization are non-active material, very low capture cross section, low melting point of 125degC and high boiling point of 1670degC, and beside coolant void reactivity become negative. But problems are due to the high corrosivity to most of the structural materials and the corrosive data are scarcity. In this report, corrosivity, reaction with water, thermal-hydraulics, chemical toxicity etc. are studied by investigating some facilities utilized and researched really for lead or lead-bismuth. And, furthermore, polonium evaporation rate and bismuth resource are investigated. Main results obtained are as follows: (1) In a refinery, there are enough employment experience for liquid Pb-Bi in period of about 17 years and not corrosion for the thermal conductive materials (1Cr-0.5Mo steel) used under the condition of natural convection with temperature around 400degC. (2) In Russia, extensive experience in the use as Russian submarines and in R and D during about 50 years are available. And as a result, it will be able to lead approximately zero corrosion for Cr-Si materials by adjusting oxygen film with oxygen concentration control between 10{sup -7} to 10{sup -5}% mass. However, the corrosion data are not enough systematically collected involving them in radiation dose field. (3) In liquid-dropping experiment, it is shown that interaction between water and high temperature liquid Pb-Bi is reduced steeply with rising of atmosphere pressure. But, in order to design the second circuit removal model of ADS, the interaction should be evaluated by water continuous injection experiment. (4) Polonium forms PbPo in Pb-Bi, and the evaporation rate become less three factor than that of Po, and furthermore, the rate decreases in the atmosphere. The effects of Po on employee and environment

  4. Preparation and characterization of bismuth ruthenate pyrochlore via solid state reaction and sol-gel methods

    Directory of Open Access Journals (Sweden)

    Mayuree Sansernnivet

    2010-01-01

    Full Text Available Bismuth ruthenate pyrochlores, potential cathode materials for intermediate temperature solid oxide fuel cells(ITSOFCs, were prepared via solid-state and sol-gel method. Effects of the preparation routes and conditions on the phase and microstructures of the materials were investigated in this study using XRD and SEM. The study showed that the preparation method and the adding sequence of the starting meterials have a significant effect on the crystal phase and the particle size obtained. Sol-gel synthesis could yield a material with only pyrochlore structure, i.e. Bi2Ru2O7, while the solid state method yielded powder with a small amount of the secondary RuO2 phase. The sol-gel synthesis resulted in materialswith a finer particle size (~0.3-1.0 μm compared to powder synthesized via the solid state reaction method.

  5. Nuclear level densities in 208Bi and 209Po from the neutron spectra in the ( p, n) reactions on 208Pb and 209Bi nuclei

    Science.gov (United States)

    Zhuravlev, B. V.; Lychagin, A. A.; Titarenko, N. N.; Demenkov, V. G.; Trykova, V. I.

    2010-07-01

    The spectra of neutrons from the ( p, n) reactions on the 208Pb and 209Bi nuclei were measured in the proton-energy range 8-11 MeV. These measurements were performed by using a time-of-flight spectrometer of fast neutrons on the basis of the pulsed tandem accelerator EGP-15 of the Institute of Physics and Power Engineering (Obninsk, Russian Federation). A high resolution and stability of the time-of-flight spectrometermade it possible to identify reliably low-lying discrete levels alongwith the continuum section of the neutron spectra. The measured data were analyzed on the basis of the statistical equilibrium and preequilibrium models of nuclear reactions. The respective calculations were performed by using the precise formalism of Hauser-Feshbach statistical theory together with the generalizedmodel of a superfluid nucleus and the back-shifted Fermi gas model for the nuclear-level density. The nuclear-level densities in 208Bi and 209Po were determined along with their energy dependences and model parameters. Our results are discussed together with available experimental data and recommendations of model systematics.

  6. A simple fast microwave-assisted synthesis of thermoelectric bismuth telluride nanoparticles from homogeneous reaction-mixture

    Science.gov (United States)

    Pradhan, Susmita; Das, Rashmita; Bhar, Radhaballabh; Bandyopadhyay, Rajib; Pramanik, Panchanan

    2017-02-01

    A new simple chemical method for synthesis of nanocrystalline bismuth telluride (Bi2Te3) has been developed by microwave assisted reduction of homogeneous tartrate complexes of bismuth and tellurium metal ions with hydrazine. The reaction is performed at pH 10. The nano-crystallites have rhombohedral phase identified by XRD. The size distribution of nanoparticle is narrow and it ranges between 50 to 70 nm. FESEM shows that the fine powders are composed of small crystallites. The TEM micrographs show mostly deformed spherical particles and the lattice fringes are found to be 0.137 nm. Energy dispersive X-ray spectroscopy (EDX) analysis shows the atomic composition ratio between bismuth and tellurium is 2:3. Thermoelectric properties of the materials are studied after sintering by spark plasma sintering method (SPS). The grain size of the material after sintering is in the nanometer range. The material shows enhanced Seebeck coefficient and electrical conductivity value at 300 K. The figure of merit is found to be 1.18 at 300 K.

  7. Fission cross section calculations for 209Bi target nucleus based on fission reaction models in high energy regions

    Directory of Open Access Journals (Sweden)

    Kaplan Abdullah

    2015-01-01

    Full Text Available Implementation of projects of new generation nuclear power plants requires the solving of material science and technological issues in developing of reactor materials. Melts of heavy metals (Pb, Bi and Pb-Bi due to their nuclear and thermophysical properties, are the candidate coolants for fast reactors and accelerator-driven systems (ADS. In this study, α, γ, p, n and 3He induced fission cross section calculations for 209Bi target nucleus at high-energy regions for (α,f, (γ,f, (p,f, (n,f and (3He,f reactions have been investigated using different fission reaction models. Mamdouh Table, Sierk, Rotating Liquid Drop and Fission Path models of theoretical fission barriers of TALYS 1.6 code have been used for the fission cross section calculations. The calculated results have been compared with the experimental data taken from the EXFOR database. TALYS 1.6 Sierk model calculations exhibit generally good agreement with the experimental measurements for all reactions used in this study.

  8. Thick target yield measurement of {sup 211}At through the nuclear reaction {sup 209}Bi({alpha}, 2n)

    Energy Technology Data Exchange (ETDEWEB)

    Alfarano, A [Institute for Health and Consumer Protection, IHCP, Joint Research Centre, via E. Fermi 1, 21020 Ispra, Varese (Italy); Abbas, K [Institute for Health and Consumer Protection, IHCP, Joint Research Centre, via E. Fermi 1, 21020 Ispra, Varese (Italy); Holzwarth, U [Institute for Health and Consumer Protection, IHCP, Joint Research Centre, via E. Fermi 1, 21020 Ispra, Varese (Italy); Bonardi, M [Universita degli Studi di Milano and INFN-Milano, LASA, Radiochemistry Laboratory, via F.lli Cervi 201, 20090 Segrate, Milan (Italy); Groppi, F [Universita degli Studi di Milano and INFN-Milano, LASA, Radiochemistry Laboratory, via F.lli Cervi 201, 20090 Segrate, Milan (Italy); Alfassi, Z [Department of Nuclear Engineering, Ben Gurion University, 84105 Beer Sheva (Israel); Menapace, E [ENEA, Applied Physics Division, Bologna (Italy); Gibson, P N [Institute for Health and Consumer Protection, IHCP, Joint Research Centre, via E. Fermi 1, 21020 Ispra, Varese (Italy)

    2006-05-15

    Radionuclide Therapy (RNT) and Radioimmunotherapy (RIT) are potentially of great interest for cancer therapy. In many therapeutic applications alpha emitters should be much more effective than already-approved beta emitters due to the short range and high linear energy transfer of alpha particles. {sup 213}Bi is an important alpha emitter already used in clinical trials but the half-life of this radioisotope is short (46 minutes) and so its use is limited for certain therapies. {sup 211}At is potentially very interesting for medical purposes because of its longer half-life of 7.2 hours, and suitable decay scheme. We have studied the cyclotron-based production of {sup 211}At via the reaction {sup 209}Bi({alpha}, 2n), this production route probably being the most promising in the long term. The energy dependence of thick target yields and the reaction cross sections for the production of {sup 211}At and {sup 210}At were determined and found to be in good agreement with literature. The best energy to produce {sup 211}At is 28-29 MeV. The possible production of the undesired, highly radiotoxic, and long-lived alpha-emitting {sup 210}Po (138.38 days), which is produced from decay of {sup 210}At, is also discussed.

  9. Review - Fabrication of crystal-oriented barium-bismuth titanate ceramics in high magnetic field and subsequent reaction sintering

    Directory of Open Access Journals (Sweden)

    Satoshi Tanaka, Yusuke Tomita, Ryoichi Furushima, Hiroyuki Shimizu, Yutaka Doshida and Keizo Uematsu

    2009-01-01

    Full Text Available High magnetic field was applied to fabricate novel lead-free piezoelectric ceramics with a textured structure. A compact of crystallographically oriented grains was prepared by dry forming in a high magnetic field from a mixed slurry of bismuth titanate and barium titanate powders. Bismuth titanate particles with a size of about 1 μ m were used as the host material. In the forming process, the slurry was poured into a mold and set in a magnetic field of 10 T until completely dried. Bismuth titanate particles were highly oriented in the slurry under the magnetic field. The dried powder compact consisted of highly oriented bismuth titanate particles and randomly oriented barium titanate particles. Barium bismuth titanate ceramics with a- and b-axis orientations were successfully produced from the dried compact by sintering at temperatures above 1100 ° C.

  10. Exploring contributions from incomplete fusion in $^{6,7}$Li+$^{209}$Bi and $^{6,7}$Li+$^{198}$Pt reactions

    CERN Document Server

    Parkar, V V; Kailas, S

    2016-01-01

    We use the breakup absorption model to simultaneously describe the measured cross-sections of the Complete fusion (CF), Incomplete fusion (ICF), and Total fusion (TF) in nuclear reactions induced by weakly bound nuclei $^{6,7}$Li on $^{209}$Bi and $^{198}$Pt targets. The absorption cross-sections are calculated using the Continuum Discretized Coupled Channels (CDCC) method with different choices of short range imaginary potentials to get the ICF, CF and TF cross-sections. It is observed that the cross-sections for deuteron-ICF/deuteron-capture are of similar magnitude as the $\\alpha$-ICF/$\\alpha$-capture, in case of $^{6}$Li projectile, while the cross-sections for triton-ICF/triton-capture is more dominant than $\\alpha$-ICF/$\\alpha$-capture in case of $^{7}$Li projectile. Both these observations are also corroborated by the experimental data. The ratio of ICF to TF cross-sections, which defines the value of fusion suppression factor is found to be in agreement with the data available from the literature. The...

  11. Polonium problem in lead-bismuth flow target

    Energy Technology Data Exchange (ETDEWEB)

    Pankratov, D.V.; Yefimov, E.I.; Bugreev, M.I. [State Scientific Centre of Russian Federation-Institute of Physics and Power Engineering, Obninsk (Russian Federation)

    1996-06-01

    Alpha-active polonium nuclides Po198 - Po210 are formed in a lead-bismuth target as results of reactions Bi{sup 209}(n,{gamma})Bi{sup 210} {yields} Po{sup 210}, Bi{sup 209}(p,xn)Po{sup 210} {yields} Po{sup 210 {minus} x} (x = 1-12), Pb{sup 208}({alpha},xn) {yields} Po{sup 210 {minus} x + 2} (x = 2-14). The most important nuclides are Po-210 (T{sub {1/2}}=138.4 day), Po-209 (T{sub {1/2}}=102 years) and Po-208 (T{sub {1/2}}=2.9 years). Polonium activity of the circuit for SINQ - conditions is about 15,000 Ci after 1-year operation. Polonium radiation hazard is connected with its output from the coolant and formation of aerosol and surface alpha-activity after the circuit break-down for repair works or in accidents. One of the important issues of polonium removal system creation is containing and storing polonium removed. Its storage in solidified alkaline is not expedient because of secondary neutron formation as a result of ({alpha},n) - reaction on oxygen and sodium nucleus. The estimations carried out demonstrated that by polonium concentration {approx} 100 Ci/l neutron current on the container surface can reach {approx} 10{sup 4}n/(cm{sup 2}s). Concentration and storage of polonium in solidified lead-bisumth seems the most convenient. The calculations demonstrated that in a 100 l container 50,000 Ci of polonium can be stored (as much as 3 times more than 1-year polonium product in SINQ-conditions) under temperature in the container less than melting point of lead bismuth (the wall temperature is about 100{degrees}C).

  12. An efficient synthesis of β-amino ketone compounds through one-pot three-component Mannich-type reactions using bismuth nitrate as catalyst

    Directory of Open Access Journals (Sweden)

    S. Sheik Mansoor

    2015-07-01

    Full Text Available Three components one-pot Mannich reaction of aromatic ketone, aromatic aldehyde and aromatic amines has been efficiently catalyzed by recyclable bismuth nitrate (Bi(NO33, BN at ambient temperature to give various β-amino carbonyl compounds in high yields. This method has advantages of mild condition, no environmental pollution, and simple work-up procedures. Most importantly, β-amino carbonyl compounds with ortho-substituted aromatic amines are obtained in acceptable to moderate yields by this methodology.

  13. A sensitive fluorescence quenching method for determination of bismuth with tiron

    Energy Technology Data Exchange (ETDEWEB)

    Taher, Mohammad Ali; Rahimi, Mina [Department of Chemistry, Shahid Bahonar University of Kerman, Kerman (Iran, Islamic Republic of); Fazelirad, Hamid, E-mail: hamidfazelirad@gmail.com [Department of Chemistry, Shahid Bahonar University of Kerman, Kerman (Iran, Islamic Republic of); Department of Chemistry, Science and Research Branch, Islamic Azad University, Yazd (Iran, Islamic Republic of); Young Researchers Society, Shahid Bahonar University of Kerman, P.O. Box 76175-133, Kerman (Iran, Islamic Republic of)

    2014-01-15

    We describe a fluorescence quenching method for determination of bismuth with tiron. The method is based on the reaction of tiron by bismuth(III) in acidic media. The influence of variables such as the pH, type of buffer, tiron concentration, reaction time and temperature were investigated. Under optimized conditions, the fluorescence quenching extent is proportional to the concentration of bismuth for Bi–tiron system at the range 0.13–2.09 μg mL{sup −1} and the detection limit is 0.05 μg mL{sup −1}. The proposed sensor presented good repeatability, evaluated in terms of relative standard deviation (R.S.D.=±0.498%) for 11 replicates. This sensitive, rapid and accurate method has been successfully applied to the determination of trace bismuth(III) in water and hair samples and certified reference materials. -- Highlights: • No previous paper report on use of fluorescence quenching for determination of Bi. • Fluorescence quenching of trion is a sensitive method for determination of Bi(III). • Under the optimum conditions the detection limit is very low (0.05 μg mL{sup −1}). • The procedure is simple and safe and has high tolerance limit to interferences.

  14. Hydrothermal synthesis of bismuth germanium oxide

    Energy Technology Data Exchange (ETDEWEB)

    Boyle, Timothy J.

    2016-12-13

    A method for the hydrothermal synthesis of bismuth germanium oxide comprises dissolving a bismuth precursor (e.g., bismuth nitrate pentahydrate) and a germanium precursor (e.g., germanium dioxide) in water and heating the aqueous solution to an elevated reaction temperature for a length of time sufficient to produce the eulytite phase of bismuth germanium oxide (E-BGO) with high yield. The E-BGO produced can be used as a scintillator material. For example, the air stability and radioluminescence response suggest that the E-BGO can be employed for medical applications.

  15. New measurement of neutron capture resonances of 209Bi

    CERN Document Server

    Domingo-Pardo, C; Abbondanno, U; Aerts, G; Alvarez-Pol, H; Alvarez-Velarde, F; Andriamonje, Samuel A; Andrzejewski, J; Assimakopoulos, Panayiotis; Audouin, L; Badurek, G; Baumann, P; Becvar, F; Berthoumieux, E; Calviño, F; Cano-Ott, D; Capote, R; Carrillode Albornoz, A; Cennini, P; Chepel, V; Chiaveri, Enrico; Colonna, N; Cortés, G; Couture, A; Cox, J; Dahlfors, M; David, S; Dillman, I; Dolfini, R; Dridi, W; Durán, I; Eleftheriadis, C; Embid-Segura, M; Ferrant, L; Ferrari, A; Ferreira-Marques, R; Fitzpatrick, L; Frais-Kölbl, H; Fujii, K; Furman, W; Gallino, R; Gonçalves, I; Gonzalez-Romero, E; Goverdovski, A; Gramegna, F; Griesmayer, E; Guerrero, C; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martínez, A; Igashira, M; Isaev, S; Jericha, E; Kadi, Y; Kappeler, F; Karamanis, D; Karadimos, D; Kerveno, M; Ketlerov, V; Köhler, P; Konovalov, V; Kossionides, E; Krticka, M; Lamboudis, C; Leeb, H; Lindote, A; Lopes, I; Lozano, M; Lukic, S; Marganiec, J; Marques, L; Marrone, S; Mastinu, P; Mengoni, A; Milazzo, P M; Moreau, C; Mosconi, M; Neves, F; Oberhummer, Heinz; Oshima, M; O'Brien, S; Pancin, J; Papachristodoulou, C; Papadopoulos, C; Paradela, C; Patronis, N; Pavlik, A; Pavlopoulos, P; Perrot, L; Plag, R; Plompen, A; Plukis, A; Poch, A; Pretel, C; Quesada, J; Rauscher, T; Reifarth, R; Rosetti, M; Rubbia, Carlo; Rudolf, G; Rullhusen, P; Salgado, J; Sarchiapone, L; Savvidis, I; Stéphan, C; Tagliente, G; Taín, J L; Tassan-Got, L; Tavora, L; Terlizzi, R; Vannini, G; Vaz, P; Ventura, A; Villamarín, D; Vincente, M C; Vlachoudis, V; Vlastou, R; Voss, F; Walter, S; Wendler, H; Wiescher, M; Wisshak, K

    2006-01-01

    The neutron capture cross section of Bi209 has been measured at the CERN n TOF facility by employing the pulse-height-weighting technique. Improvements over previous measurements are mainly because of an optimized detection system, which led to a practically negligible neutron sensitivity. Additional experimental sources of systematic error, such as the electronic threshold in the detectors, summing of gamma-rays, internal electron conversion, and the isomeric state in bismuth, have been taken into account. Gamma-ray absorption effects inside the sample have been corrected by employing a nonpolynomial weighting function. Because Bi209 is the last stable isotope in the reaction path of the stellar s-process, the Maxwellian averaged capture cross section is important for the recycling of the reaction flow by alpha-decays. In the relevant stellar range of thermal energies between kT=5 and 8 keV our new capture rate is about 16% higher than the presently accepted value used for nucleosynthesis calculations. At th...

  16. Bismuth triflate:A highly efficient catalyst for the synthesis of bio-active coumarin compoundsvia one-pot multi-component reaction

    Institute of Scientific and Technical Information of China (English)

    2015-01-01

    A series of coumarin-chalcone hybrid compounds and coumarins linked to pyrazoline was synthe-sized in good yield and short time using a simple and efficient method. This method involved the one-pot reaction of salicylaldehyde, an α-ketoester and an aromatic aldehyde (in the case of the coumarin-chalcone derivatives) in addition to hydrazine hydrate (in the case of the pyrazolyl cou-marins) in the presence of a catalytic amount of bismuth triflate [Bi(OTf)3, 5 mol%]. The synthesized compounds showed scavenging activity towards the free radical 2,2-diphenyl-1-picrylhydrazyl. All compounds were characterized using IR,1H NMR and13C NMR spectroscopy.

  17. Microwave-assisted synthesis of bismuth oxide

    Directory of Open Access Journals (Sweden)

    Eva Bartonickova

    2007-12-01

    Full Text Available Single phase and ultrafine bismuth oxide was synthesized via microwave-assisted hydrothermal synthesis. The effect of reaction parameters (temperature/pressure and pH on the product phase composition and morphology was discussed. The transformation of bismuth hydroxide into bismuth oxide was controlled by pH value and it was accelerated by time and temperature. The phase composition of reaction products was strongly dependent on pH value. The amorphous products were obtained at acidic pH conditions and the crystalline single phase product α-Bi2O3 phase was obtained at pH ≥12. The particle size was reduced from micrometric to nanometric size in the presence of a chelating agent. The bismuth hydroxides into bismuth oxides transformation mechanism, consisting in polycondensation ofBi–OH bounds to Bi–O–Bi bridges and crystallization of Bi2O3, was proposed.

  18. Dynamical decay process of {sup 219,} {sup 220}Ra{sup *} formed in {sup 10,} {sup 11}B+{sup 209}Bi reactions

    Energy Technology Data Exchange (ETDEWEB)

    Sawhney, G.; Sharma, M.K. [Thapar University, School of Physics and Materials Science, Punjab (India)

    2012-05-15

    The excitation functions for both the evaporation residue and fission have been calculated for {sup 10}B +{sup 209}Bi and {sup 11}B+{sup 209}Bi reactions forming compound systems {sup 219,220}Ra{sup *}, using the dynamical cluster-decay model (DCM) with effects of deformations and orientations of the nuclei included in it. In addition to this, the excitation functions for complete fusion (CF) are obtained by summing the fission cross-sections, neutron evaporation and charged particle evaporation residue cross-sections produced through the {alpha}xn and pxn (x = 2, 3, 4) emission channels for the {sup 219}Ra system at various incident centre-of-mass energies. Experimentally the CF cross-sections are suppressed and the observed suppression is attributed to the low binding energy of {sup 10,11}B which breaks up into charged fragments. The reported complete fusion (CF) and incomplete fusion (ICF) excitation functions for the {sup 219}Ra system are found to be nicely fitted by the calculations performed in the framework of DCM, without invoking a significant contribution from quasi-fission. Although DCM has been applied for a number of compound nucleus decay studies in the recent past, the same is being used here in reference to ICF and subsequent decay processes along with the CF process. Interestingly the main contribution to complete fusion cross-section comes from the fission cross-section at higher incident energies, which in DCM is found to consist of an asymmetric fission window, shown to arise due to the deformation and orientation effects of formation and decay fragments. (orig.)

  19. A Concise Synthesis of (-)-Indolizidines 209D and 209B

    Institute of Scientific and Technical Information of China (English)

    WU Hao; YU Menglong; ZHANG Yazhu; ZHAO Gang

    2009-01-01

    A general stereoselective synthetic route to 5-substituted and 5,8-disubstituted indolizidine alkaloids has been developed starting from commercially available L-proline. (-)-lndolizidines 209D and 209B were efficiently syn-thesized in 9.8% and 14.8% overall yields in seven and five-step reactions from readily available aldehyde 3 and ketone 10, respectively. The key steps of this synthesis involve a substrate-induced asymmetric addition of ethyl lithiopropiolate to aldehyde 3 or methyl ketone 10, and a two-step one-pot hydrogenation/cyclization sequence to construct the bicyclic skeleton.

  20. Bismuth titanate nanorods and their visible light photocatalytic properties

    Energy Technology Data Exchange (ETDEWEB)

    Pei, L.Z., E-mail: lzpei@ahut.edu.cn; Liu, H.D.; Lin, N.; Yu, H.Y.

    2015-02-15

    Highlights: • Bismuth titanate nanorods have been synthesized by a simple hydrothermal process. • The size of bismuth titanate nanorods can be controlled by growth conditions. • Bismuth titanate nanorods show good photocatalytic activities of methylene blue and Rhodamine B. - Abstract: Bismuth titanate nanorods have been prepared using a facile hydrothermal process without additives. The bismuth titanate products were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), high-resolution TEM (HRTEM) and UV-vis diffusion reflectance spectrum. XRD pattern shows that the bismuth titanate nanorods are composed of cubic Bi{sub 2}Ti{sub 2}O{sub 7} phase. Electron microscopy images show that the length and diameter of the bismuth titanate nanorods are 50-200 nm and 2 μm, respectively. Hydrothermal temperature and reaction time play important roles on the formation and size of the bismuth titanate nanorods. UV-vis diffusion reflectance spectrum indicates that bismuth titanate nanorods have a band gap of 2.58 eV. The bismuth titanate nanorods exhibit good photocatalytic activities in the photocatalytic degradation of methylene blue (MB) and Rhodamine B (RB) under visible light irradiation. The bismuth titanate nanorods with cubic Bi{sub 2}Ti{sub 2}O{sub 7} phase are a promising candidate as a visible light photocatalyst.

  1. Novel Bismuth Nanotubes

    Institute of Scientific and Technical Information of China (English)

    苏长荣; 李家明

    2002-01-01

    Theoretical investigations show that bismuth nanotubes are semiconductors for all diameters. For smalldiameter bismuth nanotubes, the band structures and bandgaps vary strongly with the strong hybridization effect. When the diameters are larger than 18 A, the bandgaps ofBi (n, n) and (n, 0) nanotubes approach 0.63 e V, corresponding to the bandgap of bismuth sheet at the Γ point. Thus, bismuth nanotubes are expected to be a potential semiconductor nanomaterial in future nanoelectronics.

  2. Energetics of bismuth vanadate

    Energy Technology Data Exchange (ETDEWEB)

    Nagabhushana, G.P.; Tavakoli, A.H.; Navrotsky, A., E-mail: anavrotsky@ucdavis.edu

    2015-05-15

    Bismuth vanadate has gained considerable interest as a photoanode for water splitting reactions under visible light. It exists in four different polymorphs, out of which three of them have been synthesized. Thermodynamic properties of these three polymorphs are investigated using high temperature oxide melt solution calorimetry. The monoclinic scheelite phase which exhibits photocatalytic activity under visible light is found to be the most stable polymorph, followed by tetragonal scheelite which exhibits activity under UV light. The photocatalytically inactive tetragonal zircon form is found to be the least stable polymorph. The small difference in enthalpy of formation between the two scheelite structures (−8 kJ/mol) is in accord with the reversibility of the transformation between them and the larger difference between the most stable monoclinic phase and the least stable tetragonal zircon phase (−23 kJ/mol) is in accord with the irreversible (monoclinic→tetragonal zircon) phase transformation. - Graphical abstract: Schematic representation of polymorphic transitions in BiVO{sub 4} along with their formation enthalpies. - Highlights: • Bismuth vanadate crystallizes in three different polymorphs. • High temperature calorimetric measurements were made to determine their formation enthalpies. • Enthalpy of formation decreases in the order BV-ms→BV-ts→BV-tz. • Photocatalytically active monoclinic-BiVO{sub 4} was found to be the most stable polymorph.

  3. Energetics of bismuth vanadate

    Science.gov (United States)

    Nagabhushana, G. P.; Tavakoli, A. H.; Navrotsky, A.

    2015-05-01

    Bismuth vanadate has gained considerable interest as a photoanode for water splitting reactions under visible light. It exists in four different polymorphs, out of which three of them have been synthesized. Thermodynamic properties of these three polymorphs are investigated using high temperature oxide melt solution calorimetry. The monoclinic scheelite phase which exhibits photocatalytic activity under visible light is found to be the most stable polymorph, followed by tetragonal scheelite which exhibits activity under UV light. The photocatalytically inactive tetragonal zircon form is found to be the least stable polymorph. The small difference in enthalpy of formation between the two scheelite structures (-8 kJ/mol) is in accord with the reversibility of the transformation between them and the larger difference between the most stable monoclinic phase and the least stable tetragonal zircon phase (-23 kJ/mol) is in accord with the irreversible (monoclinic→tetragonal zircon) phase transformation.

  4. A bismuth activation counter for high sensitivity pulsed 14 MeV neutrons

    Science.gov (United States)

    Burns, E. J. T.; Thacher, P. D.; Hassig, G. J.; Decker, R. D.; Romero, J. A.; Barrett, K. P.

    2011-08-01

    We have built a fast neutron bismuth activation counter that measures activation counts from pulsed 14-MeV neutron generators for incident neutron fluences between 30 and 300 neutrons/cm2 at 15.2 cm (6 in.). The activation counter consists of a large bismuth germanate (BGO) detector surrounded by a bismuth metal shield in front of and concentric with the cylindrical detector housing. The 14 MeV neutrons activate the 2.6-millisecond (ms) isomer in the shield and the detector by the reaction 209Bi (n,2nγ) 208mBi. The use of millisecond isomers and activation counting times minimizes the background from other activated materials and the environment. In addition to activation, the bismuth metal shields against other outside radiation sources. We have tested the bismuth activation counter, simultaneously, with two data acquisition systems (DASs) and both give similar results. The two-dimensional (2D) DAS and three dimensional (3D) DAS both consist of pulse height analysis (PHA) systems that can be used to discriminate against gamma radiations below 300 keV photon energy, so that the detector can be used strictly as a counter. If the counting time is restricted to less than 25 ms after the neutron pulse, there are less than 10 counts of background for single pulse operation in all our operational environments tested so far. High-fluence neutron generator operations are restricted by large dead times and pulse height saturation. When we operate our 3D DAS PHA system in list mode acquisition (LIST), real-time corrections to dead time or live time can be made on the scale of 1 ms time windows or dwell times. The live time correction is consistent with nonparalyzable models for dead time of 1.0±0.2 μs for our 3D DAS and 1.5±0.3 μs for our 2D DAS dominated by our fixed time width analog to digital converters (ADCs). With the same solid angle, we have shown that the bismuth activation counter has a factor of 4 increase in sensitivity over our lead activation counter

  5. Measurements of gas and volatile element production rates from an irradiated molten lead and lead-bismuth spallation target with proton beams of 1 and 1.4 GeV; Mesures de taux de production d'elements gazeux et volatiles lors de reactions induites par des protons de 1 et 1,4 GeV sur des cibles epaisses de plomb et plomb-bismuth liquides

    Energy Technology Data Exchange (ETDEWEB)

    Tall, Y

    2008-03-15

    The integrated project EUROTRANS (European Research Programme for the Transmutation of High Level Nuclear Waste in an Accelerator Driven System) of the 6. EURATOM Framework Programme aims to demonstrate the transmutation of radioactive waste in ADS (Accelerator Driven Sub-critical system). It will carry out a first advanced design of an experimental facility to demonstrate the technical feasibility of transmutation, and will produce a conceptual design of an industrial facility dedicated to transmutation. An ADS consists of three fundamental elements: the accelerator of protons, the sub-critical core and the spallation target. SUBATECH (physique Sub-Atomique et des Technologies associees) laboratory is involved to the study of the chosen liquid lead-bismuth as a spallation ADS target. The irradiation of liquid lead-bismuth target with energetic proton beam generates in addition to neutrons, volatile and radioactive residues. In order to determine experimentally the production rates of gas and volatile elements following a spallation reaction in a lead-bismuth target, the experiment IS419 was performed at the ISOLDE facility at CERN (Centre Europeen de la Recherche Nucleaire). This experiment constitutes the frame of the thesis whose main objective is to assess and study the production and release rates of many gas and volatile element from the irradiated lead-bismuth target with an energetic proton beam. The obtained data are compared to Monte Carlo simulation code (MCNPX) results in order to test the intranuclear cascade model of Bertini and of Cugnon, and the evaporation options of Dresner and Schmidt. (author)

  6. Nanocalorimetry of bismuth nanoparticles

    Science.gov (United States)

    Olson, Eric Ashley

    The properties of nanosized bismuth particles are investigated using a nanocalorimetric technique. A brief description of the experimental method and data analysis procedures is reported. Bismuth nanoparticles are found to melt at a temperature below that of bulk material, but higher than expected using the standard model. Also included is the results of a finite element analysis and simulated melting of bismuth films on various kinds of sensors. Temperature distributions are found to be nonuniform for calorimetric sensors with Al metallizations, but much more uniform for Pt metallized sensors. The consequences of this nonuniformity on caloric data are discussed.

  7. At R209

    CERN Multimedia

    1977-01-01

    Side view of R209, showing a large muon chamber in front of the Iron toroid magnet. Gunter Feilhauer is looking down from top of the magnet. Ulrich Becker (left), Lars Leistam (right) stand on the floor.

  8. Electrocatalytic activity of bismuth doped silver electrodes

    CERN Document Server

    Amjad, M

    2002-01-01

    Investigation of redox reactions on silver, and bismuth doped silver electrodes in aqueous KOH solutions, by using potentiostatic steady-state polarization technique, has been carried out. The redox wave potential and current displacements along with multiplicity of the latter have been examined. These electrodes were employed for the oxidation of organic molecules such as ethylamine in alkaline media. Subsequently, these electrodes were ranked with respect to their activity for the redox reactions. (author)

  9. Experimental Cross Sections for Reactions of Heavy Ions and 208Pb, 209Bi, 238U, and 248Cm Targets

    Energy Technology Data Exchange (ETDEWEB)

    Patin, Joshua Barnes [Univ. of California, Berkeley, CA (United States)

    2002-01-01

    The study of the reactions between heavy ions and 208Pb, 209Bi, 238U, and 248Cm Cm targets was performed to look at the differences between the cross sections of hot and cold fusion reactions. Experimental cross sections were compared with predictions from statistical computer codes to evaluate the effectiveness of the computer code in predicting production cross sections. Hot fusion reactions were studied with the MG system, catcher foil techniques and the Berkeley Gas-filled Separator (BGS). 3n- and 4n-exit channel production cross sections were obtained for the 238U(18O,xn)256-xFm, 238U(22Ne,xn)260-xNo, and 248Cm(15N,xn)263-xLr reactions and are similar to previous experimental results. The experimental cross sections were accurately modeled by the predictions of the HIVAP code using the Reisdorf and Schaedel parameters and are consistent with the existing systematics of 4n exit channel reaction products. Cold fusion reactions were examined using the BGS. The 48Pb(238Ca,xn)256-xNo, 208Pb(50Ti,xn)258-xRf, 208Pb(51V,xn)259-xDb, 50Bi(238Ti,xn)259-xDb, and 209Bi(51V,xn)260-xSg reactions were studied. The experimental production cross sections are in agreement with the results observed in previous experiments. It was necessary to slightly alter the Reisdorf and Schaedel parameters for use in the HIVAP code in order to more accurately model the experimental data. The cold fusion experimental results are in agreement with current 1n- and 2n-exit channel systematics.

  10. Bismuth vanadate process

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, R.M.

    1990-06-26

    This patent describes the process for the preparation of bismuth vanadate and bismuth vanadate-containing compounds wherein the precursor materials are calcined in the solid state at temperatures sufficient to react the precursor materials to prepare the vanadate compounds. It comprises: wet grinding the calcined product, contacting the calcined product with sufficient alkaline material to provide a pH level of 7.0-13.0 and recovering the treated product, the wet grinding of the calcined product being conducted either in the presence of the alkaline material or prior to the contacting with the alkaline material.

  11. Hierarchical bismuth phosphate microspheres with high photocatalytic performance

    Energy Technology Data Exchange (ETDEWEB)

    Pei, Lizhai; Wei, Tian; Lin, Nan; Yu, Haiyun [Anhui University of Technology, Ma' anshan (China). Key Laboratory of Materials Science and Processing of Anhui Province

    2016-05-15

    Hierarchical bismuth phosphate microspheres have been prepared by a simple hydrothermal process with polyvinyl pyrrolidone. Scanning electron microscopy observations show that the hierarchical bismuth phosphate microspheres consist of nanosheets with a thickness of about 30 nm. The diameter of the microspheres is about 1 - 3 μm. X-ray diffraction analysis shows that the microspheres are comprised of triclinic Bi{sub 23}P{sub 4}O{sub 44.5} phase. The formation of the hierarchical microspheres depends on polyvinyl pyrrolidone concentration, hydrothermal temperature and reaction time. Gentian violet acts as the pollutant model for investigating the photocatalytic activity of the hierarchical bismuth phosphate microspheres under ultraviolet-visible light irradiation. Irradiation time, dosage of the hierarchical microspheres and initial gentian violet concentration on the photocatalytic efficiency are also discussed. The hierarchical bismuth phosphate microspheres show good photocatalytic performance for gentian violet removal in aqueous solution.

  12. Effect of the bismuth content on the interface reactions between copper substrate and Sn-Zn-Al-Bi lead-free solder

    Directory of Open Access Journals (Sweden)

    Soares, D.

    2005-12-01

    Full Text Available Because of environmental and health concerns, some alternative solder alloys, named lead-free ones, are being developed. Among them, the Sn-Zn-Al system has been studied and reveals promising properties. In this work the presence of bismuth, in the range of 0-8 wt%, was evaluated in what concerns to the chemical interactions between solder/substrate and the equilibrium phases present at the interface. The phases formed at the interface between the copper substrate and a molten lead-free solder were studied with different time of stage and alloy compositions. The effect of bismuth content on transformation temperatures of a Sn-9Zn-1Al base alloy was studied by Differential Scanning Calorimetry (DSC. For each alloy the solidification range was determined, which is an important characteristic regarding the application of these materials in the electronic industry. Identification of equilibrium phases and their chemical composition evaluation was performed by scanning electron microscopy (SEM/EDS. The interface thickness and chemical composition profiles were also evaluated.

    Debido a las preocupaciones ambientales y sanitarias, se están desarrollando aleaciones alternativas para soldadura sin plomo. Entre ellas se ha estudiado el sistema Sn-Zn-Al, que revela propiedades prometedoras. En este trabajo se evalúa la presencia de bismuto, en el rango de 0 a 8 % en peso, en relación con las interacciones químicas entre soldadura y substrato y con las fases de equilibrio presentes en la superficie de contacto. Se han estudiado las fases formadas en la superficie de contacto entre el substrato de cobre y una soldadura fundida sin plomo en función del tiempo de mantenimiento y de la composición de la aleación. Se ha evaluado el efecto del contenido en bismuto sobre las temperaturas de transformación de una aleación de base Sn-9Zn-1Al mediante Calorimetría de Barrido Diferencial (DSC. Se ha determinado el rango de solidificación para cada

  13. Correlations between Polarisation States of W Particles in the Reaction $e^- e^+\\to W^- W^+$ at LEP2 Energies 189-209 GeV

    CERN Document Server

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, U; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W-D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, P; Ballestrero, A; Bambade, P; Barbier, R; Bardin, D; Barker, G J; Baroncelli, A; Battaglia, M; Baubillier, M; Becks, K-H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N; Benvenuti, A; Bérat, C; Berggren, M; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Buschbeck, B; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F; Chapkin, M; Charpentier, Ph; Checchia, P; Chierici, R; Chliapnikov, P V; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L; Di Ciaccio, L; Di Simone, A; Doroba, K; Drees, J; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J; Gandelman, M; García, C; Gavillet, Ph; Gazis, E; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Hoffman, J; Holmgren, S-O; Holt, P J; Houlden, M A; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Katsoufis, E; Kernel, G; Kersevan, B P; Kerzel, U; King, B T; Kjaer, N J; Kluit, P; Kokkinias, P; Kourkoumelis, C; Kuznetsov, O; Krumshtein, Z; Kucharczyk, M; Lamsa, J; Leder, G; Ledroit, F; Leinonen, L; Leitner, R; Lemonne, J; Lepeltier, V; Lesiak, T; Liebig, W; Liko, D; Lipniacka, A; Lopes, J H; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J-C; Mariotti, C; Markou, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L; Murray, W; Muryn, B; Myatt, G; Myklebust, T; Nassiakou, M; Navarria, F; Nawrocki, K; Némécek, S; Nicolaidou, R; Nikolenko, M; Oblakowska-Mucha, A; Obraztsov, V F; Olshevski, A; Onofre, A; Orava, R; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Palacios, J P; Palka, H; Papadopoulou, Th D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Pozdnyakov, V; Pukhaeva, N; Pullia, A; Radojicic, D; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Roudeau, P; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Sander, C; Savoy-Navarro, A; Schwickerath, U; Sekulin, R; Siebel, M; Sisakian, A; Smadja, G; Smirnova, O; Sokolov, A; Sopczak, A; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Tegenfeldt, F; Timmermans, J; Tkatchev, L; Tobin, M; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M-L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G; van Dam, P; Van Eldik, J; Van Remortel, N; Van Vulpen, I; Vegni, G; Veloso, F; Venus, W; Verdier, P; Verzi, V; Vilanova, D; Vitale, L; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J; Wilkinson, G; Winter, M; Witek, M; Yushchenko, O; Zalewska-Bak, A; Zalewski, P; Zavrtanik, D; Zhuravlov, V; Zimin, N I; Zintchenko, A; Zupan, M

    2009-01-01

    In a study of the reaction e-e+ -> W-W+ with the DELPHI detector, the probabilities of the two W particles occurring in the joint polarisation states transverse-transverse (TT), longitudinal-transverse plus transverse-longitudinal (LT) and longitudinal-longitudinal (LL) have been determined using the final states WW -> l nu q qbar (l = e, mu). The two-particle joint polarisation probabilities, i.e. the spin density matrix elements rho_TT, rho_LT, rho_LL, are measured as functions of the W- production angle, theta_W-, at an average reaction energy of 198.2 GeV. Averaged over all cos(theta_W-), the following joint probabilities are obtained: rho_TT = (67 +/- 8)%, rho_LT = (30 +/- 8)%, rho_LL = (3 +/- 7)% . These results are in agreement with the Standard Model predictions of 63.0%, 28.9% and 8.1%, respectively. The related polarisation cross-sections sigma_TT, sigma_LT and sigma_LL are also presented.

  14. THORIUM DISPERSION IN BISMUTH

    Science.gov (United States)

    Bryner, J.S.

    1961-07-01

    The growth of thorium bismutaide particles, which are formed when thorium is suspended in liquid bismuth, is inhibited when the liquid metal suspension is being flowed through a reactor and through a heat exchanger in sequence. It involves the addition of as little as 1 part by weight of tellurium to 100 parts of thorium. This addition is sufficient to inhibit particle growth and agglomeration.

  15. Layered bismuth vanadate ferroelectrics

    Energy Technology Data Exchange (ETDEWEB)

    Osipyan, V.G.; Savchenko, L.M.; Elbakyan, V.L.; Avakyan, P.B.

    1987-08-01

    The authors synthesize new layered bismuth vanadate ferroelectrics. The x-ray diffraction characteristics of Bi/sub 2/VO/sub 5.5/ are shown. Thermal expansion of ceramics with various compositions are presented, as are the temperature dependences of the dielectric constant of the ceramic with various compositions. Unit-cell parameters, Curie temperature, electrical conductivity and the dielectric characteristics of the compositions studied are shown.

  16. Bismuth toxicity in patients treated with bismuth iodoform paraffin packs.

    Science.gov (United States)

    Atwal, A; Cousin, G C S

    2016-01-01

    Bismuth is a heavy metal used in bismuth iodoform paraffin paste (BIPP) antiseptic dressings and in a number of other medical preparations. It can be absorbed systemically and cause toxicity. We report 2 cases of such neurotoxicity after it was used in operations on the jaws.

  17. Tribochemistry of Bismuth and Bismuth Salts for Solid Lubrication

    NARCIS (Netherlands)

    Gonzalez Rodriguez, P.; Nieuwenhuijzen, van den K.J.H.; Lette, W.; Schipper, D.J.; Elshof, ten J.E.

    2016-01-01

    One of the main trends in the past decades is the reduction of wastage and the replacement of toxic compounds in industrial processes. Some soft metallic particles can be used as nontoxic solid lubricants in high-temperature processes. The behavior of bismuth metal particles, bismuth sulfide (Bi2S3)

  18. Bismuth(V) oxide and silver bismuthate as oxidizing agents for gas-chromatographic elemental microanalysis

    Energy Technology Data Exchange (ETDEWEB)

    Shvykin, A.Y.; Platonov, V.V.; Proskuryakov, V.P.; Chilachava, K.B.; Khmarin, E.M.; Kovtun, I.V. [Tolstoy State Pedag University, Tula (Russian Federation)

    2004-07-01

    Bismuth(V) oxide, silver bismuthate, and a mixture of bismuth(V) oxide with fine silver powder were studied as oxidizing additives in gas-chromatographic elemental microanalysis of readily combustible organic substances and coal.

  19. Bismuth ochers from San Diego Co., California

    Science.gov (United States)

    Schaller, W.T.

    1911-01-01

    The chief points brought out in this paper may be briefly summarized as follows: (1) The existence of natural Bi2O3 has not been established. (2) Natural bismite or bismuth ocher, when pure, is more probably a bismuth hydroxide. (3) The bismuth ochers from San Diego County, California, are either a bismuth hydroxide or bismuth vanadate, pucherite, or mixtures of these two. (4) Pucherite has been found noncrystallin and determined for the first time in the United States.

  20. Highly monodisperse bismuth nanoparticles and their three-dimensional superlattices.

    Science.gov (United States)

    Yarema, Maksym; Kovalenko, Maksym V; Hesser, Günter; Talapin, Dmitri V; Heiss, Wolfgang

    2010-11-01

    A simple and reproducible synthesis of highly monodisperse and ligand-protected bismuth nanoparticles (Bi NPs) is reported. The size of the single-crystalline and spherically shaped NPs is controlled between 11 and 22 nm mainly by the reaction temperature. The high uniformity of the NPs allows their self-assembly into long-range-ordered two- and three-dimensional superstructures.

  1. Inhibition of urease by bismuth(III): implications for the mechanism of action of bismuth drugs.

    Science.gov (United States)

    Zhang, Li; Mulrooney, Scott B; Leung, Andy F K; Zeng, Yibo; Ko, Ben B C; Hausinger, Robert P; Sun, Hongzhe

    2006-10-01

    Bismuth compounds are widely used for the treatment of peptic ulcers and Helicobacter pylori infections. It has been suggested that enzyme inhibition plays an important role in the antibacterial activity of bismuth towards this bacterium. Urease, an enzyme that converts urea into ammonia and carbonic acid, is crucial for colonization of the acidic environment of the stomach by H. pylori. Here, we show that three bismuth complexes exhibit distinct mechanisms of urease inhibition, with some differences dependent on the source of the enzyme. Bi(EDTA) and Bi(Cys)(3) are competitive inhibitors of jack bean urease with K(i) values of 1.74 +/- 0.14 and 1.84 +/- 0.15 mM, while the anti-ulcer drug, ranitidine bismuth citrate (RBC) is a non-competitive inhibitor with a K (i) value of 1.17 +/- 0.09 mM. A (13)C NMR study showed that Bi(Cys)(3) reacts with jack bean urease during a 30 min incubation, releasing free cysteines from the metal complex. Upon incubation with Bi(EDTA) and RBC, the number of accessible cysteine residues in the homohexameric plant enzyme decreased by 5.80 +/- 0.17 and 11.94 +/- 0.13, respectively, after 3 h of reaction with dithiobis(2-nitrobenzoic acid). Kinetic analysis showed that Bi(EDTA) is both a competitive inhibitor and a time-dependent inactivator of the recombinant Klebsiella aerogenes urease. The active C319A mutant of the bacterial enzyme displays a significantly reduced sensitivity toward inactivation by Bi(EDTA) compared with the wild-type enzyme, consistent with binding of Bi(3+) to the active site cysteine (Cys(319)) as the mechanism of enzyme inactivation.

  2. Mineral resource of the month: bismuth

    Science.gov (United States)

    Carlin, James F.

    2006-01-01

    Bismuth compounds are most known for their soothing effects on the stomach, wounds and sores. These properties make the compounds an essential part of many medicinal and cosmetic preparations, which until 1930 accounted for about 90 percent of the bismuth used. The subsequent development of low-melting alloys and chemical catalysts containing bismuth, as well as its use as an additive to casting alloys, has resulted in a wider variety of industrial applications for bismuth.

  3. Three-Component One-Pot Synthesis of Novel Benzo[b]1,8-naphthyridines Catalyzed by Bismuth(III Chloride

    Directory of Open Access Journals (Sweden)

    Tangali R. Ravikumar Naik

    2008-01-01

    Full Text Available A novel and efficient three-component one-pot synthesis of benzo[b]1,8-naphthyridines by 2-amino-4-methylquinoline, aromatic aldehydes, and malononitrile was done. The reaction was catalyzed by an acidic Bismuth(III chloride, functionalized Bismuth(III chloride, at room temperature to give various benzo[b]1,8-naphthyridines in high yields. The Bismuth(III chloride is an environmentally friendly catalyst.

  4. 氧化铋光催化剂降解亚甲基兰反应条件研究%Study on Degradation Reaction Conditions of Methylene Blue by Bismuth Oxide

    Institute of Scientific and Technical Information of China (English)

    高红; 王学同

    2014-01-01

    氧化铋作为一种光催化剂,可应用于水中有机污染物的降解,并且氧化铋可实现对太阳光的有效利用,节约水处理成本。在氧化铋降解亚甲基兰模拟废水的实验中,影响其反应效果的因素包括催化剂用量、模拟废水浓度、pH值等。通过单因素和正交实验,确定了氧化铋降解亚甲基兰反应过程中的最佳实验条件。%As a photocatalyst, bismuth oxide could be applied to degrade organic pollutants in water, achieved the effective utilization of solar energy, and saved the cost of water treatment. In the degradation of methylene blue wastewater by bismuth oxide, influence factors included catalyst dosage, wastewater concentration and pH. Through single factor and orthogonal experiments, the optimal experimental conditions of degradation of methylene blue by bismuth oxide were obtained.

  5. Nanometer bismuth oxide produced by resistance heating vapor oxidation

    Institute of Scientific and Technical Information of China (English)

    HU Han-xiang; QIU Ke-qiang

    2006-01-01

    Bismuth oxide has wide applications in superconductive material, photoelectric material, electronic ceramic, electrolyte, and catalysts. To produce ultrafine bismuth oxide powders, some costly heating sources, such as plasma, high frequency induction, electron beam or laser, have to be used in the conventional vapor oxidation methods. The vapor oxidation method was improved by adding a reducing agent in the reaction system, where heating source was resistance tubular oven, instead of special heat source requirement. Nanometer bismuth oxide was prepared at 1 000-1 140 ℃, and the particle characteristics were investigated by XRD, SEM, DTA, laser sedimentograph. With low oxygen concentration (less than 20%) in the carrier gas, the bismuth oxide particle was near-sphere β-Bi2O3 with uniform and fine particle size (d0.5=65 nm, GSD=1.42); while with higher oxygen content (more than 50%), the powders were mixture of Bi2O2CO3 and β-Bi2O3.

  6. 48 CFR 209.407 - Suspension.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Suspension. 209.407... OF DEFENSE ACQUISITION PLANNING CONTRACTOR QUALIFICATIONS Debarment, Suspension, and Ineligibility 209.407 Suspension....

  7. 48 CFR 209.104 - Standards.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Standards. 209.104 Section 209.104 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF... Standards....

  8. γ -ray spectroscopy of 209Tl

    Science.gov (United States)

    Amro, B. M. S.; Lister, C. J.; McCutchan, E. A.; Loveland, W.; Chowdhury, P.; Zhu, S.; Ayangeakaa, A. D.; Barrett, J. S.; Carpenter, M. P.; Chiara, C. J.; Greene, J. P.; Harker, J. L.; Janssens, R. V. F.; Lauritsen, T.; Sonzogni, A. A.; Walters, W. B.; Yanez, R.

    2017-01-01

    States in 209Tl were populated using a multinucleon transfer reaction with a 136Xe beam impinging on a thick 208Pb target at E =785 MeV. The beam was pulsed at 825-ns intervals in order to perform isomer decay spectroscopy. The known Jπ=17 /2+ isomer in 209Tl was located at 1228(4) keV and measured to have a half-life of T1 /2=146 (10 ) ns. A second isomer with Jπ=13 /2+ was found to have T1 /2=14 (5 ) ns. The previously suggested low-energy X and Y transitions were found to have energies 57(2) and 47(2) keV respectively, while the measurement of conversion coefficients and a new decay path make the spin assignments below the isomers experimentally firm. Correlating the delayed γ transitions with the prompt beam flash allowed the decay of states above the isomer to be found. The longer-lived isomer represents full alignment of the simplest two-particle, one-hole configuration and illuminates the remarkably weak coupling of the proton hole to the 210Pb core.

  9. 40 CFR 89.209 - Certification.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Certification. 89.209 Section 89.209... Provisions § 89.209 Certification. (a) In the application for certification a manufacturer must: (1) Declare...) Submit a statement that the engines for which certification is requested will not, to the best of...

  10. 7 CFR 868.209 - Information.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Information. 868.209 Section 868.209 Agriculture... Application of Standards § 868.209 Information. Requests for the Rice Inspection Handbook, Equipment Handbook, or for information concerning approved devices and procedures, criteria for approved devices,...

  11. 22 CFR 209.6 - Compliance information.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Compliance information. 209.6 Section 209.6... § 209.6 Compliance information. (a) Cooperation and assistance. The Administrator shall to the fullest... and accurate compliance reports at such times, and in such form and containing such information,...

  12. 46 CFR 108.209 - Hospital spaces.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Hospital spaces. 108.209 Section 108.209 Shipping COAST... Construction and Arrangement Accommodation Spaces § 108.209 Hospital spaces. (a) Each unit carrying twelve or more persons on a voyage of more than three days must have a hospital space. (b) Each hospital...

  13. 33 CFR 136.209 - Proof.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Proof. 136.209 Section 136.209 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE POLLUTION... SOURCE; AND ADVERTISEMENT Procedures for Particular Claims § 136.209 Proof. In addition to...

  14. 40 CFR 209.12 - Time.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Time. 209.12 Section 209.12 Protection... Issued Under Section 11(d) of the Noise Control Act § 209.12 Time. (a) In computing any period of time... period of time begins to run shall not be included, except as otherwise provided. Saturdays, Sundays,...

  15. 42 CFR 59.209 - Civil rights.

    Science.gov (United States)

    2010-10-01

    ... issued by the Secretary of Health and Human Services with the approval of the President (45 CFR part 80). ... 42 Public Health 1 2010-10-01 2010-10-01 false Civil rights. 59.209 Section 59.209 Public Health... Grants for Family Planning Service Training § 59.209 Civil rights. Attention is called to...

  16. 24 CFR 941.209 - Audit.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Audit. 941.209 Section 941.209... HOUSING DEVELOPMENT PHA Eligibility and Program Requirements § 941.209 Audit. All PHAs that receive funds under this part for the development of low-income housing shall comply with audit requirements in 24...

  17. 47 CFR 53.209 - Biennial audit.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Biennial audit. 53.209 Section 53.209... PROVISIONS CONCERNING BELL OPERATING COMPANIES Separate Affiliate; Safeguards § 53.209 Biennial audit. (a) A... obtain and pay for a Federal/State joint audit every two years conducted by an independent auditor...

  18. 22 CFR 209.4 - Discrimination prohibited.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 209.4 Section 209.4 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NON-DISCRIMINATION IN FEDERALLY-ASSISTED PROGRAMS... § 209.4 Discrimination prohibited. (a) General. No person in the United States shall, on the grounds...

  19. 23 CFR 650.209 - Construction.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Construction. 650.209 Section 650.209 Highways FEDERAL..., STRUCTURES, AND HYDRAULICS Erosion and Sediment Control on Highway Construction Projects § 650.209 Construction. (a) Permanent erosion and sediment control measures and practices shall be established...

  20. Comparative Study of Semiconductors Bismuth Iodate, Bismuth Triiodide and Bismuth Trisulphide Crystals

    Directory of Open Access Journals (Sweden)

    T.K. Patil

    2012-12-01

    Full Text Available In the present investigation, crystals of Bismuth Iodate[Bi(IO33], Bismuth Iodide[BiI3] and Bismuth- Tri Sulphide [Bi2S3] were grown by a simple gel technique using single diffusion method. The optimum growth conditions were established by varying various parameters such as pH of gel solution, gel concentration, gel setting time, concentration of reactant etc. Gel was prepared by mixing sodium meta silicate (Na2SiO35H2O, glacial acetic acid (CH3COOH and supernant bismuth chloride (BiCl3 at pH value 4.4 and transferred in glass tube of diameter 2.5 cm and 25 cm in length. The mouth of test tube was covered by cotton plug and kept it for the setting. After setting the gel, it was left for aging. After 13 days duration the second supernant K(IO3, KI3 and H2S water gas solution was poured over the set gel by using pipette then it was kept undisturbed. After 72 hours of pouring the second supernatant, the small nucleation growth was observed at below the interface of gel. The good quality crystals of [Bi(IO33], [BiI3] and [Bi2S3] were grown. These grown crystals were characterized by XRD, FTIR, Chemical Analysis and Electrical Conductivity.

  1. Bismuth absorption from sup 205 Bi-labelled pharmaceutical bismuth compounds used in the treatment of peptic ulcer disease

    Energy Technology Data Exchange (ETDEWEB)

    Dresow, B.; Fischer, R.; Gabbe, E.E.; Wendel, J.; Heinrich, H.C. (Eppendorf University Hospital, Hamburg (Germany))

    1992-04-01

    The absorption of bismuth from five {sup 205}Bi-labelled pharmaceutically used bismuth compounds was studied in man. From single oral doses of all compounds under investigation only <0.1% bismuth was absorbed and excreted with the urine. A significantly higher absorption was observed from the colloidal bismuth subcitrate and the basic bismuth gallate than from the basic bismuth salicylate, nitrate and aluminate. No retention of bismuth in the whole body was found from the single dose experiment. The biologic fast-term half-lives of absorbed bismuth were calculated to be 0.12 and 1.5 days. 14 refs., 2 figs., 1 tab.

  2. Structure of unsupported bismuth nanoparticles

    Science.gov (United States)

    Wurl, A.; Hyslop, M.; Brown, S. A.; Hall, B. D.; Monot, R.

    We present new results of electron diffraction experiments on unsupported nanometer-sized bismuth clusters. The high intensity cluster beam, necessary for electron diffraction, is provided by an inert-gas aggregation source. The cluster beam contains particles with average cluster sizes between 4.5 and 10 nm. When using Helium as a carrier gas we are able to observe a transition from crystalline clusters to a new structure, which we identify with that of amorphous or liquid clusters.

  3. Ranitidine bismuth citrate: A review

    Directory of Open Access Journals (Sweden)

    N Chiba

    2001-01-01

    Full Text Available Recognition of the relationship between Helicobacter pylori infection and the development of gastroduodenal disease has increased greatly in recent years. To avoid complications of H pylori infection, such as the development of recurrent duodenal and gastric ulcers, effective therapies are required for eradication of the infection. This article reviews ranitidine bismuth citrate (RBC, a novel complex of ranitidine, bismuth and citrate, which was developed specifically for the purpose of eradicating H pylori. Dual therapy with RBC in combination with clarithromycin for 14 days yields eradication rates of 76%. Triple therapy bid for one week with a proton pump inhibitor, clarithromycin and either amoxicillin or a nitroimidazole (tinidazole or metronidazole is advocated as the treatment of choice for H pylori eradication. Analogous regimens with RBC in place of proton pump inhibitors show effective eradication rates in comparative studies and with pooled data. RBC, used alone or in combination with other antibiotics, appears to be a safe and effective drug for the treatment of H pylori infection. Bismuth levels do not appear to rise to toxic levels.

  4. In vitro cytotoxicity of surface modified bismuth nanoparticles.

    Science.gov (United States)

    Luo, Yang; Wang, Chaoming; Qiao, Yong; Hossain, Mainul; Ma, Liyuan; Su, Ming

    2012-10-01

    This paper describes in vitro cytotoxicity of bismuth nanoparticles revealed by three complementary assays (MTT, G6PD, and calcein AM/EthD-1). The results show that bismuth nanoparticles are more toxic than most previously reported bismuth compounds. Concentration dependent cytotoxicities have been observed for bismuth nanoparticles and surface modified bismuth nanoparticles. The bismuth nanoparticles are non-toxic at concentration of 0.5 nM. Nanoparticles at high concentration (50 nM) kill 45, 52, 41, 34 % HeLa cells for bare nanoparticles, amine terminated bismuth nanoparticles, silica coated bismuth nanoparticles, and polyethylene glycol (PEG) modified bismuth nanoparticles, respectively; which indicates cytotoxicity in terms of cell viability is in the descending order of amine terminated bismuth nanoparticles, bare bismuth nanoparticles, silica coated bismuth nanoparticles, and PEG modified bismuth nanoparticles. HeLa cells are more susceptible to toxicity from bismuth nanoparticles than MG-63 cells. The simultaneous use of three toxicity assays provides information on how nanoparticles interact with cells. Silica coated bismuth nanoparticles can damage cellular membrane yet keep mitochondria less influenced; while amine terminated bismuth nanoparticles can affect the metabolic functions of cells. The findings have important implications for caution of nanoparticle exposure and evaluating toxicity of bismuth nanoparticles.

  5. EQCM Study of Influence of Anion Nature on Electrochemical Reduction of Bismuth Sulfide in Nickel Plating Solution

    OpenAIRE

    Loreta TAMAŠAUSKAITĖ-TAMAŠIŪNAITĖ; Leonas NARUŠKEVIČIUS; Žielienė, Albina; Birutė ŠIMKŪNAITĖ-STANYNIENĖ; Genovaitė VALIULIENĖ; Aloyzas SUDAVIČIUS

    2011-01-01

    The influence of anion nature on the reduction of bismuth sulfide film deposited on gold using the successive ionic layer adsorption and reaction method in solutions containing Ni2+ ions has been investigated by electrochemical quartz crystal microbalance combined with cyclic voltammetry and X-ray photoelectron spectroscopy. It has been determined that the reduction of bismuth sulfide film in the nickel plating solution depends on the anion nature: larger cathodic current and mass changes (Dƒ...

  6. Study of barium bismuth titanate prepared by mechanochemical synthesis

    Directory of Open Access Journals (Sweden)

    Lazarević Z.Ž.

    2009-01-01

    Full Text Available Barium-bismuth titanate, BaBi4Ti4O15 (BBT, a member of Aurivillius bismuth-based layer-structure perovskites, was prepared from stoichiometric amounts of barium titanate and bismuth titanate obtained via mechanochemical synthesis. Mechanochemical synthesis was performed in air atmosphere in a planetary ball mill. The reaction mechanism of BaBi4Ti4O15 and the preparation and characteristics of BBT ceramic powders were studied using XRD, Raman spectroscopy, particle analysis and SEM. The Bi-layered perovskite structure of BaBi4Ti4O15 ceramic forms at 1100 °C for 4 h without a pre-calcination step. The microstructure of BaBi4Ti4O15 exhibits plate-like grains typical for the Bi-layered structured material and spherical and polygonal grains. The Ba2+ addition leads to changes in the microstructure development, particularly in the change of the average grain size.

  7. Resistivity and Seebeck coefficient measurements of a bismuth microwire array

    Energy Technology Data Exchange (ETDEWEB)

    Ishikawa, Y. [Graduate School of Science and Engineering, Saitama University, 338-8570 (Japan)]. E-mail: ishikawa@kan.env.gse.saitama-u.ac.jp; Hasegawa, Y. [Graduate School of Science and Engineering, Saitama University, 338-8570 (Japan); Morita, H. [Saitama Industrial Technology Center, Saitama Prefecture, 333-0844 (Japan); Kurokouchi, A. [Saitama Industrial Technology Center, Saitama Prefecture, 333-0844 (Japan); Wada, K. [Saitama Industrial Technology Center, Saitama Prefecture, 333-0844 (Japan); Komine, T. [Department of Media and Telecommunications Engineering, Ibaraki University, 316-8511 (Japan); Nakamura, H. [National Institute for Fusion Science, 322-6 Oroshi-cho, Toki, Gifu 509-5252 (Japan)

    2005-11-01

    The resistivity and Seebeck coefficient of a bismuth microwire array (wire diameter: 25 {mu}m) were successfully measured from 25 to 300 K. To eliminate the influence of the contact resistance between the wire edges of the microwire array and copper electrodes, the titanium (100 nm)/copper (500 nm) film layers were deposited as interlayer on the wire edge by ion plating method. Copper electrodes were glued by using Pb-Sn solder. The resistivity and the Seebeck coefficient at 300 K were approximately 1.8x10{sup -6} {omega}m and -54x10{sup -6} V/K, respectively. The value of the resistivity and the Seebeck coefficient were in good agreement with those of bulk polycrystalline bismuth reported previously. Thus, the effects of the contact resistance for the microwire array were almost resolved, and the chemical reaction of the Pb-Sn solder and bismuth was prevented by using the thin-film layer. The technique is expected to be applicable to nanowire arrays as well.

  8. Bismuth tri-iodide radiation detector development

    Science.gov (United States)

    Gokhale, Sasmit S.

    Bismuth tri-iodide is an attractive material for room temperature radiation detection. BiI3 demonstrates a number of properties that are apt for semiconductor radiation detection, especially gamma ray spectroscopy. The high atomic number (ZBi = 83 and ZI = 53) and the relatively high density (5.78 g/cm3) cause the material to have good photon stopping power, while the large band-gap (1.67 eV ) allows it to function as a room temperature radiation detector without any cooling mechanism. This work presents the fabrication and characterization of BiI3 radiation detectors. For the purpose of this research detectors were fabricated by cutting BiI3 crystal boules, followed by mechanical and chemical surface treatments. Detectors with various electrode geometries enabling single polarity charge sensing were fabricated. The electrical characteristics and the radiation response of the detectors were measured. The radiation response measurement was performed at room temperature using a 241Am alpha particle source and a 241Am sealed gamma-ray source. The spectral resolutions of the detectors varied from 2.09% - 6.1% for 59.5 keV gamma-rays and between 26% - 40% for 5.48 MeV alpha particles. Charge carrier properties such as the electron and hole mobility and lifetime were also estimated. The electron mobility for an ultrapure BiI 3 detector was estimated to be approximately 433 cm 2/Vs while that for antimony doped BiI3 was estimated to be around 956 cm2/Vs and the mobility-lifetime product for electrons was estimated to be around 5.44 x 10-4 cm 2/V. Detector simulation was performed using the Monte Carlo simulation code MCNP5. A Matlab script which incorporates charge carrier trapping and statistical variation was written to generate a gamma-ray spectrum from the simulated energy deposition spectra. Measured and simulated spectra were compared to extract the charge carrier mobility-lifetime products, which for electrons and holes were estimated to be 5 x 10-3 cm2/V and 1.3 x

  9. 42 CFR 93.209 - Funding component.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Funding component. 93.209 Section 93.209 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON...

  10. 31 CFR 800.209 - Critical technologies.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Critical technologies. 800.209 Section 800.209 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE...), which is set forth in the International Traffic in Arms Regulations (ITAR) (22 CFR parts 120-130);...

  11. Bismuth oxide based ceramics with improved electrical and mechanical properties: Part II. Structural and mechanical properties

    NARCIS (Netherlands)

    Kruidhof, H.; Seshan, K.; Velde, van de G.M.H.; Vries, de K.J.; Burggraaf, A.J.

    1988-01-01

    Coprecipitation as a method of preparation for bismuth oxides based ceramics yields relatively strong and machineable materials in comparison with the solid state reaction. Compositions within the system (1−x)Bi2O3|xEr2O3 containing up to twenty five mole percent of erbium oxide show a slow transiti

  12. Experimental study on the effects of bismuth subgallate on the inflammatory process and angiogenesis of the oral mucosa

    Directory of Open Access Journals (Sweden)

    Eduardo Vieira Couto

    2016-02-01

    Full Text Available ABSTRACT INTRODUCTION: Bismuth subgallate is a salt derived from heavy metal. The aim of this study was to evaluate the effect of this salt on some phases of healing. OBJECTIVES: To assess the effect of subgallate on mucosa and to evaluate the association between the use of bismuth subgallate and neogenesis of vessels in oral mucosal wounds. METHODS: This was a prospective and experimental study. This study used sixty rats, which were divided into control and experimental groups. The animals were submitted to a surgical procedure, which caused oral mucosal injury. A saline solution was applied on the wound of the control group, and in the experimental group, a solution of bismuth subgallate was administrated. RESULTS: The experimental group showed greater inflammatory reaction with increasing monomorphic proliferation. There was increased vessel proliferation in the control group. CONCLUSION: Bismuth subgallate had a negative influence on the healing process, delaying the rate of new vessel formation and optimal wound healing.

  13. The cytotoxicity of organobismuth compounds with certain molecular structures can be diminished by replacing the bismuth atom with an antimony atom in the molecules.

    Science.gov (United States)

    Kohri, Kumiko; Yoshida, Eiko; Yasuike, Shuji; Fujie, Tomoya; Yamamoto, Chika; Kaji, Toshiyuki

    2015-06-01

    Organic-inorganic hybrid molecules, which are composed of an organic structure and metal(s), are indispensable for synthetic chemical reactions; however, their toxicity has been incompletely understood. In the present study, we discovered two cytotoxic organobismuth compounds whose cytotoxicity diminished upon replacement of the intramolecular bismuth atom with an antimony atom. The intracellular accumulation of the organobismuth compounds was much higher than that of the organoantimony compounds with the corresponding organic structures. We also showed that both the organic structure and bismuth atom are required for certain organobismuth compounds to exert their cytotoxic effect, suggesting that the cytotoxicity of such a compound is a result of an interaction between the organic structure and the bismuth atom. The present data suggest that organobismuth compounds with certain molecular structures exhibit cytotoxicity via an interaction between the molecular structure and the bismuth atom, and this cytotoxicity can be diminished by replacing the bismuth atom with an antimony atom, resulting in lower intracellular accumulation.

  14. Bismuth ions are metabolized into autometallographic traceable bismuth-sulphur quantum dots

    Directory of Open Access Journals (Sweden)

    M Stoltenberg

    2009-06-01

    Full Text Available Bismuth – sulphur quantum dots can be silver enhanced by autometallography (AMG. In the present study, autometallographic silver enhanced bismuth-sulphur nanocrystals were isolated from unfixed cryo-sections of kidneys and livers of rats exposed to bismuth (Bi207 subnitrate. After being subjected to AMG all the organic material was removed by sonication and enzymatic digestion and the silver enhanced Bi- S quantum dots spun down by an ultracentrifuge and analyzed by scintillation. The analysis showed that the autometallographic technique traces approximately 94% of the total bismuth. This implies that the injected bismuth is ultimately captured in bismuthsulphur quantum dots, i.e., that Bi-S nanocrystals are the end product of bismuth metabolism

  15. PEG-400 promoted oxidation reaction of 2-hydroxyl-1,2-diaryl-ethanone to 1,2-diaryl-1,2-ethanedione by bismuth nitrate%PEG-400促进的硝酸铋氧化二芳基乙醇酮合成二芳基乙二酮

    Institute of Scientific and Technical Information of China (English)

    刘逸; 曾鸿耀; 仲煜洁; 王嘉骝; 彭广明

    2015-01-01

    Polyethylene glycol 400(PEG 400)had been demonstrated as an efficient and eco-friendly reaction medium for the oxida-tion of 2-hydroxyl-1,2-diaryl-ethanone to 1,2-diaryl-1,2-ethanedione catalyzed by bismuth nitrate. The structure of the 1,2-diaryl-1,2-ethanedione was characterized by IR and 1 H NMR spectroscoroy. The method had advantages of short reaction time,high yield, simple work-up,and environmental friendliness.%PEG-400作为绿色反应溶剂能有效地促进硝酸铋氧化二芳基乙醇酮为二芳基乙二酮。产物结构用IR和1 H NMR光谱进行了表征。该方法具有反应时间短,产率较高,操作简便,环境友好等优点。

  16. Electrochemical study on determination of diffusivity, activity and solubility of oxygen in liquid bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Ganesan, Rajesh [Liquid Metals and Structural Chemistry Division, Chemistry Group, Indira Gandhi Centre for Atomic Research, Kalpakkam 603 102 (India); Gnanasekaran, T. [Liquid Metals and Structural Chemistry Division, Chemistry Group, Indira Gandhi Centre for Atomic Research, Kalpakkam 603 102 (India)]. E-mail: gnani@igcar.ernet.in; Srinivasa, Raman S. [Department of Metallurgical Engineering and Materials Science, Indian Institute of Technology Bombay, Mumbai 400 076 (India)

    2006-06-15

    Diffusivity of oxygen in liquid bismuth was measured by potentiostatic method and is given bylg(D{sub O}{sup Bi}/cm{sup 2}.s{sup -1})(+/-0.042)=-3.706-1377/(TK{sup -1})(804bismuth was determined by coulometric titrations and using the measured data standard free energy of dissolution of oxygen in liquid bismuth was derived for the reaction:1/2O{sub 2}(g)=[O]{sub Bi}(at.%)and is given by{delta}G{sub O(Bi)}{sup o}/(J.g-atomO{sup -1})(+/-720)=-108784+20.356TK{sup -1}(753bismuth was derived as a function of temperature and is given by the following expressions:lg(S/at%O)(+/-0.05)=-4476/TK{sup -1}+4.05(753bismuth is compared with the literature data.

  17. Synthesis and performance of bismuth trioxide nanoparticles for high energy gas generator use.

    Science.gov (United States)

    Martirosyan, K S; Wang, L; Vicent, A; Luss, D

    2009-10-01

    Our experiments showed that the combustion of an Al-Bi2O3 nanoparticle mixture generated the highest pressure pulse among common nanothermite reactions and can potentially be used as a nanoenergetic gas generator. The combustion front propagation velocity and rate of energy release increased by up to three orders of magnitude when the particle size was reduced to a nanosize range for both the aluminum and the oxidizer. We developed a novel one-step (metal nitrate-glycine) combustion synthesis of nanostructured amorphous-like and highly crystalline bismuth trioxide nanoparticles. The combustion synthesis was conducted using a solution of molten bismuth nitrate as an oxidizer and glycine as a fuel. The glycine was completely combusted during the thermal decomposition of the bismuth nitrate pentahydrate and generated a temperature front that propagated through the sample. Increasing the fuel concentration increased the maximum combustion temperature from 280 to 1200 degrees C and the Bi2O3 particle size from 20 to 100 nm. The oxidizer/fuel ratio had a strong impact on the bismuth trioxide particle crystallinity. At low temperature (280 degrees C), amorphous-like bismuth trioxide nanoparticles formed, while at T > or =370 degrees C the structures were crystalline. A peak pressure of approximately 12 MPa and a thermal front propagating velocity of approximately 2500 m s(-1) were achieved during the combustion of an Al-Bi2O3 mixture containing 80 wt% of the synthesized Bi2O3 crystalline nanoparticles (size: 40-50 nm).

  18. Preparation of Strontium Bismuth Tantalum (SBT) Fine Powder by Sol-Gel Process Using Bismuth Subnitrate as Bismuth Source

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Strontium bismuth tantalum (SBT) fine power was prepared by Sol-Gel method. Pentaethoxy tantalum, strontium acetate and bismuth subnitrate were used as raw materials, and were dissolved in proper order in ethylene glycol to form transparent sol. The mixed precursor was dried at 80°C and annealed at 800°C for 1 h. Crystallized nanometer sized SBT fine powder was obtained and characterized by XRD.

  19. Oxidative Dehydrogenation of n-Butenes to 1,3-Butadiene over Bismuth Molybdate and Ferrite Catalysts: A Review

    KAUST Repository

    Hong, Eunpyo

    2015-11-02

    1,3-Butadiene, an important raw material for a variety of chemical products, can be produced via the oxidative dehydrogenation (ODH) of n-butenes over multicomponent oxide catalysts based on bismuth molybdates and ferrites. In this review, the basic concept, reaction mechanism, and catalysts typically used in an ODH reaction are discussed. © 2015, Springer Science+Business Media New York.

  20. Electrochemical properties of porous bismuth electrodes

    Energy Technology Data Exchange (ETDEWEB)

    Romann, T., E-mail: tavo.romann@ut.e [Institute of Chemistry, University of Tartu, Ravila 14A, 50411 Tartu (Estonia); Lust, E. [Institute of Chemistry, University of Tartu, Ravila 14A, 50411 Tartu (Estonia)

    2010-08-01

    The properties of Bi surfaces with different roughnesses were characterized by electron microscopy, cyclic voltammetry, and impedance spectroscopy. Two different strategies were used for preparation of porous bismuth layers onto Bi microelectrode surface in aqueous 0.1 M LiClO{sub 4} solution. Firstly, treatment at potential E < -2 V (vs. Ag|AgCl in sat. KCl) has been applied, resulting in bismuth hydride formation and decomposition into Bi nanoparticles which deposit at the electrode surface. Secondly, porous Bi layer was prepared by anodic dissolution (E = 1 V) of bismuth electrode followed by fast electroreduction of formed Bi{sup 3+} ions at cathodic potentials E = -2 V. The nanostructured porous bismuth electrode, with surface roughness factor up to 220, has negligible frequency dispersion of capacitance and higher hydrogen evolution overvoltage than observed for smooth Bi electrodes.

  1. Thermoelectric properties of pressed bismuth nanoparticles

    Science.gov (United States)

    Hostler, Stephen R.; Qu, Yu Qiao; Demko, Michael T.; Abramson, Alexis R.; Qiu, Xiaofeng; Burda, Clemens

    2008-03-01

    Theory predicts a substantial increase in the dimensionless figure of merit as the dimensionality and characteristic size of a material are decreased. We explore the use of bismuth nanoparticles pressed into pellets as potential increased efficiency thermoelectric materials. The figure of merit of these pellets is determined by independently measuring the electrical conductivity, thermal conductivity and Seebeck coefficient. The results from the nanoparticle sample are compared to microparticle-based samples. Both sample types show a slight reduction in thermal conductivity relative to bulk bismuth and a Seebeck coefficient near or slightly larger in magnitude than bulk bismuth. These changes are dwarfed by a hundred-fold decrease in the electrical conductivity due to porosity and an oxide layer on the particles. The low conductivity leads to figures of merit at least two orders of magnitude smaller than bulk bismuth. Oxide layer removal and reduced pellet porosity will be required to increase the figure of merit.

  2. A kinetic study of jack-bean urease denaturation by a new dithiocarbamate bismuth compound

    Science.gov (United States)

    Menezes, D. C.; Borges, E.; Torres, M. F.; Braga, J. P.

    2012-10-01

    A kinetic study concerning enzymatic inhibitory effect of a new bismuth dithiocarbamate complex on jack-bean urease is reported. A neural network approach is used to solve the ill-posed inverse problem arising from numerical treatment of the subject. A reaction mechanism for the urease denaturation process is proposed and the rate constants, relaxation time constants, equilibrium constants, activation Gibbs free energies for each reaction step and Gibbs free energies for the transition species are determined.

  3. Effect of phase stability degradation of bismuth on sensor characteristics of nano-bismuth fixed electrode.

    Science.gov (United States)

    Lee, Gyoung-Ja; Kim, Chang Kyu; Lee, Min Ku; Rhee, Chang Kyu

    2010-12-15

    Effect of phase stability degradation of bismuth on sensor characteristics of nano-bismuth fixed electrode has been investigated using square-wave anodic stripping voltammetry technique, scanning electron microscopy (SEM) and X-ray diffraction (XRD) spectroscopy. From the analyses of square-wave anodic stripping voltammograms (SWASV) repetitively measured on the nano-bismuth fixed electrode, it was found that the oxidation peak currents dropped by 81%, 68% and 59% for zinc, cadmium and lead, respectively, after the 100th measurement (about 400 min of operation time). The sphere bismuth nanoparticles gradually changed to the agglomerates with petal shape as the operation time increased. From the analyses of SEM images and XRD patterns, it is confirmed that the oxidation of Bi into BiOCl/Bi(2)O(2)CO(3) and the agglomeration of bismuth nanoparticles caused by the phase change decrease a reproducibility of the stripping voltammetric response. Moreover, most of the bismuth becomes BiOCl at pH 3.0 and bismuth hydroxide, Bi(OH)(3) at pH 7.0, which results in a significant decrease in sensitivity of the nano-bismuth fixed electrode.

  4. Gravimetric Analysis of Bismuth in Bismuth Subsalicylate Tablets: A Versatile Quantitative Experiment for Undergraduate Laboratories

    Science.gov (United States)

    Davis, Eric; Cheung, Ken; Pauls, Steve; Dick, Jonathan; Roth, Elijah; Zalewski, Nicole; Veldhuizen, Christopher; Coeler, Joel

    2015-01-01

    In this laboratory experiment, lower- and upper-division students dissolved bismuth subsalicylate tablets in acid and precipitated the resultant Bi[superscript 3+] in solution with sodium phosphate for a gravimetric determination of bismuth subsalicylate in the tablets. With a labeled concentration of 262 mg/tablet, the combined data from three…

  5. Thermal degradation of ultrabroad bismuth NIR luminescence in bismuth-doped tantalum germanate laser glasses.

    Science.gov (United States)

    Wang, Liping; Zhao, Yanqi; Xu, Shanhui; Peng, Mingying

    2016-04-01

    Because of ultra-broadband luminescence in 1000-1700 nm and consequent applications in fiber amplifier and lasers in the new spectral range where traditional rare earth cannot work, bismuth-doped laser glasses have received rising interest recently. For long-term practical application, thermal degradation must be considered for the glasses. This, however, has seldom been investigated. Here we report the thermal degradation of bismuth-doped germanate glass. Heating and cooling cycle experiments at high temperature reveal strong dependence of the thermal degradation on glass compositions. Bismuth and tantalum lead to the reversible degradation, while lithium can produce permanent irreversible degradation. The degradation becomes worse as lithium content increases in the glass. Absorption spectra show this is due to partial oxidation of bismuth near-infrared emission center. Surprisingly, we notice the emission of bismuth exhibits blueshift, rather than redshift at a higher temperature, and the blueshift can be suppressed by increasing the lithium content.

  6. Comparative study on solubilities of bismuth, bismuth oxide,and bismuth sulfide in hydrochloric acid-thiourea%铋、氧化铋、硫化铋在盐酸-硫脲中溶解性的比较研究

    Institute of Scientific and Technical Information of China (English)

    马哈亚·艾斯江; 巴哈尔古丽·别克吐尔逊

    2012-01-01

    在盐酸介质中及55℃加热条件下,铋与硫脲形成黄色络合物,从而建立了用分光光度法比较铋、氧化铋、硫化铋在盐酸-硫脲中溶解性的新方法.研究了反应介质、试剂浓度、加热时间、加热温度、震荡速率等因素的影响.在最佳实验条件下,溶液的质量浓度为0.04~0.24 mg/mL时符合比尔定律.相关系数R=0.999 9,检出限为1.05×10-2 μg/mL,标准偏差SD=0.003 5,相对标准偏差RSD=2.42%,摩尔吸收系数为1.515×105 L/(mol·cm),加标回收率为96.7%~98.8%.实验结果表明,铋、氧化铋、硫化铋的溶解性顺序大小为:铋>氧化铋>硫化铋.%A yellow complex is formed from bismuth and thiourea in hydrochloric acid under the heated condition of 55 °C. Thus a new method is set up to compare the solubilities of bismuth, bismuth oxide, and bismuth sulfide in hydrochloric acid-thiourea by using spectrophotometry.Effects of factors, such as reaction medium, reagent concentration, heating time, heating temperature, and oscillation speed,were studied respectively .Under the optimum experimental conditions, mass concentration of the solution is in line with Beer's law, when it is within the range of 0.04-0.24 mg/mL.The correlation coefficient (R) is 0.999 9.The detection limit is 1.05xl0-2μg/mL.The standard deviation is 0.003 5.The relative standard deviation (RSD) is 2.42%.The molar absorption coefficient is 1.515xl05 L/(mol-cm).The recovery rate of standard addition is at 96.7%~98.8%. Experimental result showed that the solubilities of bismuth,bismuth oxide,and bismuth sulfide in hydrochloric acid-thiourea is in order by size as following: Bi>Bi2O3>Bi2S3.

  7. Correlations between polarisation states of W particles in the reaction e {sup -}e{sup +}{yields}W{sup -}W{sup +} at LEP2 energies 189-209 GeV

    Energy Technology Data Exchange (ETDEWEB)

    Abdallah, J.; Antilogus, P.; Augustin, J.E.; Baubillier, M.; Berggren, M.; Silva, W. da; Kapusta, F.; Savoy-Navarro, A. [Univ. Paris VI et VII, LPNHE, IN2P3-CNRS, Paris Cedex 05 (France); Abreu, P.; Andringa, S.; Anjos, N.; Castro, N.; Espirito Santo, M.C.; Goncalves, P.; Moreno, S.; Onofre, A.; Peralta, L.; Pimenta, M.; Tome, B.; Veloso, F. [FCUL, LIP, IST, Lisboa Codex (Portugal); Adam, W.; Buschbeck, B.; Leder, G.; Liko, D.; MacNaughton, J.; Mandl, F.; Mitaroff, W.; Strauss, J. [Oesterr. Akad. d. Wissensch., Institut fuer Hochenergiephysik, Vienna (Austria); Adzic, P.; Fanourakis, G.; Kokkinias, P.; Loukas, D.; Markou, A.; Mastroyiannopoulos, N.; Nassiakou, M.; Tzamarias, S.; Zupan, M. [Institute of Nuclear Physics, N.C.S.R. Demokritos, P.O. Box 60228, Athens (Greece); Albrecht, T.; Allmendinger, T.; Apel, W.D.; Boer, W. de; Feindt, M.; Haag, C.; Hauler, F.; Hennecke, M.; Jungermann, L.; Kerzel, U.; Moch, M.; Rehn, J.; Sander, C.; Stanitzki, M.; Weiser, C. [Universitaet Karlsruhe, Institut fuer Experimentelle Kernphysik, Postfach 6980, Karlsruhe (Germany); Alemany-Fernandez, R.; Ask, S.; Augustinus, A.; Baillon, P.; Battaglia, M.; Camporesi, T.; Carena, F.; Charpentier, P.; Chierici, R.; Chudoba, J.; Chung, S.U.; Collins, P.; Elsing, M.; Foeth, H.; Gavillet, P.; Holt, P.J.; Joram, C.; Kjaer, N.J.; Marin, J.C.; Mariotti, C.; Pape, L.; Parzefall, U.; Piotto, E.; Poireau, V.; Rebecchi, P.; Schwickerath, U.; Spassov, T.; Treille, D.; Van Eldik, J.; Van Vulpen, I.; Wicke, D. [CERN, Geneva 23 (Switzerland); Allport, P.P.; Booth, P.S.L.; Bowcock, T.J.V.; Houlden, M.A.; Jackson, J.N.; King, B.T.; Nulty, R.Mc; Palacios, J.P.; Tobin, M.; Washbrook, A.J. [University of Liverpool, Department of Physics, P.O. Box 147, Liverpool (United Kingdom); Amaldi, U.; Bonesini, M.; Calvi, M.; Matteuzzi, C.; Paganoni, M.; Pullia, A.; Tabarelli, T.; Tonazzo, A. [Univ. di Milano-Bicocca (Italy); INFN-MILANO, Dipartimento di Fisica, Milan (Italy)] [and others

    2009-10-15

    In a study of the reaction e {sup -}e{sup +}{yields}W{sup -}W{sup +} with the DELPHI detector, the probabilities of the two W particles occurring in the joint polarisation states transverse-transverse (TT), longitudinal-transverse plus transverse-longitudinal (LT) and longitudinal-longitudinal (LL) have been determined using the final states WW{yields}l{nu}q anti q(l=e,{mu}). The two-particle joint polarisation probabilities, i.e. the spin density matrix elements {rho}{sub TT}, {rho}{sub LT}, {rho}{sub LL}, are measured as functions of the W{sup -} production angle, {theta}{sub W{sup -}}at an average reaction energy of 198.2 GeV. Averaged over all cos {theta}{sub W}{sup -}, the following joint probabilities are obtained: anti {rho}{sub TT}=(67{+-}8)%, anti {rho}{sub LT}=(30{+-}8)%, anti {rho}{sub LL}=(3{+-}7)%. These results are in agreement with the Standard Model predictions of 63.0%, 28.9% and 8.1%, respectively. The related polarisation cross-sections {sigma}{sub TT}, {sigma}{sub LT} and {sigma}{sub LL} are also presented. (orig.)

  8. Graphite felt modified with bismuth nanoparticles as negative electrode in a vanadium redox flow battery.

    Science.gov (United States)

    Suárez, David J; González, Zoraida; Blanco, Clara; Granda, Marcos; Menéndez, Rosa; Santamaría, Ricardo

    2014-03-01

    A graphite felt decorated with bismuth nanoparticles was studied as negative electrode in a vanadium redox flow battery (VRFB). The results confirm the excellent electrochemical performance of the bismuth modified electrode in terms of the reversibility of the V(3+) /V(2+) redox reactions and its long-term cycling performance. Moreover a mechanism that explains the role that Bi nanoparticles play in the redox reactions in this negative half-cell is proposed. Bi nanoparticles favor the formation of BiHx , an intermediate that reduces V(3+) to V(2+) and, therefore, inhibits the competitive irreversible reaction of hydrogen formation (responsible for the commonly observed loss of Coulombic efficiency of VRFBs). Thus, the total charge consumed during the cathodic sweep in this electrode is used to reduce V(3+) to V(2+) , resulting in a highly reversible and efficient process.

  9. Liquid Bismuth Propellant Flow Sensor

    Science.gov (United States)

    Polzin, Kurt A.; Stanojev, B. J.; Korman, V.

    2007-01-01

    Quantifying the propellant mass flow rate in liquid bismuth-fed electric propulsion systems has two challenging facets. First, the flow sensors must be capable of providing a resolvable measurement at propellant mass flow rates on the order of 10 mg/see with and uncertainty of less that 5%. The second challenge has to do with the fact that the materials from which the flow sensors are fabricated must be capable of resisting any of the corrosive effects associated with the high-temperature propellant. The measurement itself is necessary in order to properly assess the performance (thrust efficiency, Isp) of thruster systems in the laboratory environment. The hotspot sensor[I] has been designed to provide the bismuth propellant mass flow rate measurement. In the hotspot sensor, a pulse of thermal energy (derived from a current pulse and associated joule heating) is applied near the inlet of the sensor. The flow is "tagged" with a thermal feature that is convected downstream by the flowing liquid metal. Downstream, a temperature measurement is performed to detect a "ripple" in the local temperature associated with the passing "hotspot" in the propellant. By measuring the time between the upstream generation and downstream detection of the thermal feature, the flow speed can be calculated using a "time of flight" analysis. In addition, the system can be calibrated by measuring the accumulated mass exiting the system as a-function of time and correlating this with the time it takes the hotspot to convect through the sensor. The primary advantage of this technique is that it doesn't depend on an absolute measurement of temperature but, instead, relies on the observation of thermal features. This makes the technique insensitive to other externally generated thermal fluctuations. In this paper, we describe experiments performed using the hotspot flow sensor aimed at quantifying the resolution of the sensor technology. Propellant is expelled onto an electronic scale to

  10. Synthesis and characterization of bismuth alkaline titanate powders

    Energy Technology Data Exchange (ETDEWEB)

    Torres-Huerta, A.M., E-mail: atorresh@ipn.mx [CICATA-Altamira, Instituto Politecnico Nacional, Km. 14.5 Carretera Tampico Puerto Industrial Altamira, Altamira, Tamps. 89600 (Mexico); Dominguez-Crespo, M.A. [CICATA-Altamira, Instituto Politecnico Nacional, Km. 14.5 Carretera Tampico Puerto Industrial Altamira, Altamira, Tamps. 89600 (Mexico); Hernandez-Perez, M.A. [ESIQIE, Metalurgia, Instituto Politecnico Nacional, Mexico, D. F (Mexico); Garcia-Zaleta, D.S. [CICATA-Altamira, Instituto Politecnico Nacional, Km. 14.5 Carretera Tampico Puerto Industrial Altamira, Altamira, Tamps. 89600 (Mexico); Brachetti-Sibaja, S.B. [CICATA-Altamira, Instituto Politecnico Nacional, Km. 14.5 Carretera Tampico Puerto Industrial Altamira, Altamira, Tamps. 89600 (Mexico); Instituto Tecnologico de Ciudad Madero, Av. 1o. de Mayo esq. Sor Juana Ines de la Cruz s/n Col. Los Mangos C.P.89440 Cd. Madero Tamaulipas (Mexico)

    2011-06-15

    In this work, samples of bismuth alkaline titanate, (K{sub 0.5}Na{sub 0.5}){sub (2-x/2)}Bi{sub (x/6)}TiO{sub 3}, (x = 0.05-0.75) have been prepared by conventional ceramic technique and molten salts. Metal oxides or carbonates powders were used as starting raw materials. The crystalline phase of the synthesized powders was identified by the X-ray diffraction (XRD) and particle morphology was characterized by scanning electron microscopy (SEM). Solid state reaction method was unsuccessful to obtain pellets. From XRD results, a rhombohedral structure was detected and the parameter lattice were estimated to be a = 5.5478 A and {alpha} = 59.48{sup o}. These parameters were used to refine the structure by Rietveld analysis. SEM results showed several morphologies. Apparently, bismuth is promoting the grain growth whose sizes vary from 30 nm to 180 nm It is expected that these materials can be utilized in practical applications as substitutes for lead zirconatetitanate (PZT)-based ceramics.

  11. Photobleaching effect in bismuth-doped germanosilicate fibers.

    Science.gov (United States)

    Firstov, Sergei; Alyshev, Sergey; Khopin, Vladimir; Melkumov, Mikhail; Guryanov, Alexey; Dianov, Evgeny

    2015-07-27

    Photoinduced reduction of absorption (photobleaching) in bismuth-doped germanosilicate fibers irradiated with 532-nm laser has been observed for the first time. It was demonstrated that bismuth-related active centers having the absorption bands at wavelengths of 1400 and 1700 nm degrade under photoexcitation at 532 nm. The photobleaching process rate was estimated using conventional stretched exponential technique. It was found that the photobleaching rate in bismuth-doped germanosilicate fibers does not depend on type of bismuth-related active center. The possible underlying mechanism of photobleaching process in bismuth-doped fibers is discussed.

  12. Hyperfine splitting in lithium-like bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Lochmann, Matthias; Froemmgen, Nadja; Hammen, Michael; Will, Elisa [Universitaet Mainz (Germany); Andelkovic, Zoran; Kuehl, Thomas; Litvinov, Yuri; Winters, Danyal; Sanchez, Rodolfo [GSI Helmholtzzentrum, Darmstadt (Germany); Botermann, Benjamin; Noertershaeuser, Wilfried [Technische Universitaet Darmstadt (Germany); Bussmann, Michael [Helmholtzzentrum Dresden-Rossendorf (Germany); Dax, Andreas [CERN, Genf (Switzerland); Hannen, Volker; Joehren, Raphael; Vollbrecht, Jonas; Weinheimer, Christian [Universitaet Muenster (Germany); Geppert, Christopher [Universitaet Mainz (Germany); GSI Helmholtzzentrum, Darmstadt (Germany); Stoehlker, Thomas [GSI Helmholtzzentrum, Darmstadt (Germany); Universitaet Heidelberg (Germany); Thompson, Richard [Imperial College, London (United Kingdom); Volotka, Andrey [Technische Universitaet Dresden (Germany); Wen, Weiqiang [IMP Lanzhou (China)

    2013-07-01

    High-precision measurements of the hyperfine splitting values on Li- and H-like bismuth ions, combined with precise atomic structure calculations allow us to test QED-effects in the regime of the strongest magnetic fields that are available in the laboratory. Performing laser spectroscopy at the experimental storage ring (ESR) at GSI Darmstadt, we have now succeeded in measuring the hyperfine splitting in Li-like bismuth. Probing this transition has not been easy because of its extremely low fluorescence rate. Details about this challenging experiment will be given and the achieved experimental accuracy are presented.

  13. Burnout current density of bismuth nanowires

    Science.gov (United States)

    Cornelius, T. W.; Picht, O.; Müller, S.; Neumann, R.; Völklein, F.; Karim, S.; Duan, J. L.

    2008-05-01

    Single bismuth nanowires with diameters ranging from 100nmto1μm were electrochemically deposited in ion track-etched single-pore polycarbonate membranes. The maximum current density the wires are able to carry was investigated by ramping up the current until failure occurred. It increases by three to four orders of magnitude for nanowires embedded in the template compared to bulk bismuth and rises with diminishing diameter. Simulations show that the wires are heated up electrically to the melting temperature. Since the surface-to-volume ratio rises with diminishing diameter, thinner wires dissipate the heat more efficiently to the surrounding polymer matrix and, thus, can tolerate larger current densities.

  14. Solar Water Splitting and Nitrogen Fixation with Layered Bismuth Oxyhalides.

    Science.gov (United States)

    Li, Jie; Li, Hao; Zhan, Guangming; Zhang, Lizhi

    2017-01-17

    Hydrogen and ammonia are the chemical molecules that are vital to Earth's energy, environmental, and biological processes. Hydrogen with renewable, carbon-free, and high combustion-enthalpy hallmarks lays the foundation of next-generation energy source, while ammonia furnishes the building blocks of fertilizers and proteins to sustain the lives of plants and organisms. Such merits fascinate worldwide scientists in developing viable strategies to produce hydrogen and ammonia. Currently, at the forefronts of hydrogen and ammonia syntheses are solar water splitting and nitrogen fixation, because they go beyond the high temperature and pressure requirements of methane stream reforming and Haber-Bosch reaction, respectively, as the commercialized hydrogen and ammonia production routes, and inherit the natural photosynthesis virtues that are green and sustainable and operate at room temperature and atmospheric pressure. The key to propelling such photochemical reactions lies in searching photocatalysts that enable water splitting into hydrogen and nitrogen fixation to make ammonia efficiently. Although the past 40 years have witnessed significant breakthroughs using the most widely studied TiO2, SrTiO3, (Ga1-xZnx)(N1-xOx), CdS, and g-C3N4 for solar chemical synthesis, two crucial yet still unsolved issues challenge their further progress toward robust solar water splitting and nitrogen fixation, including the inefficient steering of electron transportation from the bulk to the surface and the difficulty of activating the N≡N triple bond of N2. This Account details our endeavors that leverage layered bismuth oxyhalides as photocatalysts for efficient solar water splitting and nitrogen fixation, with a focus on addressing the above two problems. We first demonstrate that the layered structures of bismuth oxyhalides can stimulate an internal electric field (IEF) that is capable of efficiently separating electrons and holes after their formation and of precisely channeling

  15. Probing bismuth ferrite nanoparticles by hard x-ray photoemission: Anomalous occurrence of metallic bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Chaturvedi, Smita; Rajendra, Ranguwar; Ballav, Nirmalya; Kulkarni, Sulabha, E-mail: s.kulkarni@iiserpune.ac.in [Indian Institute of Science Education and Research, Dr. Homi Bhabha Road, Pune 411008 (India); Sarkar, Indranil [DESY Photon Science, Deutsches Elektronen-Synchrotron, 22607 Hamburg (Germany); Shirolkar, Mandar M. [Hefei National Laboratory for Physical Sciences at the Microscale, University of Science and Technology of China, Hefei, Anhui 230026 (China); Jeng, U-Ser; Yeh, Yi-Qi [National Synchrotron Radiation Research Center, 101, Hsin-Ann Road, Science Park, Hsinchu 3007-6, Taiwan (China)

    2014-09-08

    We have investigated bismuth ferrite nanoparticles (∼75 nm and ∼155 nm) synthesized by a chemical method, using soft X-ray (1253.6 eV) and hard X-ray (3500, 5500, and 7500 eV) photoelectron spectroscopy. This provided an evidence for the variation of chemical state of bismuth in crystalline, phase pure nanoparticles. X-ray photoelectron spectroscopy analysis using Mg Kα (1253.6 eV) source showed that iron and bismuth were present in both Fe{sup 3+} and Bi{sup 3+} valence states as expected for bismuth ferrite. However, hard X-ray photoelectron spectroscopy analysis of the bismuth ferrite nanoparticles using variable photon energies unexpectedly showed the presence of Bi{sup 0} valence state below the surface region, indicating that bismuth ferrite nanoparticles are chemically inhomogeneous in the radial direction. Consistently, small-angle X-ray scattering reveals a core-shell structure for these radial inhomogeneous nanoparticles.

  16. 5 CFR 430.209 - Agency responsibilities.

    Science.gov (United States)

    2010-01-01

    ... MANAGEMENT Performance Appraisal for General Schedule, Prevailing Rate, and Certain Other Employees § 430.209... supervisors and employees (e.g., through formal training) about relevant parts of its performance appraisal system(s) and program(s); (d) Evaluate the performance appraisal system(s) and performance...

  17. 47 CFR 13.209 - Examination procedures.

    Science.gov (United States)

    2010-10-01

    ... Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL COMMERCIAL RADIO OPERATORS Examination System § 13.209 Examination procedures. (a) Each examination for a commercial radio operator license must be administered at a... eligible to apply for any commercial radio operator license shall, by reason of any physical handicap,...

  18. 40 CFR 61.209 - Required records.

    Science.gov (United States)

    2010-07-01

    ... Phosphogypsum Stacks § 61.209 Required records. (a) Each owner or operator of a phosphogypsum stack must.... (b) Each owner or operator of a phosphogypsum stack must maintain records documenting the procedure... facility which uses phosphogypsum pursuant to § 61.205 or § 61.206 shall prepare records which include...

  19. CD209 genetic polymorphism and tuberculosis disease.

    Directory of Open Access Journals (Sweden)

    Fredrik O Vannberg

    Full Text Available BACKGROUND: Tuberculosis causes significant morbidity and mortality worldwide, especially in sub-Saharan Africa. DC-SIGN, encoded by CD209, is a receptor capable of binding and internalizing Mycobacterium tuberculosis. Previous studies have reported that the CD209 promoter single nucleotide polymorphism (SNP-336A/G exerts an effect on CD209 expression and is associated with human susceptibility to dengue, HIV-1 and tuberculosis in humans. The present study investigates the role of the CD209 -336A/G variant in susceptibility to tuberculosis in a large sample of individuals from sub-Saharan Africa. METHODS AND FINDINGS: A total of 2,176 individuals enrolled in tuberculosis case-control studies from four sub-Saharan Africa countries were genotyped for the CD209 -336A/G SNP (rs4804803. Significant overall protection against pulmonary tuberculosis was observed with the -336G allele when the study groups were combined (n = 914 controls vs. 1262 cases, Mantel-Haenszel 2 x 2 chi(2 = 7.47, P = 0.006, odds ratio = 0.86, 95%CI 0.77-0.96. In addition, the patients with -336GG were associated with a decreased risk of cavitory tuberculosis, a severe form of tuberculosis disease (n = 557, Pearson's 2x2 chi(2 = 17.34, P = 0.00003, odds ratio = 0.42, 95%CI 0.27-0.65. This direction of association is opposite to a previously observed result in a smaller study of susceptibility to tuberculosis in a South African Coloured population, but entirely in keeping with the previously observed protective effect of the -336G allele. CONCLUSION: This study finds that the CD209 -336G variant allele is associated with significant protection against tuberculosis in individuals from sub-Saharan Africa and, furthermore, cases with -336GG were significantly less likely to develop tuberculosis-induced lung cavitation. Previous in vitro work demonstrated that the promoter variant -336G allele causes down-regulation of CD209 mRNA expression. Our present work suggests that decreased

  20. Bismuth phosphates as intermediate temperature proton conductors

    DEFF Research Database (Denmark)

    Huang, Yunjie; Christensen, Erik; Shuai, Qin

    2016-01-01

    Proton conducting electrolyte materials operational in the intermediate temperature range of 200-400 °C are of special interest for applications in fuel cells and water electrolysers. Bismuth phosphates in forms of polycrystalline powders and amorphous glasses are synthesized and investigated...

  1. Development and Investigation of Bismuth Nanowires

    Science.gov (United States)

    2008-06-05

    To: technicalreports@afosr.af.mil Subject: Final Statement to Dr. Donald Silversmith Contract/Grant Title: Development and Investigation of...Report Development and Investigation of Bismuth Nanowires – Start up phase FA9550-07-1-0472 To Dr. Donald Silversmith AFOSR PI: Jimmy Xu

  2. Effect of Lipophilic Bismuth Nanoparticles on Erythrocytes

    Directory of Open Access Journals (Sweden)

    Rene Hernandez-Delgadillo

    2015-01-01

    Full Text Available Lipophilic bismuth dimercaptopropanol nanoparticles (BisBAL NPs have a very important antimicrobial activity; however their effect on human cells or tissues has not been completely studied. Undesirable effects of bismuth include anemia which could result from suicidal erythrocyte death or eryptosis. The objective of this research was to determine the effect of bismuth dimercaptopropanol nanoparticles on blood cells. The nanoparticles are composed of 53 nm crystallites on average and have a spherical structure, agglomerating into clusters of small nanoparticles. Based on cell viability assays and optical microscopy, cytotoxicity on erythrocytes was observed after growing with 500 and 1000 µM of BisBAL NPs for 24 h. AM Calcein was retained inside erythrocytes when they were exposed to 100 µM (or lower concentrations of BisBAL NPs for 24 h, suggesting the absence of damage in plasmatic membrane. Genotoxic assays revealed no damage to genomic DNA of blood cells after 24 h of exposition to BisBAL NPs. Finally, 100–1000 µM of bismuth nanoparticles promotes apoptosis between blood cells after 24 h of incubation. Hence BisBAL NPs at concentrations lower than 100 µM do not cause damage on blood cells; they could potentially be used by humans without affecting erythrocytes and leukocytes.

  3. Hydrothermal synthesis and crystal structure of a new lithium copper bismuth oxide, LiCuBiO4

    Science.gov (United States)

    Kumada, Nobuhiro; Nakamura, Ayumi; Miura, Akira; Takei, Takahiro; Azuma, Masaki; Yamamoto, Hajime; Magome, Eisuke; Moriyoshi, Chikako; Kuroiwa, Yoshihiro

    2017-01-01

    A new lithium copper bismuth oxide, LiCuBiO4 was prepared by hydrothermal reaction using NaBiO30.1*4H2O. The crystal structural model of this compound was refined by using synchrotron X-ray powder diffraction data. This bismuthate has the LiCuSbO4 related structure with the orthorhombic cell (Space group: Pnma) of a=10.9096(9), b=5.8113(5) and c=5.0073(4) Å, and the final R-factors were Rwp=4.84 and Rp=3.58%. This compound is the first example of a lithium copper bismuthate containing Bi5+. An antiferromagnetic ordering of Cu2+ moment was observed at 6 K.

  4. Compatibility of structural materials with liquid bismuth, lead, and mercury

    Energy Technology Data Exchange (ETDEWEB)

    Weeks, J.R. [Brookhaven National Lab., Upton, NY (United States)

    1996-06-01

    During the 1950s and 1960s, a substantial program existed at Brookhaven National Laboratory as part of the Liquid Metal Fuel reactor program on the compatibility of bismuth, lead, and their alloys with structural materials. Subsequently, compatibility investigations of mercury with structural materials were performed in support of development of Rankine cycle mercury turbines for nuclear applications. The present talk will review present understanding of the corrosion/mass-transfer reactions of structural materials with these liquid metal coolants. Topics to be discussed include the basic solubility relationships of iron, chromium, nickel, and refractory metals in these liquid metals, the results of inhibition studies, the role of oxygen on the corrosion processes, and specialized topics such as cavitation-corrosion and liquid metal embrittlement. Emphasis will be placed on utilizing the understanding gained in this earlier work on the development of heavy liquid metal targets in spallation neutron sources.

  5. Laser spectroscopy of the ground state hyperfine splittings of $^{209}$Bi$^{82+}$ and $^{209}$Bi$^{80+}$

    CERN Document Server

    Lochmann, Matthias; Geppert, Christopher; Andelkovic, Zoran; Anielski, Denis; Botermann, Benjamin; Bussmann, Michael; Dax, Andreas; Frömmgen, Nadja; Hammen, Michael; Hannen, Volker; Kühl, Thomas; Litvinov, Yuri A; López-Coto, Rubén; Stöhlker, Thomas; Thompson, Richard C; Vollbrecht, Jonas; Volotka, Andrey; Weinheimer, Christian; Wen, Weiqiang; Will, Elisa; Winters, Danyal; Sánchez, Rodolfo; Nörtershäuser, Wilfried

    2014-01-01

    We performed a laser spectroscopic determination of the $2s$ hyperfine structure (HFS) splitting of lithiumlike $^{209}\\text{Bi}^{80+}$ for the first time and repeated the measurement of the $1s$ HFS splitting of hydrogenlike $^{209}\\text{Bi}^{82+}$. Both ion species were subsequently stored in the Experimental Storage Ring at GSI and cooled with an electron cooler at a velocity of $\\approx 0.71\\,c$. Pulsed laser excitation of the M1 HFS-transition was performed in anticollinear and collinear geometry for $^{209}\\text{Bi}^{82+}$ and $^{209}\\text{Bi}^{80+}$, respectively, and observed by fluorescence detection. We obtain $\\Delta E^{(1s)}= 5086.3(11)\\,\\textrm{meV}$ for $^{209}\\text{Bi}^{82+}$ and $\\Delta E^{(2s)}= 797.50(18)\\,\\textrm{meV}$ for $^{209}\\text{Bi}^{80+}$. A specific difference between the two splitting energies can be used to test QED calculations in the strongest static magnetic fields available in the laboratory independent of nuclear structure effects. Our results confirm the large relativistic ...

  6. 48 CFR 209.406-2 - Causes for debarment.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Causes for debarment. 209.406-2 Section 209.406-2 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... 209.406-2 Causes for debarment. (1) Any person shall be considered for debarment if...

  7. 41 CFR 101-27.209-1 - GSA stock items.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true GSA stock items. 101-27.209-1 Section 101-27.209-1 Public Contracts and Property Management Federal Property Management...-Management of Shelf-Life Materials § 101-27.209-1 GSA stock items. Shelf-life items that meet the...

  8. 30 CFR 77.209 - Surge and storage piles.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Surge and storage piles. 77.209 Section 77.209... Installations § 77.209 Surge and storage piles. No person shall be permitted to walk or stand immediately above a reclaiming area or in any other area at or near a surge or storage pile where the...

  9. Bismuth( Ⅲ ) Salts: Green Catalysts for Organic Transformations

    Institute of Scientific and Technical Information of China (English)

    C. Le Roux

    2005-01-01

    @@ 1Introduction Bismuth, the heaviest stable element in the periodic table, stands out from other heavy elements (such as mercury, thallium and lead) due to its relatively non-toxic character which confers on bismuth the enviable status of being an eco-friendly element. Therefore, bismuth and its compounds hold considerable promise as useful catalysts for green chemistry. The research presented in this communication is devoted to the applications of bismuth( Ⅲ ) salts as catalysts for organic transformations.After some general comments about bismuth and a short presentation of the various applications of bismuth( Ⅲ ) salts in organic synthesis, this communication will focus on the works done in our research group during the last several years which deals mainly with electrophilic substitutions. When appropriate, some mechanistic details will be given.

  10. Electrical resistivity of thin bismuth films

    Science.gov (United States)

    Kumar, A.; Katyal, O. P.

    1990-05-01

    The effect of the film thickness of a bismuth film deposited on glass substrate on its electrical resistivity was investigated for films from 41 to 225 nm thickness, in the temperature range 77-350 K. Results show that the electrical resistivity decreases with increasing temperature and that, for films 98.3 and 225.9 nm thick there exists a minimum (between 260 and 350 K) in resistivity at some temperature, Tc. This minimum shifts toward higher temperature for thinner samples, and lies above 350 K. The thickness dependence of the bismuth film resistivity, obtained at 77, 150, and 300 K, can be explained by a modified Fuchs model, which takes into account the thickness dependence of carrier density.

  11. Flame spray synthesis under a non-oxidizing atmosphere: Preparation of metallic bismuth nanoparticles and nanocrystalline bulk bismuth metal

    Energy Technology Data Exchange (ETDEWEB)

    Grass, Robert N.; Stark, Wendelin J. [Institute for Chemical and Bioengineering, ETH Zuerich (Switzerland)], E-mail: wendelin.stark@chem.ethz.ch

    2006-10-15

    Metallic bismuth nanoparticles of over 98% purity were prepared by a modified flame spray synthesis method in an inert atmosphere by oxygen-deficient combustion of a bismuth-carboxylate based precursor. The samples were characterized by X-ray diffraction, thermal analysis and scanning electron microscopy confirming the formation of pure, crystalline metallic bismuth nanoparticles. Compression of the as-prepared powder resulted in highly dense, nanocrystalline pills with strong electrical conductivity and bright metallic gloss.

  12. Factors affecting bismuth vanadate photoelectrochemical performance

    OpenAIRE

    Sinclair, Timothy S.; Hunter, Bryan M.; Winkler, Jay R.; Gray, Harry B.; Müller, Astrid M.

    2015-01-01

    Bismuth vanadate is a promising photoanode material, but recent reports on undoped BiVO_4 without sublayers and co-catalysts showed large variations in photocurrent generation. We addressed this issue by correlating photoelectrochemical performance with physical properties. We devised a novel anodic electrodeposition procedure with iodide added to the aqueous plating bath, which allowed us to prepare BiVO_4 photoanodes with virtually identical thicknesses but different morphologies, and we co...

  13. Efficient enhancement of bismuth NIR luminescence by aluminum and its mechanism in bismuth doped germanate laser glass

    DEFF Research Database (Denmark)

    Wang, L.P.; Tan, L.L.; Yue, Yuanzheng

    2016-01-01

    on how to improve the luminescence efficiency. Here, we demonstrate that addition of aluminum can enhance the bismuth near-infrared luminescence by more than 10 000 times, which is right followed by the discussion on the mechanism on why this can happen. We believe this work can be helpful for designing...... bismuth-doped multiple component laser glasses with high efficiency. In addition, because of high susceptibility of bismuth to local field change, it can be used as probe ion to envision glass structures. Using bismuth as a luminescent structural probe, we can see the modifier ions of Bi...

  14. Improved photoelectrochemical performance of bismuth vanadate by partial O/F-substitution

    Science.gov (United States)

    Anke, B.; Rohloff, M.; Willinger, M. G.; Hetaba, W.; Fischer, A.; Lerch, M.

    2017-01-01

    Fluorine-containing bismuth vanadate (F:BiVO4) powder was synthesized using a new, clean, and simple solid-vapor reaction. Incorporation of fluorine mainly leads to the formation of cation vacancies. Electrodes were fabricated from the pre-synthesized powder samples by electrophoretic deposition onto fluorine-doped tin oxide coated glass slides and subsequent calcination. The photoelectrochemical performance concerning the water oxidation reaction was investigated and compared to pristine BiVO4 revealing strongly enhanced photoelectrochemical behavior for the F-containing BiVO4.

  15. Heat-Pipe Bismuth Laser; Examination of Laser Action at 4722A in Bismuth Vapor

    Science.gov (United States)

    1976-11-01

    transitions in other atomic vapors. 13. MODELING OF THE INITIAL BREAKDOWN PROCESS During the initial nanosecond after the fast thyratron switch closes suddenly...lasers computer modeling , laser kin etics bismuth vapor pressure and composition excitation cross sections bismuth dim ers e8ifn.eividienibbek 2Q...P3 / 2 " p $3/4 transi- 3/4 3/2 tion probability is at least a factor of 20 too low. Continuation of the computer modeling begun in this study could

  16. Spin dynamics of complex oxides, bismuth-antimony alloys, and bismuth chalcogenides

    Science.gov (United States)

    Sahin, Cuneyt

    The emerging field of spintronics relies on the manipulation of electron spin in order to use it in spin-based electronics. Such a paradigm change has to tackle several challenges including finding materials with sufficiently long spin lifetimes and materials which are efficient in generating pure spin currents. This thesis predicts that two types of material families could be a solution to the aforementioned challenges: complex oxides and bismuth based materials. We derived a general approach for constructing an effective spin-orbit Hamiltonian which is applicable to all nonmagnetic materials. This formalism is useful for calculating spin-dependent properties near an arbitrary point in momentum space. We also verified this formalism through comparisons with other approaches for III-V semiconductors, and its general applicability is illustrated by deriving the spin-orbit interaction and predicting spin lifetimes for strained strontium titanate (STO) and a two-dimensional electron gas in STO (such as at the LAO/STO interface). Our results suggest robust spin coherence and spin transport properties in STO related materials even at room temperature. In the second part of the study we calculated intrinsic spin Hall conductivities for bismuth-antimony (BISb) semimetals with strong spin-orbit couplings, from the Kubo formula and using Berry curvatures evaluated throughout the Brillouin zone from a tight-binding Hamiltonian. Nearly crossing bands with strong spin-orbit interaction generate giant spin Hall conductivities in these materials, ranging from 474 ((h/e)O--1cm--1) for bismuth to 96((h/e)O--1cm --1) for antimony; the value for bismuth is more than twice that of platinum. The large spin Hall conductivities persist for alloy compositions corresponding to a three-dimensional topological insulator state, such as Bi0.83Sb0.17. The spin Hall conductivity could be changed by a factor of 5 for doped Bi, or for Bi0.83Sb0.17, by changing the chemical potential by 0.5 e

  17. Preparation and crystal structure of a new bismuth vanadate, Bi{sub 3.33}(VO{sub 4}){sub 2}O{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Kumada, N., E-mail: kumada@yamanashi.ac.jp [Department of Research Interdisciplinary Graduate School of Medicine and Engineering, University of Yamanashi, Miyamae-cho 7-32, Kofu 400-8511 Japan (Japan); Takei, T.; Haramoto, R.; Yonesaki, Y.; Dong, Q.; Kinomura, N. [Department of Research Interdisciplinary Graduate School of Medicine and Engineering, University of Yamanashi, Miyamae-cho 7-32, Kofu 400-8511 Japan (Japan); Nishimoto, S.; Kameshima, Y.; Miyake, M. [Department of Material and Energy Science, Graduate School of Environmental Science, Okayama University, Tsusima-Naka 3-3-1, Okayama 700-8530 Japan (Japan)

    2011-06-15

    Graphical abstract: Crystal structure of Bi{sub 3.33}(VO{sub 4}){sub 2}O{sub 2}. Solid lines indicate the unit cell. Highlights: {yields} We can prepare a new bismuth vanadate, Bi{sub 3.33}(VO{sub 4}){sub 2}O{sub 2} by hydrothermal reaction using a hydrated sodium bismuthate. {yields} We clarify that the crystal structure is composed by four bismuth atoms with the coordination number of 6 or 8 and two VO{sub 4} tetrahedra. {yields} This compound exhibited photocatalytic behavior for decomposition of phenol under visible light irradiation. -- Abstract: Single crystals of a new bismuth vanadate, Bi{sub 3.33}(VO{sub 4}){sub 2}O{sub 2} was prepared by hydrothermal reaction using a hydrated sodium bismuthate, NaBiO{sub 3}.nH{sub 2}O as one of the starting compounds. The crystal structure was determined by using single crystal X-ray diffraction data. This compound crystallizes in the triclinic space group P1{sup -bar} (no. 2) with a = 7.114(1), b = 7.844(2), c = 9.372(2) A, {alpha} = 106.090(7), {beta} = 94.468(7) and {gamma} = 112.506(8){sup o}, Z = 2 and the final R factors are R1 = 0.052 and wR2 = 0.14 for 2085 unique reflections. The crystal structure is composed by four bismuth atoms with the coordination number of 6 or 8 and two VO{sub 4} tetrahedra, and one of four bismuth atoms is statistically distributed in the splitting sites with the distance of 0.83 A. This compound exhibited photocatalytic behavior for decomposition of phenol under visible light irradiation and its activity was less than that of monoclinic BiVO{sub 4}.

  18. Organic-inorganic hybrid materials starting from the novel nanoscaled bismuth oxido methacrylate cluster [Bi38O45(OMc)24(DMSO)9]·2DMSO·7H2O.

    Science.gov (United States)

    Miersch, Linda; Rüffer, Tobias; Mehring, Michael

    2011-06-14

    The reaction of the basic bismuth nitrate [Bi(6)O(4)(OH)(4)](NO(3))(6)·H(2)O with sodium methacrylate in DMSO gave [Bi(38)O(45)(OMc)(24)(DMSO)(9)]·2DMSO·7H(2)O (OMc = O(2)CC(3)H(5)), which is highly soluble in organic solvents. By copolymerization of the bismuth oxido cluster with methyl methacrylate transparent, radiopaque organic-inorganic hybrid materials were obtained.

  19. Bismuth-ceramic nanocomposites through ball milling and liquid crystal synthetic methods

    Science.gov (United States)

    Dellinger, Timothy Michael

    Three methods were developed for the synthesis of bismuth-ceramic nanocomposites, which are of interest due to possible use as thermoelectric materials. In the first synthetic method, high energy ball milling of bismuth metal with either MgO or SiO2 was found to produce nanostructured bismuth dispersed on a ceramic material. The morphology of the resulting bismuth depended on its wetting behavior with respect to the ceramic: the metal wet the MgO, but did not wet on the SiO2. Differential Scanning Calorimetry measurements on these composites revealed unusual thermal stability, with nanostructure retained after multiple cycles of heating and cooling through the metal's melting point. The second synthesis methodology was based on the use of lyotropic liquid crystals. These mixtures of water and amphiphilic molecules self-assemble to form periodic structures with nanometer-scale hydrophilic and hydrophobic domains. A novel shear mixing methodology was developed for bringing together reactants which were added to the liquid crystals as dissolved salts. The liquid crystals served to mediate synthesis by acting as nanoreactors to confine chemical reactions within the nanoscale domains of the mesophase, and resulted in the production of nanoparticles. By synthesizing lead sulfide (PbS) and bismuth (Bi) particles as proof-of-concept, it was shown that nanoparticle size could be controlled by controlling the dimensionality of the nanoreactors through control of the liquid crystalline phase. Particle size was shown to decrease upon going from three-dimensionally percolating nanoreactors, to two dimensional sheet-like nanoreactors, to one dimensional rod-like nanoreactors. Additionally, particle size could be controlled by varying the precursor salt concentration. Since the nanoparticles did not agglomerate in the liquid crystal immediately after synthesis, bismuth-ceramic nanocomposites could be prepared by synthesizing Bi nanoparticles and mixing in SiO2 particles which

  20. The synthesis of bismuth vanadate powders and their photocatalytic properties under visible light irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Shen Yue [Institute of Material Physical Chemistry, Huaqiao University, Key Laboratory for Functional Materials of Fujian Higher Education, Quanzhou, Fujian 362021 (China); Huang Miaoliang, E-mail: huangml@hqu.edu.c [Institute of Material Physical Chemistry, Huaqiao University, Key Laboratory for Functional Materials of Fujian Higher Education, Quanzhou, Fujian 362021 (China); Huang Yi; Lin Jianming; Wu Jihuai [Institute of Material Physical Chemistry, Huaqiao University, Key Laboratory for Functional Materials of Fujian Higher Education, Quanzhou, Fujian 362021 (China)

    2010-04-30

    Bismuth vanadate powders were prepared by hydrothermal method with NaVO{sub 3} and Bi(NO{sub 3}){sub 3} as starting materials and with Na{sub 2}CO{sub 3} to adjust pH, and characterized by XRD, SEM, EDS and surface area analyzer. The results showed that the phase formation of bismuth vanadate depended on the adding amount of Na{sub 2}CO{sub 3}. The bismuth vanadate samples existed as monoclinic BiVO{sub 4} by adding 0.019 and 0.038 mol of Na{sub 2}CO{sub 3} with corresponding pH value of 0.2 and 5.8, respectively, and as Bi{sub 4}V{sub 2}O{sub 11} by adding 0.057 mol of Na{sub 2}CO{sub 3} with corresponding pH value of 9.7. The photocatalytic activities of the samples were evaluated by the decolorization of methylene blue (MB) under visible light irradiation. The sample with monoclinic form obtained by adding 0.019 mol of Na{sub 2}CO{sub 3} had the highest photocatalytic activity, the decolorization rate of MB reached to 96.4% under visible light irradiation in 200 min and the reaction rate constant was 0.015 min{sup -1}.

  1. Synthesis, crystal growth and mechanical properties of Bismuth Silicon Oxide (BSO) single crystal

    Energy Technology Data Exchange (ETDEWEB)

    Riscob, B. [CSIR – National Physical Laboratory, Crystal Growth and X-ray Analysis, New Delhi 110 012 (India); Institute for Plasma Research, Bhat, Gandhinagar 382428, Gujarat (India); Shkir, Mohd. [CSIR – National Physical Laboratory, Crystal Growth and X-ray Analysis, New Delhi 110 012 (India); Ganesh, V. [Department of Physics, Kakatiya University, Warangal 506 009 (India); Vijayan, N.; Maurya, K.K. [CSIR – National Physical Laboratory, Crystal Growth and X-ray Analysis, New Delhi 110 012 (India); Kishan Rao, K. [Department of Physics, Kakatiya University, Warangal 506 009 (India); Bhagavannarayana, G., E-mail: bhagavan@mail.nplindia.ernet.in [CSIR – National Physical Laboratory, Crystal Growth and X-ray Analysis, New Delhi 110 012 (India)

    2014-03-05

    Highlights: • Synthesis of Bismuth Silicon Oxide (BSO). • Single crystal growth of BSO by Czochralski (Cz) method. • Complete mechanical analysis by device fabrication point of view. • Theoretical and experimental calculations of mechanical properties. -- Abstract: Bismuth Silicon Oxide (BSO) is an efficient material for piezo-electric and electro-optic applications. In this article, growth of BSO single crystal by high temperature Czochralski melt growth technique and its detailed mechanical characterization by Vickers microhardness, fracture toughness, crack propagation, brittleness index and yield strength have been reported. The raw material was synthesized by solid state reaction using the stoichiometric ratio of high purity bismuth tri-oxide and silicon di-oxide. The synthesized material was charged in the platinum crucible and then melted. The required rotation and pulling rate was optimized for BSO single crystal growth and good quality single crystal has been harvested after a time span of 5 days. Powder X-ray diffraction analysis confirms the parent crystallization phase of BSO. The experimentally studied mechanical behavior of the crystal is explained using various theoretical models. The anisotropic nature of the crystals is studied using Knoop indentation technique.

  2. Glass composite waste forms for iodine confined in bismuth-embedded SBA-15

    Science.gov (United States)

    Yang, Jae Hwan; Park, Hwan Seo; Ahn, Do-Hee; Yim, Man-Sung

    2016-11-01

    The aim of this study was to stabilize bismuth-embedded SBA-15 that captured iodine gas by fabrication of monolithic waste forms. The iodine containing waste was mixed with Bi2O3 (a stabilizing additive) and low-temperature sintering glass followed by pelletizing and the sintering process to produce glass composite materials. Iodine volatility during the sintering process was significantly affected by the ratio of Bi2O3 and the glass composition. It was confirmed that BiI3, the main iodine phase within bismuth-embedded SBA-15, was effectively transformed to the mixed phases of Bi5O7I and BiOI. The initial leaching rates of iodine from the glass composite waste forms ranged 10-3-10-2 g/m2 day, showing the stability of the iodine phases encapsulated by the glassy networks. It was also observed that common groundwater anions (e.g., chloride, carbonate, sulfite, and fluoride) elevated the iodine leaching rate by anion exchange reactions. The present results suggest that the glass composite waste form of bismuth-embedded SBA-15 could be a candidate material for stable storage of 129I.

  3. Structural relaxation in bismuth and lead borate glasses

    Science.gov (United States)

    Bajaj, Anu; Khanna, Atul

    2012-06-01

    Bismuth and lead borate glasses were prepared by melt quench technique. Effects of heat treatment on the density and thermal properties of bismuth and lead borate glasses was studied by annealing the glasses at 350°C for 500 h. Density of all bismuth borate glasses increases by about 0.5-0.7% with annealing and the effect is more in glasses with higher Bi2O3 concentration. In bismuth borate glasses with 50 and 55 mol % Bi2O3 we found an extraordinary large increase of Tg by 15°C after thermal annealing. All bismuth borate glasses remained completely clear and transparent on annealing. Lead borate glasses become cloudy on thermal annealing indicating occurrence of phase separation in these glasses.

  4. Bismuth(III) dialkyldithiophosphates: Facile single source precursors for the preparation of bismuth sulfide nanorods and bismuth phosphate thin films

    Energy Technology Data Exchange (ETDEWEB)

    Biswal, Jasmine B. [Department of Chemistry, University of Mumbai, Vidyanagari, Santacruz (East), Mumbai 400098 (India); Garje, Shivram S., E-mail: ssgarje@chem.mu.ac.in [Department of Chemistry, University of Mumbai, Vidyanagari, Santacruz (East), Mumbai 400098 (India); Nuwad, Jitendra; Pillai, C.G.S. [Chemistry Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India)

    2013-08-15

    Two different phase pure materials (Bi{sub 2}S{sub 3} and Bi{sub 2}P{sub 4}O{sub 13}) have been prepared under different conditions using the same single source precursors. Solvothermal decomposition of the complexes, Bi(S{sub 2}P(OR){sub 2}){sub 3} [where, R=Methyl (Me) (1), Ethyl (Et) (2), n-Propyl (Pr{sup n}) (3) and iso-Propyl (Pr{sup i}) (4)] in ethylene glycol gave orthorhombic bismuth sulfide nanorods, whereas aerosol assisted chemical vapor deposition (AACVD) of the same precursors deposited monoclinic bismuth tetraphosphate (Bi{sub 2}P{sub 4}O{sub 13}) thin films on glass substrates. Surface study of the thin films using SEM illustrated the formation of variety of nanoscale morphologies (spherical-, wire-, pendent-, doughnut- and flower-like) at different temperatures. AFM studies were carried out to evaluate quality of the films in terms of uniformity and roughness. Thin films of average roughness as low as 1.4 nm were deposited using these precursors. Photoluminescence studies of Bi{sub 2}P{sub 4}O{sub 13} thin films were also carried out. - Graphical abstract: Solvothermal decomposition of bismuth(III) dialkyldithiophosphates in ethylene glycol gave Bi{sub 2}S{sub 3} nanoparticles, whereas aerosol assisted chemical vapor deposition of these single source precursors deposited Bi{sub 2}P{sub 4}O{sub 13} thin films. Display Omitted - Highlights: • Preparation of phase pure orthorhombic Bi{sub 2}S{sub 3} nanorods and monoclinic Bi{sub 2}P{sub 4}O{sub 13} thin films. • Use of single source precursors for deposition of bismuth phosphate thin films. • Use of solvothermal decomposition and AACVD methods. • Morphology controlled synthesis of Bi{sub 2}P{sub 4}O{sub 13} thin films. • Bi{sub 2}S{sub 3} nanorods and Bi{sub 2}P{sub 4}O{sub 13} thin films using same single source precursors.

  5. Bismuth-Based Quadruple Therapy with Bismuth Subcitrate, Metronidazole, Tetracycline and Omeprazole in the Eradication of Helicobacter pylori

    Directory of Open Access Journals (Sweden)

    Raymond Lahaie

    2001-01-01

    Full Text Available BACKGROUND: A previous study showed that 14 days of qid bismuth-based triple therapy with tetracycline 500 mg, metronidazole 250 mg and colloidal bismuth subcitrate 120 mg resulted in excellent Helicobacter pylori eradication rates (89.5%. The present study looked at a shorter treatment period by adding omeprazole and by reducing the dose of tetracycline.

  6. EQCM Study of Influence of Anion Nature on Electrochemical Reduction of Bismuth Sulfide in Nickel Plating Solution

    Directory of Open Access Journals (Sweden)

    Loreta TAMAŠAUSKAITĖ-TAMAŠIŪNAITĖ

    2011-03-01

    Full Text Available The influence of anion nature on the reduction of bismuth sulfide film deposited on gold using the successive ionic layer adsorption and reaction method in solutions containing Ni2+ ions has been investigated by electrochemical quartz crystal microbalance combined with cyclic voltammetry and X-ray photoelectron spectroscopy. It has been determined that the reduction of bismuth sulfide film in the nickel plating solution depends on the anion nature: larger cathodic current and mass changes (Dƒ are observed in the solution containing acetate anion as compared to those in the solution containing sulfate anion. As the reduction of bismuth sulfide film in the background solutions depends on the nature of anion, it influences the cathodic reduction of Ni2+ ions prior to OPD of Ni. A greater current and mass change (Dƒ is conditioned by simultaneously occurring reduction of bismuth sulfide film when the film is reduced in the acetate nickel plating electrolyte in contrast to that in the sulfate one.http://dx.doi.org/10.5755/j01.ms.17.1.244

  7. Optical Properties of Bismuth Tellurite Based Glass

    Directory of Open Access Journals (Sweden)

    Hooi Ming Oo

    2012-04-01

    Full Text Available A series of binary tellurite based glasses (Bi2O3x (TeO2100−x was prepared by melt quenching method. The density, molar volume and refractive index increase when bismuth ions Bi3+ increase, this is due to the increased polarization of the ions Bi3+ and the enhanced formation of non-bridging oxygen (NBO. The Fourier transform infrared spectroscopy (FTIR results show the bonding of the glass sample and the optical band gap, Eopt decreases while the refractive index increases when the ion Bi3+ content increases.

  8. Optical properties of bismuth tellurite based glass.

    Science.gov (United States)

    Oo, Hooi Ming; Mohamed-Kamari, Halimah; Wan-Yusoff, Wan Mohd Daud

    2012-01-01

    A series of binary tellurite based glasses (Bi(2)O(3))(x) (TeO(2))(100-) (x) was prepared by melt quenching method. The density, molar volume and refractive index increase when bismuth ions Bi(3+) increase, this is due to the increased polarization of the ions Bi(3+) and the enhanced formation of non-bridging oxygen (NBO). The Fourier transform infrared spectroscopy (FTIR) results show the bonding of the glass sample and the optical band gap, E(opt) decreases while the refractive index increases when the ion Bi(3+) content increases.

  9. Experimental and theoretical studies on the bismuth-triflate-catalysed cycloisomerisation of 1,6,10-trienes and aryl polyenes.

    Science.gov (United States)

    Godeau, Julien; Fontaine-Vive, Fabien; Antoniotti, Sylvain; Duñach, Elisabet

    2012-12-21

    Cycloisomerisation of polyenes such as diethyl geranylprenylmalonate [(E)-1 a], diethyl geranylphenylmalonate [(E)-2 a] and diethyl cinnamylgeranylmalonate [(E,E)-3 a] catalysed by bismuth triflate was studied from experimental and theoretical viewpoints. Several intermediates were isolated and characterised, and calculated transition-state structures are proposed for the three reactions. The diastereoselectivity observed during the reaction of (E)- or (Z)-2 a in favour of the formation of trans-fused bicyclic products is discussed in detail. The nature of the active catalytic species derived from bismuth triflate was also investigated, and the formation of a hybrid Lewis acid/Brønsted acid catalyst with water molecules is proposed, supported by experimental and theoretical data.

  10. Interethnic diversity of the CD209 (rs4804803 gene promoter polymorphism in African but not American sickle cell disease

    Directory of Open Access Journals (Sweden)

    Jenelle A. Noble

    2015-02-01

    Full Text Available Elucidating the genomic diversity of CD209 gene promoter polymorphism could assist in clarifying disease pathophysiology as well as contribution to co-morbidities. CD209 gene promoter polymorphism has been shown to be associated with susceptibility to infection. We hypothesize that CD209 mutant variants occur at a higher frequency among Africans and in sickle cell disease. We analyzed the frequency of the CD209 gene (rs4804803 in healthy control and sickle cell disease (SCD populations and determined association with disease. Genomic DNA was extracted from blood samples collected from 145 SCD and 231 control Africans (from Mali, 331 SCD and 379 control African Americans and 159 Caucasians. Comparative analysis among and between groups was carried out by polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP. Per ethnic diversification, we found significant disparity in genotypic (23.4% versus 16.9% versus 3.2% and allelic frequencies (48.7% versus 42.1% versus 19.8% of the homozygote mutant variant of the CD209 (snp 309A/G gene promoter between Africans, African Americans and Caucasians respectively. Comparative evaluation between disease and control groups reveal a significant difference in genotypic (10.4% versus 23.4%; p = 0.002 and allelic frequencies (39.7% versus 48.7%; p = 0.02 of the homozygote mutant variant in African SCD and healthy controls respectively, an observation that is completely absent among Americans. Comparing disease groups, we found no difference in the genotypic (p = 0.19 or allelic (p = 0.72 frequencies of CD209 homozygote mutant variant between Africans and Americans with sickle cell disease. The higher frequency of CD209 homozygote mutant variants in the African control group reveals a potential impairment of the capacity to mount an immune response to infectious diseases, and possibly delineate susceptibility to or severity of infectious co-morbidities within and between groups.

  11. Greener Friedel-Crafts Acylation using Microwave-enhanced reactivity of Bismuth Triflate in the Friedel-Crafts Benzoylation of Aromatic Compounds with Benzoic Anhydride

    DEFF Research Database (Denmark)

    Tran, Phuong Hoang; Nguyen, hai Truong; Hansen, Poul Erik

    2017-01-01

    An efficient and facile bismuth trifluoromethanesulfonate-catalyzed benzoylation of aromatic compounds using benzoic anhydride under solvent-free microwave irradiation has been developed. The microwave-assisted Friedel-Crafts benzoylation results in good yields within short reaction times. Bismut...

  12. Synthesis of β -aminoesters and α -selenoesters via Active Metal Bismuth Produced by Sm/BiCl3 System in Aqueous Media

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Active metal bismuth is produced in situ via Sm/BiCl3 system in aqueous media. Promoted by this active species, β-aminoesters and α-selenoesters are synthesized via reaction of α-bromoesters with 1-(a -aminoalkyl ) benzotriazole and diselenides in moderate to good yields.

  13. 28 CFR 36.209 - Illegal use of drugs.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Illegal use of drugs. 36.209 Section 36... PUBLIC ACCOMMODATIONS AND IN COMMERCIAL FACILITIES General Requirements § 36.209 Illegal use of drugs. (a... discrimination against an individual based on that individual's current illegal use of drugs. (2) A...

  14. 20 CFR 209.15 - Compensation reportable when paid.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Compensation reportable when paid. 209.15... RAILROAD EMPLOYERS' REPORTS AND RESPONSIBILITIES § 209.15 Compensation reportable when paid. (a) General. In preparing a report required under this part, an employer may report compensation in the...

  15. 49 CFR 209.8 - Depositions in formal proceedings.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD SAFETY ENFORCEMENT PROCEDURES General § 209.8 Depositions... part, § 209.315. (b) Any party desiring to take the deposition of a witness shall file and serve a..., limitations on the parties' resources, and the importance of the issues in the case. (c) Such notice as...

  16. 48 CFR 2452.209-71 - Limitation on future contracts.

    Science.gov (United States)

    2010-10-01

    ... or through the performance of tasks pursuant to this contract, is required to develop specifications... contracts. 2452.209-71 Section 2452.209-71 Federal Acquisition Regulations System DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions...

  17. 13 CFR 400.209 - Funding for the Program.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Funding for the Program. 400.209 Section 400.209 Business Credit and Assistance EMERGENCY STEEL GUARANTEE LOAN BOARD EMERGENCY STEEL... Government. The Board will estimate the risk posed by the guaranteed loans to the funds appropriated for...

  18. 27 CFR 555.209 - Construction of type 3 magazines.

    Science.gov (United States)

    2010-04-01

    ... magazines. 555.209 Section 555.209 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO... Construction of type 3 magazines. A type 3 magazine is a “day-box” or other portable magazine. It must be fire-resistant, weather-resistant, and theft-resistant. A type 3 magazine is to be constructed of not less...

  19. 33 CFR 209.220 - Flood control regulations.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Flood control regulations. 209..., DEPARTMENT OF DEFENSE ADMINISTRATIVE PROCEDURE § 209.220 Flood control regulations. (a) Local protection... probable date of transfer. (b) Use of storage allocated for flood control or navigation at...

  20. 33 CFR 209.300 - Flood control regulations.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Flood control regulations. 209..., DEPARTMENT OF DEFENSE ADMINISTRATIVE PROCEDURE § 209.300 Flood control regulations. (a) Regulations for the... authority contained in Section 3 of the Flood Control Act of June 22, 1936, as amended and supplemented,...

  1. 47 CFR 20.9 - Commercial mobile radio service.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Commercial mobile radio service. 20.9 Section... COMMERCIAL MOBILE RADIO SERVICES § 20.9 Commercial mobile radio service. (a) The following mobile services shall be treated as common carriage services and regulated as commercial mobile radio...

  2. 12 CFR 209.3 - Cancellation of Reserve Bank stock.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Cancellation of Reserve Bank stock. 209.3... ISSUE AND CANCELLATION OF FEDERAL RESERVE BANK CAPITAL STOCK (REGULATION I) § 209.3 Cancellation of Reserve Bank stock. (a) Application for cancellation. Any bank that desires to withdraw from membership...

  3. 8 CFR 209.1 - Adjustment of status of refugees.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of status of refugees. 209.1... STATUS OF REFUGEES AND ALIENS GRANTED ASYLUM § 209.1 Adjustment of status of refugees. The provisions of this section shall provide the sole and exclusive procedure for adjustment of status by a...

  4. 13 CFR 134.209 - Requirement of signature.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Requirement of signature. 134.209 Section 134.209 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... of signature. Every written submission to OHA, other than evidence, must be signed by the...

  5. Coulomb breakup effects on the elastic cross section of $^6$He+$^{209}$Bi scattering near Coulomb barrier energies

    CERN Document Server

    Matsumoto, T; Iseri, Y; Kamimura, M; Ogata, K; Yahiro, M

    2006-01-01

    We accurately analyze the $^6$He+$^{209}$Bi scattering at 19 and 22.5 MeV near the Coulomb barrier energy, using the continuum-discretized coupled-channels method (CDCC) based on the $n$+$n$+$^4$He+$^{209}$Bi four-body model. The three-body breakup continuum of $^6$He is discretized by diagonalizing the internal Hamiltonian of $^6$He in a space spanned by the Gaussian basis functions. The calculated elastic and total reaction cross sections are in good agreement with the experimental data, while the CDCC calculation based on the di-neutron model of $^6$He, i.e., the $^2n$+$^{4}$He+$^{209}$Bi three-body model, does not reproduce the data.

  6. Determining the background levels of bismuth in tissues of wild game birds: a first step in addressing the environmental consequences of using bismuth shotshells.

    Science.gov (United States)

    Jayasinghe, R; Tsuji, L J S; Gough, W A; Karagatzides, J D; Perera, D; Nieboer, E

    2004-11-01

    Bismuth shotshells have been approved as a "nontoxic" alternative to lead in North America. Approval was based on a limited number of studies; even background levels of bismuth in wildfowl were unknown. We report on the concentration of bismuth (and lead) in muscle and liver tissues of wildfowl (Anas platyrhynchos, Anas acuta, Anas crecca, Branta canadensis, Chen caerulescens) harvested with lead shotshell. Average liver-bismuth levels detected in the present study (e.g., teal, 0.05 microg/g dw; mallard, 0.09 microg/g dw) suggest analytical error in other studies examining the effects of bismuth in birds. Significant positive relationships between bismuth- and lead-tissue levels for muscle when all species were combined (and for B. canadensis and C. caerulescens separately) can be explained by noting that bismuth is a contaminant of lead. Thus, more research is recommended to confirm the appropriateness of bismuth as a "nontoxic" shot alternative.

  7. Effect of Bismuth Oxide on the Microstructure and Electrical Conductivity of Yttria Stabilized Zirconia.

    Science.gov (United States)

    Liu, Liwei; Zhou, Zheng; Tian, He; Li, Jixue

    2016-03-14

    Bismuth oxide (Bi2O3)-doped yttria-stabilized zirconia (YSZ) were prepared via the solid state reaction method. X-ray diffraction and electron diffraction spectroscopy results indicate that doping with 2 mol% Bi2O3 and adding 10 mol% yttria result in a stable zirconia cubic phase. Adding Bi2O3 as a dopant increases the density of zirconia to above 96%, while reducing its normal sintering temperature by approximately 250°C. Moreover, electrical impedance analyses show that adding Bi2O3 enhances the conductivity of zirconia, improving its capability as a solid electrolyte for intermediate or even lower temperatures.

  8. Compatibility of Lead-Bismuth Eutectic with SiC-Coated Graphite at Elevated Temperature

    Science.gov (United States)

    Chakraborty, Poulami; Ghosh, Abhijit; Dey, Gautam Kumar

    2017-02-01

    Uniform coating of β-silicon carbide (β-SiC) was formed over a graphite pellet through slurry-based silicon coating followed by in situ reaction at 1873 K (1600 °C). The coated pellet was exposed to molten lead-bismuth eutectic (LBE) at 1173 K (900 °C) in static condition for 200 h. Weight loss measurement, X-ray diffraction, and secondary electron microscopy-energy-dispersive spectroscopy confirmed that the SiC coating could effectively prevent molten LBE from attacking the inner graphite material.

  9. Effect of Bismuth Oxide on the Microstructure and Electrical Conductivity of Yttria Stabilized Zirconia

    Directory of Open Access Journals (Sweden)

    Liwei Liu

    2016-03-01

    Full Text Available Bismuth oxide (Bi2O3-doped yttria-stabilized zirconia (YSZ were prepared via the solid state reaction method. X-ray diffraction and electron diffraction spectroscopy results indicate that doping with 2 mol% Bi2O3 and adding 10 mol% yttria result in a stable zirconia cubic phase. Adding Bi2O3 as a dopant increases the density of zirconia to above 96%, while reducing its normal sintering temperature by approximately 250 °C. Moreover, electrical impedance analyses show that adding Bi2O3 enhances the conductivity of zirconia, improving its capability as a solid electrolyte for intermediate or even lower temperatures.

  10. Formic acid oxidation at platinum-bismuth catalysts

    Directory of Open Access Journals (Sweden)

    Popović Ksenija Đ.

    2015-01-01

    Full Text Available The field of heterogeneous catalysis, specifically catalysis on bimetallic surfaces, has seen many advances over the past few decades. Bimetallic catalysts, which often show electronic and chemical properties that are distinct from those of their parent metals, offer the opportunity to obtain new catalysts with enhanced selectivity, activity, and stability. The oxidation of formic acid is of permanent interest as a model reaction for the mechanistic understanding of the electrooxidation of small organic molecules and because of its technical relevance for fuel cell applications. Platinum is one of the most commonly used catalysts for this reaction, despite the fact that it shows a few significant disadvantages: high cost and extreme susceptibility to poisoning by CO. To solve this problem, several approaches have been used, but generally, they all consist in the modification of platinum with a second element. Especially, bismuth has received significant attention as Pt modifier. According to the results presented in this survey dealing with the effects influencing the formic acid oxidation it was found that two types of Pt-Bi bimetallic catalysts (bulk and low loading deposits on GC showed superior catalytic activity in terms of the lower onset potential and oxidation current density, as well as exceptional stability compared to Pt. The findings in this report are important for the understanding of mechanism of formic acid electrooxidation on a bulk alloy and decorated surface, for the development of advanced anode catalysts for direct formic acid fuel cells, as well as for the synthesis of novel low-loading bimetallic catalysts. The use of bimetallic compounds as the anode catalysts is an effective solution to overcoming the problems of the formic acid oxidation current stability for long term applications. In the future, the tolerance of both CO poisoning and electrochemical leaching should be considered as the key factors in the development

  11. Reaction of Projectiles with Targets during Hypervelocity Impact

    Science.gov (United States)

    Russell, Rod; Bless, Stephan; Persad, Chadee; Manthiram, Karthish

    2009-06-01

    Hollow tungsten projectiles were filled with bismuth oxide or copper and shot into aluminum blocks at 2200 m/s. The blocks were cut open, and the contents and morphology of the penetration channels were examined. In the case of copper fill, the channel was found to be filled with a black foam containing closed-cell bubbles. X-ray diffraction revealed the presence of CuAl2, indicating reaction with the aluminum target. In the case of bismuth oxide, there was little foam, but the penetration channel walls had many craters, which contained nodules of bismuth metal, again indicating reaction with the target. There were variations in crater diameter apparently corresponding to the onset and termination of the reactions. The exothermic nature of the reactions produced cracks in the target blocks.

  12. Diffused phase transition in fine-grained bismuth vanadate ceramics

    OpenAIRE

    Shantha, K; Varma, KBR

    1999-01-01

    Nanocrystalline powders of ferroelectric bismuth vanadate, Bi4V2O11 (n-BiV), with crystallite size less than 50 nm, were obtained by mechanical milling of a stoichiometric mixture of bismuth oxide and vanadium pentoxide. The n-BiV powders on sintering yielded high-density, fine-grained ceramics with improved dielectric and polar characteristics. Dielectric studies on samples obtained from milled powders indicated that the ferroelectric-to-paraelectric phase transition temperature is strongly ...

  13. Melting and solidification of bismuth inclusions in aluminium

    DEFF Research Database (Denmark)

    Thoft, N.B.; Bohr, J.; Buras, B.

    1995-01-01

    Supercooling of crystalline bismuth inclusions in aluminium crystals has been observed and studied with different techniques: x-ray diffraction, in situ Rutherford backscattering/channelling spectrometry and transmission electron microscopy. The results of the measurements with different experime......Supercooling of crystalline bismuth inclusions in aluminium crystals has been observed and studied with different techniques: x-ray diffraction, in situ Rutherford backscattering/channelling spectrometry and transmission electron microscopy. The results of the measurements with different...

  14. Studies on bismuth carboxylates—synthesis and characterization of a new structural form of bismuth(III) dipicolinate

    Indian Academy of Sciences (India)

    O Anjaneyulu; K C Kumara Swamy

    2011-03-01

    Synthesis and X-ray structure of a new bismuth dipicolinate cooordination polymer, {[Bi((2,6-O2C)2C5H3N)((2-HO2C-6-O2C)C5H3N)(H2O)]2.5H2O} (7) are presented. Compound 7 has dimeric units with a Bi2O2 skeleton that are linked by additional weak Bi-O interactions leading to a polymeric structure. The overall coordination number at bismuth is 9 [two Bi-N and seven Bi-O bonds]. New routes to a second crystalline modification (4′) of the previously reported coordination polymer, bismuth tris(picolinate), [Bi(2-O2C-C5H4N)3] (4), are described; bond parameters in the two crystalline forms (4 and 4′) are compared. In both the compounds 4′ and 7, bismuth has a distorted tricapped trigonal prismatic geometry.

  15. In situ electron beam irradiated rapid growth of bismuth nanoparticles in bismuth-based glass dielectrics at room temperature

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Shiv Prakash; Karmakar, Basudeb, E-mail: basudebk@cgcri.res.in [Central Glass and Ceramic Research Institute (CSIR, India), Glass Science and Technology Section, Glass Division (India)

    2011-09-15

    In this study, in situ control growth of bismuth nanoparticles (Bi{sup 0} NPs) was demonstrated in bismuth-based glass dielectrics under an electron beam (EB) irradiation at room temperature. The effects of EB irradiation were investigated in situ using transmission electron microscopy (TEM), selected-area electron diffraction and high-resolution transmission electron microscopy. The EB irradiation for 2-8 min enhanced the construction of bismuth nanoparticles with a rhombohedral structure and diameter of 4-9 nm. The average particle size was found to increase with the irradiation time. Bismuth metal has a melting point of 271 Degree-Sign C and this low melting temperature makes easy the progress of energy induced structural changes during in situ TEM observations. This is a very useful technique in nano-patterning for integrated optics and other applications.

  16. [Survival after gastrectomy for cancer. 209 cases].

    Science.gov (United States)

    Le Treut, Y P; Capobianco, C; Botti, G; Christophe, M; Lebreuil, G; Bricot, R

    1992-09-26

    The long-term results of 209 gastrectomies performed for adenocarcinoma, including 117 which were prospectively collected, are presented. Resection was curative in 154 cases (73.6 percent). The TNM distribution of the tumours was: stage I (TxNOMO) 75 cases, stage II (TxN1MO) 46 cases, stage III (TxN2MO) 33 cases and stage IV (TxNxM1) 55 cases. Lymph node involvement was more frequent in the prospective than in the retrospective study. With a more than 5 years' follow-up of 80 percent of the patients operated upon, the actuarial survival rate at 5 years (operative mortality included) was 38 percent for all lesions, 52 percent for curative resection and 2 percent for palliative resection. Following curative resection, the survival rates for tumours of the upper, middle and lower thirds of the stomach were 40, 60 and 55 percent respectively. These rates were 60 percent for stage I tumours, 54 percent for stage II tumours and 25 percent for stage III tumours. The results obtained in this series, where most of the curative gastrectomies included excision of N1 and N2 lymph nodes, show that lymph node involvement has no significant importance for the prognosis when it is proximal (N1) and is not incompatible with prolonged survival when it is pedicular (N2).

  17. Contribution to construction and setup of a detection system for the focal plan of the BBS spectrometer. Application to study of the neutron emission decay of the resonant states populated by the reaction ({sup 4}He,{sup 3}He) at 42 MeV/u in nuclei {sup 208}Pb and {sup 209}Pb; Contribution a la construction et a la mise au point d'un systeme de detection pour le plan focal du spectrometre BBS. Application a l'etude de la decroissance par emission de neutrons d'etats resonants peuples par la reaction ({sup 4}He,{sup 3}He) a 42 MeV/u dans les noyaux {sup 208}Pb et {sup 209}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Plankl-Chabib, Elke [Inst. de Physique Nucleaire, Paris-11 Univ., 91 - Orsay (France)

    1999-06-11

    In order to realizean experimental program dedicated to nuclear structure studies we have conceived and constructed at IPN Orsay a detection system for the focal plane of the magnetic spectrometer BBS, installed at the cryogenic cyclotron AGOR of the laboratory KVI (The Netherlands). Two detection units, consisting each of two localization plans of the Cathode Strip Chamber (CSC) type, measure the position and angle of particle trajectory. This information is used for the determination of the reaction parameters at the target by a backtracking procedure. The identification of the reaction products is done by the measurement of their time-of-flight and energy loss. For light ions this task is assumed by plastic scintillators, and for heavy ions by a parallel plan detector (PPAC) and an ionization chamber. This detection system is well adapted to the requirements given by the detection of a large range of ions (protons to {sup 36}Ar at energies of several tenths of MeV/nucleon) as well as the big acceptance, the small dispersion and the aberration of the BBS. The results of the test show the good performances of the detection system. In a first experiment the focal plane detection system was coupled to the neutron multidetector EVEN in order to study the decay of resonant high spin states at high excitation energies by the ({sup 4}He, {sup 3}He) reaction on {sup 207}Pb and {sup 208}Pb targets. The transfer spectra, inclusive and in coincidence, of the nuclei {sup 208}Pb and {sup 209}Pb show a striking resemblance except for an excitation energy shift which is due to the hole in the last neutron shell of {sup 207}Pb. The resonances at l 8 and l = 9 are clearly populated, in agreement with the predictions of the Bonaccorso-Brink model. A sizeable fraction of the decay of the l = 8 resonance is direct, but at excitation energies higher than 15 MeV (in {sup 208}Pb) the decay is mostly statistical.

  18. Novel synthesis of bismuth-based adsorbents for the removal of {sup 129}I in off-gas

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Jae Hwan, E-mail: yjh98@kaeri.re.kr [Nuclear Fuel Cycle Process Development Division, Korea Atomic Energy Research Institute, 989-111 Daeduk-daero, Yuseong-gu, Daejeon 305-353 (Korea, Republic of); Department of Nuclear and Quantum Engineering, Korea Advanced Institute of Science and Technology, 291 Daehak-ro, Yuseong-gu, Daejeon 305-701 (Korea, Republic of); Shin, Jin Myeong; Park, Jang Jin; Park, Geun Il [Nuclear Fuel Cycle Process Development Division, Korea Atomic Energy Research Institute, 989-111 Daeduk-daero, Yuseong-gu, Daejeon 305-353 (Korea, Republic of); Yim, Man Sung [Department of Nuclear and Quantum Engineering, Korea Advanced Institute of Science and Technology, 291 Daehak-ro, Yuseong-gu, Daejeon 305-701 (Korea, Republic of)

    2015-02-15

    New adsorbents based on bismuth were investigated for the capture of iodine-129 ({sup 129}I) in off-gas produced from spent fuel reprocessing. Porous bulky materials were synthesized with polyvinyl alcohol (PVA) as a sacrificial template. Our findings showed that the iodine trapping capacity of as-synthesized samples could reach 1.9-fold that of commercial silver-exchanged zeolite (AgX). The thermodynamic stability of the reaction products explains the high removal efficiency of iodine. We also found that the pore volume of each sample was closely related to the ratio of the reaction products.

  19. Isolation and characterization of a cold-resistant PCB209-degrading bacterial strain from river sediment and its application in bioremediation of contaminated soil.

    Science.gov (United States)

    Qiu, Liping; Wang, Hu; Wang, Xuntao

    2016-01-01

    A cold-resistant bacterium (strain QL) that can degrade 2,2',3,3',4,4',5,5',6,6'-decachlorobiphenyl (PCB209) was isolated from Wei-he River sediment. Strain QL was identified as a rod-shaped gram-negative bacterial strain, which was further identified as Comamonas testosteroni. C. testosteroni has never been reported to be capable of degrading PCB209 at low temperatures. In this study, the degradation characteristics showed that strain QL could grow with PCB209 as the sole carbon source at low temperatures (10 ± 0.5 °C). More significantly, strain QL of 40% inoculation volume was able to completely degrade PCB209 in 140 h (initial concentration of PCB209 was 100-500 µg L(-1) at 10 ± 0.5 °C and pH 7-8). The degradation process proceeded with zero-order reaction kinetics. Moreover, both laboratory simulation and real-world field experiments demonstrated that strain QL was effective in practical applications of PCB209 biodegradation in contaminated soil.

  20. Feasibility of preparing patterned molybdenum coatings on bismuth telluride thermoelectric modules.

    Energy Technology Data Exchange (ETDEWEB)

    Sarobol, Pylin; Hall, Aaron Christopher; Miller, Stephen Samuel; Knight, Marlene E.; LePage, William S.; Sobczak, Catherine Elizabeth.; Wesolowski, Daniel Edward

    2013-09-01

    Molybdenum electrical interconnects for thermoelectric modules were produced by air plasma spraying a 30%CE%BCm size molybdenum powder through a laser-cut Kapton tape mask. Initial feasibility demonstrations showed that the molybdenum coating exhibited excellent feature and spacing retention (~170%CE%BCm), adhered to bismuth-telluride, and exhibited electrical conductivity appropriate for use as a thermoelectric module interconnect. A design of experiments approach was used to optimize air plasma spray process conditions to produce a molybdenum coating with low electrical resistivity. Finally, a molybdenum coating was successfully produced on a fullscale thermoelectric module. After the addition of a final titanium/gold layer deposited on top of the molybdenum coating, the full scale module exhibited an electrical resistivity of 128%CE%A9, approaching the theoretical resistivity value for the 6mm module leg of 112%CE%A9. Importantly, air plasma sprayed molybdenum did not show significant chemical reaction with bismuth-telluride substrate at the coating/substrate interface. The molybdenum coating microstructure consisted of lamellar splats containing columnar grains. Air plasma sprayed molybdenum embedded deeply (several microns) into the bismuth-telluride substrate, leading to good adhesion between the coating and the substrate. Clusters of round pores (and cracks radiating from the pores) were found immediately beneath the molybdenum coating. These pores are believed to result from tellurium vaporization during the spray process where the molten molybdenum droplets (2623%C2%B0C) transferred their heat of solidification to the substrate at the moment of impact. Substrate cooling during the molybdenum deposition process was recommended to mitigate tellurium vaporization in future studies.

  1. China Plays an Important Role in the World Bismuth Market Place

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    <正>Available statistics shows that China not only has the world largest bismuth deposit but also is the world largest producer, exporter and consumer country. Particularly in the recent three years, China’s production and supply as well as the related policy changes has become a major factor in the bismuth market price fluctuations. China’s bismuth ore production in the recent two years has been kept stable and China’s output of bismuth ore concentrates accounts for

  2. Prognostic Value of Bismuth Typing and Modified T-stage in Hilar Cholangiocarcinoma

    Directory of Open Access Journals (Sweden)

    Shengen Yi

    2015-01-01

    Conclusion: The majority of our patients with HCC were characterized as Subtype IV in Bismuth typing and Stage T3 in modified T-stage. Both Bismuth typing and modified T-stage showed prognostic value in HCC. Compared with Bismuth typing, modified T-stage is a better indicator of the resectability of HCC.

  3. Functionalized bismuth ferrite harmonic nanoparticles for cancer cells labeling and imaging

    Energy Technology Data Exchange (ETDEWEB)

    Passemard, Solène; Staedler, Davide; Sonego, Giona [Ecole Polytechnique Fédérale de Lausanne, Institute of Chemical Sciences and Engineering (Switzerland); Magouroux, Thibaud [Université de Genève, GAP-Biophotonics (Switzerland); Schneiter, Guillaume Stéphane [Ecole Polytechnique Fédérale de Lausanne, Institute of Chemical Sciences and Engineering (Switzerland); Juillerat-Jeanneret, Lucienne [University Institute of Pathology, CHUV-UNIL (Switzerland); Bonacina, Luigi [Université de Genève, GAP-Biophotonics (Switzerland); Gerber-Lemaire, Sandrine, E-mail: Sandrine.Gerber@epfl.ch [Ecole Polytechnique Fédérale de Lausanne, Institute of Chemical Sciences and Engineering (Switzerland)

    2015-10-15

    Bismuth ferrite (BFO) harmonic nanoparticles (NPs) display high nonlinear optical efficiency and excellent biocompatibility profile which make them attractive for the development of diagnostic applications as contrast agents. In this study, we present a general method for the functionalization of this material with chemical ligands targeting cancer molecular biomarkers. In particular, a conjugation protocol based on click reaction between alkynyl-containing targeting ligands and poly(ethylene glycol)-coated BFO NPs (67.7 nm) displaying surface reactive azido groups was developed. Copper-free click reaction allowed fast and efficient conjugation of a covalent inhibitor of prolyl-specific endopeptidases to coated BFO NPs. The ability of these functionalized nanomaterials (134.2 nm) to act as imaging probes for cancer cells was demonstrated by the selective labeling of human lung cancer cells.

  4. Bismuth X-ray absorber studies for TES microcalorimeters

    Energy Technology Data Exchange (ETDEWEB)

    Sadleir, J.E. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States) and University of Illinois Physics Department, Urbana, IL 61801 (United States)]. E-mail: sadleir@milkyway.gsfc.nasa.gov; Bandler, S.R. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Brekosky, R.P. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Chervenak, J. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Figueroa-Feliciano, E. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Finkbeiner, F. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Iyomoto, N. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Kelley, R.L. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Kilbourne, C.A. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); King, J.M. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Porter, F.S. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Robinson, I.K. [University of Illinois Physics Department, Urbana, IL 61801 (United States); Saab, T. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Talley, D.J. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States)

    2006-04-15

    Bismuth's large atomic number and low carrier density makes it an attractive X-ray absorber material for microcalorimeters. Bismuth's long Fermi wavelength and long mean free paths have motivated much interest in the fabrication of high quality bismuth films to study quantum size effects. Despite such incentives, fabrication of high quality bismuth films has proven difficult, and measured properties of such films are highly variable in the literature. Implementing a bismuth deposition process for TES (superconducting Transition Edge Sensor) device fabrication presents additional challenges particularly at interfaces due to the inherent granularity and surface roughness of its films, its low melting point, and its tendency to diffuse and form undesired intermetallic phases. We report observations of Bi-Cu and Bi-Au diffusion in our devices correlating with large shifts in T{sub c} (superconducting transition temperature). Using SEM and in situ R vs T annealing experiments we have been able to study these diffusion processes and identify their activation temperatures.

  5. Microwave-hydrothermal synthesis of perovskite bismuth ferrite nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Biasotto, G. [Laboratorio Interdisciplinar em Ceramica (LIEC), Departamento de Fisico-Quimica, Instituto de Quimica, UNESP, CEP 14800-900, Araraquara, SP (Brazil); Simoes, A.Z., E-mail: alezipo@yahoo.com [Universidade Estadual Paulista-Unesp, Faculdade de Engenharia de Guaratingueta, Av. Dr. Ariberto Pereira da Cunha, 333, Bairro Pedregulho, CEP 12516-410, Guaratingueta, SP (Brazil); Foschini, C.R.; Zaghete, M.A.; Varela, J.A.; Longo, E. [Laboratorio Interdisciplinar em Ceramica (LIEC), Departamento de Fisico-Quimica, Instituto de Quimica, UNESP, CEP 14800-900, Araraquara, SP (Brazil)

    2011-12-15

    Highlights: Black-Right-Pointing-Pointer BiFeO{sub 3} (BFO) nanoparticles were grown by hydrothermal microwave method (HTMW). Black-Right-Pointing-Pointer The soaking time is effective in improving phase formation. Black-Right-Pointing-Pointer Rietveld refinement reveals an orthorhombic structure. Black-Right-Pointing-Pointer The observed magnetism of the BFO crystallites is a consequence of particle size. Black-Right-Pointing-Pointer The HTMW is a genuine technique for low temperatures and short times of synthesis. -- Abstract: Hydrothermal microwave method (HTMW) was used to synthesize crystalline bismuth ferrite (BiFeO{sub 3}) nanoparticles (BFO) in the temperature of 180 Degree-Sign C with times ranging from 5 min to 1 h. BFO nanoparticles were characterized by means of X-ray analyses, FT-IR, Raman spectroscopy, TG-DTA and FE-SEM. X-ray diffraction results indicated that longer soaking time was benefit to refraining the formation of any impurity phases and growing BFO crystallites into almost single-phase perovskites. Typical FT-IR spectra for BFO nanoparticles presented well defined bands, indicating a substantial short-range order in the system. TG-DTA analyses confirmed the presence of lattice OH{sup -} groups, commonly found in materials obtained by HTMW process. Compared with the conventional solid-state reaction process, submicron BFO crystallites with better homogeneity could be produced at the temperature as low as 180 Degree-Sign C. These results show that the HTMW synthesis route is rapid, cost effective, and could be used as an alternative to obtain BFO nanoparticles in the temperature of 180 Degree-Sign C for 1 h.

  6. Background Simulation of a Fission Fragment Chamber in the Experiment of 209^Bi(e, e'K^+)209^hPb

    Institute of Scientific and Technical Information of China (English)

    宋玉收; 刘辉兰; 席印印; 颜强; 胡碧涛

    2012-01-01

    An experiment for measuring the hyperon-related fission rate was carried out with the reaction 209^Bi(e, e'K^+)209^hPb at the Thomas Jefferson National Laboratory (Jlab). In the experiment, the performance of the fission fragment detector (FFD) was dramaticlly crashed by the background particles in comparison with that during the test without beam. The scattering of the high intensity (500 nA) primary electrons was the dominant cause. Using the GEANT4 toolkit, this report simulates the experimental situation of the target chamber in which the FFD was located. The simulation results indicate that the background particles were dominantly (~ electrons, and protons and alpha particles were the important heavy background particles. The performance of the multi-wire proportional chambers (MWPCs) depends not only on the background-particle intensity but also the current density, which was also given by the simulation code. Furthermore, the measures to suppress the background particles were also investigated with the simulation code.

  7. Photoreductive generation of amorphous bismuth nanoparticles using polysaccharides--bismuth-cellulose nanocomposites.

    Science.gov (United States)

    Breitwieser, Doris; Kriechbaum, Margit; Ehmann, Heike M A; Monkowius, Uwe; Coseri, Sergiu; Sacarescu, Liviu; Spirk, Stefan

    2015-02-13

    A simple and highly reproducible synthesis of amorphous bismuth nanoparticles incorporated into a polysaccharide matrix using a photoreduction process is presented. As precursor for the generation of the Bi nanoparticles, organosoluble triphenylbismuth is used. The precursor is dissolved in toluene and mixed with a hydrophobic organosoluble polysaccharide, namely trimethylsilyl cellulose (TMSC) with high DSSi. The solution is subjected to UV exposure, which induces the homolytic cleavage of the bismuth-carbon bond in BiPh3 resulting in the formation of Bi(0) and phenyl radicals. The aggregation of the Bi atoms can be controlled in the TMSC matrix and yields nanoparticles of around 20 nm size as proven by TEM. The phenyl radicals undergo recombination to form small organic molecules like benzene and biphenyl, which can be removed from the nanocomposite after lyophilization and exposure to high vacuum. Finally, the TMSC matrix is converted to cellulose after exposure to HCl vapors, which remove the trimethylsilyl groups from the TMSC derivative. Although TMSC is converted to cellulose, the formed TMS-OH is not leaving the nanocomposite but reacts instead with surface oxide layer of the Bi nanoparticles to form silylated Bi nanoparticles as proven by TEM/EDX.

  8. Bismuth nanoparticles for phenolic compounds biosensing application.

    Science.gov (United States)

    Mayorga-Martinez, Carmen C; Cadevall, Miquel; Guix, Maria; Ros, Josep; Merkoçi, Arben

    2013-02-15

    The rapid determination of trace phenolic compounds is of great importance for evaluating the total toxicity of contaminated water samples. Nowadays, electrochemical tyrosinase (Tyr) based biosensors constitute a promising technology for the in situ monitoring of phenolic compounds because of their advantages such as high selectivity, low production cost, promising response speed, potential for miniaturization, simple instrumentation and easy automatization. A mediator-free amperometric biosensor for phenolic compounds detection based on the combination of bismuth nanoparticles (BiNPs) and Tyr for phenol detections will be hereby reported. This is achieved through the integration of BiNPs/Tyr onto the working electrode of a screen printed electrode (SPE) by using glutaraldehyde as a cross-linking agent. BiNPs/Tyr biosensor is evaluated by amperometric measurements at -200 mV DC and a linear range of up to 71 μM and 100 μM and a correlation coefficient of 0.995 and 0.996 for phenol and catechol, respectively. The very low DC working potential ensures the avoidance of interferences making this biosensor an advantageous device for real sample applications. In addition, the response mechanism including the effect of BiNPs based on electrochemical studies and optical characterizations will be also discussed. The obtained results may open the way to many other BiNPs applications in the biosensing field.

  9. Laser Spectroscopy of Neutron Rich Bismuth Isotopes

    CERN Multimedia

    2002-01-01

    %IS344 :\\\\ \\\\ The aim of the experiment is to measure the optical isotope shifts and hyperfine structures of bismuth isotopes across the N=126 shell closure in order to extract the change in mean square charge radii ($\\delta\\langle r^{2}\\rangle$) and static moments. These include the first isotones of lead to be measured directly above the shell closure and will provide new information on the systematics of the kink ($\\delta\\langle r^{2}\\rangle)$ seen in the lead isotopic chain. After two very successful runs the programme has been extended to include the neutron deficient isotopes below $^{201}$Bi to study the systematics across the $i_{13/2}$ neutron sub-shell closure at N=118.\\\\ \\\\ During the initial 2 runs (9 shifts) the isotope shifts and hyperfine structures of three new isotopes, $ ^{210,212,213}$Bi and the 9$^{-}$ isomer of $^{210}$Bi have been measured. The accuracy of the previous measurements of $^{205,206,208}$Bi have been greatly improved. The samples of $ ^{208,210,210^{m}}$Bi were prepared by c...

  10. LMO dielectronic resonances in highly charged bismuth

    Science.gov (United States)

    Smiga, Joseph; Gillaspy, John; Podpaly, Yuri; Ralchenko, Yuri

    2016-05-01

    Dielectronic resonances from high-Z elements are important for the analysis of high temperature plasmas. Thus, the extreme ultraviolet spectra of highly charged bismuth were measured using the NIST electron beam ion trap (EBIT) at beam energies ranging from 8.7 keV to 9.2 keV. The measured intensity ratios between forbidden magnetic-dipole lines in Bi64+ and Bi63+ show strong resonance features. The experimental data were compared to theoretical predictions from a large-scale collisional-radiative model with the code NOMAD, and good agreement was found that allowed the identification of observed resonance features as the LMO inner-shell dielectronic resonances. It is common practice in EBIT experiments that ions are periodically dumped from the trap and replaced. However, in this particular experiment, the contents of the trap were not dumped for the duration of each 10 minute sampling. The effects of trap stability were studied and a small but noticeable shift in beam energy over time was observed. Potential explanations for this are considered.

  11. Bismuth iron oxide thin films using atomic layer deposition of alternating bismuth oxide and iron oxide layers

    Energy Technology Data Exchange (ETDEWEB)

    Puttaswamy, Manjunath; Vehkamäki, Marko [University of Helsinki, Department of Chemistry, P.O. Box 55, FI-00014 Helsinki (Finland); Kukli, Kaupo, E-mail: kaupo.kukli@helsinki.fi [University of Helsinki, Department of Chemistry, P.O. Box 55, FI-00014 Helsinki (Finland); University of Tartu, Institute of Physics, W. Ostwald 1, EE-50411 Tartu (Estonia); Dimri, Mukesh Chandra [National Institute of Chemical Physics and Biophysics, Akadeemia tee 23, EE-12618 Tallinn (Estonia); Kemell, Marianna; Hatanpää, Timo; Heikkilä, Mikko J. [University of Helsinki, Department of Chemistry, P.O. Box 55, FI-00014 Helsinki (Finland); Mizohata, Kenichiro [University of Helsinki, Department of Physics, P.O. Box 64, FI-00014 Helsinki (Finland); Stern, Raivo [National Institute of Chemical Physics and Biophysics, Akadeemia tee 23, EE-12618 Tallinn (Estonia); Ritala, Mikko; Leskelä, Markku [University of Helsinki, Department of Chemistry, P.O. Box 55, FI-00014 Helsinki (Finland)

    2016-07-29

    Bismuth iron oxide films with varying contributions from Fe{sub 2}O{sub 3} or Bi{sub 2}O{sub 3} were prepared using atomic layer deposition. Bismuth (III) 2,3-dimethyl-2-butoxide, was used as the bismuth source, iron(III) tert-butoxide as the iron source and water vapor as the oxygen source. The films were deposited as stacks of alternate Bi{sub 2}O{sub 3} and Fe{sub 2}O{sub 3} layers. Films grown at 140 °C to the thickness of 200–220 nm were amorphous, but crystallized upon post-deposition annealing at 500 °C in nitrogen. Annealing of films with intermittent bismuth and iron oxide layers grown to different thicknesses influenced their surface morphology, crystal structure, composition, electrical and magnetic properties. Implications of multiferroic performance were recognized in the films with the remanent charge polarization varying from 1 to 5 μC/cm{sup 2} and magnetic coercivity varying from a few up to 8000 A/m. - Highlights: • Bismuth iron oxide thin films were grown by atomic layer deposition at 140 °C. • The major phase formed in the films upon annealing at 500 °C was BiFeO{sub 3}. • BiFeO{sub 3} films and films containing excess Bi favored electrical charge polarization. • Slight excess of iron oxide enhanced saturative magnetization behavior.

  12. Characterization of bismuth nanospheres deposited by plasma focus device

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, M., E-mail: cscientific2@aec.org.sy [IBA Laboratory, Chemistry Department, Atomic Energy Commission of Syria, P.O. Box 6091, Damascus (Syrian Arab Republic); Al-Hawat, Sh.; Akel, M. [Physics Department, Atomic Energy Commission of Syria, P.O. Box 6091, Damascus (Syrian Arab Republic); Mrad, O. [Chemistry Department, Atomic Energy Commission of Syria, P.O. Box 6091, Damascus (Syrian Arab Republic)

    2015-02-14

    A new method for producing thin layer of bismuth nanospheres based on the use of low energy plasma focus device is demonstrated. Various techniques such as scanning electron microscopy, Rutherford backscattering spectroscopy, X-ray diffraction, X-ray photoelectron spectroscopy, and Raman spectroscopy have been used to characterize the morphology and the composition of the nanospheres. Experimental parameters may be adjusted to favour the formation of bismuth nanospheres instead of microspheres. Therefore, the formation of large surface of homogeneous layer of bismuth nanospheres with sizes of below 100 nm can be obtained. The natural snowball phenomenon is observed to be reproduced in nanoscale where spheres roll over the small nanospheres and grow up to bigger sizes that can reach micro dimensions. The comet-like structure, a reverse phenomenon to snowball is also observed.

  13. Inexpensive laser-induced surface modification in bismuth thin films

    Energy Technology Data Exchange (ETDEWEB)

    Contreras, A. Reyes [Facultad de Ciencias, Universidad Autónoma del Estado de México, Carretera Toluca, Ixtlahuaca Kilómetro 15.5, C.P. 50200 Edo. de México (Mexico); Hautefeuille, M., E-mail: mathieu_h@ciencias.unam.mx [Facultad de Ciencias, Universidad Nacional Autónoma de México, Avenida Universidad 3000, Circuito Exterior S/N, Coyoacán, Ciudad Universitaria, C.P. 04510 D.F. Mexico (Mexico); García, A. Esparza [Fotofísica y Películas Delgadas, Departamento de Tecnociencias, CCADET-UNAM, Circuito exterior s/n C.P. 04510 Cd. Universitaria, D.F. Mexico (Mexico); Mejia, O. Olea [Centro Conjunto de Investigación en Química Sustentable UAEM-UNAM, Carretera Toluca-Atlacomulco, Km 14.5, Unidad El Rosedal, 50200 San Cayetano, Estado de México (Mexico); López, M.A. Camacho [Facultad de Química, Universidad Autónoma del Estado de México, Tollocan s/n, esq. Paseo Colón, Toluca, Estado de México 50110 (Mexico)

    2015-05-01

    Highlights: • Laser-induced microbumps were formed on bismuth films using a simple, low-cost, laser setup. • The patterns, similar to those typically obtained with high-power lasers, were characterized. • Control of laser ablation conditions is critical in the fabrication of surface microbumps. - Abstract: In this work, we present results on texturing a 500 nm thick bismuth film, deposited by sputtering onto a glass slide using a low-cost homemade, near-infrared pulsed laser platform. A 785 nm laser diode of a CD–DVD pickup head was precisely focused on the sample mounted on a motorized two-axis translation stage to generate localized surface microbumps on the bismuth films. This simple method successfully transferred desired micropatterns on the films in a computer-numerical control fashion. Irradiated zones were characterized by atomic force microscopy and scanning electron microscopy. It was observed that final results are strongly dependent on irradiation parameters.

  14. Dependence of optical properties of calcium bismuthates on synthesis conditions

    Science.gov (United States)

    Shtarev, D. S.; Shtareva, A. V.

    2016-08-01

    The article studies optical properties of calcium bismuthate nanoparticles of different composition. For the first time the synthesis of these compounds was produced by the pyrolysis of organic precursors using an organic solvent. Characterization of particles was made by scanning electron microscopy and X-ray analysis. The optical properties were investigated by diffuse reflectance spectroscopy (DRS). It is shown that the type of crystal lattice of the particles of calcium bismuthate determines the possibility to control the optical properties of nanoparticles by varying their composition. The conclusions about the production process and the composition of calcium bismuthate, the most promising for use as a photocatalyst of visible light and solar cells, were made.

  15. Deposition of Visible Light Active Photocatalytic Bismuth Molybdate Thin Films by Reactive Magnetron Sputtering

    Directory of Open Access Journals (Sweden)

    Marina Ratova

    2016-01-01

    Full Text Available Bismuth molybdate thin films were deposited by reactive magnetron co-sputtering from two metallic targets in an argon/oxygen atmosphere, reportedly for the first time. Energy dispersive X-ray spectroscopy (EDX analysis showed that the ratio of bismuth to molybdenum in the coatings can be effectively controlled by varying the power applied to each target. Deposited coatings were annealed in air at 673 K for 30 min. The crystalline structure was assessed by means of Raman spectroscopy and X-ray diffraction (XRD. Oxidation state information was obtained by X-ray photoelectron spectroscopy (XPS. Photodegradation of organic dyes methylene blue and rhodamine B was used for evaluation of the photocatalytic properties of the coatings under a visible light source. The photocatalytic properties of the deposited coatings were then compared to a sample of commercial titanium dioxide-based photocatalytic product. The repeatability of the dye degradation reactions and photocatalytic coating reusability are discussed. It was found that coatings with a Bi:Mo ratio of approximately 2:1 exhibited the highest photocatalytic activity of the coatings studied; its efficacy in dye photodegradation significantly outperformed a sample of commercial photocatalytic coating.

  16. Low-Temperature Synthesis of Bismuth Chalcohalides: Candidate Photovoltaic Materials with Easily, Continuously Controllable Band gap

    Science.gov (United States)

    Kunioku, Hironobu; Higashi, Masanobu; Abe, Ryu

    2016-09-01

    Although bismuth chalcohalides, such as BiSI and BiSeI, have been recently attracting considerable attention as photovoltaic materials, the methods available to synthesize them are quite limited thus far. In this study, a novel, facile method to synthesize these chalcohalides, including BiSBr1-xIx solid solutions, at low temperatures was developed via the substitution of anions from O2- to S2- (or Se2-) using bismuth oxyhalide precursors. Complete phase transition was readily observed upon treatment of BiOI particles with H2S or H2Se at surprisingly low temperatures of less than 150 °C and short reaction times of less than 1 h, producing BiSI and BiSeI particles, respectively. This method was also applied for synthesizing BiSBr1-xIx, where continuous changes in their band gaps were observed depending on the ratio between iodine and bromine. The composition of all elements (except oxygen) in the chalcohalides thus produced was almost identical to that of the oxyhalide precursors, attributed to the suppressed volatilization of halogens at such low temperatures. All chalcohalides loaded on FTO clearly exhibited an anodic photocurrent in an acetonitrile solution containing I-, attributed to their n-type nature, e.g., the BiSI electrode exhibited high IPCE (64% at 700 nm, +0.2 V vs. Ag/AgCl).

  17. Extraction of nitric acid, uranyl nitrate, and bismuth nitrate from aqueous nitric acid solutions with CMPO

    Energy Technology Data Exchange (ETDEWEB)

    Spencer, B.B.

    1995-08-01

    DOE sponsored development of the transuranium extraction (TRUEX) process for removing actinides from radioactive wastes. The solvent is a mixture of CMPO and TBP. Since the extraction characteristics of CMPO are not as well understood as those of TBP, the extraction of nitric acid, uranyl nitrate, and bismuth nitrate with CMPO (dissolved in n-dodecane) were studied. Results indicate that CMPO extracts nitric acid with a 1:1 stoichiometry; equilibrium constant is 2. 660{plus_minus}0.092 at 25 C, and extraction enthalpy is -5. 46{plus_minus}0.46 kcal/mol. Slope analysis indicates that uranyl nitrate extracts with a mixed equilibria of 1:1 and 2:1 stoichiometries in nearly equal proportion. Equil. constant of the 2: 1 extraction was 1.213 {times} 10{sup 6}{plus_minus}3.56 {times} 10{sup 4} at 25 C; reaction enthalpy was -9.610{plus_minus}0.594 kcal/mol. Nitration complexation constant is 8.412{plus_minus}0.579, with an enthalpy of -10.72{plus_minus}1.87 kcal/mol. Bismuth nitrate also extracts with a mixed equilibria of (perhaps) 1:1 and 2:1 stoichiometries. A 2:1 extraction equilibrium and a nitrate complexation adequately model the data. Kinetics and enthalpies were also measured.

  18. Preparation of bismuth subcarbonate by liquid ball-milling transformation method from bismuth oxide%液相球磨法由氧化铋制备次碳酸铋的动力学

    Institute of Scientific and Technical Information of China (English)

    叶龙刚; 蒋叶; 唐朝波; 陈永明; 唐谟堂

    2014-01-01

    In order to solve the problems of environment pollution and high cost in traditional process of bismuth subcarbonate preparation, a new process using ball-milling transformation method from NH4HCO3 and Bi2O3 was proposed. Additionally, the kinetics of bismuth subcarbonate preparation was studied. Effects of reaction temperature, particle size of bismuth oxide, solid-to-liquid ratio and concentrations of ammonium bicarbonate on the conversion rate of bismuth oxide were studied. The results indicate that the conversion rate of bismuth oxide significantly increased under the conditions of higher temperature, smaller particle size, higher concentration of ammonium bicarbonate and smaller solid-to-liquid ratio. The XRD and ICP-AES analyses show that the purity of product is high. The reaction kinetics with activation energy of 9.783 kJ/mol was analyzed by shrinking core model, and the whole transformation process is controlled by solid product layer diffusion. A semi-empirical kinetics equation was obtained to describe the conversion process.%为解决传统次碳酸铋生产过程中成本高和环境污染问题,提出采用液相球磨法由氧化铋制备次碳酸铋的新工艺,研究用碳酸氢氨和氧化铋制备次碳酸铋反应过程的动力学,考察反应温度、氧化铋粒度、液固比以及碳酸氢氨浓度对氧化铋转化率的影响。结果表明,在9~30°C的范围内,升高反应温度、减小氧化铋粉末的粒度、扩大液固比以及提高碳酸氢氨浓度均有利于氧化铋转化率的提高。对反应产物的表征分析表明,产品的纯度较高、杂质少;SEM结果显示产品次碳酸铋主要呈针棒状形态。反应过程受产物层的扩散控制,可用未反应收缩核模型描述,反应的表观活化能为9.783 kJ/mol,同时获得了描述反应过程的半经验动力学方程。

  19. A biokinetic study of {sup 209}Po in man

    Energy Technology Data Exchange (ETDEWEB)

    Henricsson, C.F.; Ranebo, Y. [Department of Medical Radiation Physics, Clinical Sciences in Lund, Lund University, Skane University Hospital in Lund (Sweden); Hansson, M. [Medical Radiation Physics, Department of Clinical Sciences in Malmoe, Lund University, Skane University Hospital in Malmoe (Sweden); Raeaef, C.L., E-mail: Christopher.Raaf@med.lu.se [Medical Radiation Physics, Department of Clinical Sciences in Malmoe, Lund University, Skane University Hospital in Malmoe (Sweden); Holm, E. [Norwegian Radiation Protection Authority, Osteras (Norway)

    2012-10-15

    Five adult volunteers participated in a biokinetic study of radioactive polonium. Portions of about 10 Bq of {sup 209}Po were orally administrated to four of the volunteers in a single ingestion. The fifth volunteer ingested a daily amount of 53 mBq of 209Po for 243 d to study the time to achieve equilibrium between intake and excretion for protracted intakes. For the subjects ingesting single intakes of {sup 209}Po complete sampling of urine and feces was subsequently collected the first few days upon the ingestion. The samples were processed with radiochemical extraction and analyzed with alpha spectrometry. In the study, the maximum daily excretion rates in feces were 18-50% of the ingested activity, observed within 3 d after intake. Regarding the urine excretion, the daily excretion peaked, on average, at 0.15-1% of the ingested activity within two days upon intake. These results indicate an average gastro-intestinal uptake fraction of 0.46 {+-} 0.08, which agrees well with earlier biokinetic studies of polonium in man. -- Highlights: Black-Right-Pointing-Pointer Human metabolism of an oral intake of polonium. Black-Right-Pointing-Pointer 4 individuals were administrated about 10 Bq polonium-209. Black-Right-Pointing-Pointer Gastro-intestinal uptake fraction, if orally administrated polonium-209 was investigated. Black-Right-Pointing-Pointer The biological half-time of polonium in human body was studied.

  20. Genetic variants of CD209 associated with Kawasaki disease susceptibility.

    Directory of Open Access Journals (Sweden)

    Ho-Chang Kuo

    Full Text Available BACKGROUND: Kawasaki disease (KD is a systemic vasculitis with unknown etiology mainly affecting children in Asian countries. Dendritic cell-specific intercellular adhesion molecule-3 grabbing non-integrin (DC-SIGN, CD209 in humans was showed to trigger an anti-inflammatory cascade and associated with KD susceptibility. This study was conducted to investigate the association between genetic polymorphisms of CD209 and the risk KD. METHODS: A total of 948 subjects (381 KD and 567 controls were recruited. Nine tagging SNPs (rs8112310, rs4804800, rs11465421, rs1544766, rs4804801, rs2287886, rs735239, rs735240, rs4804804 were selected for TaqMan allelic discrimination assay. Clinical phenotypes, coronary artery lesions (CAL and intravenous immunoglobulin (IVIG treatment outcomes were collected for analysis. RESULTS: Significant associations were found between CD209 polymorphisms (rs4804800, rs2287886, rs735240 and the risk of KD. Haplotype analysis for CD209 polymorphisms showed that A/A/G haplotype (P = 0.0002, OR = 1.61 and G/A/G haplotype (P = 0.0365, OR = 1.52 had higher risk of KD as compared with G/G/A haplotype in rs2287886/rs735239/rs735240 pairwise allele analysis. There were no significant association in KD with regards to CAL formation and IVIG treatment responses. CONCLUSION: CD209 polymorphisms were responsible for the susceptibility of KD, but not CAL formation and IVIG treatment responsiveness.

  1. Compact and Integrated Liquid Bismuth Propellant Feed System

    Science.gov (United States)

    Polzin, Kurt A.; Stanojev, Boris; Korman, Valentin; Gross, Jeffrey T.

    2007-01-01

    Operation of Hall thrusters with bismuth propellant has been shown to be a promising path toward high-power, high-performance, long-lifetime electric propulsion for spaceflight missions [1]. There has been considerable effort in the past three years aimed at resuscitating this promising technology and validating earlier experimental results indicating the advantages of a bismuth-fed Hall thruster. A critical element of the present effort is the precise metering of propellant to the thruster, since performance cannot be accurately assessed without an accurate accounting of mass flow rate. Earlier work used a pre./post-test propellant weighing scheme that did not provide any real-time measurement of mass flow rate while the thruster was firing, and makes subsequent performance calculations difficult. The motivation of the present work is to develop a precision liquid bismuth Propellant Management System (PMS) that provides hot, molten bismuth to the thruster while simultaneously monitoring in real-time the propellant mass flow rate. The system is a derivative of our previous propellant feed system [2], but the present system represents a more compact design. In addition, all control electronics are integrated into a single unit and designed to reside on a thrust stand and operate in the relevant vacuum environment where the thruster is operating, significantly increasing the present technology readiness level of liquid metal propellant feed systems. The design of various critical components in a bismuth PMS are described. These include the bismuth reservoir and pressurization system, 'hotspot' flow sensor, power system and integrated control system. Particular emphasis is given to selection of the electronics employed in this system and the methods that were used to isolate the power and control systems from the high-temperature portions of the feed system and thruster. Open loop calibration test results from the 'hotspot' flow sensor are reported, and results of

  2. Electrical and optical properties of gadolinium doped bismuth ferrite nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Mukherjee, A., E-mail: soumen.basu@phy.nitdgp.ac.in; Banerjee, M., E-mail: soumen.basu@phy.nitdgp.ac.in; Basu, S., E-mail: soumen.basu@phy.nitdgp.ac.in [Department of Physics, National Institute of Technology, Durgapur-713209 (India); Pal, M. [CSIR-Central Mechanical Engineering Research Institute, Durgapur-713209 (India)

    2014-04-24

    Multiferroic bismuth ferrite (BFO) and gadolinium (Gd) doped bismuth ferrite had been synthesized by a sol-gel method. Particle size had been estimated by Transmission electron microscopy (TEM) and found to decrease with Gd doping. We studied the temperature and frequency dependence of impedance and electric modulus and calculated the grain and grain boundary resistance and capacitance of the investigated samples. We observed that electrical activation energy increases for all the doped samples. Optical band gap also increases for the doped samples which can be used in photocatalytic application of BFO.

  3. Microscopic and voltammetric properties of lustrous bismuth deposits

    OpenAIRE

    Krolicka, Agnieszka; Bobrowski, Andrzej; Pamuła, Elżbieta

    2010-01-01

    A comparison of lustrous bismuth films, plated at glassy carbon, platinum and gold supports, is presented. The voltammetric performance of preplated bismuth film electrodes was tested using 50 μg/L In(III) and 50 μg/L Pb(II) solutions in 0.1 M acetic buffer in square wave and differential pulse modes. The influence of support material, plating solution concentration and storing conditions on the voltammetric response of BiFEs is discussed. The results of microscopic examination...

  4. The continuum shell-model neutron states of 209Pb

    Indian Academy of Sciences (India)

    Ramendra Nath Majumdar

    2003-12-01

    The neutron strength distributions of the three high-spin 117/2, 2ℎ11/2 and 113/2 states of 209Pb have been obtained within the formalism of the core-polarisation effect where the effect of interaction of the neutron shell-model states of 209Pb with the collective vibrational states (originating also from the giant resonances) have been taken into consideration. The theoretical results have been discussed in the light of works on 117/2, 2ℎ11/2 and 113/2 neutron orbitals of 209Pb. The shell-model energies of the neutron states have been obtained by Skyrme–Hartree–Fock method.

  5. Hydrolysis studies on bismuth nitrate: synthesis and crystallization of four novel polynuclear basic bismuth nitrates.

    Science.gov (United States)

    Miersch, L; Rüffer, T; Schlesinger, M; Lang, H; Mehring, M

    2012-09-03

    Hydrolysis of Bi(NO(3))(3) in aqueous solution gave crystals of the novel compounds [Bi(6)O(4)(OH)(4)(NO(3))(5)(H(2)O)](NO(3)) (1) and [Bi(6)O(4)(OH)(4)(NO(3))(6)(H(2)O)(2)]·H(2)O (2) among the series of hexanuclear bismuth oxido nitrates. Compounds 1 and 2 both crystallize in the monoclinic space group P2(1)/n but show significant differences in their lattice parameters: 1, a = 9.2516(6) Å, b = 13.4298(9) Å, c = 17.8471(14) Å, β = 94.531(6)°, V = 2210.5(3) Å(3); 2, a = 9.0149(3) Å, b = 16.9298(4) Å, c = 15.6864(4) Å, β = 90.129(3)°, V = 2394.06(12) Å(3). Variation of the conditions for partial hydrolysis of Bi(NO(3))(3) gave bismuth oxido nitrates of even higher nuclearity, [{Bi(38)O(45)(NO(3))(24)(DMSO)(26)}·4DMSO][{Bi(38)O(45)(NO(3))(24)(DMSO)(24)}·4DMSO] (3) and [{Bi(38)O(45)(NO(3))(24)(DMSO)(26)}·2DMSO][{Bi(38)O(45)(NO(3))(24)(DMSO)(24)}·0.5DMSO] (5), upon crystallization from DMSO. Bismuth oxido clusters 3 and 5 crystallize in the triclinic space group P1 both with two crystallographically independent molecules in the asymmetric unit. The following lattice parameters are observed: 3, a = 20.3804(10) Å, b = 20.3871(9) Å, c = 34.9715(15) Å, α = 76.657(4)°, β = 73.479(4)°, γ = 60.228(5)°, V = 12021.7(9) Å(3); 5, a = 20.0329(4) Å, b = 20.0601(4) Å, c = 34.3532(6) Å, α = 90.196(1)°, β = 91.344(2)°, γ = 119.370(2)°, V = 12025.8(4) Å(3). Differences in the number of DMSO molecules (coordinated and noncoordinated) and ligand (nitrate, DMSO) coordination modes are observed.

  6. Bismuth centred magnetic perovskite: A projected multiferroic

    Energy Technology Data Exchange (ETDEWEB)

    Kundu, Asish K., E-mail: asish.k@gmail.com [Discipline of Physics, Indian Institute of Information Technology, Design and Manufacturing, Dumna Airport Road, Jabalpur 482005 (India); Seikh, Md. Motin [Department of Chemistry, Visva-Bharati University, Santiniketan, West Bengal 731235 (India); Nautiyal, Pranjal [Discipline of Mechanical Engineering, Indian Institute of Information Technology, Design and Manufacturing, Dumna Airport Road, Jabalpur 482005 (India)

    2015-03-15

    In recent time substantial attention has been initiated to understand the physics behind multiferroism and to design new multiferroic materials. BiMnO{sub 3} and BiFeO{sub 3} are the well-studied Bi-centred multiferroic oxides. BiMnO{sub 3} is a ferromagnetic–ferroelectric (metastable) phase and require drastic conditions to synthesize. However, lanthanum substituted BiMnO{sub 3} phases stabilized at ambient pressure. It is thus of major importance to increase the number of ferromagnetic perovskites with Bi cations that could be designed under ambient conditions. In this article, we have presented an up to date report of investigations on Bi-centred magnetic perovskites, a prospective material for multiferroic application. Central focus is concentrated on La{sub 0.5}Bi{sub 0.5}MnO{sub 3} perovskite with various substitutions at different levels. A few of these perovskites are found to be of practical importance e.g. La{sub 0.5}Bi{sub 0.5}Mn{sub 0.67}Co{sub 0.33}O{sub 3} with high dielectric permittivity coupled with ferromagnetism. A comprehensive analysis of different physical functionalities and their interrelation for a wide range of compositions of these Bi-centred perovskites is presented. It has been found that the complex magnetic behaviour originates from mixed valence metal ions. The ferroelectricity is associated with the 6s{sup 2} lone pair of Bi{sup 3+} cations. The magnetic ground state influences the dielectric properties reflecting the multiferroism in a single material. - Highlights: • Multiferroics have attracted increasing attention due to their possible device applications. • Bismuth centred magnetic perovskite is one kind of such promising multiferroic materials. • Ferromagnetic Bi-perovskites, which are synthesized at ambient conditions, have been discussed.

  7. Dicty_cDB: VSG209 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSG209 (Link to dictyBase) - G21421 DDB0185383 Contig-U12508-1...ary VS (Link to library) Clone ID VSG209 (Link to dictyBase) Atlas ID - NBRP ID G21421 dictyBase ID DDB01853...83 Link to Contig Contig-U12508-1 | Contig-U15943-1 Original site URL http://dict...Frames) Frame A: VDSNLSISQILKQICTKYKIEGSERFSIITTEEFPLILNENSTLGHYGLGNKFQTLELSI VFTELIPPYSLKNNNVPTFGAFQVGSVDPV...ces producing significant alignments: (bits) Value N AC114263 |AC114263.2 Dictyostelium discoideum chromosom

  8. Ultrafast electronic dynamics in laser-excited crystalline bismuth

    Directory of Open Access Journals (Sweden)

    Chekalin S.

    2013-03-01

    Full Text Available Femtosecond spectroscopy was applied to capture complex dynamics of non equilibrium electrons in bismuth. Data analysis reveals significant wavevector dependence of electron-hole and electron-phonon coupling strength along the Γ-T direction of the Brillouin zone

  9. REMOVAL OF CERTAIN FISSION PRODUCT METALS FROM LIQUID BISMUTH COMPOSITIONS

    Science.gov (United States)

    Dwyer, O.E.; Howe, H.E.; Avrutik, E.R.

    1959-11-24

    A method is described for purifying a solution of urarium in liquid bismuth containing at least one metal from the group consisting of selenium, tellurium, palladium, ruthenium, rhodium, niobium, and zirconium. The solution is contacted with zinc in an inert atmosphere to form a homogeneous melt, a solid zinc phase is formed, and the zinc phase containing the metal is separated from the melt.

  10. Polymeric architectures of bismuth citrate based on dimeric building blocks

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    Four bismuth complexes, (H2En)[Bi2(cit)2(H2O)4/3]·(H2O)x (1), (H2En)3[Bi2(cit)2Cl4]·(H2O)x (2), (HPy)2[Bi2(cit)2(H2O)8/5]·(H2O)x (3) and (H2En)[Bi2(cit)2](H2O)x (4) [cit = citrate4-; En = ethylenediamine; Py = pyridine] have been synthesized and crystallized. The crystal structures reveal that the basic building blocks in all of these complexes are bismuth citrate dimeric units which combine to form polymeric architectures. The embedded protonated ethylenediamine and pyridine moieties in the polymeric frameworks have been identified by X-ray crystallography and solid-state cross polarization/magic angle spinning (CP/MAS) 13C NMR. Based on the framework of complex 1, a structural model of a clinically used antiulcer drug, ranitidine bismuth citrate (RBC) was generated. The behavior of the protonated amine-bismuth citrate complexes in acidic aqueous solution has been studied by electrospray ionization-mass spectrometry (ESI-MS).

  11. Oxygen semi-permeability of erbia-stabilized bismuth oxide

    NARCIS (Netherlands)

    Bouwmeester, H.J.M.; Kruidhof, H.; Burggraaf, A.J.; Gellings, P.J.

    1992-01-01

    The isothermal permeability of oxygen through sintered dense disks of bismuth oxide stabilized with 25 mol% erbia (BE25) has been studied at 610–810°C and oxygen pressures of 0.0001–1 atm. It is concluded that the permeating flux is rate limited both by solid state diffusion of electron holes and by

  12. Light-Induced Absorption in Nominally Pure Bismuth Silicon Oxide

    Institute of Scientific and Technical Information of China (English)

    李飞飞; 许京军; 孔勇发; 黄辉; 张光寅; 杨春晖; 徐玉恒

    2001-01-01

    Light-induced absorption in the nominally pure bismuth silicon oxide is investigated experimentally and the result shows that it consists of transient and persistent parts. The experimental evidence is analysed based on the model of three groups of trap (donor) centres.

  13. Bismuth-lead oxide, a new highly conductive oxygen materials

    NARCIS (Netherlands)

    Honnart, F.; Boivin, J.C.; Thomas, D.; Vries, de K.J.

    1983-01-01

    The transport properties of an oxygen-deficient solid solution containing lead and bismuth oxides have been investigated. The conductivity is larger than 1 (ω× cm)−1 at 600 °C. Thermogalvanic measurements confirm that no significant electronic contribution occurs in the range 1–10−3atm p O2. The hea

  14. High ionic conductivity in confined bismuth oxide-based heterostructures

    DEFF Research Database (Denmark)

    Sanna, Simone; Esposito, Vincenzo; Christensen, Mogens

    2016-01-01

    Bismuth trioxide in the cubic fluorite phase (δ-Bi2O3) exhibits the highest oxygen ionic conductivity. In this study, we were able to stabilize the pure -Bi2O3 at low temperature with no addition of stabilizer but only by engineering the interface, using highly coherent heterostructures made...

  15. Ultrafast electron diffraction studies of optically excited thin bismuth films

    Energy Technology Data Exchange (ETDEWEB)

    Rajkovic, Ivan

    2008-10-21

    This thesis contains work on the design and the realization of an experimental setup capable of providing sub-picosecond electron pulses for ultrafast electron diffraction experiments, and performing the study of ultrafast dynamics in bismuth after optical excitation using this setup. (orig.)

  16. Phase transition of bismuth telluride thin films grown by MBE

    DEFF Research Database (Denmark)

    Fülöp, Attila; Song, Yuxin; Charpentier, Sophie

    2014-01-01

    A previously unreported phase transition between Bi2Te3 and Bi4Te3 in bismuth telluride grown by molecular beam epitaxy is recorded via XRD, AFM, and SIMS observations. This transition is found to be related to the Te/Bi beam equivalent pressure (BEP) ratio. BEP ratios below 17 favor the formation...

  17. Bismuth-based oxide semiconductors: Mild synthesis and practical applications

    Science.gov (United States)

    Timmaji, Hari Krishna

    In this dissertation study, bismuth based oxide semiconductors were prepared using 'mild' synthesis techniques---electrodeposition and solution combustion synthesis. Potential environmental remediation and solar energy applications of the prepared oxides were evaluated. Bismuth vanadate (BiVO4) was prepared by electrodeposition and solution combustion synthesis. A two step electrosynthesis strategy was developed and demonstrated for the first time. In the first step, a Bi film was first electrodeposited on a Pt substrate from an acidic BiCl3 medium. Then, this film was anodically stripped in a medium containing hydrolyzed vanadium precursor, to generate Bi3+, and subsequent BiVO4 formation by in situ precipitation. The photoelectrochemical data were consistent with the in situ formation of n-type semiconductor films. In the solution combustion synthesis procedure, BiVO4 powders were prepared using bismuth nitrate pentahydrate as the bismuth precursor and either vanadium chloride or vanadium oxysulfate as the vanadium precursor. Urea, glycine, or citric acid was used as the fuel. The effect of the vanadium precursor on the photocatalytic activity of combustion synthesized BiVO 4 was evaluated in this study. Methyl orange was used as a probe to test the photocatalytic attributes of the combustion synthesized (CS) samples, and benchmarked against a commercial bismuth vanadate sample. The CS samples showed superior activity to the commercial benchmark sample, and samples derived from vanadium chloride were superior to vanadium oxysulfate counterparts. The photoelectrochemical properties of the various CS samples were also studied and these samples were shown to be useful both for environmental photocatalytic remediation and water photooxidation applications. Silver bismuth tungstate (AgBiW2O8) nanoparticles were prepared for the first time by solution combustion synthesis by using silver nitrate, bismuth nitrate, sodium tungstate as precursors for Ag, Bi, and W

  18. Photoelectroactivity of bismuth vanadate prepared by combustion synthesis: effect of different fuels and surfactants

    Energy Technology Data Exchange (ETDEWEB)

    Afonso, Renata; Serafim, Jessica A.; Lucilha, Adriana C.; Dall' Antonia, Luiz H., E-mail: luizh@uel.br [Universidade Estadual de Londrina (UEL), PR (Brazil). Dept. Quimica. Lab. de Eletroquimica e Materiais; Silva, Marcelo R. [Universidade Estadual Paulista Julio de Mesquita Filho (CTI/UNESP), Bauru, SP (Brazil). Colegio Tecnico Industrial; Lepre, Luiz F.; Ando, Romulo A. [Universidade de Sao Paulo (USP), SP (Brazil). Inst. de Quimica. Lab. de Espectroscopia Molecular

    2014-04-15

    The bismuth vanadate (BiVO{sub 4}) is a semiconductor that has attracted much attention due to the photocatalytic efficiency in the visible light region. The objective of this work was to synthesize monoclinic BiVO{sub 4} by solution combustion synthesis, with different surfactants and fuels and apply it as photoelectrodes. The characterization by infrared spectroscopy and Raman spectroscopy showed that all samples showed characteristic bands of the monoclinic structure BiVO{sub 4}. The samples synthesized with glycine and glycine/Tween® 80 had V{sub 2}O{sub 5}. The film obtained from the alanine/ Tween® 80 showed highest photocurrent values, which may be related to smaller size particles (200 to 300 nm) observed by scanning electron microscopy images. The films obtained using alanine showed highest values of rate constant reaction and percentage discoloration of methylene blue. (author)

  19. Bismuth Substituted Yttrium Iron Garnet Single Crystal Films Prepared by Sol-gel Method

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Magneto-optic Faraday rotation effect and the amount of bismuth substituted in yttrium iron garnet single crystal films prepared by gel-coating on modified gadolinium-gallium garnet substrates are investigated, where the gel is synthesized by a sol-gel reaction of nitrates and ethylene glycol. The coated gel is annealed in air at temperatures up to 660℃ for 4h, which is about 300℃ lower than that of liquid-phase epitaxy. The maximum amount of Bi substitution is x=2.7 and the crystallization temperature of garnet phase decreases with the increase of x down to 520℃ for x=2.7. In this film, a huge Faraday rotation of -8.1×104 (°)/cm at λ=0.633μm is obtained.

  20. Preparation of nanometer δ-and β-bismuth trioxide by vacuum vapor-phase oxidation

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    A stable δ- and β-bismuth trioxide was prepared at room temperature by vacuum vapor-phase oxidation. The average crystal size of products was 14.6 nm (by XRD), the d(0.5) value was in the range from 62 nm to 69 nm, and geometric standard deviation(GSD)was from 1.42 to 1.64. The results show that δ-Bi2O3 is formed when quenching rates is rapid and β-Bi2O3 is formed when it is slow. The size of grains increases with rising reaction temperature, flow rate of carrier gas, residual pressure of system and longer growing time of grains.

  1. 40 CFR 209.2 - Use of number and gender.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Use of number and gender. 209.2... gender. In these rules of practice, words in the singular number apply to the plural and words in the masculine gender apply to the feminine and vice versa....

  2. 18 CFR 706.209 - Gambling, betting, and lotteries.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Gambling, betting, and... EMPLOYEE RESPONSIBILITIES AND CONDUCT Conduct and Responsibilities of Employees § 706.209 Gambling, betting... while on duty for the Government, in any gambling activity, including the operation of a gambling...

  3. 20 CFR 725.209 - Determination of dependency; child.

    Science.gov (United States)

    2010-04-01

    ... FEDERAL MINE SAFETY AND HEALTH ACT, AS AMENDED Persons Entitled to Benefits, Conditions, and Duration of Entitlement Conditions and Duration of Entitlement: Miner's Dependents (augmented Benefits) § 725.209... directly supported by the United States, or by a State or local government or political subdivision...

  4. 40 CFR 209.18 - Administrative law judge.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Administrative law judge. 209.18... law judge. (a) General. The administrative law judge shall conduct a fair and impartial hearing in... form whenever in the opinion of the administrative law judge oral testimony is not necessary for...

  5. 14 CFR 145.209 - Repair station manual contents.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Repair station manual contents. 145.209... manual contents. A certificated repair station's manual must include the following: (a) An organizational... for revising the repair station's manual and notifying its certificate holding district office...

  6. 48 CFR 1552.209-76 - Contractor performance evaluations.

    Science.gov (United States)

    2010-10-01

    ... 1552.209-76 Contractor performance evaluations. As prescribed in section 1509.170-1, insert the following clause in all applicable solicitations and contracts. Contractor Performance Evaluations (OCT 2002... compliance with safety standards performance categories if deemed appropriate for the evaluation or...

  7. 41 CFR 101-29.209 - Purchase description.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Purchase description. 101... DESCRIPTIONS 29.2-Definitions § 101-29.209 Purchase description. A purchase description is any informal product description prepared for one-time use only or for small purchases when issuance of a formal...

  8. 44 CFR 209.3 - Roles and responsibilities.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Roles and responsibilities... ASSISTANCE § 209.3 Roles and responsibilities. The following describes the general roles of FEMA, the State... apply directly to us, they will be the grantee and carry out “state” roles. (c) Applicant...

  9. 7 CFR 1160.209 - Duties of the Board.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Milk), DEPARTMENT OF AGRICULTURE FLUID MILK PROMOTION PROGRAM Fluid Milk Promotion Order National Fluid Milk Processor Promotion Board § 1160.209 Duties of the Board. The Board shall...

  10. 48 CFR 1553.209-70 - EPA Form 1900-26, Contracting Officer's Evaluation of Contractor Performance.

    Science.gov (United States)

    2010-10-01

    ..., Contracting Officer's Evaluation of Contractor Performance. 1553.209-70 Section 1553.209-70 Federal... 1553.209-70 EPA Form 1900-26, Contracting Officer's Evaluation of Contractor Performance. As prescribed... evaluation of Contractor performance....

  11. Reduction smelting on bismuth oxide residue in FeO-SiO2-CaO ternary slag system

    Institute of Scientific and Technical Information of China (English)

    张杜超; 张新望; 杨天足; 剑锋; 刘伟锋; 陈霖; 饶帅; 肖庆凯; 郝占东

    2016-01-01

    Reduction smelting of the bismuth oxide residue from pressure leaching of bismuth sulfide was investigated in the FeO−SiO2−CaO ternary slag system. The results show that all the recovery ratios of Bi, Ag, Cu and Pb increase with the increase of reductive coal proportion, reaction temperature and time, while too much reductive coal would help Fe enter metal phase;CaO/SiO2 and FeO/SiO2 of the chosen slag system should be 0.5−0.75 and 1.25−1.75, respectively, for the reason that the slag system has the optimum mobility and is beneficial for the recovery of metals. The corresponding optimum conditions are determined as follows:the added coal proportion is 7%of the leaching residue, CaO/SiO2 mass ratio in the chosen slag system is 0.5 and FeO/SiO2 is 1.5, the reaction temperature is 1300 °C and the reaction time is 40 min. Under the above conditions, the recovery ratios of Bi, Ag, Cu and Pb are 99.6%, 99.8%, 97.0%and 97.3%, respectively.

  12. Determining the background levels of bismuth in tissues of wild game birds: a first step in addressing the environmental consequences of using bismuth shotshells

    Energy Technology Data Exchange (ETDEWEB)

    Jayasinghe, R.; Tsuji, L.J.S.; Gough, W.A.; Karagatzides, J.D.; Perera, D.; Nieboer, E

    2004-11-01

    Bismuth shotshells have been approved as a 'nontoxic' alternative to lead in North America. Approval was based on a limited number of studies; even background levels of bismuth in wildfowl were unknown. We report on the concentration of bismuth (and lead) in muscle and liver tissues of wildfowl (Anas platyrhynchos, Anas acuta, Anas crecca, Branta canadensis, Chen caerulescens) harvested with lead shotshell. Average liver-bismuth levels detected in the present study (e.g., teal, 0.05 {mu}g/g dw; mallard, 0.09 {mu}g/g dw) suggest analytical error in other studies examining the effects of bismuth in birds. Significant positive relationships between bismuth- and lead-tissue levels for muscle when all species were combined (and for B. canadensis and C. caerulescens separately) can be explained by noting that bismuth is a contaminant of lead. Thus, more research is recommended to confirm the appropriateness of bismuth as a 'nontoxic' shot alternative.

  13. 48 CFR 836.209 - Construction contracts with architect-engineer firms.

    Science.gov (United States)

    2010-10-01

    ... with architect-engineer firms. 836.209 Section 836.209 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS SPECIAL CATEGORIES OF CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Special Aspects of Contracting for Construction 836.209 Construction contracts with...

  14. 48 CFR 1536.209 - Construction contracts with architect-engineer firms.

    Science.gov (United States)

    2010-10-01

    ... architect-engineer firms. 1536.209 Section 1536.209 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY SPECIAL CATEGORIES OF CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Special Aspects of Contracting for Construction 1536.209 Construction contracts with architect-engineer firms....

  15. 48 CFR 1436.209 - Construction contracts with architect-engineer firms.

    Science.gov (United States)

    2010-10-01

    ... with architect-engineer firms. 1436.209 Section 1436.209 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR SPECIAL CATEGORIES OF CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Special Aspects of Contracting for Construction 1436.209 Construction contracts with...

  16. 48 CFR 436.209 - Construction contracts with architect-engineer firms.

    Science.gov (United States)

    2010-10-01

    ... with architect-engineer firms. 436.209 Section 436.209 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE SPECIAL CATEGORIES OF CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Special Aspects of Contracting for Construction 436.209 Construction contracts with...

  17. 48 CFR 2936.209 - Construction contracts with architect-engineer firms.

    Science.gov (United States)

    2010-10-01

    ... with architect-engineer firms. 2936.209 Section 2936.209 Federal Acquisition Regulations System DEPARTMENT OF LABOR GENERAL CONTRACTING REQUIREMENTS CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Special Aspects of Contracting for Construction 2936.209 Construction contracts with architect-engineer firms....

  18. 48 CFR 36.209 - Construction contracts with architect-engineer firms.

    Science.gov (United States)

    2010-10-01

    ... with architect-engineer firms. 36.209 Section 36.209 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SPECIAL CATEGORIES OF CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Special Aspects of Contracting for Construction 36.209 Construction contracts with architect-engineer firms....

  19. 48 CFR 636.209 - Construction contracts with architect-engineer firms.

    Science.gov (United States)

    2010-10-01

    ... with architect-engineer firms. 636.209 Section 636.209 Federal Acquisition Regulations System DEPARTMENT OF STATE SPECIAL CATEGORIES OF CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Special Aspects of Contracting for Construction 636.209 Construction contracts with architect-engineer firms....

  20. 48 CFR 209.470 - Reserve Officer Training Corps and military recruiting on campus.

    Science.gov (United States)

    2010-10-01

    ... QUALIFICATIONS Debarment, Suspension, and Ineligibility 209.470 Reserve Officer Training Corps and military... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Reserve Officer Training Corps and military recruiting on campus. 209.470 Section 209.470 Federal Acquisition Regulations...

  1. 12 CFR 209.2 - Banks desiring to become member banks.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Banks desiring to become member banks. 209.2 Section 209.2 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM ISSUE AND CANCELLATION OF FEDERAL RESERVE BANK CAPITAL STOCK (REGULATION I) § 209.2 Banks desiring...

  2. 8 CFR 209.2 - Adjustment of status of alien granted asylum.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of status of alien granted asylum. 209.2 Section 209.2 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS OF REFUGEES AND ALIENS GRANTED ASYLUM § 209.2 Adjustment of status of...

  3. 47 CFR 54.209 - Annual reporting requirements for designated eligible telecommunications carriers.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Annual reporting requirements for designated eligible telecommunications carriers. 54.209 Section 54.209 Telecommunication FEDERAL COMMUNICATIONS... Service Support § 54.209 Annual reporting requirements for designated eligible telecommunications...

  4. Operating Practice for Recovering Bismuth from Bismuth Dross%从铋渣中回收铋的生产实践

    Institute of Scientific and Technical Information of China (English)

    刘金铭

    2015-01-01

    阐述了从处理铅阳极泥时产生的铋渣中回收铋的生产实践,采用湿法浸出→氯氧铋→热浓碱转型→氧化铋→还原熔炼→火法精炼的生产工艺,为铋渣的处理提供了新的途径。%This paper expounds operating practice for recovering bismuth from bismuth dross that were outputed during dealing with the lead anode mud in pyrometallurgical process,which uesd production process of leaching—bismuth oxychloride—transformation—bismuth oxide—reduction smelting—pyrometallurgical refining.The operating practice provided a new technology to process the bismuth dross.

  5. Dechlorination of Zinc Sulfate Solution by Bismuth Oxide%氧化铋法从硫酸锌溶液中除氯的研究

    Institute of Scientific and Technical Information of China (English)

    封志敏; 宁顺明; 王文娟; 佘宗华; 万洪强; 吴江华

    2015-01-01

    Processing parameters for dechlorination of zinc sulfate solution by bismuth oxide were investigated, and the results show that dechlorination can be accomplished after 2 h reaction in a pulp with pH value of 2. 0 at 50 ℃ by bismuth oxide with weight 1. 5 times the theoretically calculated dosage. The chlorine concentration can be reduced to 0.28 g/L with the residue bismuth concentration at 0.96 mg/L. The conversion conditions of bismuth oxychloride were also studied and optimized as follows: initial alkali concentration at 1 mol/L, twofold calculated NaOH dosage, 4 h reaction at room temperature, with which, good conversion effect can be achieved as the conversion rate amounted to 93.97% with the residue bismuth concentration around 2.35 mg/L. A six⁃period commercial test was conducted, leading to results consistent with that from laboratory tests. This processing technique is easy to operate, with which chlorine concentration in zinc sulfate solution can be effectively reduced with less loss of bismuth.%以硫酸锌溶液为研究对象,研究了氧化铋脱除硫酸锌溶液中氯的工艺条件,结果表明,较佳的工艺条件为:pH值约2.0,50℃,氧化铋用量为理论计算值的1.5倍,反应时间2 h,此条件下除氯后溶液中Cl含量为0.28 g/L,Bi含量为0.96 mg/L。同时研究了氯氧铋转化的工艺参数条件,较佳的工艺条件为:NaOH用量为计算值2倍当量,初始碱浓度1 mol/L,反应时间4 h,常温,在此条件下可达到转化率93.97%、余铋浓度约2.35 mg/L的较好转化效果。进行了6周期工业实验,与模似实验结果重现性好。本工艺操作简单,能有效降低硫酸锌溶液中氯的浓度,且铋损失较小。

  6. Dielectric spectra of bismuth vanadate Bi4V2O11

    Energy Technology Data Exchange (ETDEWEB)

    Borisov, V.N.; Pashkov, V.M.; Poplavko, IU.M.; Avakian, P.B.; Osipian, V.G. (Kievskii Politekhnicheskii Institut, Kiev (Ukrainian SSR))

    1990-06-01

    Results of a study of the temperature-frequency dependence of the behavior of the dielectric parameters of bismuth vanadate, Bi4V2O11, in the frequency range 1-100 GHz are reported. It is shown that bismuth vanadate is characterized by a large number of phase transitions. Yet another, previously unknown, phase transition in bismuth vanadate, masked by a relaxation process, has been observed in the temperature range 410-420 K. 12 refs.

  7. Dielectric spectra of bismuth vanadate Bi4V2O11

    Science.gov (United States)

    Borisov, V. N.; Pashkov, V. M.; Poplavko, Iu. M.; Avakian, P. B.; Osipian, V. G.

    1990-06-01

    Results of a study of the temperature-frequency dependence of the behavior of the dielectric parameters of bismuth vanadate, Bi4V2O11, in the frequency range 1-100 GHz are reported. It is shown that bismuth vanadate is characterized by a large number of phase transitions. Yet another, previously unknown, phase transition in bismuth vanadate, masked by a relaxation process, has been observed in the temperature range 410-420 K.

  8. Focused ion beam processing to fabricate ohmic contact electrodes on a bismuth nanowire for Hall measurements

    OpenAIRE

    Murata, Masayuki; Hasegawa, Yasuhiro

    2013-01-01

    Ohmic contact electrodes for four-wire resistance and Hall measurements were fabricated on an individual single-crystal bismuth nanowire encapsulated in a cylindrical quartz template. Focused ion beam processing was utilized to expose the side surfaces of the bismuth nanowire in the template, and carbon and tungsten electrodes were deposited on the bismuth nanowire in situ to achieve electrical contacts. The temperature dependence of the four-wire resistance was successfully measured for the ...

  9. Standard triple, bismuth pectin quadruple and sequential therapies for Helicobacter pylori eradication

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    AIM: To compare the effectiveness of standard triple, bismuth pectin quadruple and sequential therapies for Helicobacter pylori (H. pylori ) eradication in a randomized, double-blinded, comparative clinical trial in China. METHODS: A total of 215 H. pylori -positive patients were enrolled in the study and randomly allocated into three groups: group A (n = 72) received a 10-d bismuth pectin quadruple therapy (20 mg rabeprazole bid , 1000 mg amoxicillin bid , 100 mg bismuth pectin qid , and 500 mg levofloxaci...

  10. Bismuth-Induced Raman Modes in GaP1-xBix

    Energy Technology Data Exchange (ETDEWEB)

    Christian, Theresa M.; Fluegel, Brian; Beaton, Daniel A.; Alberi, Kirstin; Mascarenhas, Angelo

    2016-10-01

    Dilute bismide semiconductor alloys are a promising material platform for optoelectronic devices due to drastic impacts of bismuth on the electronic structure of the alloy. At the same time, the details of bismuth incorporation in the lattice are not fully understood. In this work, we conduct Raman scattering spectroscopy on GaP1- x Bi x epilayers grown by molecular beam epitaxy (MBE) and identify several bismuth-related Raman features including gap vibration modes at 296, 303, and 314 cm-1. This study paves the way for more detailed analysis of the local symmetry at bismuth incorporation sites in the dilute bismide alloy regime.

  11. Antibacterial effects of Bismuth compounds and it synergy with Tetracycline and Metronidazole on Helicobacter Pylori

    Directory of Open Access Journals (Sweden)

    Rajabie A

    1997-04-01

    Full Text Available Bismuth salts and different antimicrobials including Metonidazole & Tetracyclines were used in the assessment of inhibition zone of Helicobacter pylori cultures on solid media. Antibiotics were used or in combined in order to find out their possible synergistic effects. It was showed that: only Bismuth substrate and not then salts have antibacterial effects on Helicobacter pylori and also on the other bacteria such as staphylococci; salmonella and brulla. In addition, only Bismuth substrances showed remarkable synergistic effects with antimicrobial drugs against Helicobacter pylori. Therefore the data obtained from this investigation confirm previously known effect of combination antibiotic therapy including Bismuth compounds in eradicating Helicobacter pylori.

  12. Elimination of the beam effect on channeling dips of bismuth implanted in silicon

    Science.gov (United States)

    Wagh, A. G.; Radhakrishnan, S.; Gaonkar, S. G.; Kansara, M. J.

    1980-01-01

    The effect of the analysing He + ion beam has been eliminated from channeling measurements on Si(Bi) by extrapolating the plot of normalised yield against He + dose to zero ion dose. The magnitude of the beam effect varies with the angle of incidence, being minimum for beam incidence along the crystallographic axis. The axial channeling dips thus obtained exhibit similar minimum yields for bismuth and silicon. The bismuth dips are, however, narrower than for silicon. The planar channeling experiments, on the other hand, yield nearly identical bismuth and silicon dips. The results indicate that the bismuth atom occupies the substitutional site in silicon, but the lattice is strained in its vicinity.

  13. Preparation of high-purity bismuth by sulphur deleadization in vacuum distillation

    Institute of Scientific and Technical Information of China (English)

    熊利芝; 何则强; 刘文萍; 麻成金; 戴永年

    2004-01-01

    The feasibility of separation of impurities in refined bismuth and sulphur deleadization with vacuum distillation was studied theoretically. Experimental studies on sulphur deleadization were carried out under vacuum.The influences of amount of sulphur, distillation temperature, vacuum degree and distillation time on deleadization were investigated and an optimal technical condition was achieved. The content of lead in refined bismuth can be decreased from 30 μg/g to 0.21 μg/g, which has reached the level of "5N" high-purity bismuth. Other impurities in refined bismuth can be also removed effectively under certain conditions.

  14. Nanophotonic Modulator with Bismuth Ferrite as Low-loss Switchable Material

    DEFF Research Database (Denmark)

    Babicheva, Viktoriia; Zhukovsky, Sergei; Lavrinenko, Andrei

    2015-01-01

    We propose a nanophotonic waveguide modulator with bismuth ferrite as a tunable material. Due to near-zero losses in bismuth ferrite, modulation with up to 20 dB/μm extinction ratio and 12 μm propagation length is achieved.......We propose a nanophotonic waveguide modulator with bismuth ferrite as a tunable material. Due to near-zero losses in bismuth ferrite, modulation with up to 20 dB/μm extinction ratio and 12 μm propagation length is achieved....

  15. Bismuth-induced Raman modes in GaP1- x Bi x

    Science.gov (United States)

    Christian, Theresa M.; Fluegel, Brian; Beaton, Daniel A.; Alberi, Kirstin; Mascarenhas, Angelo

    2016-10-01

    Dilute bismide semiconductor alloys are a promising material platform for optoelectronic devices due to drastic impacts of bismuth on the electronic structure of the alloy. At the same time, the details of bismuth incorporation in the lattice are not fully understood. In this work, we conduct Raman scattering spectroscopy on GaP1- x Bi x epilayers grown by molecular beam epitaxy (MBE) and identify several bismuth-related Raman features including gap vibration modes at 296, 303, and 314 cm-1. This study paves the way for more detailed analysis of the local symmetry at bismuth incorporation sites in the dilute bismide alloy regime.

  16. Optimal biliary drainage for inoperable Klatskin's tumor based on Bismuth type

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    AIM: To investigate differences in the effects of biliary drainage procedures in patients with inoperable Klatskin's tumor based on Bismuth type, considering endoscopic retrograde biliary drainage (ERBD), external percutaneous transhepatic biliary drainage (EPTBD) and internal biliary stenting via the PTBD tract (IPTBD).METHODS: The initial success rate, cumulative patency rate, and complication rate were compared retrospectively, according to the Bismuth type and ERBD,EPTBD, and IPTBD. Patency was defined as the duration for adequate initial bile drainage or to the point of the patient's death associated with inadequate drainage.RESULTS: One hundred thirty-four patients (93 men,41 women; 21 Bismuth type Ⅱ, 47 Ⅲ, 66 Ⅳ; 34 ERBD,66 EPTBD, 34 IPTBD) were recruited. There were no differences in demographics among the groups.Adequate initial relief of jaundice was achieved in 91% of patients without a significant difference in the results among different procedures or Bismuth types. The cumulative patency rates for ERBD and IPTBD were better than those for EPTBD with Bismuth type Ⅲ.IPTBD provided an excellent response for Bismuth type Ⅳ. However, there was no difference in the patency rate among drainage procedures for Bismuth type Ⅱ.Procedure-related cholangitis occurred less frequently with EPTBD than with ERBD and IPTBD.CONCLUSION: ERBD is recommended as the firstline drainage procedure for the palliation of jaundice in patients with inoperable Klatskin's tumor of Bismuth type Ⅱ or Ⅲ, but IPTBD is the best option for Bismuth type Ⅳ.

  17. Bismuth Ferrite for Active Control of Surface Plasmon Polariton Modes

    DEFF Research Database (Denmark)

    Babicheva, Viktoriia; Zhukovsky, Sergei; Lavrinenko, Andrei

    2014-01-01

    We propose and investigate several layouts of m etal-insulator-metal waveguide with active core which can be utilized for dynamic switching in photonic integrated circuits. The active material, bismuth ferrite (BiFeO3), is sandwiched between metal plates and changes i ts refractive index through ...... partial switching of ferroelectric domain orientati on under applied voltage. Both phase and amplitude modulations are envisaged.......We propose and investigate several layouts of m etal-insulator-metal waveguide with active core which can be utilized for dynamic switching in photonic integrated circuits. The active material, bismuth ferrite (BiFeO3), is sandwiched between metal plates and changes i ts refractive index through...

  18. Large area bismuth absorbers for X-ray microcalorimeters

    Energy Technology Data Exchange (ETDEWEB)

    Vaillancourt, J.E. E-mail: vaillancourt@wisp.physics.wisc.edu; Allen, C.A.; Brekosky, R.; Dosaj, A.; Galeazzi, M.; Kelley, R.; Liu, D.; McCammon, D.; Porter, F.S.; Rocks, L.E.; Sanders, W.T.; Stahle, C.K

    2004-03-11

    Two challenges facing the use of large area (2 mmx2 mm) bismuth absorbers for microcalorimetry are uncertainties in the heat capacity of bismuth and the effects of lateral heat conduction and position dependence due to the absorber's large size. We have measured the heat capacity of three Bi samples to be 0.3-0.6 J K{sup -1} m{sup -3} at 100 mK. These absorbers also exhibit response variations as phonons created by an X-ray event at an absorber edge will take longer to propagate to the thermometer attachment point than those at the absorber center. This effect may degrade the detector's energy resolution if the propagation time is not very short compared to the thermometer time constant. We show that the response of the largest absorber varies by {approx}4% across its area.

  19. Ab initio electronic structure and optical conductivity of bismuth tellurohalides

    CERN Document Server

    Schwalbe, Sebastian; Starke, Ronald; Schober, Giulio A H; Kortus, Jens

    2016-01-01

    We investigate the electronic structure, dielectric and optical properties of bismuth tellurohalides BiTeX (X = I, Cl, Br) by means of all-electron density functional theory. In particular, we present the ab initio conductivities and dielectric tensors calculated over a wide frequency range, and compare our results with the recent measurements by Akrap et al. , Makhnev et al. , and Rusinov et al. . We show how the low-frequency branch of the optical conductivity can be used to identify characteristic intra- and interband transitions between the Rashba spin-split bands in all three bismuth tellurohalides. We further calculate the refractive indices and dielectric constants, which in turn are systematically compared to previous predictions and measurements. We expect that our quantitative analysis will contribute to the general assessment of bulk Rashba materials for their potential use in spintronics devices.

  20. Low temperature Hall effect in bismuth chalcogenides thin films

    OpenAIRE

    Kuntsevich, A. Yu.; Gabdullin, A. A.; Prudkogliad, V. A.; Selivanov, Yu. G.; Chizhevskii, E. G.; Pudalov, V. M.

    2016-01-01

    Bismuth chalcogenides are the most studied 3D topological insulators. As a rule, at low temperatures thin films of these materials demonstrate positive magnetoresistance due to weak antilocalization. Weak antilocalization should lead to resistivity decrease at low temperatures; in experiments, however, resistivity grows as temperature decreases. From transport measurements for several thin films (with various carrier density, thickness, and carrier mobility), and by using purely phenomenologi...

  1. Modular Lead-Bismuth Fast Reactors in Nuclear Power

    OpenAIRE

    Vladimir Petrochenko; Georgy Toshinsky

    2012-01-01

    On the basis of the unique experience of operating reactors with heavy liquid metal coolant–eutectic lead-bismuth alloy in nuclear submarines, the concept of modular small fast reactors SVBR-100 for civilian nuclear power has been developed and validated. The features of this innovative technology are as follows: a monoblock (integral) design of the reactor with fast neutron spectrum, which can operate using different types of fuel in various fuel cycles including MOX fuel in a self-providing...

  2. Atomic Layer Deposition of Bismuth Vanadates for Solar Energy Materials.

    Science.gov (United States)

    Stefik, Morgan

    2016-07-07

    The fabrication of porous nanocomposites is key to the advancement of energy conversion and storage devices that interface with electrolytes. Bismuth vanadate, BiVO4 , is a promising oxide for solar water splitting where the controlled fabrication of BiVO4 layers within porous, conducting scaffolds has remained a challenge. Here, the atomic layer deposition of bismuth vanadates is reported from BiPh3 , vanadium(V) oxytriisopropoxide, and water. The resulting films have tunable stoichiometry and may be crystallized to form the photoactive scheelite structure of BiVO4 . A selective etching process was used with vanadium-rich depositions to enable the synthesis of phase-pure BiVO4 after spinodal decomposition. BiVO4 thin films were measured for photoelectrochemical performance under AM 1.5 illumination. The average photocurrents were 1.17 mA cm(-2) at 1.23 V versus the reversible hydrogen electrode using a hole-scavenging sulfite electrolyte. The capability to deposit conformal bismuth vanadates will enable a new generation of nanocomposite architectures for solar water splitting.

  3. Aerosol deposition of (Cu,Ti) substituted bismuth vanadate films

    Energy Technology Data Exchange (ETDEWEB)

    Exner, Jörg, E-mail: Functional.Materials@Uni-Bayreuth.de [University of Bayreuth, Department of Functional Materials, Universitätsstraße 30, 95440 Bayreuth (Germany); Fuierer, Paul [Materials and Metallurgical Engineering Department, New Mexico Institute of Mining and Technology, Socorro, NM 87801 (United States); Moos, Ralf [University of Bayreuth, Department of Functional Materials, Universitätsstraße 30, 95440 Bayreuth (Germany)

    2014-12-31

    Bismuth vanadate, Bi{sub 4}V{sub 2}O{sub 11}, and related compounds with various metal (Me) substitutions, Bi{sub 4}(Me{sub x}V{sub 1−x}){sub 2}O{sub 11−δ}, show some of the highest ionic conductivities among the known solid oxide electrolytes. Films of Cu and Ti substituted bismuth vanadate were prepared by an aerosol deposition method, a spray coating process also described as room temperature impact consolidation. Resultant films, several microns in thickness, were dense with good adhesion to the substrate. Scanning electron microscopy and high temperature X-ray diffraction were used to monitor the effects of temperature on the structure and microstructure of the film. The particle size remained nano-scale while microstrain decreased rapidly up to 500 °C, above which coarsening and texturing increased rapidly. Impedance measurements of films deposited on inter-digital electrodes revealed an annealing effect on the ionic conductivity, with the conductivity exceeding that of a screen printed film, and approaching that of bulk ceramic. - Highlights: • Cu and Ti doped bismuth vanadate films were prepared by aerosol deposition (AD). • Dense 3–5 μm thick films were deposited on alumina, silicon and gold electrodes. • Annealing of the AD-layer increases the conductivity by 1.5 orders of magnitude. • Effect of temperature on structure and microstructure was investigated.

  4. Bismuth pyrochlore-based thin films for dielectric energy storage

    Science.gov (United States)

    Michael, Elizabeth K.

    The drive towards the miniaturization of electronic devices has created a need for dielectric materials with large energy storage densities. These materials, which are used in capacitors, are a critical component in many electrical systems. Here, the development of dielectric energy storage materials for pulsed power applications, which require materials with the ability to accumulate a large amount of energy and then deliver it to the system rapidly, is explored. The amount of electrostatic energy that can be stored by a material is a function of the induced polarization and the dielectric breakdown strength of the material. An ideal energy storage dielectric would possess a high relative permittivity, high dielectric breakdown strength, and low loss tangent under high applied electric fields. The bismuth pyrochlores are a compositionally tunable family of materials that meet these requirements. Thin films of cubic pyrochlore bismuth zinc niobate, bismuth zinc tantalate, and bismuth zinc niobate tantalate, were fabricated using a novel solution chemistry based upon the Pechini method. This solution preparation is advantageous because it avoids the use of teratogenic solvents, such as 2-methoxyethanol. Crystalline films fabricated using this solution chemistry had very small grains that were approximately 27 nm in lateral size and 35 nm through the film thickness. Impedance measurements found that the resistivity of the grain boundaries was two orders of magnitude higher than the resistivity of the grain interior. The presence of many resistive grain boundaries impeded conduction through the films, resulting in high breakdown strengths for these materials. In addition to high breakdown strengths, this family of materials exhibited moderate relative permittivities of between 55 +/- 2 and 145 +/- 5, for bismuth zinc tantalate and bismuth zinc niobate, respectively, and low loss tangents on the order of 0.0008 +/- 0.0001. Increases in the concentration of the tantalum

  5. Solvothermal synthesis and study of nonlinear optical properties of nanocrystalline thallium doped bismuth telluride

    Energy Technology Data Exchange (ETDEWEB)

    Molli, Muralikrishna, E-mail: muralikrishnamolli@sssihl.edu.in [Department of Physics, Sri Sathya Sai Institute of Higher Learning, Prasanthinilayam-515 134 (India); Parola, Sowmendran; Avinash Chunduri, L.A.; Aditha, Saikiran; Sai Muthukumar, V; Mimani Rattan, Tanu; Kamisetti, Venkataramaniah [Department of Physics, Sri Sathya Sai Institute of Higher Learning, Prasanthinilayam-515 134 (India)

    2012-05-15

    Nanocrystalline Bismuth telluride and thallium (4 mol %) doped Bismuth telluride were synthesized through hydrothermal method. The as-prepared products were characterized using Powder X-ray Diffraction, High Resolution Transmission Electron Microscopy, Energy Dispersive X-Ray Spectroscopy, UV-Visible spectroscopy and Fourier Transform Infrared Spectroscopy. Powder XRD results revealed the crystalline nature of the obtained phases. HRTEM showed the particle-like morphology of the products. The decrease in the absorption coefficient due to thallium doping was observed in FTIR spectra. The intensity dependent nonlinear optical properties of nanocrystalline bismuth telluride and thallium doped bismuth telluride were studied using the Z-scan technique in open-aperture configuration. Bismuth telluride doped with thallium showed enhanced nonlinear optical response compared to pristine bismuth telluride and hence could be used as a potential candidate for optical power limiting applications. - Graphical Abstract: Nonlinear transmission (Z-scan) curves of nanocrystalline bismuth telluride ({Delta}) and thallium doped bismuth telluride ({open_square}). Thallium doped bismuth telluride showed enhanced nonlinear absorption compared to bismuth telluride. Inset: TEM micrograph of bismuth telluride nanocrystallites. Highlights: Black-Right-Pointing-Pointer Synthesis of Nanocrystalline Bi{sub 2}Te{sub 3} and Thallium doped Bi{sub 2}Te{sub 3} through solvothermal method. Black-Right-Pointing-Pointer Reduced absorption coefficient due to thallium doping found from IR spectroscopy. Black-Right-Pointing-Pointer Open-aperture Z-scan technique for nonlinear optical studies. Black-Right-Pointing-Pointer Two photon absorption based model for theoretical fitting of Z-scan data. Black-Right-Pointing-Pointer Enhanced nonlinear absorption in Thallium doped Bi{sub 2}Te{sub 3} - potential candidate for optical power limiting applications.

  6. Search for single top production in e+e- collisions at sqrt(s) up to 209 GeV

    Science.gov (United States)

    ALEPH Collaboration; Heister, A.; Schael, S.; Barate, R.; Brunelière, R.; de Bonis, I.; Decamp, D.; Goy, C.; Jezequel, S.; Lees, J.-P.; Martin, F.; Merle, E.; Minard, M.-N.; Pietrzyk, B.; Trocmé, B.; Boix, G.; Bravo, S.; Casado, M. P.; Chmeissani, M.; Crespo, J. M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, Ll.; Graugés, E.; Lopez, J.; Martinez, M.; Merino, G.; Pacheco, A.; Paneque, D.; Ruiz, H.; Colaleo, A.; Creanza, D.; de Filippis, N.; de Palma, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Azzurri, P.; Barklow, T.; Buchmüller, O.; Cattaneo, M.; Cerutti, F.; Clerbaux, B.; Drevermann, H.; Forty, R. W.; Frank, M.; Gianotti, F.; Greening, T. C.; Hansen, J. B.; Harvey, J.; Hutchcroft, D. E.; Janot, P.; Jost, B.; Kado, M.; Mato, P.; Moutoussi, A.; Ranjard, F.; Rolandi, L.; Schlatter, D.; Sguazzoni, G.; Tejessy, W.; Teubert, F.; Valassi, A.; Videau, I.; Ward, J. J.; Badaud, F.; Dessagne, S.; Falvard, A.; Fayolle, D.; Gay, P.; Jousset, J.; Michel, B.; Monteil, S.; Pallin, D.; Pascolo, J. M.; Perret, P.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Nilsson, B. S.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Zachariadou, K.; Blondel, A.; Brient, J.-C.; Machefert, F.; Rougé, A.; Swynghedauw, M.; Tanaka, R.; Videau, H.; Ciulli, V.; Focardi, E.; Parrini, G.; Antonelli, A.; Antonelli, M.; Bencivenni, G.; Bossi, F.; Capon, G.; Chiarella, V.; Laurelli, P.; Mannocchi, G.; Murtas, G. P.; Passalacqua, L.; Kennedy, J.; Lynch, J. G.; Negus, P.; O'Shea, V.; Thompson, A. S.; Wasserbaech, S.; Cavanaugh, R.; Dhamotharan, S.; Geweniger, C.; Hanke, P.; Hepp, V.; Kluge, E. E.; Leibenguth, G.; Putzer, A.; Stenzel, H.; Tittel, K.; Wunsch, M.; Beuselinck, R.; Cameron, W.; Davies, G.; Dornan, P. J.; Girone, M.; Hill, R. D.; Marinelli, N.; Nowell, J.; Rutherford, S. A.; Sedgbeer, J. K.; Thompson, J. C.; White, R.; Ghete, V. M.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Bouhova-Thacker, E.; Bowdery, C. K.; Clarke, D. P.; Ellis, G.; Finch, A. J.; Foster, F.; Hughes, G.; Jones, R. W. L.; Pearson, M. R.; Robertson, N. A.; Smizanska, M.; van der Aa, O.; Delaere, C.; Lemaitre, V.; Blumenschein, U.; Hölldorfer, F.; Jakobs, K.; Kayser, F.; Kleinknecht, K.; Müller, A.-S.; Quast, G.; Renk, B.; Sander, H.-G.; Schmeling, S.; Wachsmuth, H.; Zeitnitz, C.; Ziegler, T.; Bonissent, A.; Coyle, P.; Curtil, C.; Ealet, A.; Fouchez, D.; Payre, P.; Tilquin, A.; Ragusa, F.; David, A.; Dietl, H.; Ganis, G.; Hüttmann, K.; Lütjens, G.; Männer, W.; Moser, H.-G.; Settles, R.; Wolf, G.; Boucrot, J.; Callot, O.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Jacholkowska, A.; Serin, L.; Veillet, J.-J.; de Vivie de Régie, J.-B.; Yuan, C.; Bagliesi, G.; Boccali, T.; Foà, L.; Giammanco, A.; Giassi, A.; Ligabue, F.; Messineo, A.; Palla, F.; Sanguinetti, G.; Sciabà, A.; Tenchini, R.; Venturi, A.; Verdini, P. G.; Awunor, O.; Blair, G. A.; Cowan, G.; Garcia-Bellido, A.; Green, M. G.; Jones, L. T.; Medcalf, T.; Misiejuk, A.; Strong, J. A.; Teixeira-Dias, P.; Clifft, R. W.; Edgecock, T. R.; Norton, P. R.; Tomalin, I. R.; Bloch-Devaux, B.; Boumediene, D.; Colas, P.; Fabbro, B.; Lançon, E.; Lemaire, M.-C.; Locci, E.; Perez, P.; Rander, J.; Tuchming, B.; Vallage, B.; Konstantinidis, N.; Litke, A. M.; Taylor, G.; Booth, C. N.; Cartwright, S.; Combley, F.; Hodgson, P. N.; Lehto, M.; Thompson, L. F.; Böhrer, A.; Brandt, S.; Grupen, C.; Hess, J.; Ngac, A.; Prange, G.; Sieler, U.; Borean, C.; Giannini, G.; He, H.; Putz, J.; Rothberg, J.; Armstrong, S. R.; Berkelman, K.; Cranmer, K.; Ferguson, D. P. S.; Gao, Y.; González, S.; Hayes, O. J.; Hu, H.; Jin, S.; Kile, J.; McNamara, P. A.; Nielsen, J.; Pan, Y. B.; von Wimmersperg-Toeller, J. H.; Wiedenmann, W.; Wu, J.; Wu, Sau Lan; Wu, X.; Zobernig, G.; Dissertori, G.

    2002-09-01

    Single top production via the flavour changing neutral current reactions e+e--->t¯c,t¯u is searched for within the 214 pb-1 of data collected by ALEPH at centre-of-mass energies between 204 and 209 GeV. No deviation from the Standard Model expectation is observed and upper limits on the single top production cross sections are derived. The combination with data collected at lower centre-of-mass energies yields an upper limit on the branching ratio BR(t-->Zc)+BR(t-->Zu)γc)+BR(t-->γu)=0 and mt=174 GeV/c2.

  7. Search for Single Top Production in $e^{+} e^{-}$ Collisions at $\\sqrt{s}$ up to 209 GeV

    CERN Document Server

    Heister, A; Barate, R; Brunelière, R; De Bonis, I; Décamp, D; Goy, C; Jézéquel, S; Lees, J P; Martin, F; Merle, E; Minard, M N; Pietrzyk, B; Trocmé, B; Boix, G; Bravo, S; Casado, M P; Chmeissani, M; Crespo, J M; Fernández, E; Fernández-Bosman, M; Garrido, L; Graugès-Pous, E; López, J; Martínez, M; Merino, G; Pacheco, A; Paneque, D; Ruiz, H; Colaleo, A; Creanza, D; De Filippis, N; De Palma, M; Iaselli, Giuseppe; Maggi, G; Maggi, M; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Abbaneo, D; Azzurri, P; Barklow, Timothy L; Buchmüller, O L; Cattaneo, M; Cerutti, F; Clerbaux, B; Drevermann, H; Forty, Roger W; Frank, M; Gianotti, F; Greening, T C; Hansen, J B; Harvey, J; Hutchcroft, D E; Janot, P; Jost, B; Kado, M; Mato, P; Moutoussi, A; Ranjard, F; Rolandi, Luigi; Schlatter, W D; Sguazzoni, G; Tejessy, W; Teubert, F; Valassi, Andrea; Videau, I; Ward, J J; Badaud, F; Dessagne, S; Falvard, A; Fayolle, D; Gay, P; Jousset, J; Michel, B; Monteil, S; Pallin, D; Pascolo, J M; Perret, P; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Kyriakis, A; Markou, C; Simopoulou, Errietta; Vayaki, Anna; Zachariadou, K; Blondel, A; Brient, J C; Machefert, F P; Rougé, A; Swynghedauw, M; Tanaka, R; Videau, H L; Ciulli, V; Focardi, E; Parrini, G; Antonelli, A; Antonelli, M; Bencivenni, G; Bossi, F; Capon, G; Chiarella, V; Laurelli, P; Mannocchi, G; Murtas, G P; Passalacqua, L; Kennedy, J; Lynch, J G; Negus, P; O'Shea, V; Thompson, A S; Wasserbaech, S R; Cavanaugh, R J; Dhamotharan, S; Geweniger, C; Hanke, P; Hepp, V; Kluge, E E; Leibenguth, G; Putzer, A; Stenzel, H; Tittel, K; Wunsch, M; Beuselinck, R; Cameron, W; Davies, G; Dornan, Peter J; Girone, M; Hill, R D; Marinelli, N; Nowell, J; Rutherford, S A; Sedgbeer, J K; Thompson, J C; White, R; Ghete, V M; Girtler, P; Kneringer, E; Kuhn, D; Rudolph, G; Bouhova-Thacker, E; Bowdery, C K; Clarke, D P; Ellis, G; Finch, A J; Foster, F; Hughes, G; Jones, R W L; Pearson, M R; Robertson, N A; Smizanska, M; van der Aa, O; Delaere, C; Lemaître, V; Blumenschein, U; Hölldorfer, F; Jakobs, K; Kayser, F J; Kleinknecht, K; Müller, A S; Quast, G; Renk, B; Sander, H G; Schmeling, S; Wachsmuth, H W; Zeitnitz, C; Ziegler, T; Bonissent, A; Coyle, P; Curtil, C; Ealet, A; Fouchez, D; Payre, P; Tilquin, A; Ragusa, F; David, A; Dietl, H; Ganis, G; Hüttmann, K; Lütjens, G; Männer, W; Moser, H G; Settles, Ronald; Wolf, G; Boucrot, J; Callot, O; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Jacholkowska, A; Serin, L; Veillet, J J; De Vivie de Régie, J B; Yuan, C; Bagliesi, G; Boccali, T; Foà, L; Giammanco, A; Giassi, A; Ligabue, F; Messineo, A; Palla, Fabrizio; Sanguinetti, G; Sciabà, A; Tenchini, Roberto; Venturi, A; Verdini, P G; Awunor, O; Blair, G A; Cowan, G; García-Bellido, A; Green, M G; Jones, L T; Medcalf, T; Misiejuk, A; Strong, J A; Teixeira-Dias, P; Clifft, R W; Edgecock, T R; Norton, P R; Tomalin, I R; Bloch-Devaux, B; Boumediene, D E; Colas, P; Fabbro, B; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Rander, J; Tuchming, B; Vallage, B; Konstantinidis, N P; Litke, A M; Taylor, G; Booth, C N; Cartwright, S L; Combley, F; Hodgson, P N; Lehto, M H; Thompson, L F; Böhrer, A; Brandt, S; Grupen, Claus; Hess, J; Ngac, A; Prange, G; Sieler, U; Borean, C; Giannini, G; He, H; Pütz, J; Rothberg, J E; Armstrong, S R; Berkelman, K; Cranmer, K; Ferguson, D P S; Gao, Y; González, S; Hayes, O J; Hu, H; Jin, S; Kile, J; McNamara, P A; Nielsen, J; Pan, Y B; Von Wimmersperg-Töller, J H; Wiedenmann, W; Wu, J; Wu Sau Lan; Wu, X; Zobernig, G; Dissertori, G

    2002-01-01

    Single top production via the flavour changing neutral current reactions e+e- -> \\bar{t}c , \\bar{t}u is searched for within the 214~pb-1 of data collected by ALEPH at centre-of-mass energies between 204 and 209~GeV. No deviation from the Standard Model expectation is observed and upper limits on the single top production cross sections are derived. The combination with data collected at lower centre-of-mass energies yields an upper limit on the branching ratio BR(t -> Zc)+BR(t -> Zu) \\gamma c)+BR(t -> \\gamma u)= 0 and mt=174 GeV/c2$.

  8. Bismuth nanoparticle decorating graphite felt as a high-performance electrode for an all-vanadium redox flow battery.

    Science.gov (United States)

    Li, Bin; Gu, Meng; Nie, Zimin; Shao, Yuyan; Luo, Qingtao; Wei, Xiaoliang; Li, Xiaolin; Xiao, Jie; Wang, Chongmin; Sprenkle, Vincent; Wang, Wei

    2013-03-13

    Employing electrolytes containing Bi(3+), bismuth nanoparticles are synchronously electrodeposited onto the surface of a graphite felt electrode during operation of an all-vanadium redox flow battery (VRFB). The influence of the Bi nanoparticles on the electrochemical performance of the VRFB is thoroughly investigated. It is confirmed that Bi is only present at the negative electrode and facilitates the redox reaction between V(II) and V(III). However, the Bi nanoparticles significantly improve the electrochemical performance of VRFB cells by enhancing the kinetics of the sluggish V(II)/V(III) redox reaction, especially under high power operation. The energy efficiency is increased by 11% at high current density (150 mA·cm(-2)) owing to faster charge transfer as compared with one without Bi. The results suggest that using Bi nanoparticles in place of noble metals offers great promise as high-performance electrodes for VRFB application.

  9. Real-time observation of bismuth silicon oxide crystal growth in silicon oxide-bismuth oxide system%氧化硅-氧化铋系统中硅酸铋晶体生长实时观测

    Institute of Scientific and Technical Information of China (English)

    王秀峰; 徐驰; 江红涛; 韩元亨

    2015-01-01

    高温熔体的实时观测与分析对于晶体生长及其影响因素分析具有十分重要的意义 .利用高温热台及偏光显微镜 ,对铋硅系统熔融及冷却过程进行实时观测 .观察到高温下与石英砂接触的氧化铋粉体先熔融 ,说明异质颗粒接触点处是反应开始的地方 .之后熔体与石英(二氧化硅)晶体反应 ,冷却过程中在石英晶体表面周围及坩埚壁附近生长出硅酸铋晶体 ,这说明晶体易在颗粒接触处析出 .实验中氧化铋与二氧化硅摩尔比为4:3,此时石英晶体并没有全部熔融 .对比分析系统熔体在降温时晶体析出长大的过程 ,计算出硅酸铋晶体的生长平均速率为15 .38 μm/min .通过线能谱扫描分析 ,认为熔体温度和硅元素的富集程度对晶体生长速度有重要影响.%Real time observation and analysis of high temperature melt is great of significance for crystal growth and the analysis of its influencing factors .The paper using high tempera-ture thermal units and polarizing optical microscope observed the melt and cooling process of bismuth silicon systems in real time .In high temperature the bismuth oxide powder which in contact with quartz sand is first melting ,it shows that the heterogeneity particles at the con-tact point is the place to reaction start .Then bismuth oxide melt reacted with the quartz (sil-icon dioxide) crystal .In cooling process the surface of quartz crystal and the crucible wall grown bismuth silicate crystals .This means at the contact point of particle is easy to crystal grow .The molar ratio of bismuth oxide and silicon dioxide was 4:3 in the experiment ,not all of the quartz crystal melted at this moment .Comparative analysis of the system melt crystallization process of growing up in cooling process ,the average grow th rate of crystals of bismuth silicate is calculated 15 .38 μm/min .According to the energy spectrum analysis of scanning ,melt temperature and the enrichment of

  10. Effect of O-vacancies on magnetic properties of bismuth ferrite nanoparticles by solution evaporation method

    Energy Technology Data Exchange (ETDEWEB)

    Afzal, A.M., E-mail: Amirafzal461@gmail.com [Department of Physics, GC University, Faisalabad 38000 (Pakistan); Umair, M., E-mail: umairranwerr@gmail.com [Department of Physics, GC University, Faisalabad 38000 (Pakistan); Dastgeer, G., E-mail: dtedastgeer@gmail.com [Department of Physics, University of Agriculture, Faisalabad 38000 (Pakistan); Rizwan, M., E-mail: h.rizwan70@gmail.com [Department of Physics, GC University, Faisalabad 38000 (Pakistan); Yaqoob, M.Z., E-mail: zeeshaan32@gmail.com [Department of Physics, GC University, Faisalabad 38000 (Pakistan); Rashid, R., E-mail: rashid.kanwar22@gmail.com [Department of Physics, University of Agriculture, Faisalabad 38000 (Pakistan); Munir, H.S., E-mail: sadiamunir.cute@gmail.com [Department of Physics, GC University, Faisalabad 38000 (Pakistan)

    2016-02-01

    Bismuth ferrite is a multiferroic material which shows high magnetization and polarization at room temperature. In present work, the effect of Oxygen (O) vacancies on magnetic properties of bismuth ferrite nanoparticles is studied. Bismuth ferrite nanoparticles (BiFeO{sub 3}) were synthesized by solution evaporation method (SEM) at room temperature. The sample was annealed under two different atmospheres such as in air and oxygen, to check the effect of O-vacancies on magnetic properties. The average crystallite size of Bismuth ferrite nanoparticles (NPs) as calculated by X-ray diffraction (XRD) falls in the range of 23–32 nm and 26–39 nm for the case of air and oxygen respectively. The crystallite size of bismuth ferrite nanoparticles increases as the temperature was varied from 450 °C to 650 °C. Further the influence of annealing temperature on the magnetic properties of the bismuth ferrite nanoparticles was also observed. It was concluded that the magnetic properties of Bismuth ferrite nanoparticles are directly interconnected to annealing atmosphere and annealing temperature. The magnetic properties were increased in the case of oxygen annealing, which actually leads in our case to an improvement of the crystallinity. - Highlights: • Bismuth ferrite was synthesized by solution evaporation method. • The effect of different annealing atmosphere on magnetic properties was studied. • The magnetic properties dramatically increased in case of Oxygen annealing. • The influence of crystalline size on magnetic properties was studied. • The magnetization was decreased as the temperature and crystallite size increased.

  11. Electronic Properties of Tin and Bismuth from Angular Correlation of Annihilation Photons

    DEFF Research Database (Denmark)

    Mogensen, O.E.; Trumpy, Georg

    1969-01-01

    A linear slit setup has been used to obtain results of angular-correlation measurements in (a) tin single crystals in three orientations: [001], [100], and [110], (b) bismuth single crystals in four orientations: [111], [100], [1¯10], and [2¯1¯1], (c) solid and liquid tin and bismuth, and (d) def...

  12. Biosynthesis of bismuth nanoparticles using Serratia marcescens isolated from the Caspian Sea and their characterisation.

    Science.gov (United States)

    Nazari, P; Faramarzi, M A; Sepehrizadeh, Z; Mofid, M R; Bazaz, R D; Shahverdi, A R

    2012-06-01

    Today, synthesis of nanoparticles (NPs) using micro-organisms has been receiving increasing attention. In this investigation, a bismuth-reducing bacterium was isolated from the Caspian Sea in Northern Iran and was used for intracellular biosynthesis of elemental bismuth NPs. This isolate was identified as non-pigmented Serratia marcescens using conventional identification assays and the 16s rDNA fragment amplification method and used to prepare bismuth NPs. The biogenic bismuth NPs were released by liquid nitrogen and highly purified using an n-octanol water two-phase extraction system. Different characterisations of the purified NPs such as particle shapes, size and purity were carried out with different instruments. The energy-dispersive X-ray and X-ray diffraction (XRD) patterns demonstrated that the purified NPs consisted of only bismuth and are amorphous. In addition, the transmission electron micrograph showed that the small NPs formed larger aggregated NPs around <150 nm. Although the chemical syntheses of elemental bismuth NPs have been reported in the literature, the biological synthesis of elemental bismuth NPs has not been published yet. This is the first report to demonstrate a biological method for synthesising bismuth NPs and their purification with a simple solvent partitioning method.

  13. Selective oxidation of propylene to acrolein by silica-supported bismuth molybdate catalysts

    DEFF Research Database (Denmark)

    Duc, Duc Truong; Ha, Hanh Nguyen; Fehrmann, Rasmus

    2011-01-01

    Silica-supported bismuth molybdate catalysts have been prepared by impregnation, structurally characterized and examined as improved catalysts for the selective oxidation of propylene to acrolein. Catalysts with a wide range of loadings (from 10 to 90 wt%) of beta bismuth molybdate (β-Bi2Mo2O9...

  14. Method of Creating Micro-scale Silver Telluride Grains Covered with Bismuth Nanoparticles

    Science.gov (United States)

    Kim, Hyun-Jung (Inventor); Choi, Sang Hyouk (Inventor); King, Glen C. (Inventor); Park, Yeonjoon (Inventor); Lee, Kunik (Inventor)

    2014-01-01

    Provided is a method of enhancing thermoelectric performance by surrounding crystalline semiconductors with nanoparticles by contacting a bismuth telluride material with a silver salt under a substantially inert atmosphere and a temperature approximately near the silver salt decomposition temperature; and recovering a metallic bismuth decorated material comprising silver telluride crystal grains.

  15. Effects of In Vitro Antibiotic Resistance on Treatment: Bismuth-Containing Regimens

    Directory of Open Access Journals (Sweden)

    Naoki Chiba

    2000-01-01

    Full Text Available Bismuth compounds remain useful for Helicobacter pylori eradication therapy. These include colloidal bismuth subcitrate (CBS, bismuth subsalicylate (BSS and, most recently, ranitidine bismuth citrate (RBC. CBS appears to prevent the development of imidazole resistance when coadministered with nitroimidazoles. Traditional triple therapy with bismuth, metronidazole and tetracycline or amoxicillin (BMT/A only partially overcomes metronidazole resistance. However, the addition of a PPI to bismuth triple therapy largely overcomes established metronidazole resistance if treatment is given for at least one week or more. When RBC rather than PPI is used with clarithromycin, this dual regimen appears to be more effective in preventing the development of secondary clarithromycin resistance. The triple combination of RBC, metronidazole and clarithromycin appears to be effective against metronidazole resistant strains of H pylori. Thus, overall, there is some evidence that bismuth compounds may prevent the development of antibiotic resistance and that existing antibiotic resistance may at least be partially overcome in vitro and in vivo. With the growing emergence of H pylori resistance to metronidazole and clarithromycin, further research to clarify the role of bismuth compounds is required.

  16. Local Structural Distortion Induced Uniaxial Negative Thermal Expansion in Nanosized Semimetal Bismuth.

    Science.gov (United States)

    Li, Qiang; Zhu, He; Zheng, Lirong; Fan, Longlong; Ren, Yang; Chen, Jun; Deng, Jinxia; Xing, Xianran

    2016-11-01

    The corrugated layer structure bismuth has been successfully tailored into negative thermal expansion along c axis by size effect. Pair distribution function and extended X-ray absorption fine structure are combined to reveal the local structural distortion for nanosized bismuth. The comprehensive method to identify the local structure of nanomaterials can benefit the regulating and controlling of thermal expansion in nanodivices.

  17. Synthesis, structure and temperature-depended 2D IR correlation spectroscopy of an organo-bismuth benzoate with 1,10-phenanthroline

    Science.gov (United States)

    Sun, Yan-Qiong; Zhong, Jie-Cen; Liu, Le-Hui; Qiu, Xing-Tai; Chen, Yi-Ping

    2016-11-01

    An organo-bismuth benzoate with phen as auxiliary ligand, [Bi(phen)(C6H5COO)(C6H4COO)] (1) (phen = 1,10-phenanthroline) has been hydrothermally synthesized from bismuth nitrate, 2-mercaptonbenzoic acid with phen as auxiliary ligand and characterized by single-crystal X-ray diffraction, elemental analyses, PXRD, IR spectra, TG analyses, temperature-depended 2D-IR COS (two-dimensional infrared correlation spectroscopy). Interestingly, benzoate anions in 1 came from the desulfuration reaction of 2-mercaptonbenzoic acid under hydrothermal condition. Compound 1 is a discrete organo-bismuth compound with benzoate and phen ligands. The offset face-to-face π-π stacking interactions and C-H⋯O hydrogen bonds link the isolate complex into a 3D supramolecular network. The temperature-depended 2D-IR COS indicates that the stretching vibrations of Cdbnd C/Cdbnd N of aromatic rings and Cdbnd O bonds are sensitive to the temperature change.

  18. Microbial electricity generation enhances decabromodiphenyl ether (BDE-209) degradation.

    Science.gov (United States)

    Yang, Yonggang; Xu, Meiying; He, Zhili; Guo, Jun; Sun, Guoping; Zhou, Jizhong

    2013-01-01

    Due to environmental persistence and biotoxicity of polybrominated diphenyl ethers (PBDEs), it is urgent to develop potential technologies to remediate PBDEs. Introducing electrodes for microbial electricity generation to stimulate the anaerobic degradation of organic pollutants is highly promising for bioremediation. However, it is still not clear whether the degradation of PBDEs could be promoted by this strategy. In this study, we hypothesized that the degradation of PBDEs (e.g., BDE-209) would be enhanced under microbial electricity generation condition. The functional compositions and structures of microbial communities in closed-circuit microbial fuel cell (c-MFC) and open-circuit microbial fuel cell (o-MFC) systems for BDE-209 degradation were detected by a comprehensive functional gene array, GeoChip 4.0, and linked with PBDE degradations. The results indicated that distinctly different microbial community structures were formed between c-MFCs and o-MFCs, and that lower concentrations of BDE-209 and the resulting lower brominated PBDE products were detected in c-MFCs after 70-day performance. The diversity and abundance of a variety of functional genes in c-MFCs were significantly higher than those in o-MFCs. Most genes involved in chlorinated solvent reductive dechlorination, hydroxylation, methoxylation and aromatic hydrocarbon degradation were highly enriched in c-MFCs and significantly positively correlated with the removal of PBDEs. Various other microbial functional genes for carbon, nitrogen, phosphorus and sulfur cycling, as well as energy transformation process, were also significantly increased in c-MFCs. Together, these results suggest that PBDE degradation could be enhanced by introducing the electrodes for microbial electricity generation and by specifically stimulating microbial functional genes.

  19. Microbial electricity generation enhances decabromodiphenyl ether (BDE-209 degradation.

    Directory of Open Access Journals (Sweden)

    Yonggang Yang

    Full Text Available Due to environmental persistence and biotoxicity of polybrominated diphenyl ethers (PBDEs, it is urgent to develop potential technologies to remediate PBDEs. Introducing electrodes for microbial electricity generation to stimulate the anaerobic degradation of organic pollutants is highly promising for bioremediation. However, it is still not clear whether the degradation of PBDEs could be promoted by this strategy. In this study, we hypothesized that the degradation of PBDEs (e.g., BDE-209 would be enhanced under microbial electricity generation condition. The functional compositions and structures of microbial communities in closed-circuit microbial fuel cell (c-MFC and open-circuit microbial fuel cell (o-MFC systems for BDE-209 degradation were detected by a comprehensive functional gene array, GeoChip 4.0, and linked with PBDE degradations. The results indicated that distinctly different microbial community structures were formed between c-MFCs and o-MFCs, and that lower concentrations of BDE-209 and the resulting lower brominated PBDE products were detected in c-MFCs after 70-day performance. The diversity and abundance of a variety of functional genes in c-MFCs were significantly higher than those in o-MFCs. Most genes involved in chlorinated solvent reductive dechlorination, hydroxylation, methoxylation and aromatic hydrocarbon degradation were highly enriched in c-MFCs and significantly positively correlated with the removal of PBDEs. Various other microbial functional genes for carbon, nitrogen, phosphorus and sulfur cycling, as well as energy transformation process, were also significantly increased in c-MFCs. Together, these results suggest that PBDE degradation could be enhanced by introducing the electrodes for microbial electricity generation and by specifically stimulating microbial functional genes.

  20. Bismuth Nanoparticle Decorating Graphite Felt as a High-Performance Electrode for an All-Vanadium Redox Flow Battery

    Energy Technology Data Exchange (ETDEWEB)

    Li, Bin; Gu, Meng; Nie, Zimin; Shao, Yuyan; Luo, Qingtao; Wei, Xiaoliang; Li, Xiaolin; Xiao, Jie; Wang, Chong M.; Sprenkle, Vincent L.; Wang, Wei

    2013-02-04

    The selection of electrode materials plays a great role in improving performances of all vanadium redox flow batteries (VRBs). Low-cost graphite felt (GF) as traditional electrode material has to be modified to address its issue of low electrocatalytic activity. In our paper, low-cost and highly conductive bismuth nanoparticles, as a powerful alternative electrocatalyst to noble metal, are proposed and synchronously electro-deposited onto the surface of GF while running flow cells employing the electrolytes containing suitable Bi3+. Although bismuth is proved to only take effect on the redox reaction of V(II)/V(III) and present at negative half-cell side, the whole cell electrochemical performances are significantly improved. In particular, the energy efficiency is increased by 11% owing to faster charge transfer as compared with one without Bi at high charge/discharge rate of 150 mA/cm2, which is prone to reduce stack size, thus dramatically reducing the cost. The excellent results show great promise of Bi nano-catalysts in the commercialization of VRBs in terms of product cost as well as electrochemical properties.

  1. Visible light photooxidative performance of a high-nuclearity molecular bismuth vanadium oxide cluster

    Directory of Open Access Journals (Sweden)

    Johannes Tucher

    2014-05-01

    Full Text Available The visible light photooxidative performance of a new high-nuclearity molecular bismuth vanadium oxide cluster, H3[{Bi(dmso3}4V13O40], is reported. Photocatalytic activity studies show faster reaction kinetics under anaerobic conditions, suggesting an oxygen-dependent quenching of the photoexcited cluster species. Further mechanistic analysis shows that the reaction proceeds via the intermediate formation of hydroxyl radicals which act as oxidant. Trapping experiments using ethanol as a hydroxyl radical scavenger show significantly decreased photocatalytic substrate oxidation in the presence of EtOH. Photocatalytic performance analyses using monochromatic visible light irradiation show that the quantum efficiency Φ for indigo photooxidation is strongly dependent on the irradiation wavelength, with higher quantum efficiencies being observed at shorter wavelengths (Φ395nm ca. 15%. Recycling tests show that the compound can be employed as homogeneous photooxidation catalyst multiple times without loss of catalytic activity. High turnover numbers (TON ca. 1200 and turnover frequencies up to TOF ca. 3.44 min−1 are observed, illustrating the practical applicability of the cluster species.

  2. Repolarization of Negative Muons by Polarized $^{209}$Bi Nuclei

    CERN Document Server

    Kadono, R; Ishikawa, T; Nishiyama, K; Nagamine, K; Yamazaki, T; Bosshard, A; Döbeli, M; van Elmbt, L; Schaad, M; Truöl, P; Bay, A; Perroud, J P; Deutsch, J; Tasiaux, B; Hagn, E

    2016-01-01

    A large $\\mu^-$ polarization was achieved in muonic Bi atoms with the help of the strong hyperfine field in a polarized nuclear target. Using $^{209}$Bi nuclei polarized to ($59\\pm9$)% in ferromagnetic BiMn, we observed a $\\mu$-$e$ decay asymmetry of ($13.1\\pm3.9$)%, which gives $\\mu^-$ polarization per nuclear polarization equal to $-1.07\\pm 0.35$. This value is almost consistent with $-0.792$ calculated for nuclei with spin $I= \\frac{9}{2}$ and a positive magnetic moment under the assumption that the hyperfine interaction becomes effective in the lowest muonic states.

  3. Antiprotonic potentials from global fits to the PS209 data

    Science.gov (United States)

    Friedman, E.; Gal, A.

    2004-01-01

    The experimental results for strong interaction effects in antiprotonic atoms by the PS209 collaboration consist of high quality data for several sequences of isotopes along the periodic table. Global analysis of these data in terms of a p¯-nucleus optical potential achieves good description of the data using a s-wave finite-range p¯N interaction. Equally good fits are also obtained with a poorly-defined zero-range potential containing a p-wave term.

  4. An atomic absorption spectrometric method for the determination of phosphorus in foodstuffs using the bismuth phosphomolybdate complex

    Directory of Open Access Journals (Sweden)

    LJILJANA V. MIHAJLOVIC

    2000-06-01

    Full Text Available A new indirect AAS method using the bismuth phosphomolybdate complex for the determination of phosphorus in foodstuffs is suggested. The bismuth phosphomolybdate complex in acid medium was extacted with isobutyl methylketone and the phosphorus was determined through bismuth in an air/acetylene flame by utilising the 223.06 nm resonance line of bismuth. The interference caused by antimony and titanium can be neglected in the presence of excess of bismuth. The detection limit of the method is 0.008 mg/mL of phosphorus.

  5. Hydrothermal synthesis and crystal structure analysis of two new cadmium bismuthates, CdBi2O6 and Cd0.37Bi0.63O1.79

    Directory of Open Access Journals (Sweden)

    N. Kumada

    2015-09-01

    Full Text Available Two new cadmium bismuthates, CdBi2O6 and Cd0.37Bi0.63O1.79, were prepared by hydrothermal reaction using NaBiO3·nH2O as one of the starting compounds. The crystal structures of these compounds were refined by using synchrotron X-ray powder diffraction data. The former bismuthate has a MnSb2O6-type structure with a hexagonal cell (space group: P321; the cell parameters were a = 9.3641(7 and c = 4.9523(3 Å, and the final R-factors were Rwp = 4.59% and Rp = 3.04%. The latter bismuthate has a fluorite-type structure with a cubic cell (space group: Fm3¯m of a = 5.4110(4 Å, and the final R-factors were Rwp = 4.79% and Rp = 3.57%. These new bismuthates exhibit no photocatalytic activity under visible light.

  6. Yttrium bismuth titanate pyrochlore mixed oxides for photocatalytic hydrogen production

    Energy Technology Data Exchange (ETDEWEB)

    Merka, Oliver

    2012-10-18

    In this work, the sol-gel synthesis of new non-stoichiometric pyrochlore titanates and their application in photocatalytic hydrogen production is reported. Visible light response is achieved by introducing bismuth on the A site or by doping the B site by transition metal cations featuring partially filled d orbitals. This work clearly focusses on atomic scale structural changes induced by the systematical introduction of non-stoichiometry in pyrochlore mixed oxides and the resulting influence on the activity in photocatalytic hydrogen production. The materials were characterized in detail regarding their optical properties and their atomic structure. The pyrochlore structure tolerates tremendous stoichiometry variations. The non-stoichiometry in A{sub 2}O{sub 3} rich compositions is compensated by distortions in the cationic sub-lattice for the smaller Y{sup 3+} cation and by evolution of a secondary phase for the larger Bi{sup 3+} cation on the A site. For TiO{sub 2} rich compositions, the non-stoichiometry leads to a special vacancy formation in the A and optionally O' sites. It is shown that pyrochlore mixed oxides in the yttrium bismuth titanate system represent very active and promising materials for photocatalytic hydrogen production, if precisely and carefully tuned. Whereas Y{sub 2}Ti{sub 2}O{sub 7} yields stable hydrogen production rates over time, the bismuth richer compounds of YBiTi{sub 2}O{sub 7} and Bi{sub 2}Ti{sub 2}O{sub 7} are found to be not stable under irradiation. This drawback is overcome by applying a special co-catalyst system consisting of a precious metal core and a Cr{sub 2}O{sub 3} shell on the photocatalysts.

  7. Cytotoxic Effect of Lipophilic Bismuth Dimercaptopropanol Nanoparticles on Epithelial Cells.

    Science.gov (United States)

    Rene, Hernandez-Delgadillo; Badireddy, Appala Raju; José, Martínez-Sanmiguel Juan; Francisco, Contreras-Cordero Juan; Israel, Martinez-Gonzalez Gustavo; Isela, Sánchez-Nájera Rosa; Chellam, Shankararaman; Claudio, Cabral-Romero

    2016-01-01

    Bismuth nanoparticles have many interesting properties to be applied in biomedical and medicinal sectors, however their safety in humans have not been comprehensively investigated. The objective of this research was to determine the cytotoxic effect of bismuth dimercaptopropanol nanoparticles (BisBAL NPs) on epithelial cells. The nanoparticles are composed of 18.7 nm crystallites on average and have a rhombohedral structure, agglomerating into chains-like or clusters of small nanoparticles. Based on MTT viability assay and fluorescence microscopy, cytotoxicity was not observed on monkey kidney cells after growing with 5 µM of BisBAL NPs for 24 h. Employing same techniques, identical results were obtained with human epithelial cells (HeLa), showing a not strain-dependent phenomenon. The absence of toxic effects on epithelial cells growing with BisBAL NPs was corroborated with long-time experiments (24-72 hrs.), showing no difference in comparison with growing control (cells without nanoparticles). Further, genotoxicity assays, comet assay and fluorescent microscopy and electrophoresis in bromide-stained agarose gel revealed no damage to genomic DNA of MA104 cells after 24 h. of exposition to BisBAL NPs. Finally, the effect of bismuth nanoparticles on protein synthesis was studied in cells growing with BisBAL NPs for 24 h. SDS-PAGE assays showed no difference between treated and untreated cells, suggesting that BisBAL NPs did not interfere with protein synthesis. Hence BisBAL NPs do not appear to exert cytotoxic effects suggesting their biological compatibility with epithelial cells.

  8. Conduction mechanism in bismuth silicate glasses containing titanium

    Science.gov (United States)

    Dult, Meenakshi; Kundu, R. S.; Murugavel, S.; Punia, R.; Kishore, N.

    2014-11-01

    Bismuth silicate glasses mixed with different concentrations of titanium dioxide having compositions xTiO2-(60-x)Bi2O3-40SiO2 with x=0, 5, 10, 15 and 20 were prepared by the normal melt quench technique. The frequency dependence of the ac electrical conductivity of different compositions of titanium bismuth silicate glasses has been studied in the frequency range 10-1 Hz to 10 MHz and in the temperature range 623-703 K. The temperature and frequency dependent conductivity is found to obey Jonscher's universal power law for all the compositions of titanium bismuth silicate glass system. The dc conductivity (σdc), so called crossover frequency (ωH), and frequency exponent (s) have been estimated from the fitting of experimental data of ac conductivity with Jonscher's universal power law. Enthalpy to dissociate the cation from its original site next to a charge compensating center (Hf) and enthalpy of migration (Hm) have also been estimated. The conductivity data have been analyzed in terms of different theoretical models to determine the possible conduction mechanism. Analysis of the conductivity data and the frequency exponent shows that the correlated barrier hopping of electrons between Ti3+ and Ti4+ ions in the glasses is the most favorable mechanism for ac conduction. The temperature dependent dc conductivity has been analyzed in the framework of theoretical variable range hopping model (VRH) proposed by Mott which describe the hopping conduction in disordered semiconducting systems. The various polaron hopping parameters have also been deduced. Mott's VRH model is found to be in good agreement with experimental data and the values of inverse localization length of s-like wave function (α) obtained by this model with modifications suggested by Punia et al. are close to the ones reported for a number of oxide glasses.

  9. Toxic effects of decabromodiphenyl ether (BDE-209 on human embryonic kidney cells

    Directory of Open Access Journals (Sweden)

    Min eLi

    2014-05-01

    Full Text Available Polybrominated diphenyl ethers (PBDEs are widely used as flame-retardant additives in consumer and household products and can escape into the environment over time. PBDEs have become a global environmental organic pollutant due to the properties of persistence, toxicity, and bioaccumulation. The well-studied toxic effects of PBDEs mainly include thyroid hormone disruption and neurotoxicity. There is no consistent conclusions on the carcinogenic potential of PBDEs to date. Here, we explored the toxic effects of BDE-209 on human embryonic kidney cells (HEK293T. The comparison of the gene expression profiles of HEK293T cells with BDE-209 treatment and the negative control found that BDE-209 exposure may alter nucleosome organization through significantly changing the expression of histone gene clusters. The remodeled chromatin structure could further disturb systemic lupus erythematosus as one of the toxic effects of BDE-209. Additionally, gene sets of different cancer modules are positively correlated with BDE-209 exposure. This suggests that BDE-209 has carcinogenic potential for a variety of tumors. Collectively, BDE-209 has a broader toxicity not limited to disruption of thyroid hormone-related biological processes. Notably, the toxic effects of BDE-209 dissolved in dimethyl sulfoxide (DMSO is not the simply additive effects of BDE-209 and DMSO alone.

  10. Solution combustion synthesis and characterization of nanosized bismuth ferrite

    Science.gov (United States)

    Sai Kumar, V. Sesha; Rao, K. Venkateswara; Krishnaveni, T.; Kishore Goud, A. Shiva; Reddy, P. Ranjith

    2012-06-01

    The present paper describes a simple method of nanosized BiFeO3 by the solution combustion synthesis using bismuth and iron nitrates as oxidizers and the combination fuel of citric acid and ammonium hydroxide, with fuel to oxidizer ratio (Ψ = 1) one. The X-ray Diffraction results indicated rhombohedral phase (R3m) with JCPDS data card no: 72-2035. The ferroelectric transition of the sample at 8310C was detected by differential thermal analysis. Thermal analysis was done by Thermal gravimetric-Differential thermal analyzer and obtained results were presented in this paper.

  11. Coherent phonon coupling to individual Bloch states in photoexcited bismuth.

    Science.gov (United States)

    Papalazarou, E; Faure, J; Mauchain, J; Marsi, M; Taleb-Ibrahimi, A; Reshetnyak, I; van Roekeghem, A; Timrov, I; Vast, N; Arnaud, B; Perfetti, L

    2012-06-22

    We investigate the temporal evolution of the electronic states at the bismuth (111) surface by means of time- and angle-resolved photoelectron spectroscopy. The binding energy of bulklike bands oscillates with the frequency of the A(1g) phonon mode, whereas surface states are insensitive to the coherent displacement of the lattice. A strong dependence of the oscillation amplitude on the electronic wave vector is correctly reproduced by ab initio calculations of electron-phonon coupling. Besides these oscillations, all the electronic states also display a photoinduced shift towards higher binding energy whose dynamics follows the evolution of the electronic temperature.

  12. Low-temperature Hall effect in bismuth chalcogenides thin films

    Science.gov (United States)

    Kuntsevich, A. Yu.; Gabdullin, A. A.; Prudkogliad, V. A.; Selivanov, Yu. G.; Chizhevskii, E. G.; Pudalov, V. M.

    2016-12-01

    Bismuth chalcogenides are the most studied 3D topological insulators. As a rule, at low temperatures, thin films of these materials demonstrate positive magnetoresistance due to weak antilocalization. Weak antilocalization should lead to resistivity decrease at low temperatures; in experiments, however, resistivity grows as temperature decreases. From transport measurements for several thin films (with various carrier density, thickness, and carrier mobility), and by using a purely phenomenological approach, with no microscopic theory, we show that the low-temperature growth of the resistivity is accompanied by growth of the Hall coefficient, in agreement with the diffusive electron-electron interaction correction mechanism. Our data reasonably explain the low-temperature resistivity upturn.

  13. Concentration Quenching in Erbium Doped Bismuth Silicate Glasses

    Institute of Scientific and Technical Information of China (English)

    DAI Shi-Xun; XU Tie-Feng; NIE Qiu-Hua; SHEN Xiang; WANG Xun-Si

    2006-01-01

    @@ Er2 O3-doped bismuth silicate glasses are prepared by the conventional melt-quenching method, and the Er3+ : 4 I13/2 → 4I15/2 fluorescence properties are studied for different Er3+ concentrations. Infrared spectra are measured to estimate the exact content of OH- groups in the samples. Based on the electric dipole-dipole interaction theory,the interaction parameter CEr,Er for the migration rate of Er3+ :4 I13/2 → 4 I13/2 in proposed glasses is calculated.

  14. Kinetics of Propagating Phase Transformation in Compressed Bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Bastea, M; Bastea, S; Emig, J; Springer, P; Reisman, D

    2004-08-18

    The authors observed dynamically driven phase transitions in isentropically compressed bismuth. By changing the stress loading conditions they explored two distinct cases one in which the experimental signature of the phase transformation corresponds to phase-boundary crossings initiated at both sample interfaces, and another in which the experimental trace is due to a single advancing transformation front in the bulk of the material. They introduce a coupled kinetics-hydrodynamics model that for this second case enables them, under suitable simplifying assumptions, to directly extract characteristic transition times from the experimental measurements.

  15. Galaxy Evolution in the Environment of ABCG 209

    CERN Document Server

    Haines, C P; Merluzzi, P; La Barbera, F; Massarotti, M; Busarello, G; Girardi, M

    2004-01-01

    We examine the environmental effects on the photometric properties of galaxies for the rich galaxy cluster ABCG 209 at z=0.209. We use archive CFHT optical imaging of a 42'x28' field centred on the cluster to produce a galaxy sample complete to B=25.0 and R=24.5. Both the composite and red sequence galaxy luminosity functions are found to be dependent on the local galaxy surface density, their faint-end slopes becoming shallower with increasing density. We explain this as a combination of the morphology-density relation, and dwarf galaxies being cannibalised and/or disrupted by the cD galaxy and the ICM in the cluster core. The B-R colour of the red sequence itself appears 0.02mag redder for the highest-density regions, indicative of their stellar populations being marginally (<5%) older or (<20%) more metal-rich. This may be due to the galaxies themselves forming earliest in the rarest overdensities marked by rich clusters, or their star-formation being suppressed earliest by the ICM.

  16. Focused ion beam processing to fabricate ohmic contact electrodes on a bismuth nanowire for Hall measurements.

    Science.gov (United States)

    Murata, Masayuki; Hasegawa, Yasuhiro

    2013-09-26

    Ohmic contact electrodes for four-wire resistance and Hall measurements were fabricated on an individual single-crystal bismuth nanowire encapsulated in a cylindrical quartz template. Focused ion beam processing was utilized to expose the side surfaces of the bismuth nanowire in the template, and carbon and tungsten electrodes were deposited on the bismuth nanowire in situ to achieve electrical contacts. The temperature dependence of the four-wire resistance was successfully measured for the bismuth nanowire, and a difference between the resistivities of the two-wire and four-wire methods was observed. It was concluded that the two-wire method was unsuitable for estimation of the resistivity due to the influence of contact resistance, even if the magnitude of the bismuth nanowire resistance was greater than the kilo-ohm order. Furthermore, Hall measurement of a 4-μm-diameter bismuth microwire was also performed as a trial, and the evaluated temperature dependence of the carrier mobility was in agreement with that for bulk bismuth, which indicates that the carrier mobility was successfully measured using this technique. PACS: 81.07.Gf.

  17. Magnetic anisotropies in ultrathin bismuth iron garnet films

    Energy Technology Data Exchange (ETDEWEB)

    Popova, Elena, E-mail: popova@physique.uvsq.fr [Groupe d' Etude de la Matière Condensée (GEMaC), CNRS/Université de Versailles-Saint-Quentin, 45 Avenue des Etats-Unis, 78035 Versailles (France); Franco Galeano, Andres Felipe [Laboratoire PROcédés, Matériaux et Energie Solaire (PROMES), CNRS/Université de Perpignan Via Domitia, 52 Avenue Paul Alduy, 66860 Perpignan (France); Deb, Marwan [Groupe d' Etude de la Matière Condensée (GEMaC), CNRS/Université de Versailles-Saint-Quentin, 45 Avenue des Etats-Unis, 78035 Versailles (France); Warot-Fonrose, Bénédicte [Centre d' Elaboration de Matériaux et d' Etudes Structurales (CEMES), CNRS, 29 rue Jeanne Marvig, 31055 Toulouse (France); Transpyrenean Associated Laboratory for Electron Microscopy (TALEM), CEMES-INA, CNRS–Universidad de Zaragoza (Spain); Kachkachi, Hamid [Laboratoire PROcédés, Matériaux et Energie Solaire (PROMES), CNRS/Université de Perpignan Via Domitia, 52 Avenue Paul Alduy, 66860 Perpignan (France); Gendron, François [Institut des NanoSciences de Paris (INSP), CNRS/Université Pierre et Marie Curie-Paris 6, 4 place Jussieu, Boîte courrier 840, 75252 Paris Cedex 05 (France); Ott, Frédéric [Laboratoire Léon Brillouin (LLB), CNRS/CEA, Bâtiment 563, CEA Saclay, 91191 Gif sur Yvette Cedex (France); and others

    2013-06-15

    Ultrathin bismuth iron garnet Bi{sub 3}Fe{sub 5}O{sub 12} films were grown epitaxially on (001)-oriented gadolinium gallium garnet substrates. Film thickness varied from two to three dozens of unit cells. Bi{sub 3}Fe{sub 5}O{sub 12} films grow pseudomorphically on substrates up to a thickness of 20 nm, and then a lattice relaxation occurs. Magnetic properties of the films were studied as a function of bismuth iron garnet thickness. The magnetization and cubic anisotropy decrease with decreasing film thickness. The uniaxial magnetocrystalline anisotropy is constant for all film thicknesses. For two unit cell thick films, the easy magnetization axis changes from in-plane to perpendicular to the plane direction. Such a reorientation takes place as a result of the competition of constant uniaxial perpendicular anisotropy with weakening film magnetization. - Highlights: ► Ultrathin Bi{sub 3}Fe{sub 5}O{sub 12} films were grown epitaxially on structure-matching substrates. ► Magnetic properties of Bi{sub 3}Fe{sub 5}O{sub 12} were studied down to the thickness of 2.5 nm. ► Reorientation of easy magnetization axis as a function of film thickness was observed.

  18. New Bismuth-Substituted Hydroxyapatite Nanoparticles for Bone Tissue Engineering

    Science.gov (United States)

    Ciobanu, Gabriela; Bargan, Ana Maria; Luca, Constantin

    2015-11-01

    New bismuth-substituted hydroxyapatite [Ca10- x Bi x (PO4)6(OH)2 where x = 0-2.5] nanoparticles were synthesized by the co-precipitation method from aqueous solutions. The structural properties of the samples were analyzed by scanning electron microscopy coupled with x-ray analysis, x-ray powder diffraction, x-ray photoelectron spectroscopy, Fourier transform infrared spectroscopy and Brunauer-Emmett-Teller surface area analysis. The results confirm that bismuth ions have been incorporated into the hydroxyapatite lattice. The prepared nanocrystalline powders consisted of hydroxyapatite as single phase with hexagonal structure, crystal sizes smaller than 60 nm and (Bi + Ca)/P atomic ratio of around 1.67. The hydroxyapatite samples doped with Bi have mesoporous textures with pores size of around 2 nm and specific surface area in the range of 12-25 m2/g. The Bi-substituted hydroxyapatite powders are more effective against Gram-negative Escherichia coli bacteria than Gram-positive Staphylococcus aureus bacteria.

  19. Preparation and characterization of nanocrystalline powders of bismuth vanadate

    Energy Technology Data Exchange (ETDEWEB)

    Shantha, K.; Varma, K.B.R. [Indian Inst. of Science, Bangalore (India). Materials Research Centre

    1999-05-31

    The influence of mechanical activation on the formation of Bi{sub 2}VO{sub 5.5}, bismuth vanadate (BiV) phase, was investigated by ball-milling a stoichiometric mixture of bismuth oxide and vanadium pentoxide. The structural evolution of the desired BiV phase, via an intermediate BiVO{sub 4} phase, was investigated using X-ray powder diffraction (XRD), differential thermal analysis (DTA) and transmission electron microscopy (TEM). Milling for 54h yielded monophasic {gamma}-BiV powders with an average crystallite size of 30 nm. The electron paramagnetic resonance (EPR) peaks associated with the V{sup 4+} ions are stronger and broader in nanocrystalline (n) BiV than in the conventionally prepared microcrystalline (m) BiV, suggesting that a significant portion of V{sup 5+} has been transformed to V{sup 4+} during milling. The optical bandgap of n-BiV was found to be higher than that of m-BiV. High density (97% of the theoretical density), fine-grained (average grain-size of 2 {mu}m) ceramics with uniform grain-size distribution could be fabricated using n-BiV powders. These fine-grained ceramics exhibit improved dielectric, pyro and ferroelectric properties. (orig.) 29 refs.

  20. Superconductivity in Bismuth. A New Look at an Old Problem

    Science.gov (United States)

    2016-01-01

    To investigate the relationship between atomic topology, vibrational and electronic properties and superconductivity of bismuth, a 216-atom amorphous structure (a-Bi216) was computer-generated using our undermelt-quench approach. Its pair distribution function compares well with experiment. The calculated electronic and vibrational densities of states (eDOS and vDOS, respectively) show that the amorphous eDOS is about 4 times the crystalline at the Fermi energy, whereas for the vDOS the energy range of the amorphous is roughly the same as the crystalline but the shapes are quite different. A simple BCS estimate of the possible crystalline superconducting transition temperature gives an upper limit of 1.3 mK. The e-ph coupling is more preponderant in a-Bi than in crystalline bismuth (x-Bi) as indicated by the λ obtained via McMillan’s formula, λc = 0.24 and experiment λa = 2.46. Therefore with respect to x-Bi, superconductivity in a-Bi is enhanced by the higher values of λ and of eDOS at the Fermi energy. PMID:26815431

  1. Genotoxic effects of bismuth (III oxide nanoparticles by comet assay

    Directory of Open Access Journals (Sweden)

    Reecep Liman

    2015-06-01

    Full Text Available Bismuth oxide is one of the important transition metal oxides and it has been intensively studied due to their peculiar characteristics (semiconductor band gap, high refractive index, high dielectric permittivity, high oxygen conductivity, resistivity, photoconductivity and photoluminescence etc.. Therefore, it is used such as microelectronics, sensor technology, optical coatings, transparent ceramic glass manufacturing, nanoenergetic gas generator, biosensor for DNA hybridization, potential immobilizing platforms for glucose oxidase and polyphenol oxidase, fuel cells, a additive in paints, an astringent in a variety of medical creams and topical ointments, and for the determination of heavy metal ions in drinking water, mineral water and urine. In addition this, Bismuth (III oxide nanoparticles (BONPs are favorable for the biomolecules adsorption than regular sized particles because of their greater advantages and novel characteristics (much higher specific surface, greater surface free energy, and good electrochemical stability etc.. Genotoxic effects of BONPs were investigated on the root cells of Allium cepa by Comet assay. A. cepa roots were treated with the aqueous dispersions of BONPs at 5 different concentrations (12.5, 25, 50, 75, and 100 ppm for 4 h. A significant increase in DNA damage was also observed at all concentrations of BONPs except 12.5 ppm by Comet assay. The results were also analyzed statistically by using SPSS for Windows; Duncan’s multiple range test was performed. These result indicate that BONPs exhibit genotoxic activity in A. cepa root meristematic cells.

  2. Nonproportionality in the scintillation light yield of bismuth germanate

    CERN Document Server

    Gentile, T R; Breuer, H; Chupp, T E; Coakley, K J; Cooper, R L; Nico, J S; O'Neill, B

    2015-01-01

    We present measurements of nonproportionality in the scintillation light yield of bismuth germanate (BGO) for gamma-rays with energies between 6 keV and 662 keV. The scintillation light was read out by avalanche photodiodes (APDs) with both the BGO crystals and APDs operated at a temperature of approximately 90 K. Data were obtained using radioisotope sources to illuminate both a single BGO crystal in a small test cryostat and a 12-element detector in a neutron radiative beta-decay experiment. In addition one datum was obtained in a 4.6 T magnetic field based on the bismuth K x-ray escape peak produced by a continuum of background gamma rays in this apparatus. These measurements and comparison to prior results were motivated by an experiment to study the radiative decay mode of the free neutron. The combination of data taken under different conditions yields a reasonably consistent picture for BGO nonproportionality that should be useful for researchers employing BGO detectors at low gamma ray energies.

  3. Phase transition of solid bismuth under high pressure

    Science.gov (United States)

    Chen, Hai-Yan; Xiang, Shi-Kai; Yan, Xiao-Zhen; Zheng, Li-Rong; Zhang, Yi; Liu, Sheng-Gang; Bi, Yan

    2016-10-01

    As a widely used pressure calibrator, the structural phase transitions of bismuth from phase I, to phase II, to phase III, and then to phase V with increasing pressure at 300 K have been widely confirmed. However, there are different structural versions for phase III, most of which are determined by x-ray diffraction (XRD) technology. Using x-ray absorption fine structure (XAFS) measurements combined with ab initio calculations, we show that the proposed incommensurate composite structure of bismuth of the three configurations is the best option. An abnormal continuous increase of the nearest-neighbor distance of phase III with elevated pressure is also observed. The electronic structure transformation from semimetal to metal is responsible for the complex behavior of structure transformation. Project supported by the National Natural Science Foundation of China (Grant Nos. 10904133, 11304294, 11274281, 11404006, and U1230201), the Development Foundation of China Academy of Engineering Physics (Grant Nos. 2015B0101004, 2013B0401062, and 2012A0101001), the Research Foundation of the Laboratory of Shock Wave and Detonation, China (Grant No. 9140C670201140C67282).

  4. Pathways for the release of polonium from a lead-bismuth spallation target (thermochemical calculation); Verfluechtigungspfade des Poloniums aus einem Pb-Bi-Spallationstarget (Thermochemische Kalkulation)

    Energy Technology Data Exchange (ETDEWEB)

    Eichler, B.; Neuhausen, J

    2004-06-01

    An analysis of literature data for the thermochemical constants of polonium reveals considerable discrepancies in the relations of these data among each other as well as in their expected trends within the chalcogen group. This fact hinders a reliable assessment of possible reaction paths for the release of polonium from a liquid lead-bismuth spallation target. In this work an attempt is made to construct a coherent data set for the thermochemical properties of polonium and some of its compounds that are of particular importance with respect to the behaviour of polonium in a liquid Pb-Bi target. This data set is based on extrapolations using general trends throughout the periodic table and, in particular, within the chalcogen group. Consequently, no high accuracy should be attributed to the derived data set. However, the data set derived in this work is consistent with definitely known experimental data. Furthermore, it complies with the general trends of physicochemical properties within the chalcogen group. Finally, well known relations between thermochemical quantities are fulfilled by the data derived in this work. Thus, given the lack of accurate experimental data it can be regarded as best available data. Thermochemical constants of polonium hydride, lead polonide and polonium dioxide are derived based on extrapolative procedures. Furthermore, the possibility of formation of the gaseous intermetallic molecule BiPo, which has been omitted from discussion up to now, is investigated. From the derived thermochemical data the equilibrium constants of formation, release and dissociation reactions are calculated for different polonium containing species. Furthermore equilibrium constants are determined for the reaction of lead polonide and polonium dioxide with hydrogen, water vapour and the target components lead and bismuth. The most probable release pathways are discussed. From thermochemical evaluations polonium is expected to be released from liquid lead-bismuth

  5. Bismuth ferrite as low-loss switchable material for plasmonic waveguide modulator

    DEFF Research Database (Denmark)

    Babicheva, Viktoriia; Zhukovsky, Sergei; Lavrinenko, Andrei

    2014-01-01

    We propose new designs of plasmonic modulators, which can beused for dynamic signal switching in photonic integrated circuits. We studyperformance of a plasmonic waveguide modulator with bismuth ferrite as atunable material. The bismuth ferrite core is sandwiched between metalplates (metal...... modulation in both phase andamplitude control schemes. Due to high field confinement between themetal layers, existence of mode cut-offs for certain values of the corethickness, and near-zero material losses in bismuth ferrite, efficientmodulation performance is achieved. For the phase control scheme...

  6. Is the ultra-fast transformation of bismuth non-thermal?

    CERN Document Server

    Gamaly, E G

    2009-01-01

    Transient state of femtosecond laser excited bismuth has been studied by various groups with time-resolved optical, x-ray, and electron probes at the deposited energy density from below through up to several times the equilibrium enthalpy of melting. However, the interpretations of the experimental results are controversial: the optical probes reveal the absence of transition to the melting phase while the authors of x-ray and electron diffraction experiments claim the observation of ultrafast non-thermal melting. The presented analysis, based on temperature dependence of bismuth optical properties, unequivocally shows a purely thermal nature of all the observed fs-laser induced transformations in bismuth.

  7. Exploiting Chemistry to Improve Performance of Screen-Printed, Bismuth Film Electrodes (SP-BiFE)

    Science.gov (United States)

    Dossi, Carlo; Monticelli, Damiano; Pozzi, Andrea; Recchia, Sandro

    2016-01-01

    Mercury substitution is a big issue in electroanalysis, and the search for a suitable, and less toxic, replacement is still under development. Of all the proposed alternatives, bismuth films appear to be the most viable solution, although they are still suffering some drawbacks, particularly the influence of deposition conditions and linearity at low concentrations. In this paper, the most promising strategies for bismuth film deposition on screen-printed electrodes (surface modifications, polymeric film deposition, insoluble salt precursors) will be evaluated for trace metal analysis. Particular attention will be devoted to bismuth chemistry, aiming to rationalize their electroanalytic performance. PMID:27455338

  8. Exploiting Chemistry to Improve Performance of Screen-Printed, Bismuth Film Electrodes (SP-BiFE

    Directory of Open Access Journals (Sweden)

    Carlo Dossi

    2016-07-01

    Full Text Available Mercury substitution is a big issue in electroanalysis, and the search for a suitable, and less toxic, replacement is still under development. Of all the proposed alternatives, bismuth films appear to be the most viable solution, although they are still suffering some drawbacks, particularly the influence of deposition conditions and linearity at low concentrations. In this paper, the most promising strategies for bismuth film deposition on screen-printed electrodes (surface modifications, polymeric film deposition, insoluble salt precursors will be evaluated for trace metal analysis. Particular attention will be devoted to bismuth chemistry, aiming to rationalize their electroanalytic performance.

  9. Frequency of SNP -336A/G in the promoter region of CD209 in a population from northeastern Brazil.

    Science.gov (United States)

    Costa, P N; Ferreira-Fernandes, H; de Oliveira, J S; Pereira, A C T C; Pinto, G R; Ferreira, G P

    2015-08-14

    Dendritic cells (DCs) mediate the initiation of the immune response against a variety of pathogens. The DC-SIGN receptor is encoded by the gene CD209 and is expressed on the surface of DCs. It binds to mannose-rich carbohydrates and enables the recognition of bacteria, fungi, parasites, and viruses. SNP -336A/G in the promoter region of CD209 influences the expression of the DC-SIGN receptor. Several studies have associated this SNP with an increased susceptibility to infectious diseases and the development of more severe forms of disease. Therefore, the aim of this study was to determine the prevalence of SNP -336A/G in a population from northeastern Brazil. We analyzed 181 individuals from the general population of Parnaíba, Piauí, Brazil, of which 37% were men and 63% were women. SNP -336A/G was detected by polymerase chain reaction and treatment with the restriction enzyme MscI and visualized by electrophoresis on an 8% polyacrylamide gel stained with silver nitrate. Of the individuals analyzed, 116 (64.1%) were homozygous AA, 57 (31.5%) were heterozygous (AG), and 8 (4.4%) were homozygous GG. The allele frequency of -336G was 20.2%. Genotype frequencies were in Hardy-Weinberg equilibrium. To the best of our knowledge, this is the first report to describe the frequency of the CD209 SNP -336A/G in a population in the State of Piauí. Further studies are needed to determine the relationship between this SNP and the vulnerability of this population to major infectious diseases.

  10. 48 CFR 1552.209-73 - Notification of conflicts of interest regarding personnel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Notification of conflicts of interest regarding personnel. 1552.209-73 Section 1552.209-73 Federal Acquisition Regulations... guard services, or electrical services, provisions which shall conform substantially to the language...

  11. 48 CFR 252.209-7005 - Reserve Officer Training Corps and military recruiting on campus.

    Science.gov (United States)

    2010-10-01

    ...: Reserve Officer Training Corps and Military Recruiting on Campus (JAN 2000) (a) Definition. “Institution... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Reserve Officer Training Corps and military recruiting on campus. 252.209-7005 Section 252.209-7005 Federal...

  12. 33 CFR 209.310 - Representation of submarine cables and pipelines on nautical charts.

    Science.gov (United States)

    2010-07-01

    ... cables and pipelines on nautical charts. 209.310 Section 209.310 Navigation and Navigable Waters CORPS OF... of submarine cables and pipelines on nautical charts. (a) The policy of the Corps of Engineers with respect to showing the locations of submarine cables and pipelines on nautical charts published by...

  13. 10 CFR 835.209 - Concentrations of radioactive material in air.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Concentrations of radioactive material in air. 835.209... External Exposure § 835.209 Concentrations of radioactive material in air. (a) The derived air... exposures to airborne radioactive material. (b) The estimation of internal dose shall be based on...

  14. 33 CFR 209.180 - Temporary closure of waterway to navigation.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Temporary closure of waterway to navigation. 209.180 Section 209.180 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE... navigation. (a) When an application is received for the temporary closure of a waterway for the...

  15. 33 CFR 209.320 - Policy on release of commercial statistics.

    Science.gov (United States)

    2010-07-01

    ... statistics. 209.320 Section 209.320 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE... statistics. The collection of commercial statistics pertaining to rivers, harbors, and waterways, and annual... waterway statistics. In case Federal or State agencies or local interests request other than...

  16. BDE-209 inhibits pluripotent genes expression and induces apoptosis in human embryonic stem cells.

    Science.gov (United States)

    Du, Lili; Sun, Wen; Zhang, Huili; Chen, Dunjin

    2016-05-01

    Decabromodiphenyl ether (BDE-209) has been detected in human serum, semen, placenta, cord blood and milk worldwide. However, little is known regarding the potential effects on the early human embryonic development of BDE-209. In this study, human embryonic stem cell lines FY-hES-10 and FY-hES-26 were used to evaluate the potential effects and explore the toxification mechanisms using low-level BDE-209 exposure. Our data showed that BDE-209 exposure (1, 10 and 100 nM) reduced the expression of pluripotent genes such as OCT4, SOX2 and NANOG and induced human embryonic stem cells (hESCs) apoptosis. The downregulation of BIRC5/BCL2 and upregulation of BAX were related to apoptosis of hESCs induced by BDE-209 exposure. A mechanism study showed that OCT4 down-regulation accompanied by OCT4 promoter hypermethylation and increasing miR-145/miR-335 levels, OCT4 inhibitors. Moreover, BDE-209 could increase the generation of intracellular reactive oxygen species (ROS) and decrease SOD2 expression. The ROS increase and OCT4 downregulation after BDE-209 exposure could be reversed partly by antioxidant N-acetylcysteine supplement. These findings showed that BDE-209 exposure could decrease pluripotent genes expression via epigenetic regulation and induce apoptosis through ROS generation in human embryonic stem cells in vitro.

  17. 49 CFR 240.209 - Procedures for making the determination on knowledge.

    Science.gov (United States)

    2010-10-01

    ... knowledge. 240.209 Section 240.209 Transportation Other Regulations Relating to Transportation (Continued... determination on knowledge. (a) Each railroad, prior to initially certifying or recertifying any person as an... with the requirements of § 240.125 of this part, demonstrated sufficient knowledge of the...

  18. 23 CFR 636.209 - What items must be included in a phase-two solicitation?

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false What items must be included in a phase-two solicitation? 636.209 Section 636.209 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS DESIGN-BUILD CONTRACTING Selection Procedures, Award Criteria §...

  19. Thermoluminescence studies of bismuth doped Ba xCa 1- xS nanostructures

    Science.gov (United States)

    Singh, Surender; Lochab, S. P.; Kumar, Ravi; Singh, Nafa

    2011-01-01

    Bismuth doped Ba 1- xCa xS:Bi ( x=0-1) nanocrystallities have been prepared by the solid state reaction method and characterized by XRD and TEM. X-ray diffraction analysis shows the formation of the compounds in cubic structure at room temperature. Only partial replacement of Ba is possible and we found that Ba 0.5Ca 0.5S:Bi could not be prepared due to the difference between ionic radii of barium and calcium. Thermoluminescence studies of these samples after exposure to UV radiation have been carried out. The TL glow curve of Ba xCa 1 -xS:Bi has been found to be a simple structure with a single peak at 405, 428 and 503 K for x=1, 0.8 and 0, respectively. The kinetic parameters at various heating rates namely activation energy ( E), order of kinetics ( b) and frequency factor ( s) of the Ba 1- xCa xS:Bi ( x=0.2) (0.4 mol%) sample have been determined using Chen’s method. The deconvolution of curve was done using the GCD function suggested by Kitis. The effect of different heating rates and different amount of dose has also been discussed.

  20. Sol-Gel Synthesis and Characterization of Cubic Bismuth Zinc Niobium Oxide Nanopowders

    Directory of Open Access Journals (Sweden)

    Ganchimeg Perenlei

    2014-01-01

    Full Text Available Bismuth zinc niobium oxide (BZN was successfully synthesized by a diol-based sol-gel reaction utilizing metal acetate and alkoxide precursors. Thermal analysis of a liquid suspension of precursors suggests that the majority of organic precursors decompose at temperatures up to 150°C, and organic free powders form above 350°C. The experimental results indicate that a homogeneous gel is obtained at about 200°C and then converts to a mixture of intermediate oxides at 350–400°C. Finally, single-phased BZN powders are obtained between 500 and 900°C. The degree of chemical homogeneity as determined by X-ray diffraction and EDS mapping is consistent throughout the samples. Elemental analysis indicates that the atomic ratio of metals closely matches a Bi1.5ZnNb1.5O7 composition. Crystallite sizes of the BZN powders calculated from the Scherrer equation are about 33–98 nm for the samples prepared at 500–700°C, respectively. The particle and crystallite sizes increase with increased sintering temperature. The estimated band gap of the BZN nanopowders from optical analysis is about 2.60–2.75 eV at 500-600°C. The observed phase formations and measured results in this study were compared with those of previous reports.

  1. Bismuth oxyiodide-graphene nanocomposites with high visible light photocatalytic activity.

    Science.gov (United States)

    Liu, Hong; Cao, Wei-Ran; Su, Yun; Chen, Zhen; Wang, Yong

    2013-05-15

    A series of chemically bonded Bismuth oxyiodide (BiOI)-graphene (GR) nanocomposites have been synthesized by a facile one-step hydrothermal method. Both the reduction in graphene oxide (GO) and the formation of BiOI nanocrystals were achieved simultaneously during the hydrothermal reaction. The prepared materials were characterized by means of powder X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FT-IR), Raman spectra, high-resolution transmission electron micrographs (HRTEM), UV-vis diffuse reflectance spectra (DRS), and photoluminescence (PL) emission spectroscopy. The photocatalytic activities of these BiOI-GR nanocomposites were evaluated by the degradation of methyl orange. Under visible irradiation (λ>420 nm), the BiOI-GR photocatalysts were found to exhibit higher photocatalytic activities than pure BiOI, and the activity was increased by almost 6 times when loaded with 2.0 wt% graphene. The enhanced photocatalytic activity can be attributed to more effective charge transportations and separations arisen from the strong chemical bonding between BiOI and graphene, the high dye adsorption performance, and the increased light absorption.

  2. In situ formation of bismuth nanoparticles through electron-beam irradiation in a transmission electron microscope

    Science.gov (United States)

    Sepulveda-Guzman, S.; Elizondo-Villarreal, N.; Ferrer, D.; Torres-Castro, A.; Gao, X.; Zhou, J. P.; Jose-Yacaman, M.

    2007-08-01

    In this work, bismuth nanoparticles were synthesized when a precursor, sodium bismuthate, was exposed to an electron beam at room temperature in a transmission electron microscope (TEM). The irradiation effects were investigated in situ using selected-area electron diffraction, high-resolution transmission electron microscopy and x-ray energy dispersive spectroscopy. After the electron irradiation, bismuth nanoparticles with a rhombohedral structure and diameter of 6 nm were observed. The average particle size increased with the irradiation time. The electron-induced reduction is attributed to the desorption of oxygen ions. This method offers a one-step route to synthesize bismuth nanoparticles using electron irradiation, and the particle size can be controlled by the irradiation time.

  3. In situ formation of bismuth nanoparticles through electron-beam irradiation in a transmission electron microscope

    Energy Technology Data Exchange (ETDEWEB)

    Sepulveda-Guzman, S; Elizondo-Villarreal, N; Ferrer, D; Torres-Castro, A; Gao, X; Zhou, J P; Jose-Yacaman, M [Chemical Engineering Department and Texas Materials Institute, University of Texas at Austin, Austin, TX 78712 (United States)

    2007-08-22

    In this work, bismuth nanoparticles were synthesized when a precursor, sodium bismuthate, was exposed to an electron beam at room temperature in a transmission electron microscope (TEM). The irradiation effects were investigated in situ using selected-area electron diffraction, high-resolution transmission electron microscopy and x-ray energy dispersive spectroscopy. After the electron irradiation, bismuth nanoparticles with a rhombohedral structure and diameter of 6 nm were observed. The average particle size increased with the irradiation time. The electron-induced reduction is attributed to the desorption of oxygen ions. This method offers a one-step route to synthesize bismuth nanoparticles using electron irradiation, and the particle size can be controlled by the irradiation time.

  4. Potentiation of the action of metronidazole on Helicobacter pylori by omeprazole and bismuth subcitrate

    DEFF Research Database (Denmark)

    Andersen, L P; Colding, H; Kristiansen, J E

    2000-01-01

    Treatment failures using triple therapy that include metronidazole, are common in patients infected with metronidazole-resistant Helicobacter pylori in the gastric mucosa. Higher eradication rates in such patients have been described when treatment regimens include bismuth salts compared...

  5. Three-component synthesis of amidoalkyl naphthols catalyzed by bismuth(Ⅲ) nitrate pentahydrate

    Institute of Scientific and Technical Information of China (English)

    Min Wang; Yan Liang; Ting Ting Zhang; Jing Jing Gao

    2012-01-01

    Bismuth(Ⅲ) nitrate pentahydrate catalyzed the three-component condensation of β-naphthol,aldehydes and amines/urea under solvent-free conditions to afford the corresponding amidoalkyl naphthols in excellent yields.

  6. Corrosion by liquid lead and lead-bismuth: experimental results review and analysis

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Jinsuo [Los Alamos National Laboratory

    2008-01-01

    Liquid metal technologies for liquid lead and lead-bismuth alloy are under wide investigation and development for advanced nuclear energy systems and waste transmutation systems. Material corrosion is one of the main issues studied a lot recently in the development of the liquid metal technology. This study reviews corrosion by liquid lead and lead bismuth, including the corrosion mechanisms, corrosion inhibitor and the formation of the protective oxide layer. The available experimental data are analyzed by using a corrosion model in which the oxidation and scale removal are coupled. Based on the model, long-term behaviors of steels in liquid lead and lead-bismuth are predictable. This report provides information for the selection of structural materials for typical nuclear reactor coolant systems when selecting liquid lead or lead bismuth as heat transfer media.

  7. Effects of bismuth vandate and anthraquinone dye on the photodegradation of polycarbonate

    OpenAIRE

    Saron,Clodoaldo; Felisberti, Maria Isabel; Zulli, Fabio; Giordano, Marco

    2007-01-01

    Both inorganic and organic compounds, such as oxides or salts of metals and polycyclic and azo compounds, are frequently used as colorants in polymeric systems. Bismuth vanadate pigment has been used as an environmentally friendly alternative for cadmium containing pigments and anthraquinone dyes represent a polycyclic colorant class of wide use in polymers. Besides their coloring properties, both bismuth vanadate and anthraquinone present photocatalytic activity or photochemical properties t...

  8. Reactive magnetron sputtering deposition of bismuth tungstate onto titania nanoparticles for enhancing visible light photocatalytic activity

    Science.gov (United States)

    Ratova, Marina; Kelly, Peter J.; West, Glen T.; Tosheva, Lubomira; Edge, Michele

    2017-01-01

    Titanium dioxide - bismuth tungstate composite materials were prepared by pulsed DC reactive magnetron sputtering of bismuth and tungsten metallic targets in argon/oxygen atmosphere onto anatase and rutile titania nanoparticles. The use of an oscillating bowl placed beneath the two magnetrons arranged in a co-planar closed field configuration enabled the deposition of bismuth tungstate onto loose powders, rather than a solid substrate. The atomic ratio of the bismuth/tungsten coatings was controlled by varying the power applied to each target. The effect of the bismuth tungstate coatings on the phase, optical and photocatalytic properties of titania was investigated by X-ray diffraction, energy-dispersive X-ray spectroscopy (EDX), Brunauer-Emmett-Teller (BET) surface area measurements, transmission electron microscopy (TEM), UV-vis diffuse reflectance spectroscopy and an acetone degradation test. The latter involved measurements of the rate of CO2 evolution under visible light irradiation of the photocatalysts, which indicated that the deposition of bismuth tungstate resulted in a significant enhancement of visible light activity, for both anatase and rutile titania particles. The best results were achieved for coatings with a bismuth to tungsten atomic ratio of 2:1. In addition, the mechanism by which the photocatalytic activity of the TiO2 nanoparticles was enhanced by compounding it with bismuth tungstate was studied by microwave cavity perturbation. The results of these tests confirmed that such enhancement of the photocatalytic properties is due to more efficient photogenerated charge carrier separation, as well as to the contribution of the intrinsic photocatalytic properties of Bi2WO6.

  9. Bismuth ferrite as low-loss switchable material for plasmonic waveguide modulator

    OpenAIRE

    Babicheva, Viktoriia; Zhukovsky, Sergei; Lavrinenko, Andrei

    2014-01-01

    We propose new designs of plasmonic modulators, which can be utilized for dynamic signal switching in photonic integrated circuits. We study performance of plasmonic waveguide modulator with bismuth ferrite as an active material. The bismuth ferrite core is sandwiched between metal plates (metal-insulator-metal configuration), which also serve as electrodes so that the core changes its refractive index under applied voltage by means of partial in-plane to out-of-plane reorientation of ferroel...

  10. Exhaustive removal of chloride ions from water with the aid of a bismuth-based metallic sorbent

    Energy Technology Data Exchange (ETDEWEB)

    Moskvin, L.N.; Ushenko, V.G.

    1988-04-20

    The authors discuss the sorption properties of sorbents based on metallic bismuth, in relation to a solution of the problem of exhaustive removal of chloride ions from water. Metallic sorbents with bismuth contents of 10 mass % on polytetrafluoroethylene were used. The sorption properties of sorbents based on metallic bismuth and on Bi/sub 2/O/sub 3/ were studied under dynamic conditions. Their results show that bismuth-based metal sorbents and sorbents based on bismuth oxide can be used as inorganic anion-exchangers. In order to demonstrate the possibility of selective separation of chloride ions from solutions they determined the dynamic exchange capacity for chloride ions at various nitrate-ion concentrations. The use of the proposed sorbents based on metallic bismuth for exhaustive purification of water lowers the chloride-ion concentration in the water sharply in comparison with the level achieved by ion-exchange purification with the aid of organic anion-exchangers.

  11. Fabrication and characterization of grain-oriented bismuth vanadate ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Shantha, K.; Varma, K.B.R. [Indian Inst. of Science, Bangalore (India). Materials Research Centre

    1997-11-01

    Grain-oriented (GO; 79%), high density (96% of the theoretical value) ceramics of bismuth vanadate, Bi{sub 2}VO{sub 5.5}, have been fabricated via a liquid-phase-aided two-stage sintering process. Scanning electron microscopy (SEM) was employed to monitor the crystallite size and the morphology of the starting powders and the microstructure of the sintered ceramics. X-ray diffraction (XRD) studies were carried out to verify the grain-orientation in the ceramics. The dielectric constant and the conductivity studies carried out along the directions perpendicular and parallel to the pressing axis show significant anisotropies (1.7 and 5.3, respectively, at 300 K). The grain-oriented ceramics were found to exhibit improved ferroelectric properties, with higher remnant polarization (P{sub r}) and lower coercive field (E{sub c}) than those of the randomly oriented (RO) ceramics.

  12. High ionic conductivity in confined bismuth oxide-based heterostructures

    Science.gov (United States)

    Sanna, Simone; Esposito, Vincenzo; Christensen, Mogens; Pryds, Nini

    2016-12-01

    Bismuth trioxide in the cubic fluorite phase (δ -Bi2O3 ) exhibits the highest oxygen ionic conductivity. In this study, we were able to stabilize the pure δ -Bi2O3 at low temperature with no addition of stabilizer but only by engineering the interface, using highly coherent heterostructures made of alternative layers of δ -Bi2O3 and Yttria Stabilized Zirconia (YSZ), deposited by pulsed laser deposition. The resulting [δ -Bi2O3 /YSZ ] heterostructures are found to be stable over a wide temperature range (500-750 °C) and exhibits stable high ionic conductivity over a long time comparable to the value of the pure δ -Bi2O3 , which is approximately two orders of magnitude higher than the conductivity of YSZ bulk.

  13. Structural investigation of Zn doped sodium bismuth borate glasses

    Science.gov (United States)

    Bhatia, V.; Kumar, D.; Singh, D.; Singh, S. P.

    2016-05-01

    A series of Bismuth Borate Oxide Glass samples with composition x(ZnO):(15-x)Na2O:15Bi2O3:70B2O3 (variation in x is from 6 to 12 mole %) have been prepared by conventional melt quenching technique. All the chemicals used were of Analytical Grade. In order to verify the amorphous nature of the prepared samples the X-Ray Diffraction (XRD) was done. The physical and structural properties have been explored by using the techniques such as density, molar volume and FTIR in order to understand the effect of alkali and transition metal ions on the structure of these glasses. The results obtained by these techniques are in good agreement to one another and with literature as well. With the increase in the content of ZnO, the increase in density and some variations in structural coordination (ratio of BO3 & BO4 structural units) have been observed.

  14. High thermoelectric performance of the distorted bismuth(110) layer.

    Science.gov (United States)

    Cheng, L; Liu, H J; Zhang, J; Wei, J; Liang, J H; Jiang, P H; Fan, D D; Sun, L; Shi, J

    2016-07-14

    The thermoelectric properties of the distorted bismuth(110) layer are investigated using first-principles calculations combined with the Boltzmann transport equation for both electrons and phonons. To accurately predict the electronic and transport properties, the quasiparticle corrections with the GW approximation of many-body effects have been explicitly included. It is found that a maximum ZT value of 6.4 can be achieved for n-type systems, which essentially stemmed from the weak scattering of electrons. Moreover, we demonstrate that the distorted Bi layer retains high ZT values in relatively broad regions of both temperature and carrier concentration. Our theoretical work emphasizes that the deformation potential constant characterizing the electron-phonon scattering strength is an important paradigm for searching high thermoelectric performance materials.

  15. Spark plasma sintering of hydrothermally synthesized bismuth ferrite

    Directory of Open Access Journals (Sweden)

    Zorica Branković

    2016-12-01

    Full Text Available Bismuth ferrite, BiFeO3 (BFO, powder was synthesized by hydrothermal method from Bi(NO33·5 H2O and Fe(NO33·9 H2O as precursors. The synthesized powder was further sintered using spark plasma sintering (SPS. The sintering conditions were optimized in order to achieve high density, minimal amount of secondary phases and improved ferroelectric and magnetic properties. The optimal structure and properties were achieved after spark plasma sintering at 630 °C for 20 min, under uniaxial pressure of 90 MPa. The composition, microstructure, ferroelectric and magnetic properties of the SPS samples were characterized and compared to those of conventionally sintered ceramics obtained from the same powder. Although the samples sintered using conventional method showed slightly lower amount of secondary phases, the spark plasma sintered samples exhibited favourable microstructure and better ferroelectric properties.

  16. High ionic conductivity in confined bismuth oxide-based heterostructures

    Directory of Open Access Journals (Sweden)

    Simone Sanna

    2016-12-01

    Full Text Available Bismuth trioxide in the cubic fluorite phase (δ-Bi2O3 exhibits the highest oxygen ionic conductivity. In this study, we were able to stabilize the pure δ-Bi2O3 at low temperature with no addition of stabilizer but only by engineering the interface, using highly coherent heterostructures made of alternative layers of δ-Bi2O3 and Yttria Stabilized Zirconia (YSZ, deposited by pulsed laser deposition. The resulting [δ-Bi2O3/YSZ] heterostructures are found to be stable over a wide temperature range (500-750 °C and exhibits stable high ionic conductivity over a long time comparable to the value of the pure δ-Bi2O3, which is approximately two orders of magnitude higher than the conductivity of YSZ bulk.

  17. Formic Acid Oxidation at Platinum-Bismuth Clusters

    DEFF Research Database (Denmark)

    Lovic, J. D.; Stevanovic, S. I.; Tripkovic, D. V.

    2014-01-01

    Formic acid oxidation was studied on platinum-bismuth deposits on glassy carbon (GC) substrate. The catalysts of equimolar ratio were prepared by potentiostatic deposition using chronocoulometry. Bimetallic structures obtained by two-step process, comprising deposition of Bi followed by deposition...... of Pt, were characterized by AFM spectroscopy which indicated that Pt crystallizes preferentially onto previously formed Bi particles. The issue of Bi leaching (dissolution) from PtBi catalysts, and their catalytic effect alongside the HCOOH oxidation is rather unresolved. In order to control Bi...... dissolution, deposits were subjected to electrochemical oxidation, in the relevant potential range and supporting electrolyte, prior to use as catalysts for HCOOH oxidation. Anodic striping charges indicated that along oxidation procedure most of deposited Bi was oxidized. ICP mass spectroscopy analysis...

  18. Bismuth Sodium Titanate Based Materials for Piezoelectric Actuators

    Directory of Open Access Journals (Sweden)

    Klaus Reichmann

    2015-12-01

    Full Text Available The ban of lead in many electronic products and the expectation that, sooner or later, this ban will include the currently exempt piezoelectric ceramics based on Lead-Zirconate-Titanate has motivated many research groups to look for lead-free substitutes. After a short overview on different classes of lead-free piezoelectric ceramics with large strain, this review will focus on Bismuth-Sodium-Titanate and its solid solutions. These compounds exhibit extraordinarily high strain, due to a field induced phase transition, which makes them attractive for actuator applications. The structural features of these materials and the origin of the field-induced strain will be revised. Technologies for texturing, which increases the useable strain, will be introduced. Finally, the features that are relevant for the application of these materials in a multilayer design will be summarized.

  19. Process dependent thermoelectric properties of EDTA assisted bismuth telluride

    Science.gov (United States)

    Kulsi, Chiranjit; Kargupta, Kajari; Banerjee, Dipali

    2016-04-01

    Comparison between the structure and thermoelectric properties of EDTA (Ethylene-diamine-tetra-acetic acid) assisted bismuth telluride prepared by electrochemical deposition and hydrothermal route is reported in the present work. The prepared samples have been structurally characterized by high resolution X-ray diffraction spectra (HRXRD), field emission scanning electron microscopy (FESEM) and high resolution transmission electron microscopic images (HRTEM). Crystallite size and strain have been determined from Williamson-Hall plot of XRD which is in conformity with TEM images. Measurement of transport properties show sample in the pellet form (S1) prepared via hydrothermal route has higher value of thermoelectric power (S) than the electrodeposited film (S2). But due to a substantial increase in the electrical conductivity (σ) of the film (S2) over the pellet (S1), the power factor and the figure of merit is higher for sample S2 than the sample S1 at room temperature.

  20. Shock-Wave Consolidation of Nanostructured Bismuth Telluride Powders

    Science.gov (United States)

    Beck, Jan; Alvarado, Manuel; Nemir, David; Nowell, Mathew; Murr, Lawrence; Prasad, Narasimha

    2012-06-01

    Nanostructured thermoelectric powders can be produced using a variety of techniques. However, it is very challenging to build a bulk material from these nanopowders without losing the nanostructure. In the present work, nanostructured powders of the bismuth telluride alloy system are obtained in kilogram quantities via a gas atomization process. These powders are characterized using a variety of methods including scanning electron microscopy, transition electron microscopy, and x-ray diffraction analysis. Then the powders are consolidated into a dense bulk material using a shock-wave consolidation technique whereby a nanopowder-containing tube is surrounded by explosives and then detonated. The resulting shock wave causes rapid fusing of the powders without the melt and subsequent grain growth of other techniques. We describe the test setup and consolidation results.

  1. A novel synthesis of perovskite bismuth ferrite nanoparticles

    Directory of Open Access Journals (Sweden)

    Alexandre Z. Simões

    2011-09-01

    Full Text Available Microwave assisted hydrothermal (MAH method was used to synthesize crystalline bismuth ferrite (BiFeO3 nanoparticles (BFO at temperature of 180°C with times ranging from 5 min to 1 h. For comparison, BFO powders were also crystallized by the soft chemistry route in a conventional furnace at a temperature of 850°C for 4 h. X-ray diffraction (XRD results verified the formation of perovskite BFO crystallites while infrared data showed no traces of carbonate. Field emission scanning microcopy (FE/SEM revealed a homogeneous size distribution of nanometric BFO powders. MAH method produced nanoparticles of 96% pure perovskite, with a size of 130 nm. These results are in agreement with Raman scattering values which show that the MAH synthesis route is rapid and cost effective. This method could be used as an alternative to other chemical methods in order to obtain BFO nanoparticles.

  2. Bismuth coatings deposited by the pulsed dc sputtering technique

    Energy Technology Data Exchange (ETDEWEB)

    Ortiz, M. F.; Olaya, J. J.; Alfonso, J. E., E-mail: jealfonsoo@unal.edu.co [Universidad Nacional de Colombia, Departamento de Fisica, Grupo de Ciencia de Materiales y Superficies, Carrera 45 No. 26-85, Edif. Uriel Gutierrez, Bogota D. C. (Colombia)

    2013-08-01

    In this work we present the results obtained from the deposition of nano-structured bismuth coatings through Dc pulsed unbalanced magnetron sputtering. The coatings were grown on two substrates: silicon and AISI steel 316 L. The microstructure of the Bi coatings grown on silicon and the corrosion resistance of the Bi coatings grown on AISI steel were evaluated. The microstructure was evaluated by X-ray diffraction and the corrosion resistance was characterized by means of polarization potentiodynamic and electrochemical impedance spectroscopy. Finally the morphology of the coatings was evaluated through scanning electronic microscopy. The X-ray diffraction analysis indicates that the coatings are polycrystalline; the corrosion resistance tests indicate that the films with better corrosion resistance were deposited at 40 khz. Scanning electron microscopy micrographs show that the coatings are grown as granular form. (Author)

  3. Nano sized bismuth oxy chloride by metal organic chemical vapour deposition

    Energy Technology Data Exchange (ETDEWEB)

    Jagdale, Pravin, E-mail: pravin.jagdale@polito.it [Department of Applied Science and Technology (DISAT), Politecnico di Torino, 10129 (Italy); Castellino, Micaela [Center for Space Human Robotics, Istituto Italiano di Tecnologia, Corso Trento 21, 10129 Torino (Italy); Marrec, Françoise [Laboratory of Condensed Matter Physics, University of Picardie Jules Verne (UPJV), Amiens 80039 (France); Rodil, Sandra E. [Instituto de Investigaciones en Materiales, Universidad Nacional Autonoma de Mexicom (UNAM), Mexico D.F. 04510 (Mexico); Tagliaferro, Alberto [Department of Applied Science and Technology (DISAT), Politecnico di Torino, 10129 (Italy)

    2014-06-01

    Metal organic chemical vapour deposition (MOCVD) method was used to prepare thin films of bismuth based nano particles starting from bismuth salts. Nano sized bismuth oxy chloride (BiOCl) crystals were synthesized from solution containing bismuth chloride (BiCl{sub 3}) in acetone (CH{sub 3}-CO-CH{sub 3}). Self-assembly of nano sized BiOCl crystals were observed on the surface of silicon, fused silica, copper, carbon nanotubes and aluminium substrates. Various synthesis parameters and their significant impact onto the formation of self-assembled nano-crystalline BiOCl were investigated. BiOCl nano particles were characterized by X-ray diffraction, X-ray photoelectron spectroscopy, field emission scanning electron microscopy, energy-dispersive X-ray spectroscopy and Micro-Raman spectroscopy. These analyses confirm that bismuth nanometer-sized crystal structures showing a single tetragonal phase were indeed bismuth oxy chloride (BiOCl) square platelets 18–250 nm thick and a few micrometres wide.

  4. Adverse events with bismuth salts for Helicobacter pylori eradication:Systematic review and meta-analysis

    Institute of Scientific and Technical Information of China (English)

    Alexander C Ford; Peter Malfertheiner; Monique Giguére; José Santana; Mostafizur Khan; Paul Moayyedi

    2008-01-01

    AIM:To assess the safety of bismuth used in Helicobacter pylori (H pylori) eradication therapy regimens.METHODS:We conducted a systematic review and meta-analysis.MEDLINE and EMBASE were searched (up to October 2007) to identify randomised controlled trials comparing bismuth with placebo or no treatment,or bismuth salts in combination with antibiotics as part of eradication therapy with the same dose and duration of antibiotics alone or,in combination,with acid suppression.Total numbers of adverse events were recorded.Data were pooled and expressed as relative risks with 95% confidence intervals (CI).RESULTS:We identified 35 randomised controlled trials containing 4763 patients.There were no serious adverse events occurring with bismuth therapy.There was no statistically significant difference detected in total adverse events with bismuth [relative risk (RR)=1.01;95% CI:0.87-1.16],specific individual adverse events,with the exception of dark stools (RR = 5.06;95% CI:1.59-16.12),or adverse events leading to withdrawal of therapy (RR = 0.86;95% CI:0.54-1.37).CONCLUSION:Bismuth for the treatment of H pylori is safe and well-tolerated.The only adverse event occurring significantly more commonly was dark stools.

  5. Zerovalent bismuth nanoparticles inhibit Streptococcus mutans growth and formation of biofilm

    Science.gov (United States)

    Hernandez-Delgadillo, Rene; Velasco-Arias, Donaji; Diaz, David; Arevalo-Niño, Katiushka; Garza-Enriquez, Marianela; De la Garza-Ramos, Myriam A; Cabral-Romero, Claudio

    2012-01-01

    Background and methods Despite continuous efforts, the increasing prevalence of resistance among pathogenic bacteria to common antibiotics has become one of the most significant concerns in modern medicine. Nanostructured materials are used in many fields, including biological sciences and medicine. While some bismuth derivatives has been used in medicine to treat vomiting, nausea, diarrhea, and stomach pain, the biocidal activity of zerovalent bismuth nanoparticles has not yet been studied. The objective of this investigation was to analyze the antimicrobial activity of bismuth nanoparticles against oral bacteria and their antibiofilm capabilities. Results Our results showed that stable colloidal bismuth nanoparticles had 69% antimicrobial activity against Streptococcus mutans growth and achieved complete inhibition of biofilm formation. These results are similar to those obtained with chlorhexidine, the most commonly used oral antiseptic agent. The minimal inhibitory concentration of bismuth nanoparticles that interfered with S. mutans growth was 0.5 mM. Conclusion These results suggest that zerovalent bismuth nanoparticles could be an interesting antimicrobial agent to be incorporated into an oral antiseptic preparation. PMID:22619547

  6. Wine as a digestive aid: comparative antimicrobial effects of bismuth salicylate and red and white wine.

    Science.gov (United States)

    Weisse, M. E.; Eberly, B.; Person, D. A.

    1995-01-01

    OBJECTIVE--To test whether red and white wines are as potent as bismuth salicylate against the bacteria responsible for traveller's diarrhoea to try to explain wine's legendary reputation as a digestive aid. DESIGN--Red and white wine, bismuth salicylate, two solutions containing ethanol (diluted absolute ethanol and tequila), and sterilised water were tested against suspensions of salmonella, shigella, and Escherichia coli to determine relative antibacterial activity. Suspensions of 10(7) colony forming units of shigella, salmonella, and E coli were added to the test solutions and plated on standard nutrient agar at 0, 10, 20, 30, 60, and 120 minutes and 24 hours. Dilutions of wine and bismuth salicylate were then tested with E coli as the test bacterium, and the experiment repeated. MAIN OUTCOME MEASURES--Exposure times necessary for eradication of organisms for the different solutions; decreases in colony counts at the different exposure times for dilutions of wine and bismuth salicylates. RESULTS--Undiluted wine and bismuth salicylate were both effective in reducing the number of viable organisms (by 10(5)-10(6) colony forming units) after 20-30 minutes. Dilutions of wine were much more effective in decreasing colony counts than were similar dilutions of bismuth salicylate. CONCLUSION--The antibacterial property of wine is largely responsible for wine's reputation as a digestive aid. Images p1659-a PMID:8541747

  7. Large-Area Dry Transfer of Single-Crystalline Epitaxial Bismuth Thin Films.

    Science.gov (United States)

    Walker, Emily S; Na, Seung Ryul; Jung, Daehwan; March, Stephen D; Kim, Joon-Seok; Trivedi, Tanuj; Li, Wei; Tao, Li; Lee, Minjoo L; Liechti, Kenneth M; Akinwande, Deji; Bank, Seth R

    2016-11-09

    We report the first direct dry transfer of a single-crystalline thin film grown by molecular beam epitaxy. A double cantilever beam fracture technique was used to transfer epitaxial bismuth thin films grown on silicon (111) to silicon strips coated with epoxy. The transferred bismuth films retained electrical, optical, and structural properties comparable to the as-grown epitaxial films. Additionally, we isolated the bismuth thin films on freestanding flexible cured-epoxy post-transfer. The adhesion energy at the bismuth/silicon interface was measured to be ∼1 J/m(2), comparable to that of exfoliated and wet transferred graphene. This low adhesion energy and ease of transfer is unexpected for an epitaxially grown film and may enable the study of bismuth's unique electronic and spintronic properties on arbitrary substrates. Moreover, this method suggests a route to integrate other group-V epitaxial films (i.e., phosphorus) with arbitrary substrates, as well as potentially to isolate bismuthene, the atomic thin-film limit of bismuth.

  8. Constraints on anomalous QGC's in $e^{+}e^{-}$ interactions from 183 to 209 GeV

    CERN Document Server

    Heister, A; Barate, R; Brunelière, R; De Bonis, I; Décamp, D; Goy, C; Jézéquel, S; Lees, J P; Martin, F; Merle, E; Minard, M N; Pietrzyk, B; Trocmé, B; Bravo, S; Casado, M P; Chmeissani, M; Crespo, J M; Fernández, E; Fernández-Bosman, M; Garrido, L; Martínez, M; Pacheco, A; Ruiz, H; Colaleo, A; Creanza, D; De Filippis, N; De Palma, M; Iaselli, G; Maggi, G; Maggi, M; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Abbaneo, D; Barklow, T; Buchmüller, O L; Cattaneo, M; Clerbaux, B; Drevermann, H; Forty, R W; Frank, M; Gianotti, F; Hansen, J B; Harvey, J; Hutchcroft, D E; Janot, P; Jost, B; Kado, M; Mato, P; Moutoussi, A; Ranjard, F; Rolandi, Luigi; Schlatter, W D; Sguazzoni, G; Teubert, F; Valassi, Andrea; Videau, I; Badaud, F; Dessagne, S; Falvard, A; Fayolle, D; Gay, P; Jousset, J; Michel, B; Monteil, S; Pallin, D; Pascolo, J M; Perret, P; Hansen, J D; Hansen, J R; Hansen, P H; Kraan, A C; Nilsson, B S; Kyriakis, A; Markou, C; Simopoulou, Errietta; Vayaki, Anna; Zachariadou, K; Blondel, A; Brient, J C; Machefert, F P; Rougé, A; Videau, H L; Ciulli, V; Focardi, E; Parrini, G; Antonelli, A; Antonelli, M; Bencivenni, G; Bossi, F; Capon, G; Cerutti, F; Chiarella, V; Laurelli, P; Mannocchi, G; Murtas, G P; Passalacqua, L; Kennedy, J; Lynch, J G; Negus, P; O'Shea, V; Thompson, A S; Wasserbaech, S R; Cavanaugh, R J; Dhamotharan, S; Geweniger, C; Hanke, P; Hepp, V; Kluge, E E; Putzer, A; Stenzel, H; Tittel, K; Wunsch, M; Beuselinck, R; Cameron, W; Davies, G; Dornan, P J; Girone, M; Hill, R D; Marinelli, N; Nowell, J; Rutherford, S A; Sedgbeer, J K; Thompson, J C; White, R; Ghete, V M; Girtler, P; Kneringer, E; Kuhn, D; Rudolph, G; Bouhova-Thacker, E; Bowdery, C K; Clarke, D P; Ellis, G; Finch, A J; Foster, F; Hughes, G; Jones, R W L; Pearson, M R; Robertson, N A; Smizanska, M; van der Aa, O; Delaere, C; Leibenguth, G; Lemaître, V; Blumenschein, U; Hölldorfer, F; Jakobs, K; Kayser, F; Kleinknecht, K; Müller, A S; Renk, B; Sander, H G; Schmeling, S; Wachsmuth, H W; Zeitnitz, C; Ziegler, T; Bonissent, A; Coyle, P; Curtil, C; Ealet, A; Fouchez, D; Payre, P; Tilquin, A; Ragusa, F; David, A; Dietl, H; Ganis, G; Hüttmann, K; Lütjens, G; Männer, W; Moser, H G; Settles, Ronald; Villegas, M; Wolf, G; Boucrot, J; Callot, O; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Jacholkowska, A; Serin, L; Veillet, J J; Azzurri, P; Bagliesi, G; Boccali, T; Foà, L; Giammanco, A; Giassi, A; Ligabue, F; Messineo, A; Palla, F; Sanguinetti, G; Sciabà, A; Spagnolo, P; Tenchini, R; Venturi, A; Verdini, P G; Awunor, O; Blair, G A; Cowan, G; García-Bellido, A; Green, M G; Medcalf, T; Misiejuk, A; Strong, J A; Teixeira-Dias, P; Clifft, R W; Edgecock, T R; Norton, P R; Tomalin, I R; Ward, J J; Bloch-Devaux, B; Boumediene, D E; Colas, P; Fabbro, B; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Rander, J; Tuchming, B; Vallage, B; Litke, A M; Taylor, G; Booth, C N; Cartwright, S; Combley, F; Hodgson, P N; Lehto, M H; Thompson, L F; Böhrer, A; Brandt, S; Grupen, C; Hess, J; Ngac, A; Prange, G; Borean, C; Giannini, G; He, H; Pütz, J; Rothberg, J E; Armstrong, S R; Berkelman, K; Cranmer, K; Ferguson, D P S; Gao, Y; González, S; Hayes, O J; Hu, H; Jin, S; Kile, J; McNamara, P A; Nielsen, J; Pan, Y B; Von Wimmersperg-Töller, J H; Wiedenmann, W; Wu, J; Wu Sau Lan; Wu, X; Zobernig, G; Dissertori, G

    2004-01-01

    The acoplanar photon pairs produced in the reaction e+ e- --> nu nubar gamma gamma are analysed in the 700 inverse nanobarns of data collected by the ALEPH detector at centre-of-mass energies between 183 and 209 GeV. No deviation from the Standard Model predictions is seen in any of the distributions examined. The resulting 95% C.L. limits set on the anomalous QGC's, az_0, az_c, aw_0 and aw_c, are -0.012 GeV**-2 < az_0/Lambda**2 < +0.019 GeV**-2, -0.041 GeV**-2 < az_c/Lambda**2 < +0.044 GeV**-2, -0.060 GeV**-2 < aw_0/Lambda**2 < +0.055 GeV**-2, -0.099 GeV**-2 < aw_c/Lambda**2 < +0.093 GeV**-2, where Lambda is the energy scale of the new Physics responsible for the anomalous couplings.

  9. Constraints on anomalous QGCs in $e^{+}e^{-}$ interactions from 183 to 209 GeV

    CERN Document Server

    Heister, A; Antonelli, A; Antonelli, M; Armstrong, S R; Awunor, O; Azzurri, P; Badaud, F; Bagliesi, G; Barate, R; Barklow, T; Bencivenni, G; Berkelman, K; Beuselinck, R; Blair, G A; Bloch-Devaux, B; Blondel, A; Blumenschein, U; Boccali, T; Böhrer, A; Bonissent, A; Booth, C N; Borean, C; Bossi, F; Boucrot, J; Bouhova-Thacker, E; Boumediene, D E; Bowdery, C K; Brandt, S; Bravo, S; Brient, J C; Brunelière, R; Buchmüller, O L; Callot, O; Cameron, W; Capon, G; Cartwright, S; Casado, M P; Cattaneo, M; Cavanaugh, R J; Cerutti, F; Chiarella, V; Chmeissani, M; Ciulli, V; Clarke, D P; Clerbaux, B; Clifft, R W; Colaleo, A; Colas, P; Combley, F; Cowan, G; Coyle, P; Cranmer, K; Creanza, D; Crespo, J M; Curtil, C; David, A; Davier, M; Davies, G; De Bonis, I; De Filippis, N; Décamp, D; Delaere, C; Dessagne, S; Dhamotharan, S; Dietl, H; Dissertori, G; Dornan, P J; Drevermann, H; Duflot, L; Ealet, A; Edgecock, T R; Ellis, G; Fabbro, B; Falvard, A; Fayolle, D; Ferguson, D P S; Fernández-Bosman, M; Fernández, E; Finch, A J; Foà, L; Focardi, E; Forty, R W; Foster, F; Fouchez, D; Frank, M; Ganis, G; Gao, Y; García-Bellido, A; Garrido, L; Gay, P; Geweniger, C; Ghete, V M; Giammanco, A; Giannini, G; Gianotti, F; Giassi, A; Girone, M; Girtler, P; González, S; Goy, C; Green, M G; Grivaz, J F; Grupen, C; Hanke, P; Hansen, J B; Hansen, J D; Hansen, J R; Hansen, P H; Harvey, J; Hayes, O J; He, H; Hepp, V; Hess, J; Heusse, P; Hill, R D; Hodgson, P N; Hölldorfer, F; Hu, H; Huang, X; Hughes, G; Hutchcroft, D E; Hüttmann, K; Iaselli, G; Jacholkowska, A; Jakobs, K; Janot, P; Jézéquel, S; Jin, S; Jones, R W L; Jost, B; Jousset, J; Kado, M; Kayser, F; Kennedy, J; Kile, J; Kleinknecht, K; Kluge, E E; Kneringer, E; Kraan, A C; Kuhn, D; Kyriakis, A; Langon, E; Laurelli, P; Lees, J P; Lehto, M H; Leibenguth, G; Lemaire, M C; Lemaître, V; Ligabue, F; Lin, J; Litke, A M; Locci, E; Lütjens, G; Lynch, J G; Machefert, F; Maggi, G; Maggi, M; Männer, W; Mannocchi, G; Marinelli, N; Markou, C; Martin, F; Martínez, M; Mato, P; McNamara, P A; Medcalf, T; Merle, E; Messineo, A; Michel, B; Miiller, A S; Minard, M N; Misiejuk, A; Monteil, S; Moser, H G; Moutoussi, A; Murtas, G P; Negus, P; Ngac, A; Nielsen, J; Nilsson, B S; Norton, P R; Nowell, J; Nuzzo, S; O'Shea, V; Ouyang, Q; Pacheco, A; Palla, F; Pallin, D; Pan, Y B; Parrini, G; Pascolo, J M; Passalacqua, L; Payre, P; Pearson, M R; Pérez, P; Perret, P; Pietrzyk, B; Prange, G; Pütz, J; Putzer, A; Ragusa, F; Rander, J; Ranieri, A; Ranjard, F; Raso, G; Renk, B; Robertson, N A; Rolandi, Luigi; Rothberg, J E; Rougé, A; Rudolph, G; Ruggieri, F; Ruiz, H; Rutherford, S A; Sander, H G; Sanguinetti, G; Schael, S; Schlatter, W D; Schmeling, S; Sciabà, A; Sedgbeer, J K; Selvaggi, G; Serin, L; Settles, R; Sguazzoni, G; Silvestris, L; Simopoulou, E; Smizanska, M; Spagnolo, P; Stenzel, H; Strong, J A; Taylor, G; Teixeira-Dias, P; Tempesta, P; Tenchini, R; Teubert, F; Thompson, A S; Thompson, J C; Thompson, L F; Tilquin, A; Tittel, K; Tomalin, I R; Tricomi, A; Trocmé, B; Tuchming, B; Valassi, A; Vallage, B; Vayaki, A; Veillet, J J; Venturi, A; Verdini, P G; Videau, H L; Videau, I; Villegas, M; Wachsmuth, H W; Wang, T; Ward, J J; Wasserbaech, S R; White, R; Wiedenmann, W; Wolf, G; Wu, J; Wu, S L; Wu, X; Wunsch, M; Xie, Y; Xu, R; Xue, S; Zachariadou, K; Zeitnitz, C; Zhang, J; Zhang, L; Zhao, W; Ziegler, T; Zito, G; Zobernig, G; De Palma, M; van der Aa, O; Von Wimmersperg-Töller, J H

    2004-01-01

    The acoplanar photon pairs produced in the reaction e/sup +/e/sup to / nu nu gamma gamma are analysed in the 700 pb/sup -1/ of data collected by the ALEPH detector at centre-of-mass energies between 183 and 209 GeV. No deviation from the standard model predictions is seen in any of the distributions examined. The resulting 95% C.L. limits set on the anomalous QGCs, a/sub 0//sup Z/, a/sub c//sup Z/, a /sub 0//sup W/ a/sub c//sup W/, are -0.012

  10. Role of stirring assist during solvothermal synthesis for preparing single-crystal bismuth telluride hexagonal nanoplates

    Energy Technology Data Exchange (ETDEWEB)

    Takashiri, Masayuki, E-mail: takashiri@tokai-u.jp [Department of Materials Science, Tokai University, 4-1-1 Kitakaname, Hiratsuka, Kanagawa 259-1292 (Japan); Kai, Shintaro; Wada, Kodai [Department of Materials Science, Tokai University, 4-1-1 Kitakaname, Hiratsuka, Kanagawa 259-1292 (Japan); Takasugi, Soichi [Graduate School of Science and Technology, Tokai University, 4-1-1 Kitakaname, Hiratsuka, Kanagawa 259-1292 (Japan); Tomita, Koji [Department of Chemistry, Tokai University, 4-1-1 Kitakaname, Hiratsuka, Kanagawa 259-1292 (Japan)

    2016-04-15

    We investigated the role of stirring assist during solvothermal synthesis for preparing high quality bismuth telluride (Bi{sub 2}Te{sub 3}) hexagonal nanoplates. We performed a series of experiments that comprised solvothermal synthesis with stirring assist at 500 rpm and without stirring assist. As a result, high purity Bi{sub 2}Te{sub 3} hexagonal nanoplates with uniform morphology and edge length of 400–800 nm were obtained by solvothermal synthesis using stirring assist, whereas intermediate products such as tellurium and tellurium oxide compounds were also produced besides the Bi{sub 2}Te{sub 3} hexagonal nanoplates by solvothermal synthesis without stirring assist. To further study the nanostructure of the nanoplates with stirring assist, we performed high-resolution transmission electron microscopy and selected-area electron diffraction analysis. It was found that the Bi{sub 2}Te{sub 3} hexagonal nanoplates were composed of rhombohedral phases and highly single-crystalline structures. Based on the experimental and analytical results, we propose a possible reaction process and growth mechanism of the Bi{sub 2}Te{sub 3} hexagonal nanoplates. The reaction rate is the key factor to control the shapes of nanostructures. When the reaction rate was sufficient, it proceeded to the final stage, and then Bi{sub 2}Te{sub 3} nanoplates were produced. However, when the reaction rate was insufficient, the entire morphology evolution process was terminated at the intermediate stage, and intermediate products besides Bi{sub 2}Te{sub 3} nanoplates were also produced. - Highlights: • High quality Bi{sub 2}Te{sub 3} hexagonal nanoplates were prepared by solvothermal synthesis. • Role of stirring assist during the solvothermal synthesis were investigated. • Bi{sub 2}Te{sub 3} hexagonal nanoplates with edge length of 400–800 nm were obtained. • Bi{sub 2}Te{sub 3} hexagonal nanoplates were composed of single-crystalline structures. • The reaction rate is the key

  11. Neutron detection and multiplicity counting using a boron-loaded plastic scintillator/bismuth germanate phoswich detector array

    Energy Technology Data Exchange (ETDEWEB)

    Miller, M.C.

    1998-03-01

    Neutron detection and multiplicity counting has been investigated using a boron-loaded plastic scintillator/bismuth germanate phoswich detector array. Boron-loaded plastic combines neutron moderation (H) and detection ({sup 10}B) at the molecular level, thereby physically coupling increasing detection efficiency and decreasing die-away time with detector volume. Both of these characteristics address a fundamental limitation of thermal-neutron multiplicity counters, where {sup 3}He proportional counters are embedded in a polyethylene matrix. Separation of the phoswich response into its plastic scintillator and bismuth germanate components was accomplished on a pulse-by-pulse basis using custom integrator and timing circuits. In addition, a custom time-tag module was used to provide a time for each detector event. Analysis of the combined energy and time event stream was performed by calibrating each detector`s response and filtering based on the presence of a simultaneous energy deposition corresponding to the {sup 10}B(n,alpha) reaction products in the plastic scintillator (93 keV{sub ee}) and the accompanying neutron-capture gamma ray in the bismuth germanate (478 keV). Time-correlation analysis was subsequently performed on the filtered event stream to obtain shift-register-type singles and doubles count rates. Proof-of-principle measurements were conducted with a variety of gamma-ray and neutron sources including {sup 137}Cs, {sup 54}Mn, AmLi, and {sup 252}Cf. Results of this study indicate that a neutron-capture probability of {approximately}10% and a die-away time of {approximately}10 {micro}s are possible with a 4-detector array with a detector volume of 1600 cm{sup 3}. Simulations were performed that indicate neutron-capture probabilities on the order of 50% and die-away times of less than 4 {micro}s are realistically achievable. While further study will be required for practical application of such a detection system, the results obtained in this

  12. Progress in bismuth molybdenum composite oxide%铋钼复合氧化物的研究进展

    Institute of Scientific and Technical Information of China (English)

    程琳; 李榕; 甄强

    2013-01-01

    In this work,a variety of the preparation methods of bismuth molybdenum composite oxides have been summarized,such as solid state reaction,precipitation,sol-gel,hydrothermal method,spray-drying and so on.The advantages and disadvantages of these methods were also commented.Then,the application of bis-muth molybdenum composite oxides were introduced,including oxidation catalysts,photocatalysts and electro-lyte materials,as well as the effect of structure,morphology,composition on the properties of the material. The development direction of the preparation techniques,components,structure and morphology were pointed out,in view of its application field.%综述了多种铋钼复合氧化物的制备方法:固相反应法、沉淀法、溶胶-凝胶法、水热法以及喷雾干燥法等,分析了这些方法的优缺点。同时综述了铋钼复合氧化物在氧化反应催化、光催化、电解质材料等领域的应用以及材料的结构、形貌对于其性能的影响。针对铋钼复合氧化物不同的应用领域提出了制备技术、材料组分和结构与形貌的发展方向。

  13. Photon Events with Missing Energy in $e^{+}e^{-}$ Collisions at $\\sqrt{s}$ = 130 to 209 GeV

    CERN Document Server

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alderweireld, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barbier, R; Bardin, Dimitri Yuri; Barker, G J; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Bugge, L; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F R; Chapkin, M M; Charpentier, P; Checchia, P; Chierici, R; Shlyapnikov, P; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Dalmau, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L S; Di Ciaccio, L; Di Simone, A; Doroba, K; Drees, J; Dris, M; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J A; Gandelman, M; García, C; Gavillet, P; Gazis, E N; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Herr, H; Hoffman, J; Holmgren, S O; Holt, P J; Houlden, M A; Hultqvist, K; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Johansson, P D; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Katsoufis, E C; Kernel, G; Kersevan, B P; Kerzel, U; Kiiskinen, A P; King, B T; Kjaer, N J; Kluit, P; Kokkinias, P; Kourkoumelis, C; Kuznetsov, O; Krumshtein, Z; Kucharczyk, M; Lamsa, J; Leder, G; Ledroit, F; Leinonen, L; Leitner, R; Lemonne, J; Lepeltier, V; Lesiak, T; Liebig, W; Liko, D; Lipniacka, A; Lopes, J H; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L; Murray, W; Muryn, B; Myatt, G; Myklebust, T; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Nicolaidou, R; Nikolenko, M; Oblakowska-Mucha, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, R; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Palacios, J P; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V F; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Pozdnyakov, V; Pukhaeva, N; Pullia, Antonio; Rames, J; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Roudeau, P; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Sander, C; Savoy-Navarro, A; Schwickerath, U; Segar, A; Sekulin, R L; Siebel, M; Sissakian, A N; Smadja, G; Smirnova, O G; Sokolov, A; Sopczak, A; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Timmermans, J; Tkatchev, L G; Tobin, M; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G; van Dam, P; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I; Vegni, G; Veloso, F; Venus, W A; Verdier, P; Verzi, V; Vilanova, D; Vitale, L; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G; Winter, M; Witek, M; Yushchenko, O P; Zalewska-Bak, A; Zalewski, P; Zavrtanik, D; Zhuravlov, V; Zimin, N I; Zintchenko, A; Zupan, M

    2005-01-01

    The production of single- and multi-photon events has been studied in the reaction e+e- -> gamma (gamma) + invisible particles. The data collected with the DELPHI detector during the years 1999 and 2000 at centre-of-mass energies between 191 GeV and 209 GeV was combined with earlier data to search for phenomena beyond the Standard Model. The measured number of light neutrino families was consistent with three and the absence of an excess of events beyond that predicted by the Standard Model processes was used to set limits on new physics. Both model-independent searches and searches for new processes predicted by supersymmetric and extra-dimensional models have been made. Limits on new non-standard model interactions between neutrinos and electrons were also determined.

  14. Spectroscopic Characterization of Extracellular Polymeric Substances from Escherichia coli and Serratia marcescens: Suppression using Sub-Inhibitory Concentrations of Bismuth Thiols

    Energy Technology Data Exchange (ETDEWEB)

    Badireddy, Appala R.; Korpol, Bhoom Reddy; Chellam, Shankararaman; Gassman, Paul L.; Engelhard, Mark H.; Lea, Alan S.; Rosso, Kevin M.

    2008-10-21

    Free and capsular EPS produced by Escherichia coli and Serratia marcescens were characterized in detail using Fourier transform infrared spectroscopy (FTIR), X-ray photoelectron spectroscopy (XPS), and Auger electron spectroscopy (AES). Total EPS production decreased upon treatment with sub-inhibitory concentrations of lipophilic bismuth thiols (bismuth dimercaptopropanol, BisBAL; bismuth ethanedithiol, BisEDT; and bismuth pyrithione, BisPYR), BisBAL being most effective. Bismuth thiols also influenced acetylation and carboxylation of polysaccharides in EPS from S. marcescens. Extensive homology between EPS samples in the presence and absence of bismuth was observed with proteins, polysaccharides, and nucleic acids varying predominantly only in the total amount expressed. Second derivative analysis of the amide I region of FTIR spectra revealed decreases in protein secondary structures in the presence of bismuth thiols. Hence, anti-fouling properties of bismuth thiols appear to originate in their ability to suppress O-acetylation and protein secondary structures in addition to total EPS secretion.

  15. Dextran coated bismuth-iron oxide nanohybrid contrast agents for computed tomography and magnetic resonance imaging.

    Science.gov (United States)

    Naha, Pratap C; Zaki, Ajlan Al; Hecht, Elizabeth; Chorny, Michael; Chhour, Peter; Blankemeyer, Eric; Yates, Douglas M; Witschey, Walter R T; Litt, Harold I; Tsourkas, Andrew; Cormode, David P

    2014-12-14

    Bismuth nanoparticles have been proposed as a novel CT contrast agent, however few syntheses of biocompatible bismuth nanoparticles have been achieved. We herein report the synthesis of composite bismuth-iron oxide nanoparticles (BION) that are based on a clinically approved, dextran-coated iron oxide formulation; the particles have the advantage of acting as contrast agents for both CT and MRI. BION were synthesized and characterized using various analytical methods. BION CT phantom images revealed that the X-ray attenuation of the different formulations was dependent upon the amount of bismuth present in the nanoparticle, while T2-weighted MRI contrast decreased with increasing bismuth content. No cytotoxicity was observed in Hep G2 and BJ5ta cells after 24 hours incubation with BION. The above properties, as well as the yield of synthesis and bismuth inclusion efficiency, led us to select the Bi-30 formulation for in vivo experiments, performed in mice using a micro-CT and a 9.4 T MRI system. X-ray contrast was observed in the heart and blood vessels over a 2 hour period, indicating that Bi-30 has a prolonged circulation half-life. Considerable signal loss in T2-weighted MR images was observed in the liver compared to pre-injection scans. Evaluation of the biodistribution of Bi-30 revealed that bismuth is excreted via the urine, with significant concentrations found in the kidneys and urine. In vitro experiments confirmed the degradability of Bi-30. In summary, dextran coated BION are biocompatible, biodegradable, possess strong X-ray attenuation properties and also can be used as T2-weighted MR contrast agents.

  16. Bismuth oxide aqueous colloidal nanoparticles inhibit Candida albicans growth and biofilm formation

    Directory of Open Access Journals (Sweden)

    Hernandez-Delgadillo R

    2013-04-01

    Full Text Available Rene Hernandez-Delgadillo,1 Donaji Velasco-Arias,3 Juan Jose Martinez-Sanmiguel,2 David Diaz,3 Inti Zumeta-Dube,3 Katiushka Arevalo-Niño,1 Claudio Cabral-Romero2 1Facultad de Ciencias Biológicas, Instituto de Biotecnologia, Universidad Autonoma de Nuevo Leon, UANL, Monterrey, Mexico; 2Facultad de Odontología, Universidad Autonoma de Nuevo Leon, UANL, Monterrey, México; 3Facultad de Quimica, Universidad Nacional Autonoma de Mexico, UNAM, Distrito Federal, México Abstract: Multiresistance among microorganisms to common antimicrobials has become one of the most significant concerns in modern medicine. Nanomaterials are a new alternative to successfully treat the multiresistant microorganisms. Nanostructured materials are used in many fields, including biological sciences and medicine. Recently, it was demonstrated that the bactericidal activity of zero-valent bismuth colloidal nanoparticles inhibited the growth of Streptococcus mutans; however the antimycotic potential of bismuth nanostructured derivatives has not yet been studied. The main objective of this investigation was to analyze the fungicidal activity of bismuth oxide nanoparticles against Candida albicans, and their antibiofilm capabilities. Our results showed that aqueous colloidal bismuth oxide nanoparticles displayed antimicrobial activity against C. albicans growth (reducing colony size by 85% and a complete inhibition of biofilm formation. These results are better than those obtained with chlorhexidine, nystatin, and terbinafine, the most effective oral antiseptic and commercial antifungal agents. In this work, we also compared the antimycotic activities of bulk bismuth oxide and bismuth nitrate, the precursor metallic salt. These results suggest that bismuth oxide colloidal nanoparticles could be a very interesting candidate as a fungicidal agent to be incorporated into an oral antiseptic. Additionally, we determined the minimum inhibitory concentration for the synthesized

  17. Zerovalent bismuth nanoparticles inhibit Streptococcus mutans growth and formation of biofilm

    Directory of Open Access Journals (Sweden)

    Hernandez-Delgadillo R

    2012-04-01

    Full Text Available Rene Hernandez-Delgadillo1, Donaji Velasco-Arias2, David Diaz2, Katiushka Arevalo-Niño1, Marianela Garza-Enriquez1, Myriam A De la Garza-Ramos1, Claudio Cabral-Romero11Instituto de Biotecnologia, Centro de Investigacion y Desarrollo en Ciencias de la Salud, CIDICS, Facultad de Odontologia, Universidad Autonoma de Nuevo Leon, UANL, Monterrey, Nuevo Leon, 2Facultad de Quimica, Universidad Nacional Autonoma de Mexico, Distrito Federal, MexicoBackground and methods: Despite continuous efforts, the increasing prevalence of resistance among pathogenic bacteria to common antibiotics has become one of the most significant concerns in modern medicine. Nanostructured materials are used in many fields, including biological sciences and medicine. While some bismuth derivatives has been used in medicine to treat vomiting, nausea, diarrhea, and stomach pain, the biocidal activity of zerovalent bismuth nanoparticles has not yet been studied. The objective of this investigation was to analyze the antimicrobial activity of bismuth nanoparticles against oral bacteria and their antibiofilm capabilities.Results: Our results showed that stable colloidal bismuth nanoparticles had 69% antimicrobial activity against Streptococcus mutans growth and achieved complete inhibition of biofilm formation. These results are similar to those obtained with chlorhexidine, the most commonly used oral antiseptic agent. The minimal inhibitory concentration of bismuth nanoparticles that interfered with S. mutans growth was 0.5 mM.Conclusion: These results suggest that zerovalent bismuth nanoparticles could be an interesting antimicrobial agent to be incorporated into an oral antiseptic preparation.Keywords: zerovalent bismuth nanoparticles, antimicrobial agent, biofilm, Streptococcus mutans

  18. Biodegradation of Decabromodiphenyl Ether (BDE-209 by Crude Enzyme Extract from Pseudomonas aeruginosa

    Directory of Open Access Journals (Sweden)

    Yu Liu

    2015-09-01

    Full Text Available The biodegradation effect and mechanism of decabromodiphenyl ether (BDE-209 by crude enzyme extract from Pseudomonas aeruginosa were investigated. The results demonstrated that crude enzyme extract exhibited obviously higher degradation efficiency and shorter biodegradation time than Pseudomonas aeruginosa itself. Under the optimum conditions of pH 9.0, 35 °C and protein content of 2000 mg/L, 92.77% of the initial BDE-209 (20 mg/L was degraded after 5 h. A BDE-209 biodegradation pathway was proposed on the basis of the biodegradation products identified by GC-MS analysis. The biodegradation mechanism showed that crude enzyme extract degraded BDE-209 into lower brominated PBDEs and OH-PBDEs through debromination and hydroxylation of the aromatic rings.

  19. 49 CFR 180.209 - Requirements for requalification of specification cylinders.

    Science.gov (United States)

    2010-10-01

    ... CONTINUING QUALIFICATION AND MAINTENANCE OF PACKAGINGS Qualification, Maintenance and Use of Cylinders § 180... incorporated into § 180.209 because of the inaccurate amendatory instruction. For the convenience of the...

  20. Fission of Weakly Prolate 119Sn and Weakly Oblate 209Bi Nuclei Induced by 500 and 672 MeV Negative Pions

    Institute of Scientific and Technical Information of China (English)

    Mukhtar Ahmed Rana; Gul Sher,Shahid Manzoor; M.I.Shahzad

    2011-01-01

    @@ Fission cross-sections of 119Sn and 209Bi induced by negative pions of two energies 500 and 672 MeV were measured using a CR-39 nuclear track detector.Target-detector stacks were exposed to pion beams at the Brookhaven National Laboratory(USA).Measurement results are compared with the corresponding calculations using the computer code CEM95.Agreement between measurements and calculations is fairly good for the 209Bi target nuclei whereas it is poor for 119Sn at both investigated energies of 500 and 672 MeV Fission cross-section results of 119Sn and 209Bi are explained using the equilibrium properties of these nuclides including nuclear electric quadrupole moments which determine the shapes of nuclei.A logarithmic dependence of fission cross-section on Z2/A is observed for the above-mentioned reactions and a critical limit of Z2/A is identified with the value of 30 which divides the curve of of versus Z2/A into two regimes,one with weak dependence and the other with strong dependence.%Fission cross-sections of 119Sn and 20gBi induced by negative pions of two energies 500 and 672 MeV were measured using a CR-39 nuclear track detector. Target-detector stacks were exposed to pion beams at the Brookhaven National Laboratory (USA). Measurement results are compared with the corresponding calculations using the computer code CEM95. Agreement between measurements and calculations is fairly good for the 209Bi target nuclei whereas it is poor for 119Sn at both investigated energies of 500 and 672 MeV. Fission cross-section results of 119Sn and 209Bi are explained using the equilibrium properties of these nuclides including nuclear electric quadrupole moments which determine the shapes of nuclei. A logarithmic dependence of fission cross-section on Z2/A is observed for the above-mentioned reactions and a critical limit of Z2/A is identified with the value of 30 which divides the curve of at versus Z2 /A into two regimes, one with weak dependence and the other with strong

  1. Analysis of single and binary phases in cerium doped sodium bismuth titanate -inorganic materials Na{sub 0}.5Bi{sub (}0.5-x)Ce{sub x}TiO{sub 3}; Estudio de fases simples y binarias en BNT puro y dopado con cerio Na{sub 0},5Bi{sub (}0,5-x)Ce{sub x}TiO{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Supriya, S.; Dos Santos-Garcia, A. J.; Frutos, J. de; Fernandez-Martinez, F.

    2015-07-01

    The pure and cerium doped sodium bismuth titanate (NBT) inorganic powders were synthesized by solid-state reaction method. The presence of rhombohedral phase was observed in cerium doped NBT compounds. When x= 0.05 of cerium doped NBT is heat treated at 1200 degree centigrade, the compound forms single perovskite phase. The samples of x = 0.10 and 0.15 were heat treated up to 1350 degree centigrade, the binary phases with cerium and bismuth oxides were observed. The X-ray diffraction, Fourier transform infrared spectroscopy, reflectance spectra, differential thermal analysis and thermogravimetric analysis were used to analyze the various properties of samples. Moreover, the effects of cerium doping and calcining temperature on NBT samples were investigated. In this work, we present our recent results on the synthesis and characterization of cerium doped sodium bismuth titanate materials. (Author)

  2. CLASH-VLT: Environment-driven evolution of galaxies in the z=0.209 cluster Abell 209

    CERN Document Server

    Annunziatella, M; Biviano, A; Girardi, M; Nonino, M; Balestra, I; Rosati, P; Caminha, G Bartosch; Brescia, M; Gobat, R; Grillo, C; Lombardi, M; Sartoris, B; De Lucia, G; Demarco, R; Frye, B; Fritz, A; Moustakas, J; Scodeggio, M; Kuchner, U; Maier, C; Ziegler, B

    2016-01-01

    The analysis of galaxy properties and the relations among them and the environment, can be used to investigate the physical processes driving galaxy evolution. We study the cluster A209 by using the CLASH-VLT spectroscopic data combined with Subaru photometry, yielding to 1916 cluster members down to a stellar mass of 10^{8.6} Msun. We determine: i) the stellar mass function of star-forming and passive galaxies; ii) the intra-cluster light and its properties; iii) the orbits of low- and high-mass passive galaxies; and iv) the mass-size relation of ETGs. The stellar mass function of the star-forming galaxies does not depend on the environment, while the slope found for passive galaxies becomes flatter in the densest region. The color distribution of the intra-cluster light is consistent with the color of passive members. The analysis of the dynamical orbits shows that low-mass passive galaxies have tangential orbits, avoiding small pericenters around the BCG. The mass-size relation of low-mass passive ETGs is ...

  3. Altitudinal distributions of BDE-209 and other polybromodiphenyl ethers in high mountain lakes

    Energy Technology Data Exchange (ETDEWEB)

    Bartrons, Mireia [Department of Environmental Chemistry, Institute of Environmental Assessment and Water Research (IDAEA-CSIC), Jordi Girona, 18, 08034 Barcelona, Catalonia (Spain); Limnology Unit (CSIC-UB), Centre for Advanced Studies of Blanes (CEAB-CSIC), Acces Cala St. Francesc, 14, 17300 Blanes, Catalonia (Spain); Grimalt, Joan O., E-mail: joan.grimalt@idaea.csic.es [Department of Environmental Chemistry, Institute of Environmental Assessment and Water Research (IDAEA-CSIC), Jordi Girona, 18, 08034 Barcelona, Catalonia (Spain); Catalan, Jordi [Limnology Unit (CSIC-UB), Centre for Advanced Studies of Blanes (CEAB-CSIC), Acces Cala St. Francesc, 14, 17300 Blanes, Catalonia (Spain)

    2011-07-15

    The present study shows the occurrence of 2,2',3,3',4,4',5,5',6,6'-decabromodiphenyl ether (BDE-209) in microbial biofilms of Pyrenean and Tatra high mountain lakes despite its low vapor pressure and high hydrophobicity. Aerosol air transport is therefore a feasible mechanism for BDE-209 accumulation in sites up to 2688 m above sea level. This compound and other PBDEs exhibit altitudinally-dependent distribution involving higher concentrations with increasing mountain lake elevation. However, the apparently very high enthalpies of the concentration gradients observed, including BDE-209, suggest that bacterial anaerobic debromination also plays a significant role in the resulting altitudinal distributions. This microbial mechanism explains the relative abundances of PBDEs and their within lake differences between rocky and sediment microbial biofilms, thereby showing that the altitudinal pattern observed is not purely due to water temperature control on bacterial activity but also to changes in the availability of anaerobic microenvironments which increase with increasing lake productivity at lower altitudes. - Highlights: > BDE-209 is found in high mountain areas despite its low vapor pressure. > Aerosol air transport may transport BDE-209 to high mountain sites. > BDE-209 and PBDEs exhibit altitudinally-dependent distributions. > PBDE bacterial anaerobic debromination is important in mountain areas. > Biodegradation may generate altitudinal and latitudinal concentration gradients. - Decabromodiphenyl ether and the other polybromodiphenyl congeners show vertical distributions in high mountains due to temperature effects and microbial degradation.

  4. Bismuth nanoparticles synthesized by laser ablation in lubricant oils for tribological tests

    Energy Technology Data Exchange (ETDEWEB)

    Flores-Castañeda, M., E-mail: mar.floc@hotmail.com [Universidad Autónoma del Estado de México, Av. Instituto Literario No. 100, Oriente Col. Centro, Toluca, Estado de México C.P. 50000, México (Mexico); Instituto Nacional de Investigaciones Nucleares, Carretera México-Toluca s/n, La Marquesa, Ocoyoacac, Edo. de México C.P. 52750, México (Mexico); Camps, E. [Instituto Nacional de Investigaciones Nucleares, Carretera México-Toluca s/n, La Marquesa, Ocoyoacac, Edo. de México C.P. 52750, México (Mexico); Camacho-López, M. [Universidad Autónoma del Estado de México, Av. Instituto Literario No. 100, Oriente Col. Centro, Toluca, Estado de México C.P. 50000, México (Mexico); Muhl, S. [Instituto de Investigación en Materiales (UNAM), Circuito Exterior, Ciudad Universitaria, Coyoacán, 04510 México, D.F., México (Mexico); and others

    2015-09-15

    Highlights: • Bismuth nanoparticles have been obtained by laser ablation of solids in liquids. • The technique allows controlling the size and concentration of the samples. • Bi np’s in base oils can improve the tribological characteristics of the lubricant. - Abstract: The improvement of the tribological properties of mineral base oils through the addition of bismuth nanoparticles as an additive, together with the idea of obtaining lubricants free of heavy metals, was evaluated. Bismuth nanoparticles were produced directly in the heavy and light viscosity mineral base oils (BS900 and BS6500) using the technique of laser ablation of solids immersed in liquids. Transmission electron microscopy measurements showed the presence of pure bismuth nanoparticles. Small Angle X-ray Scattering (SAXS) measurements showed that the average size of the nanoparticles was between 7 and 65 nm depending on the experimental conditions used. The tribological properties of the base oil with the bismuth nanoparticles additives were evaluated using a four-ball tester. Tests were performed using the base oil with and without Bi nanoparticles. It was observed that the coefficient of friction of the oil decrease with an increasing concentration of the nanoparticles. The results also showed that the wear rate was reduced when the Bi nanoparticle additives were used.

  5. Bismuth Modified Carbon-Based Electrodes for the Determination of Selected Neonicotinoid Insecticides

    Directory of Open Access Journals (Sweden)

    Marko Rodić

    2011-05-01

    Full Text Available Two types of bismuth modified electrodes, a bismuth-film modified glassy carbon (BiF-GCE and a bismuth bulk modified carbon paste, were applied for the determination of selected nitroguanidine neonicotinoid insecticides. The method based on an ex situ prepared BiF-GCE operated in the differential pulse voltammetric (DPV mode was applied to determine clothianidin in the concentration range from 2.5 to 23 μg cm−3 with a relative standard deviation (RSD not exceeding 1.5%. The tricresyl phosphate-based carbon paste electrodes (TCP-CPEs, bulk modified with 5 and 20 w/w% of bismuth, showed a different analytical performance in the determination of imidacloprid, regarding the peak shape, potential window, and noise level. The TCP-CPE with 5% Bi was advantageous, and the developed DPV method based on it allowed the determination in the concentration range from 1.7 to 60 μg cm−3 with an RSD of 2.4%. To get a deeper insight into the morphology of the bismuth-based sensor surfaces, scanning electron microscopic measurements were performed of both the surface film and the bulk modified electrodes.

  6. Facile solvothermal synthesis of a graphene nanosheet-bismuth oxide composite and its electrochemical characteristics

    Energy Technology Data Exchange (ETDEWEB)

    Wang Huanwen [Key Laboratory of Eco-Environment-Related Polymer Materials of Ministry of Education, Key Laboratory of Polymer Materials of Gansu Province, College of Chemistry and Chemical Engineering, Northwest Normal University, Lanzhou 730070 (China); Hu Zhongai, E-mail: zhongai@nwnu.edu.c [Key Laboratory of Eco-Environment-Related Polymer Materials of Ministry of Education, Key Laboratory of Polymer Materials of Gansu Province, College of Chemistry and Chemical Engineering, Northwest Normal University, Lanzhou 730070 (China); Chang Yanqin; Chen Yanli; Lei Ziqiang; Zhang Ziyu; Yang Yuying [Key Laboratory of Eco-Environment-Related Polymer Materials of Ministry of Education, Key Laboratory of Polymer Materials of Gansu Province, College of Chemistry and Chemical Engineering, Northwest Normal University, Lanzhou 730070 (China)

    2010-12-01

    This work demonstrates a novel and facile route for preparing graphene-based composites comprising of metal oxide nanoparticles and graphene. A graphene nanosheet-bismuth oxide composite as electrode materials of supercapacitors was firstly synthesized by thermally treating the graphene-bismuth composite, which was obtained through simultaneous solvothermal reduction of the colloidal dispersions of negatively charged graphene oxide sheets in N,N-dimethyl formamide (DMF) solution of bismuth cations at 180 {sup o}C. The morphology, composition, and microstructure of the composites together with pure graphite oxide, and graphene were characterized using powder X-ray diffraction (XRD), FT-IR, field emission scanning electron microscopy (FESEM), transmission electron microscope (TEM), thermogravimetry and differential thermogravimetry (TG-DTG). The electrochemical behaviors were measured by cyclic voltammogram (CV), galvanostatic charge-discharge and electrochemical impedance spectroscopy (EIS). The specific capacitance of 255 F g{sup -1} (based on composite) is obtained at a specific current of 1 A g{sup -1} as compared with 71 F g{sup -1} for pure graphene. The loaded-bismuth oxide achieves a specific capacitance as high as 757 F g{sup -1} even at 10 A g{sup -1}. In addition, the graphene nanosheet-bismuth oxide composite electrode exhibits the excellent rate capability and well reversibility.

  7. How reliable are environmental data on 'orphan' elements? The case of bismuth concentrations in surface waters.

    Science.gov (United States)

    Filella, Montserrat

    2010-01-01

    Like all elements of the periodic table, bismuth is ubiquitously distributed throughout the environment as a result of natural processes and human activities. It is present as Bi(III) in environmental, biological and geochemical samples. Although bismuth and its compounds are considered to be non-toxic to humans, its increasing use as a replacement for lead has highlighted how little is known about its environmental and ecotoxicological behaviour. In this first critical review paper on the existing information on bismuth occurrence in natural waters, 125 papers on fresh and marine waters have been collated. Although the initial objective of this study was to establish the range of the typical concentrations of total dissolved bismuth in natural waters, this proved impossible to achieve due to the wide, and hitherto unexplained, dispersion of published data. Since analytical limitations might be one of the reasons underlying value dispersion, new analytical methods published since 2000--intended to be applied to natural waters--have also been reviewed. Disappointingly, the detection limits of the bulk of them are well above those required; they are thus of limited usefulness. Analysis of the existing information on bismuth in secondary references (i.e., books, review chapters) and on its chemical speciation in seawater revealed that the uncritical reproduction of old data is a widespread practice.

  8. Computational chemistry calculations of stability for bismuth nanotubes, fullerene-like structures and hydrogen-containing nanostructures.

    Science.gov (United States)

    Kharissova, Oxana V; Osorio, Mario; Vázquez, Mario Sánchez; Kharisov, Boris I

    2012-08-01

    Using molecular mechanics (MM+), semi-empirical (PM6) and density functional theory (DFT) (B3LYP) methods we characterized bismuth nanotubes. In addition, we predicted the bismuth clusters {Bi(20)(C(5V)), Bi(24)(C(6v)), Bi(28)(C(1)), B(32)(D(3H)), Bi(60)(C(I))} and calculated their conductor properties.

  9. Magnetic and Electrical Characteristics of Bismuth Ferrite, Depending on the Impurities, Method of Preparation and Size of the Nanoparticles

    Directory of Open Access Journals (Sweden)

    V.M. Sarnatsky

    2016-10-01

    Full Text Available The prospect of application of the multiferroics in devices and spintronics devices is shown. A comparative analysis of magnetic and dielectric properties of nanostructures based on bismuth ferrite which were synthesized by various ways was made. The results of studies of the structure and properties of the nanostructured bismuth ferrite powder, synthesized by combustion of nitrate - organic precursors, are presented.

  10. A binary palladium-bismuth nanocatalyst with high activity and stability for alkaline glucose electrooxidation

    Science.gov (United States)

    Chen, Cheng-Chuan; Lin, Cheng-Lan; Chen, Lin-Chi

    2015-08-01

    Binary palladium-bismuth nanocatalysts supported on functionalized multi-walled carbon nanotubes (Pd-Bi/C) are synthesized using a one-pot polyol method. The prepared Pd-Bi/C catalysts have a metal particle range from 5.25 to 12.98 nm and are investigated for alkaline electrocatalytic glucose oxidation reaction (GOR). The physical properties of the catalysts are characterized by X-ray diffraction (XRD), scanning electron microscopy with energy-dispersive X-ray spectroscopy (SEM-EDS), transmission electron microscopy (TEM) and X-ray photoelectron spectroscopy (XPS). The electrochemical activities are determined by cyclic voltammetry (CV), linear sweep voltammetry (LSV), Tafel analysis and chronoamperomtry (CA) for comparing the electrochemical active surface area (ECSA), GOR onset potential, GOR peak current density, Tafel slope, poisoning rate and cycling stability of the Pd-Bi/C catalysts. It is found that Pd-Bi/C (1:0.14) can significantly enhance the electrocatalytic activity on GOR about 40% times higher than Pd/C and as well as has a 3.7-fold lower poisoning rate. The in-use stability of Pd-Bi/C (1:0.14) is also remarkably improved, according to the results of the 200 cycling CV test. The effects of the operating temperature and the concentration of glucose and NaOH electrolyte on Pd-Bi/C (1:0.14) are further studied in this work. The highest Pd-Bi/C catalyzed GOR current density of 29.5 mA cm-2 is attained in alkaline medium.

  11. Dielectric properties and microstructural characterization of cubic pyrochlored bismuth magnesium niobates

    KAUST Repository

    Zhang, Yuan

    2013-08-06

    Cubic bismuth pyrochlores in the Bi2O3 Bi 2O3-MgO-Nb2O5 Nb2O 5 system have been investigated as promising dielectric materials due to their high dielectric constant and low dielectric loss. Here, we report on the dielectric properties and microstructures of cubic pyrochlored Bi 1.5 MgNb 1.5 O 7 Bi1.5MgNb1.5O7 (BMN) ceramic samples synthesized via solid-state reactions. The dielectric constant (measured at 1 MHz) was measured to be ∼ 120 ∼120 at room temperature, and the dielectric loss was as low as 0.001. X-ray diffraction patterns demonstrated that the BMN samples had a cubic pyrochlored structure, which was also confirmed by selected area electron diffraction (SAED) patterns. Raman spectrum revealed more than six vibrational models predicted for the ideal pyrochlore structure, indicating additional atomic displacements of the A and O′ O\\' sites from the ideal atomic positions in the BMN samples. Structural modulations of the pyrochlore structure along the [110] and [121] directions were observed in SAED patterns and high-resolution transmission electron microscopy (HR-TEM) images. In addition, HR-TEM images also revealed that the grain boundaries (GBs) in the BMN samples were much clean, and no segregation or impure phase was observed forming at GBs. The high dielectric constants in the BMN samples were ascribed to the long-range ordered pyrochlore structures since the electric dipoles formed at the superstructural direction could be enhanced. The low dielectric loss was attributed to the existence of noncontaminated GBs in the BMN ceramics. © 2013 Springer-Verlag Berlin Heidelberg.

  12. Thermodynamic assessment of solubility and activity of iron, chromium, and nickel in lead bismuth eutectic

    Science.gov (United States)

    Gossé, Stéphane

    2014-06-01

    Lead-Bismuth Eutectic (LBE) is a heavy liquid alloy used as a coolant for the Lead-Cooled Fast Reactors and spallation target for Accelerator Driven Systems. LBE is also considered in sodium fast reactor designs as coolant in secondary circuit to avoid any occurrence of the reaction between sodium and water in steam generators. Even if this coolant presents many advantages due to its thermophysical properties, corrosion towards structural materials remains one of the major issues of LBE. Because corrosion in LBE is partly driven by dissolution processes, the solubility and chemical activity of the main elements of the alloy are the key parameters to model the related corrosion processes. Using the Calphad method and the Thermo-Calc software, a thermodynamic database was developed to assess the interaction between Cr-Ni-Fe alloys and LBE. The current thermodynamic data on the Cr-Fe-Ni + Bi-Pb quinary system was reviewed and the Bi-Cr and Cr-Pb binary phase diagrams were assessed. Fe, Cr and Ni solubilities (in at. fraction, T in K) at LBE composition were calculated: Fe solubility at LBE composition: log10 (SFe)=0.5719-4398.6T (399-1173 K) Cr solubility at LBE composition: log10 (SCr)=-0.2757-3056.1T (399-1173 K) Ni solubility at LBE composition: log10 (SNi)=2.8717-2932.9T (528-742 K) log10 (SNi)=0.2871-1006.3T (742-1173 K) Then, the thermodynamic assessment performed in this study was used to predict more accurately the Fe, Cr and Ni activities and solubilities in the case of four austenitic model alloys also studied in the framework of corrosion tests [1]. The calculated activities and solubilities provide thermodynamic data to better understand dissolution or precipitation phenomena observed during LBE corrosion processes.

  13. Behavior of decabromodiphenyl ether (BDE-209) in soil: Effects of rhizosphere and mycorrhizal colonization of ryegrass roots

    Energy Technology Data Exchange (ETDEWEB)

    Wang Sen [State Key Laboratory of Environmental Chemistry and Ecotoxicology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, P.O. Box 2871, Beijing 100085 (China); Zhang Shuzhen, E-mail: szzhang@rcees.ac.cn [State Key Laboratory of Environmental Chemistry and Ecotoxicology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, P.O. Box 2871, Beijing 100085 (China); Huang, Honglin [State Key Laboratory of Environmental Chemistry and Ecotoxicology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, P.O. Box 2871, Beijing 100085 (China); Christie, Peter [Agri-Environment Branch, Agri-Food and Biosciences Institute, Newforge Lane, Belfast BT9 5PX (United Kingdom)

    2011-03-15

    A rhizobox experiment was conducted to investigate degradation of decabromodiphenyl ether (BDE-209) in the rhizosphere of ryegrass and the influence of root colonization with an arbuscular mycorrhizal (AM) fungus. BDE-209 dissipation in soil varied with its proximity to the roots and was enhanced by AM inoculation. A negative correlation (P < 0.001, R{sup 2} = 0.66) was found between the residual BDE-209 concentration in soil and soil microbial biomass estimated as the total phospholipid fatty acids, suggesting a contribution of microbial degradation to BDE-209 dissipation. Twelve and twenty-four lower brominated PBDEs were detected in soil and plant samples, respectively, with a higher proportion of di- through hepta-BDE congeners in the plant tissues than in the soils, indicating the occurrence of BDE-209 debromination in the soil-plant system. AM inoculation increased the levels of lower brominated PBDEs in ryegrass. These results provide important information about the behavior of BDE-209 in the soil-plant system. - Research highlights: > BDE-209 dissipation in soil was affected by the proximity to the roots. > Microbial degradation contributes greatly to BDE-209 dissipation in the soil. > Twelve and twenty-four lower brominated PBDEs were detected in soil and plant samples. > AM inoculation increased root uptake and accumulation of BDE-209. - BDE-209 dissipation and degradation in soil were affected by both its proximity to ryegrass roots and inoculation with an AM fungus.

  14. One-dimensional Topological Edge States of Bismuth Bilayers

    Science.gov (United States)

    Drozdov, Ilya; Alexandradinata, Aris; Jeon, Sangjun; Nadj-Perge, Stevan; Ji, Huiwen; Cava, Robert; Bernevig, B. Andrei; Yazdani, Ali

    2014-03-01

    The hallmark of a time-reversal symmetry protected topologically insulating state of matter in two-dimensions (2D) is the existence of chiral edge modes propagating along the perimeter of the sample. Bilayers of bismuth (Bi), an elemental system theoretically predicted to be a Quantum Spin Hall (QSH) insulator1, has been studied with Scanning Tunneling Microscopy (STM) and the electronic structure of its bulk and edge modes has been experimentally investigated. Spectroscopic mapping with STM reveals the presence of the state bound to the edges of the Bi-bilayer. By visualizing quantum interference of the edge state quasi-particles in confined geometries we characterize their dispersion and demonstrate that their properties are consistent with the absence of backscattering. Hybridization of the edge modes to the underlying substrate will be discussed. [1] Shuichi Murakami, Phys. Rev. Lett. 97, 236805 (2006). The work at Princeton and the Princeton Nanoscale Microscopy Laboratory was supported by ARO MURI program W911NF-12-1-0461, DARPA-SPWAR Meso program N6601-11-1-4110, NSF-DMR1104612, and NSF-MRSEC programs through the Princeton Center for Complex Materials (DMR-0819860)

  15. Antibacterial effect of bismuth subsalicylate nanoparticles synthesized by laser ablation

    Energy Technology Data Exchange (ETDEWEB)

    Flores-Castañeda, Mariela [Instituto Nacional de Investigaciones Nucleares (Mexico); Vega-Jiménez, Alejandro L., E-mail: argelia.almaguer@mac.com; Almaguer-Flores, Argelia [Universidad Nacional Autónoma de México, Facultad de Odontología, DEPeI, I (Mexico); Camps, Enrique; Pérez, Mario [Instituto Nacional de Investigaciones Nucleares (Mexico); Silva-Bermudez, Phaedra [Instituto Nacional de Rehabilitación, Unidad de Ingeniería de Tejidos, Terapia Celular y Medicina Regenerativa (Mexico); Berea, Edgardo [FarmaQuimia SA de CV. (Mexico); Rodil, Sandra E. [Universidad Nacional Autónoma de México, Instituto de Investigaciones en Materiales (Mexico)

    2015-11-15

    The antimicrobial properties of bismuth subsalicylate (BSS) nanoparticles against four opportunistic pathogens; E. coli, P. aeruginosa, S. aureus, and S. epidermidis were determined. BSS nanoparticles were synthesized by pulse laser ablation of a solid target in distilled water under different conditions. The nanoparticles were characterized using high-resolution transmission electron microscopy and absorption spectra and small angle X-ray scattering. The analysis shows that the colloids maintained the BSS structure and presented average particle size between 20 and 60 nm, while the concentration ranges from 95 to 195 mg/L. The antibacterial effect was reported as the inhibition ratio of the bacterial growth after 24 h and the cell viability was measured using the XTT assay. The results showed that the inhibition ratio of E. coli and S. epidermidis was dependant on the NPs size and/or concentration, meanwhile P. aeruginosa and S. aureus were more sensitive to the BSS nanoparticles independently of both the size and the concentration. In general, the BSS colloids with average particle size of 20 nm were the most effective, attaining inhibition ratios >80 %, similar or larger than those obtained with the antibiotic used as control. The results suggest that the BSS colloids could be used as effective antibacterial agents with potential applications in the medical area.

  16. Shape-dependent photocatalytic activities of bismuth subcarbonate nanostructures.

    Science.gov (United States)

    Tang, Jiale; Cheng, Gang; Zhou, Huamin; Yang, Hao; Lu, Zhong; Chen, Rong

    2012-05-01

    Different shaped bismuth subcarbonate ((BiO)2CO3) nanostructures including irregular nanoplates, relatively uniform nanoplates and nanocubes were prepared and characterized by powder X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), UV-vis diffuse reflection spectroscopy (DRS) and nitrogen adsorption. The photocatalytic performance of the as-synthesized (BiO)2CO3 nanostructures on the degradation of Rhodamine B (RhB), methyl orange (MO) and methyl blue (MB) were evaluated under UV-vis light irradiation (modeling sunlight). The photocatalysis tests showed that all the different (BiO)2CO3 nanostructures displayed enhanced photodegradation performance compared with commercial (BiO)2CO3. The irregular (BiO)2CO3 nanoplates exhibited the highest photocatalytic activity on the degradation of different organic dyes. (BiO)2CO3 nanosturctures exhibited the different capacity to bleach the three organic dyes, which might be attributed to their different molecular structures. This work may provide a potential photocatalyst for the environmental pollutants treatments.

  17. Dielectric and Impedance Spectroscopy of Barium Bismuth Vanadate Ferroelectrics

    Science.gov (United States)

    Sutar, B. C.; Choudhary, R. N. P.; Das, Piyush R.

    2014-07-01

    Structural, micro-structural and electrical properties of barium bismuth vanadate Ba(Bi0.5V0.5)O3 ceramics were investigated. X-ray diffraction (XRD) analysis of the prepared material confirmed the formation of the compound with monoclinic crystal system. Scanning electron microscopy (SEM) of the compound exhibits well-defined grains that are uniformly distributed throughout the surface of the sample. Dielectric properties of the compound were studied as a function of temperature at different frequencies. An observation of dielectric anomaly at 295 °C is due to ferroelectric phase transition that was later confirmed by the appearance of hysteresis loop. Detailed studies of complex impedance spectroscopy have provided a better understanding of the relaxation process and correlations between the microstructure-electrical properties of the materials. The nature of frequency dependence of ac conductivity obeys the Debye power law. The dc conductivity, calculated from the ac conductivity spectrum, shows the negative temperature coefficient of resistance behavior similar to that of a semiconductor.

  18. Mechanically Activated Synthesis of Nanocrystalline Powders of Ferroelectric Bismuth Vanadate

    Science.gov (United States)

    Shantha, K.; Subbanna, G. N.; Varma, K. B. R.

    1999-01-01

    Mechanical milling of a stoichiometric mixture of Bi2O3and V2O5yielded nanosized powders of bismuth vanadate, Bi2VO5.5(BiV). Structural evolution of the desired BiV phase, through an intermediate product (BiVO4), was monitored by subjecting the powders, ball milled for various durations to X-ray powder diffraction (XRD), differential thermal analysis (DTA), and transmission electron microscopic (TEM) studies. XRD studies indicate that the relative amount of the BiV phase present in the ball-milled mixture increases with increase in milling time and its formation reaches completion within 54 h of milling. Assynthesized powders were found to stabilize in the high-temperature tetragonal (γ) phase. DTA analyses of the powders milled for various durations suggest that the BiV phase-formation temperature decreases with increase in milling time. The nanometric size (30 nm) of the crystallites in the final product was confirmed by TEM and XRD studies. TEM studies clearly demonstrate the growth of BiV onBi2O3crystallites.

  19. Aromatic amino acids in high selectivity bismuth(III) recognition.

    Science.gov (United States)

    Ghatak, Sumanta Kumar; Dey, Debarati; Sen, Souvik; Sen, Kamalika

    2013-04-21

    The three aromatic amino acids, tyrosine, tryptophan and phenylalanine, play different physiological roles in life processes. Metal ions capable of binding these amino acids may aid in the reduction of effective concentration of these amino acids in any physiological system. Here we have studied the efficacy of some heavy metals for their complexation with these three amino acids. Bismuth has been found to bind selectively with these aromatic amino acids and this was confirmed using spectrofluorimetric, spectrophotometric and cyclic voltammetric studies. The series of heavy metals has been chosen because each of these metals remains associated with the others at very low concentration levels and Bi(III) is the least toxic amongst the other elements. So, selective recognition for Bi(III) would also mean no response for the other heavy elements if contaminants are present even at low concentration levels. The affinity towards these amino acids has been found to be in the order tryptophan phenylalanine amino acids have been calculated using Benesi-Hildebrand equations and the corresponding free energy change has also been calculated. The values of the association constants obtained from BH equations using absorbance values corroborate with the Stern-Volmer constants obtained from fluorimetric studies. The evidence for complexation is also supported by the results of cyclic voltammetry.

  20. Optical analysis of samarium doped sodium bismuth silicate glass

    Science.gov (United States)

    Thomas, V.; Sofin, R. G. S.; Allen, M.; Thomas, H.; Biju, P. R.; Jose, G.; Unnikrishnan, N. V.

    2017-01-01

    Samarium doped sodium bismuth silicate glass was synthesized using the melt quenching method. Detailed optical spectroscopic studies of the glassy material were carried out in the UV-Vis-NIR spectral range. Using the optical absorption spectra Judd-Ofelt (JO) parameters are derived. The calculated values of the JO parameters are utilized in evaluating the various radiative parameters such as electric dipole line strengths (Sed), radiative transition probabilities (Arad), radiative lifetimes (τrad), fluorescence branching ratios (β) and the integrated absorption cross- sections (σa) for stimulated emission from various excited states of Sm3 +‡ ion. The principal fluorescence transitions are identified by recording the fluorescence spectrum. Our analysis revealed that the novel glassy system has the optimum values for the key parameters viz. spectroscopic quality factor, optical gain, stimulated emission cross section and quantum efficiency, which are required for a high performance optical amplifier. Calculated chromaticity co-ordinates (0.61, 0.38) also confirm its application potential in display devices.

  1. Bismuth nanoparticles integration into heavy metal electrochemical stripping sensor.

    Science.gov (United States)

    Cadevall, Miquel; Ros, Josep; Merkoçi, Arben

    2015-08-01

    Between their many applications bismuth nanoparticles (BiNPs) are showing interest as pre-concentrators in heavy metals detection while being applied as working electrode modifiers used in electrochemical stripping analysis. From the different reported methods to synthesize BiNPs we are focused on the typical polyol method, largely used in these types of metallic and semi-metallic nanoparticles. This study presents the strategy for an easy control of the shape and size of BiNPs including nanocubes, nanosferes and triangular nanostructures. To improve the BiNP size and shape, different reducing agents (ethylene glycol or sodium hypophosphite) and stabilizers (polyvinyl pyrrolidone, PVP, in different amounts) have been studied. The efficiency of BiNPs for heavy metals analysis in terms of detection sensitivity while being used as modifiers of screen-printed carbon electrodes including the applicability of the developed device in real sea water samples is shown. A parallel study between the obtained nanoparticles and their performance in heavy metal sensing has been described in this communication.

  2. Modular Lead-Bismuth Fast Reactors in Nuclear Power

    Directory of Open Access Journals (Sweden)

    Vladimir Petrochenko

    2012-09-01

    Full Text Available On the basis of the unique experience of operating reactors with heavy liquid metal coolant–eutectic lead-bismuth alloy in nuclear submarines, the concept of modular small fast reactors SVBR-100 for civilian nuclear power has been developed and validated. The features of this innovative technology are as follows: a monoblock (integral design of the reactor with fast neutron spectrum, which can operate using different types of fuel in various fuel cycles including MOX fuel in a self-providing mode. The reactor is distinct in that it has a high level of self-protection and passive safety, it is factory manufactured and the assembled reactor can be transported by railway. Multipurpose application of the reactor is presumed, primarily, it can be used for regional power to produce electricity, heat and for water desalination. The Project is being realized within the framework of state-private partnership with joint venture OJSC “AKME-Engineering” established on a parity basis by the State Atomic Energy Corporation “Rosatom” and the Limited Liability Company “EuroSibEnergo”.

  3. On the use of bismuth as a neutron filter

    CERN Document Server

    Adib, M

    2003-01-01

    A formula is given which, for neutron energies in the range 10 sup - sup 4 bismuth temperature and crystalline form. Computer programs have been developed which allow calculations for the Bi rhombohedral structure in its poly-crystalline form and its equivalent hexagonal close-packed structure. The calculated total neutron cross-sections for poly-crystalline Bi at different temperatures were compared with the measured values. An overall agreement is indicated between the formula fits and experimental data. Agreement was also obtained for values of Bi-single crystals, at room and liquid nitrogen temperatures. A feasibility study for use of Bi in powdered form, as a cold neutron filter, is detailed in terms of the optimum Bi-single crystal thickness, mosaic spread, temperature and cutting plane for efficient transmission of thermal-reactor neutrons, and also for rejection of the accom...

  4. Synthesis and characterization of bismuth zinc niobate pyrochlore nanopowders

    Directory of Open Access Journals (Sweden)

    Sonia Maria Zanetti

    2007-09-01

    Full Text Available Bismuth zinc niobate pyrochlores Bi1.5ZnNb1.5O7 (alpha-BZN, and Bi2(Zn1/3Nb2/32O 7 (beta-BZN have been synthesized by chemical method based on the polymeric precursors. The pyrochlore phase was investigated by differential scanning calorimetry, infrared spectroscopy, and X ray diffraction. Powder and sintered pellets morphology was examined by scanning electron microscopy. The study of alpha-BZN phase formation reveals that, at 500 °C, the pyrochlore phase was already present while a single-phased nanopowder was obtained after calcination at 700 °C. The crystallization mechanism of the beta-BZN is quite different, occurring through the crystallization of alpha-BZN and BiNbO4 intermediary phases. Both compositions yielded soft agglomerated powders. alpha-BZN pellets, sintered at 800 °C for 2 hours, presented a relative density of 97.3% while those of beta-BZN, sintered at 900 °C for 2 hours, reached only 91.8%. Dielectric constant and dielectric loss, measured at 1 MHz, were 150 and 4 x/10-4 for a-BZN, and 97 and 8 x 10-4 for beta-BZN.

  5. Pressure effects on crystal and electronic structure of bismuth tellurohalides

    Science.gov (United States)

    Rusinov, I. P.; Menshchikova, T. V.; Sklyadneva, I. Yu; Heid, R.; Bohnen, K.-P.; Chulkov, E. V.

    2016-11-01

    We study the possibility of pressure-induced transitions from a normal semiconductor to a topological insulator (TI) in bismuth tellurohalides using density functional theory and tight-binding method. In BiTeI this transition is realized through the formation of an intermediate phase, a Weyl semimetal, that leads to modification of surface state dispersions. In the topologically trivial phase, the surface states exhibit a Bychkov-Rashba type dispersion. The Weyl semimetal phase exists in a narrow pressure interval of 0.2 GPa. After the Weyl semimetal-TI transition occurs, the surface electronic structure is characterized by gapless states with linear dispersion. The peculiarities of the surface states modification under pressure depend on the band-bending effect. We have also calculated the frequencies of Raman active modes for BiTeI in the proposed high-pressure crystal phases in order to compare them with available experimental data. Unlike BiTeI, in BiTeBr and BiTeCl the topological phase transition does not occur. In BiTeBr, the crystal structure changes with pressure but the phase remains a trivial one. However, the transition appears to be possible if the low-pressure crystal structure is retained. In BiTeCl under pressure, the topological phase does not appear up to 18 GPa due to a relatively large band gap width in this compound.

  6. Thermoelectric characterization of individual bismuth selenide topological insulator nanoribbons

    Science.gov (United States)

    Tang, Hao; Wang, Xiaomeng; Xiong, Yucheng; Zhao, Yang; Zhang, Yin; Zhang, Yan; Yang, Juekuan; Xu, Dongyan

    2015-04-01

    Bismuth selenide (Bi2Se3) nanoribbons have attracted tremendous research interest recently to study the properties of topologically protected surface states that enable new opportunities to enhance the thermoelectric performance. However, the thermoelectric characterization of individual Bi2Se3 nanoribbons is rare due to the technological challenges in the measurements. One challenge is to ensure good contacts between the nanoribbon and electrodes in order to determine the thermal and electrical properties accurately. In this work, we report the thermoelectric characterization of individual Bi2Se3 nanoribbons via a suspended microdevice method. Through careful measurements, we have demonstrated that contact thermal resistance is negligible after the electron-beam-induced deposition (EBID) of platinum/carbon (Pt/C) composites at the contacts between the nanoribbon and electrodes. It is shown that the thermal conductivity of the Bi2Se3 nanoribbons is less than 50% of the bulk value over the whole measurement temperature range, which can be attributed to enhanced phonon boundary scattering. Our results indicate that intrinsic Bi2Se3 nanoribbons prepared in this work are highly doped n-type semiconductors, and therefore the Fermi level should be in the conduction band and no topological transport behavior can be observed in the intrinsic system.

  7. Energy levels scheme simulation of divalent cobalt doped bismuth germanate

    Energy Technology Data Exchange (ETDEWEB)

    Andreici, Emiliana-Laura, E-mail: andreicilaura@yahoo.com [Department of Physics, West University of Timisoara, Bd. V. Parvan 4,300223 Timisoara (Romania); Petkova, Petya [Shumen University “Konstantin Preslavsky”, 115 Universitetska street, 9712 Shumen (Bulgaria); Avram, Nicolae M. [Department of Physics, West University of Timisoara, Bd. V. Parvan 4,300223 Timisoara (Romania); Academy of Romanian Scientists, Independentei 54, 050094-Bucharest (Romania)

    2015-12-07

    The aim of this paper is to simulate the energy levels scheme for Bismuth Germanate (BGO) doped with divalent cobalt, in order to give a reliable explanation for spectral experimental data. In the semiempirical crystal field theory we first modeled the Crystal Field Parameters (CFPs) of BGO:Cr{sup 2+} system, in the frame of Exchange Charge Model (ECM), with actually site symmetry of the impurity ions after doping. The values of CFPs depend on the geometry of doped host matrix and by parameter G of ECM. First, we optimized the geometry of undoped BGO host matrix and afterwards, that of doped BGO with divalent cobalt. The charges effect of ligands and covalence bonding between cobalt cations and oxygen anions, in the cluster approach, also were taken into account. With the obtained values of the CFPs we simulate the energy levels scheme of cobalt ions, by diagonalizing the matrix of the doped crystal Hamiltonian. Obviously, energy levels and estimated Racah parameters B and C were compared with the experimental spectroscopic data and discussed. Comparison of obtained results with experimental data shows quite satisfactory, which justify the model and simulation schemes used for the title system.

  8. Bismuth alloying properties in GaAs nanowires

    Energy Technology Data Exchange (ETDEWEB)

    Ding, Lu [State Key Laboratory of Information Photonics and Optical Communications, Ministry of Education, Beijing University of Posts and Telecommunications, PO Box 72, Beijing 100876 (China); Lu, Pengfei, E-mail: photon.bupt@gmail.com [State Key Laboratory of Information Photonics and Optical Communications, Ministry of Education, Beijing University of Posts and Telecommunications, PO Box 72, Beijing 100876 (China); Cao, Huawei; Cai, Ningning; Yu, Zhongyuan [State Key Laboratory of Information Photonics and Optical Communications, Ministry of Education, Beijing University of Posts and Telecommunications, PO Box 72, Beijing 100876 (China); Gao, Tao [Institute of Atomic and Molecular Physics, Sichuan University, Chengdu 610065 (China); Wang, Shumin [State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Chinese Academy of Sciences, Shanghai 200050 (China); Photonics Laboratory, Department of Microtechnology and Nanoscience, Chalmers University of Technology, 41296 Gothenburg (Sweden)

    2013-09-15

    First-principles calculations have been performed to investigate the structural, electronic and optical properties of bismuth alloying in GaAs nanowires. A typical model of Ga{sub 31}As{sub 31} nanowires is introduced for its reasonable band gap. The band gap of GaAs{sub 1−x}Bi{sub x} shrinks clearly with the increasing Bi concentration and the band edge shifts when spin–orbit coupling (SOC) is considered. The insertion of Bi atom leads to hybridization of Ga/As/Bi p states which contributes a lot around Fermi level. Scissor effect is involved. The optical properties are presented, including dielectric function, optical absorption spectra and reflectivity, which are also varied with the increasing of Bi concentrations. - Graphical abstract: Top view of Bi-doped GaAs nanowires. Ga, As, and Bi atoms are denoted with grey, purple and red balls, respectively. Display Omitted - Highlights: • A typical model of Ga{sub 31}As{sub 31} nanowires is introduced for its reasonable band gap. • The band gap of GaAs{sub 1−x}Bi{sub x} shrinks clearly with the increasing Bi concentration. • The band edge shifts when spin–orbit coupling (SOC) is considered. • The insertion of Bi atom leads to hybridization of Ga/As/Bi p states.

  9. A novel layered bismuth-based photocatalytic material LiBi3O4Cl2 with rad OH and h+ as the active species for efficient photodegradation applications

    Science.gov (United States)

    Wang, Shuobo; Huang, Hongwei; Zhang, Yihe

    2016-12-01

    Developing new photocatalysts is of significant importance for their potential environmental and energetic applications. Herein, a novel layered bismuth-based photocatalytic material LiBi3O4Cl2 was developed by a simple solid-state reaction. The morphology, microstructures and optical properties were investigated by XRD, SEM, TEM and DRS. The band gap of LiBi3O4Cl2 has been determined to be 3.35 eV, and its ECB and EVB were also estimated. The photocatalytic property of LiBi3O4Cl2 is surveyed by oxidative decomposition of rhodamine B (RhB), methyl orange (MO), methylene blue (MB) and phenol in aqueous solution. The results demonstrated that LiBi3O4Cl2 is an efficient UV light active photocatalyst, which can destroy the contaminants with irradiation. It is also more effective in degrading pollutants than the related layered bismuth-based photocatalyst Bi4NbO8Br. The photocatalysis mechanism is detailedly investigated by active species trapping measurement and terephthalic acid photoluminescence probing technique (TA-PL). It revealed that powerful hydroxyl radicals (rad OH) and photogenerated holes (h+) are the two main active species and are responsible for the efficient degradation process. This study provides a new layered bismuth-based photocatalytic material for environmental and energetic applications.

  10. Preparation and Performance of Bismuth and Iron Compound Oxides Photocatalysis Materials%铋铁复合氧化物光催化材料的制备及其性能研究

    Institute of Scientific and Technical Information of China (English)

    郝敏

    2016-01-01

    采用共沉淀法制备了一系列铋铁复合氧化物光催化剂,并以可见光降解甲基橙为模型反应,研究其在可见光照射下降解甲基橙的光催化性能。详细考察了 pH 值、铋铁摩尔比、煅烧温度等对其光催化性能的影响。在优化条件下,铋铁摩尔比为2∶1、pH=3~4时制备出的样品具有较好的光催化性能,甲基橙的降解率可达到91.95%。%This paper introduced a series of Bismuth and iron compound oxides photocatalysts were prepared by coprecipitation method, and the visible light degradation of methyl orange as a model reaction, photocatalytic performance of the degradation under visible light irradiation of methyl orange. Effects of pH value, bismuth and iron molar ratio, calcination temperature on the photocatalytic properties were investigated in detail. Under the optimized conditions, bismuth and iron molar ratio was 2∶1, the prepared samples in pH=3~4 had better photo catalytic degradation of methyl orange, the degradation rate could reach 91.95%.

  11. Insights into the growth of bismuth nanoparticles on 2D structured BiOCl photocatalysts: an in situ TEM investigation.

    Science.gov (United States)

    Chang, Xiaofeng; Wang, Shuangbao; Qi, Qi; Gondal, Mohammed A; Rashid, Siddique G; Gao, Si; Yang, Deyuan; Shen, Kai; Xu, Qingyu; Wang, Peng

    2015-09-28

    The synthetic techniques for novel photocatalytic crystals had evolved by a trial-and-error process that spanned more than two decades, and an insight into the photocatalytic crystal growth process is a challenging area and prerequisite for achieving an excellent photoactivity. Bismuth nanoparticle based hybrids, such as Bi/BiOCl composites, have recently been investigated as highly efficient photocatalytic systems because of the localized surface plasmon resonance (LSPR) of nanostructured bismuth. In this work, the observation towards the formation and growth of bismuth nanoparticles onto 2D structured BiOCl photocatalysts has been performed using a transmission electron microscope (TEM) directly in real time. The growth of bismuth nanoparticles on BiOCl nanosheets can be emulated and speeded up driven by the electron beam (e(-) beam) in TEM. The crystallinity, growth and the elemental evolution during the formation of bismuth nanoparticles have also been probed in this work.

  12. Overview of the use of ATHENA for thermal-hydraulic analysis of systems with lead-bismuth coolant

    Energy Technology Data Exchange (ETDEWEB)

    C. B. Davis; A. S. Shieh

    2000-04-02

    The INEEL and MIT are investigating the suitability of lead-bismuth cooled fast reactor for producing low-cost electricity as well as for actinide burning. This paper is concerned with the general area of thermal-hydraulics of lead-bismuth cooled reactors. The ATHENA code is being used in the thermal-hydraulic design and analysis of lead-bismuth cooled reactors. The ATHENA code was reviewed to determine its applicability for simulating lead-bismuth cooled reactors. Two modifications were made to the code as a result of this review. Specifically, a correlation to represent heat transfer from rod bundles to a liquid metal and a void correlation based on data taken in a mixture of lead-bismuth and steam were added the code. The paper also summarizes the analytical work that is being performed with the code and plans for future analytical work.

  13. Overview of the Use of ATHENA for Thermal-Hydraulic Analysis of Systems with Lead-Bismuth Coolant

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Cliff Bybee; Shieh, Arthur Shan Luk

    2000-04-01

    The INEEL and MIT are investigating the suitability of lead-bismuth cooled fast reactor for producing low-cost electricity as well as for actinide burning. This paper is concerned with the general area of thermal-hydraulics of lead-bismuth cooled reactors. The ATHENA code is being used in the thermal-hydraulic design and analysis of lead-bismuth cooled reactors. The ATHENA code was reviewed to determine its applicability for simulating lead-bismuth cooled reactors. Two modifications were made to the code as a result of this review. Specifically, a correlation to represent heat transfer from rod bundles to a liquid metal and a void correlation based on data taken in a mixture of lead-bismuth and steam were added the code. The paper also summarizes the analytical work that is being performed with the code and plans for future analytical work.

  14. Experimental investigation of the shock response of bismuth under one-dimensional shock-loading

    Science.gov (United States)

    Whiteman, Glenn; Millett, Jeremy; Appleby-Thomas, Gareth; Wood, David; Hameed, Amer

    2017-01-01

    Interest in the dynamic response of bismuth is largely derived from the existence of multiple phase transitions attainable with increasing pressure. In addition, its industrial use has grown in recent years (e.g. in solder as a replacement for lead), in part due to its relatively low toxicity. While some shock experiments have been conducted on bismuth they have largely concentrated on equation of state research at relatively low stresses. To the authors' knowledge the strength behaviour under shock is not prevalent in the literature. To this end, the low pressure response of bismuth targets has been experimentally investigated here using commercial stress gauges mounted in both longitudinal and lateral orientation with respect to the loading axis. Of particular note was the potential to observe the relatively low pressure phase transitions in the lateral stress response.

  15. Radioactive Iodine (I-129) Gas Adsorption by Using Bismuth-Embedded SBA-15

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Jae Hwan; Cho, Yong-Jun; Park, Jang Jin; Ahn, Do-Hee [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Yim, Man-Sung [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of)

    2015-05-15

    The efficient capture of the long-lived I-129, released as off-gas from nuclear fuel reprocessing, have been of significant concern in the waste management field. In this study, bismuth-embedded SBA-15 mesoporous silica was firstly applied for iodine capture and storage. SBA-15 was functionalized with thiol (-SH) groups, followed by bismuth adsorption with Bi-S bonding, which was thermally treated to form Bi{sub 2}S{sub 3} within SBA-15. The bismuth-embedded SBA-15s demonstrated high iodine loading capacities with 540 mg-I/g-sorbent maximally, which benefitted from the high surface area and porosity of SBA-15 as well as the formation of thermodynamically stable BiI{sub 3} compound. Iodine physisorption could effectively be suppressed due to the large pores present in SBA-15, resulting in chemisorption as a main mechanism for iodine confinement.

  16. Bismuth Oxide Thin Films Deposited on Silicon Through Pulsed Laser Ablation, for Infrared Detectors

    Science.gov (United States)

    Condurache-Bota, Simona; Constantinescu, Catalin; Tigau, Nicolae; Praisler, Mirela

    2016-12-01

    Infrared detectors are used in many human activities, from industry to military, telecommunications, environmental studies and even medicine. Bismuth oxide thin films have proved their potential for optoelectronic applications, but their uses as infrared sensors have not been thoroughly studied so far. In this paper, pulsed laser ablation of pure bismuth targets within a controlled oxygen atmosphere is proposed for the deposition of bismuth oxide films on Si (100) substrates. Crystalline films were obtained, whose uniformity depends on the deposition conditions (number of laser pulses and the use of a radio-frequency (RF) discharge of the oxygen inside the deposition chamber). The optical analysis proved that the refractive index of the films is higher than 3 and that their optical bandgap is around 1eV, recommending them for infrared applications.

  17. Poisoning effect of bismuth on modification behaviour of strontium in LM25 alloy

    Indian Academy of Sciences (India)

    S Farahany; A Ourdjini; M H Idris; L T Thai

    2011-10-01

    Nucleation and growth, temperature measurements andmicrostructure observations of silicon phase are presented for strontium modified Al–7%Si (LM25) cast alloy treated with bismuth. The results show that addition of bismuth in strontium modified alloys may have a poisoning effect resulting in lost modification of the silicon phase. With increasing Bi/Sr ratio, thermal analysis measurements showed that the eutectic growth temperature increased remarkably to 573°C and recalescence decreased to 0.2°C and the morphology of silicon displayed the same flakelike structure as in the unmodified alloys. Microstructural observation showed that a minimum Bi/Sr ratio of 1.2 which is equivalent to a Sr/Bi ratio of 0.43 is required for effective strontium modification and neutralization of the poisoning effect of bismuth.

  18. Facile preparation of Bi nanoparticles by novel cathodic dispersion of bulk bismuth electrodes

    Energy Technology Data Exchange (ETDEWEB)

    Chen Xin [Zhejiang Key Laboratory for Reactive Chemistry on Solid Surfaces, Institute of Physical Chemistry, Zhejiang Normal University, Jinhua 321004 (China); Chen Shu; Huang Wei [Key Laboratory of Chemical Biology and Traditional Chinese Medicine Research (Ministry of Education of China), College of Chemistry and Chemical Engineering, Hunan Normal University, Lushan Road, Changsha 410081 (China); Zheng Jufang [Zhejiang Key Laboratory for Reactive Chemistry on Solid Surfaces, Institute of Physical Chemistry, Zhejiang Normal University, Jinhua 321004 (China); Li Zelin, E-mail: lizelin@zjnu.c [Key Laboratory of Chemical Biology and Traditional Chinese Medicine Research (Ministry of Education of China), College of Chemistry and Chemical Engineering, Hunan Normal University, Lushan Road, Changsha 410081 (China)

    2009-12-01

    A novel electrochemical approach has been developed to prepare clean bismuth nanoparticles (NPs) with a bulk Bi electrode in a 0.5 mol dm{sup -3} NaOH solution under highly cathodic polarization of -8 V versus a saturated mercurous sulfate electrode, requiring no any precursor ions and organic protective agents. The bulk Bi electrode can be facilely dispersed into Bi NPs at the condition of intensive hydrogen evolution. This cathodic dispersion of the bulk Bi electrode involves the formation and decomposition of unstable bismuth hydrides and the aggregation of atomic bismuth from the decomposition. Moreover, Bi{sub 2}O{sub 3} NPs have also been achieved by heating the precursor Bi NPs. Field-emission scanning electron microscopy, transmission electron microscope and X-ray diffraction were used to characterize these NPs. The as-prepared Bi NPs mainly existed in rhombohedral phase.

  19. Application of Thermodynamic Calculations to the Pyro-refining Process for Production of High Purity Bismuth

    Science.gov (United States)

    Mezbahul-Islam, Mohammad; Belanger, Frederic; Chartrand, Patrice; Jung, In-Ho; Coursol, Pascal

    2017-02-01

    The present work has been performed with the aim to optimize the existing process for the production of high purity bismuth (99.999 pct). A thermo-chemical database including most of the probable impurities of bismuth (Bi-X, X = Ag, Au, Al, Ca, Cu, Fe, Mg, Mn, Na, Ni, Pb, S, Sb, Sn, Si, Te, Zn) has been constructed to perform different thermodynamic calculations required for the refining process. Thermodynamic description for eight of the selected binaries, Bi-Ca, Cu, Mn, Ni, Pb, S, Sb, and Sn, has been given in the current paper. Using the current database, different thermodynamic calculations have been performed to explain the steps involved in the bismuth refining process.

  20. Optical properties of thermally reduced bismuth-doped sodium aluminosilicate glasses

    DEFF Research Database (Denmark)

    Nielsen, K.H.; Smedskjær, Morten Mattrup; Yue, Yuanzheng

    , but also concerning the metal particle formation, and the broadband near infrared luminescence. Both the inward diffusion and the infrared luminescence depend on the bismuth oxidation state. The latter can be varied by adjusting the parameters of the heat-treatment, e.g., time, temperature, and partial......Heat-treatment of multivalent ion containing glasses in a hydrogen atmosphere may cause both reduction of the multivalent ions and ionic inward diffusion, resulting in improved glass properties. Bismuth-doped glasses are also interesting objects not only concerning the reduction induced diffusion...... pressure of hydrogen. Here, we present results on the effect of the heat-treatment on the optical properties of bismuth-doped sodium aluminosilicate glasses....

  1. Melting behaviour of lead and bismuth nano-particles in quasicrystalline matrix - The role of interfaces

    Indian Academy of Sciences (India)

    Alok Singh; A P Tsai

    2003-02-01

    Nanomaterials are playing an increasingly important role in modern technologies. Interfaces are crucial in nanotechnology. In this study, we have examined the stability of nanoparticles. Major emphasis is on understanding the effect of interfaces on melting. Melting behaviour of nanocrystalline interfaces, created by embedding lead and bismuth nanoparticles in quasicrystalline matrices, was studied. Sharply faceted and coherent interfaces can be related to sharper melting transitions, while irregularly shaped and incoherent interfaces can be directly correlated with lowering of melting temperatures. It is shown here that solid lead forms a high energy interface with phason strain-free quasicrystal (resulting in a lowering of the melting temperature) while bismuth forms a low energy interface with the quasicrystal (resulting in superheating, unusual for bismuth).

  2. Design of an Actinide Burning, Lead-Bismuth Cooled Reactor That Produces Low Cost Electricity

    Energy Technology Data Exchange (ETDEWEB)

    C. Davis; S. Herring; P. MacDonald; K. McCarthy; V. Shah; K. Weaver (INEEL); J. Buongiorno; R. Ballinger; K. Doyoung; M. Driscoll; P. Hejzler; M. Kazimi; N. Todreas (MIT)

    1999-07-01

    The purpose of this project is to investigate the suitability of lead-bismuth cooled fast reactors for producing low-cost electricity as well as for actinide burning. The goal is to identify and analyze the key technical issues in core neutronics, materials, thermal-hydraulics, fuels, and economics associated with the development of this reactor concept. The choice of lead-bismuth for the reactor coolant is an actinide burning fast reactor offers enhanced safety and reliability. The advantages of lead-bismuth over sodium as a coolant are related to the following material characteristics: chemical inertness with air and water; higher atomic number; lower vapor pressure at operating temperatures; and higher boiling temperature. Given the status of the field, it was agreed that the focus of this investigation in the first two years will be on the assessment of approaches to optimize core and plant arrangements in order to provide maximum safety and economic potential in this type of reactor.

  3. Fluorescence Emission Centres and the Corresponding Infrared Fluorescence Saturation in a Bismuth-Doped Silica Fibre

    Institute of Scientific and Technical Information of China (English)

    QIU Yan-Qing; SHEN Yong-Hang

    2008-01-01

    We investigate the fluorescence characteristics of bismuth doped silica fibres with and without Al co-dopant which are fabricated by means of modified chemical vapour deposition (MCVD) technique, and find that the fluorescences in the red region (centred around 750nm) and in the infrared region (centred around 1100nm) may originate from different emission sites in the fibre. Strong upconversion phenomena are observed in both Al-codoped and non Al codoped bismuth fibres when the fibres are excited by an acoustic-optic Q-switched Nd: YVO4 laser. Both the aspects indicate that the upper energy level absorption reported in the work of the bismuth doped silica fibre lasers may result from the fluorescence emission sites that are not responsible for the infrared emission. It is thus expected that optimizing the compositions and the fabrication conditions of the fibre and then transferring more fluorescence emission centres are helpful for the infrared emission.

  4. Glass-like carbon, pyrolytic graphite or nanostructured carbon for electrochemical sensing of bismuth ion?

    Directory of Open Access Journals (Sweden)

    Jadranka Milikić

    2016-06-01

    Full Text Available Different carbon electrodes were explored for application in electroanalysis, namely for sensing of bismuth ion as model analyte. Carbon materials tested included glassy carbon, basal and edge plane pyrolytic graphite, as well as nanostructured carbonized polyaniline prepared in the presence of 3,5-dinitrosalicylic acid. Bismuth ion was chosen as model analyte as protocol for its detection and quantifications is still to be determined. Herein, anodic stripping voltammetry was used with study of effect of several parameters such as scan rate and deposition time. Electrode based on carbonized polyaniline showed the highest activity for bismuth ion sensing in terms of the highest current densities recorded both in a laboratory and in real sample, while basal plane pyrolytic graphite electrode gave the lowest limit of detection.

  5. Bismuth subcarbonate as filler particle for an Epoxy-based root canal sealer

    Directory of Open Access Journals (Sweden)

    Eduardo Schwartzer

    2013-01-01

    Full Text Available Introduction: The aim of this study was to evaluate the addition of bismuth subcarbonate with different concentrations regarding the rheological properties of an experimental epoxy-based root canal sealer. Materials and Methods: Endodontic sealers were prepared with epoxy resin-based sealer with bismuth subcarbonate additions of 20%, 40%, 60%, 80%, 100%, and 120%. Flow, film thickness, working time, setting time, dimensional change, sorption, solubility, and cytotoxicity were studied according to the ISO standards. Data were statistically analyzed by one-way ANOVA, and Tukey multiple comparisons were used, with a significance level of 5%. Results: The flow, working time, water sorption, and solubility significantly decreased and the film thickness and dimensional change increased with higher filler particle addition. There were no statistically significant differences for setting time and cytotoxicity between the filler particle proportions. Conclusion: Experimental resin-based sealer with bismuth subcarbonate addition up to 40% can be an alternative for root canal sealer.

  6. Tunable band gap of iron-doped lanthanum-modified bismuth titanate synthesized by using the thermal decomposition of a secondary phase

    Science.gov (United States)

    Han, Jun Young; Bark, Chung Wung

    2015-05-01

    The photoelectric properties of complex oxides have prompted interest in materials with a tunable band gap because of the absorption. The substitution of iron atoms in La-modified bismuth titanate (BLT) can lead to dramatic improvements in the band gap; however, the substitution of iron atoms while maintaining the original bismuth layer structure without forming a BiFeO3 secondary phase is quite challenging. Therefore, a series of Fe-doped BLT (Fe-BLT) samples were synthesized using a solid reaction at various calcination temperatures (300 ˜ 900°C) to remove the secondary phase. The structural and the optical properties were analyzed by using X-ray diffraction and ultraviolet-visible absorption spectroscopy. This paper reports a new route by using high-temperature calcination, to synthesize the Aurivillius phase with a reduced optical band gap due to the thermal decomposition of BiFeO3 during high-temperature calcination. This simple route to reduce the second phase can be adapted to other complex oxides for use in emerging oxide optoelectronic devices.

  7. Heterocyclic Bismuth(III) Dithiocarbamato Complexes as Single-Source Precursors for the Synthesis of Anisotropic Bi2 S3 Nanoparticles.

    Science.gov (United States)

    Kun, Walter N; Mlowe, Sixberth; Nyamen, Linda D; Ndifon, Peter T; Malik, Mohammad A; Munro, Orde Q; Revaprasadu, Neerish

    2016-09-05

    New complexes catena-(μ2 -nitrato-O,O')bis(piperidinedithiocarbamato)bismuth(III) (1) and tetrakis(μ-nitrato)tetrakis[bis(tetrahydroquinolinedithiocarbamato)bismuth(III)] (2) were synthesised and characterised by elemental analysis, FTIR spectroscopy and thermogravimetric analysis. The single-crystal X-ray structures of 1 and 2 were determined. The coordination numbers of the Bi(III) ion are 8 for 1 and ≥6 for 2 when the experimental electron density for the nominal 6s(2) lone pair of electrons is included. Both complexes were used as single-source precursors for the synthesis of dodecylamine-, hexadecylamine-, oleylamine and tri-n-octylphosphine oxide-capped Bi2 S3 nanoparticles at different temperatures. UV/Vis spectra showed a blueshift in the absorbance band edge characteristic of a quantum size effect. High-quality, crystalline, long and short Bi2 S3 nanorods were obtained depending on the thermolysis temperature, which was varied from 190 to 270 °C. A general trend of increasing particle breadth with increasing reaction temperature and increasing length of the carbon chain of the amine (capping agent) was observed. Powder XRD patterns revealed the orthorhombic crystal structure of Bi2 S3 .

  8. Bismuth Passivation Technique for High-Resolution X-Ray Detectors

    Science.gov (United States)

    Chervenak, James; Hess, Larry

    2013-01-01

    The Athena-plus team requires X-ray sensors with energy resolution of better than one part in 3,000 at 6 keV X-rays. While bismuth is an excellent material for high X-ray stopping power and low heat capacity (for large signal when an X-ray is stopped by the absorber), oxidation of the bismuth surface can lead to electron traps and other effects that degrade the energy resolution. Bismuth oxide reduction and nitride passivation techniques analogous to those used in indium passivation are being applied in a new technique. The technique will enable improved energy resolution and resistance to aging in bismuth-absorber-coupled X-ray sensors. Elemental bismuth is lithographically integrated into X-ray detector circuits. It encounters several steps where the Bi oxidizes. The technology discussed here will remove oxide from the surface of the Bi and replace it with nitridized surface. Removal of the native oxide and passivating to prevent the growth of the oxide will improve detector performance and insulate the detector against future degradation from oxide growth. Placing the Bi coated sensor in a vacuum system, a reduction chemistry in a plasma (nitrogen/hydrogen (N2/H2) + argon) is used to remove the oxide and promote nitridization of the cleaned Bi surface. Once passivated, the Bi will perform as a better X-ray thermalizer since energy will not be trapped in the bismuth oxides on the surface. A simple additional step, which can be added at various stages of the current fabrication process, can then be applied to encapsulate the Bi film. After plasma passivation, the Bi can be capped with a non-diffusive layer of metal or dielectric. A non-superconducting layer is required such as tungsten or tungsten nitride (WNx).

  9. Spin-Polarized Tunneling Study on Spin-Momentum Locking in the Topological Insulator Bismuth Selenide

    Science.gov (United States)

    Chen, Ching-Tzu; Liu, Luqiao; Richardella, Anthony; Garate, Ion; Zhu, Yu; Samarth, Nitin

    2015-03-01

    In this talk, we will demonstrate that the helical spin texture on topological insulator (TI) surfaces can be electrically detected using four-terminal tunnel junction devices with ferromagnetic top electrodes. Consistent results are obtained in both the Edelstein and spin-galvanic effect configurations, allowing a quantitative determination of the charge-spin conversion efficiency in bismuth selenide. By applying finite DC biases at the junction, we further extract the energy dependence of the effective spin polarization in bismuth selenide. The observed temperature stability up to 200K suggests that TIs can be highly promising for room-temperature spintronics applications

  10. Simultaneous enhancements in photon absorption and charge transport of bismuth vanadate photoanodes for solar water splitting

    OpenAIRE

    Kim, Tae Woo; Ping, Yuan; Galli, Giulia A.; Choi, Kyoung-Shin

    2015-01-01

    n-Type bismuth vanadate has been identified as one of the most promising photoanodes for use in a water-splitting photoelectrochemical cell. The major limitation of BiVO4 is its relatively wide bandgap (∼2.5 eV), which fundamentally limits its solar-to-hydrogen conversion efficiency. Here we show that annealing nanoporous bismuth vanadate electrodes at 350 °C under nitrogen flow can result in nitrogen doping and generation of oxygen vacancies. This gentle nitrogen treatment not only effective...

  11. Simultaneous Determination of Bismuth and Copper by Square Wave Voltammetry in The Presence of Ethylenediaminetetraacedic Acid

    OpenAIRE

    HASDEMİR, Erdoğan; KARABODUK, Kuddusi

    2010-01-01

    A sensitive and selective method for the simultaneous determination of copper and bismuth by square wave voltammetry (SWV) was developed using ethylenediaminetetraacedic acid (EDTA) as complexing agent. Factors affecting the pH and concentrations ratios of copper and bismuth were investigated. Optimal analytical conditions were  found to be: pH of 8.0, the ratio of [Cu2+]/[Bi3+] was 0.13-2.5. The limit of detection (3δ) was 1.26 × 10-7 mol dm-3 for copper,  1.30×10...

  12. Investigation on bismuth-oxide photonic crystal fiber for optical parametric amplification

    Institute of Scientific and Technical Information of China (English)

    JIN Cang; RAO Lan; YUAN Jin-hui; SHEN Xiang-wei; YU Chong-xiu

    2011-01-01

    A hexagonal solid-core bismuth-oxide micro-structure fiber is developed to balance its dispersion and nonlinearity. This simulation and calculation results show that the bismuth-oxide photonic crystal fiber (Bi-PCF) has near zero dispersion around 1550 nm. Its dispersion slop in the communication wavelength range is also relatively flat. Moreover, both nonlinear coefficient and model field distribution are obtained. Compared with the experimental results by SiO-PCF, it can be seen that the Bi-PCF shows excellent characteristics for the optical parametric amplification (OPA).

  13. Structural investigations of bismuth lead borosilicate glasses under the influence of gamma irradiation through ultrasonic studies

    Science.gov (United States)

    Bootjomchai, Cherdsak; Laopaiboon, Jintana; Laopaiboon, Raewat

    2012-04-01

    The ultrasonic velocity measurements for different compositions of irradiated bismuth lead borosilicate glasses xBi2O3-(50-x)PbO-20B2O3-30SiO2 (x=2, 4, 6, 8, and 10 mol.%) were performed at room temperature using pulse-echo technique. Densities of glass samples were measured by Archimedes' principle using n-hexane as the immersion liquid. The results from the studies show that ultrasonic velocity, elastic moduli, Poisson's ratio, microhardness, and the Debye temperature increase with increasing bismuth oxide content and increasing gamma-radiation dose (3-12 Gy).

  14. Growth morphology and structure of bismuth thin films on GaSb(110)

    DEFF Research Database (Denmark)

    Gemmeren, T. van; Lottermoser, L.; Falkenberg, G.

    1998-01-01

    Photoelectron spectroscopy, low-energy electron diffraction, scanning tunneling microscopy and surface X-ray diffraction were used to investigate the growth of thin layers of bismuth on GaSb(110). At submonolayer coverages, growth of two-dimensional islands occurs. A uniform (1 x I)-reconstructio...... that the (1 x 1)-phases formed by antimony and bismuth adsorbates on (110) surfaces of other III-V compound semiconductors are also described by the epitaxial continued layer model. (C) 1998 Elsevier Science B.V. All rights reserved....

  15. Structure and Evolution of Galaxy Clusters Internal Dynamics of ABCG 209 at z~0.21

    CERN Document Server

    Mercurio, A; Boschin, W; Merluzzi, P; Busarello, G

    2003-01-01

    We study the internal dynamics of the rich galaxy cluster ABGC 209 on the basis of new spectroscopic and photometric data. The distribution in redshift shows that ABCG 209 is a well isolated peak of 112 detected member galaxies at z=0.209, characterised by a high value of the line-of-sight velocity dispersion, sigma_v=1250-1400 Km/s, on the whole observed area (1 Mpc/h from the cluster center), that leads to a virial mass of M=1.6-2.2x10^15 M_sun within the virial radius, assuming the dynamical equilibrium. The presence of a velocity gradient in the velocity field, the elongation in the spatial distribution of the colour-selected likely cluster members, the elongation of the X-ray contour levels in the Chandra image, and the elongation of cD galaxy show that ABCG 209 is characterised by a preferential NW-SE direction. We also find a significant deviation of the velocity distribution from a Gaussian, and relevant evidence of substructure and dynamical segregation. All these facts show that ABCG 209 is a strong...

  16. Focused Ion Beam and Advanced Electron Microscopy for Minerals: Insights and Outlook from Bismuth Sulphosalts

    Directory of Open Access Journals (Sweden)

    Cristiana L. Ciobanu

    2016-10-01

    Full Text Available This paper comprises a review of the rapidly expanding application of nanoscale mineral characterization methodology to the study of ore deposits. Utilising bismuth sulphosalt minerals from a reaction front in a skarn assemblage as an example, we illustrate how a complex problem in ore petrology, can be approached at scales down to that of single atoms. We demonstrate the interpretive opportunities that can be realised by doing this for other minerals within their petrogenetic contexts. From an area defined as Au-rich within a sulphosalt-sulphide assemblage, and using samples prepared on a Focused Ion Beam–Scanning Electron Microscopy (SEM platform, we identify mineral species and trace the evolution of their intergrowths down to the atomic scale. Our approach progresses from a petrographic and trace element study of a larger polished block, to high-resolution Transmission Electron Microscopy (TEM and High Angle Annular Dark Field (HAADF Scanning-TEM (STEM studies. Lattice-scale heterogeneity imaged in HAADF STEM mode is expressed by changes in composition of unit cell slabs followed by nanoparticle formation and their growth into “veins”. We report a progressive transition from sulphosalt species which host lattice-bound Au (neyite, lillianite homologues; Pb-Bi-sulphosalts, to those that cannot accept Au (aikinite. This transition acts as a crystal structural barrier for Au. Fine particles of native gold track this progression over the scale of several hundred microns, leading to Au enrichment at the reaction front defined by an increase in the Cu gradient (several wt %, and abrupt changes in sulphosalt speciation from Pb-Bi-sulphosalts to aikinite. Atom-scale resolution imaging in HAADF STEM mode allows for the direct visualisation of the three component slabs in the neyite crystal structure, one of the largest and complex sulphosalts of boxwork-type. We show for the first time the presence of aikinite nanoparticles a few nanometres in

  17. Designing of Anti Dengue Drug Molecule against Insilico Modeled Target DC-Sign (CD-209

    Directory of Open Access Journals (Sweden)

    Prashantha C.N

    2013-09-01

    Full Text Available The C-type lectin DC-SIGN (CD209 plays a major role in receptor on human dendritic cells, it binds to several glycoproteins of viruses that facilitate disease progression. In dengue fever, the disease targets of arbovirus infection, show dendritic and reticuloendothelial cells that may affect immune system. The phytochemical extracts of Bosenbergia rotunda (BR have been effectively used as potential small molecular inhibitors to inhibit DC-SIGN (CD209 function. Using rational drug designing the training sets include Panduratin-A and 4-hydroxypanduratin is designed from BR derivatives could be an effective inhibitor of a DC-SIGN (CD209 binding towards the drug discovery/ therapy against dengue fever.

  18. Measurement of neutron total cross-sections of 209Bi at the Pohang Neutron Facility

    CERN Document Server

    Wang, Tao-Feng; Kim, Guinyun

    2014-01-01

    Measurements of neutron total cross-sections of natural bismuth in the neutron energy region from 0.1 eV to 100 eV have been performed by using the time-of-flight method at the Pohang Neutron Facility, which consists of an electron linear accelerator, a water-cooled tantalum target with a water moderator, and a 12-m-long time-of-flight path. A 6Li-ZnS(Ag) scintillator with a diameter of 12.5 cm and a thickness of 1.6 cm is employed as a neutron detector, and a piece of high purity natural bismuth metallic plates with a thickness of 3 mm is used for the neutron transmission measurement. The present results were compared with the evaluated data from ENDF/B VII.1 and other previous reported experimental data.

  19. Study of the di-nuclear system $^{A}$Rb + $^{209}$Bi (Z$_{1}$ + Z$_{2}$ = 120)

    CERN Multimedia

    The exact location of the next spherical shell closures beyond Z = 82, N = 126 is still an open question. According to model predictions shell closures are expected at Z = 114 or 120 or 126 and N = 184. Also experimental data cannot yet give a definite answer. Known nuclei with Z = 114 are too neutron‐deficient with respect to the N = 184 shell and nuclei with Z = 120 and beyond are still unknown. An option for studying reactions of super-heavy systems at Z = 120 and neutron numbers up to 184 becomes possible with the use of $^{209}$Bi targets and neutron‐rich beams. By studying quasi-fission and fusion‐fission reactions, which have significantly larger production cross‐sections than the evaporation residues, a possible influence of shell closures at Z = 120, N = 184 can be explored. Well suitable for such studies will be neutron‐rich rubidium beams at energies of about 5 MeV/u delivered by the HIE‐ISOLDE facility.

  20. Extractive Spectrophotometric Determination of Bismuth(III in Water Using Some Ion Pairing Reagents

    Directory of Open Access Journals (Sweden)

    Abdulaziz S. Bashammakh

    2011-01-01

    Full Text Available Two novel and low cost liquid-liquid extraction methods for the separation of bismuth(III at trace level from aqueous medium have been developed. The two methods were based upon the formation of yellow colored ternary complex ion associates of tetraiodobismuth(III complex anion, BiI4- with the ion-pairing reagent 2,3,5-tetraphenyltetrazoliumchloride (Tz+.Cl– and 1, 10 phenanthroline (Phen in sulfuric acid medium. The effect of various parameters e.g. pH, organic solvent, shaking time, etc. on the preconcentration of bismuth(III from the aqueous media by the reagent was investigated. The developed colored complex ion associates [Tz+.BiI4-] and [Phen+.BiI4-] were extracted quantitatively into acetone-chloroform (1:1v/v and methyliso- butylketone (MIBK, respectively. The compositions of the formed complex ion associates [Tz+.BiI4-] and [Phen+.BiI4-] were determined by the Job's method at 500 and 490 nm, respectively. The plots of bismuth(III concentration (0-17 μg mL-1 versus absorbance of the associates at 500 and 490 nm were linear with good correlation coefficient (R2=0.998. The developed method of the ion associate [Tz+.BiI4-] two methods was applied successfully for the analysis of bismuth in water.

  1. Electrodeposition of bismuth telluride thermoelectric films from a nonaqueous electrolyte using ethylene glycol

    NARCIS (Netherlands)

    Nguyen, H.P.; Wu, M.; Su, J.; Vullers, R.J.M.; Vereecken, P.M.; Fransaer, J.

    2012-01-01

    Ethylene glycol was studied as an electrolyte for the electrodeposition of thermoelectric bismuth telluride films by cyclic voltammetry, rotating ring disk electrode and electrochemical quartz crystal microbalance (EQCM). The reduction of both Bi3+ and Te4+ ions proceeds in one step without the form

  2. Bismuth-embedded SBA-15 mesoporous silica for radioactive iodine capture and stable storage

    Science.gov (United States)

    Yang, Jae Hwan; Cho, Yong-Jun; Shin, Jin Myeong; Yim, Man-Sung

    2015-10-01

    Efficient capture and stable storage of the long-lived iodine-129 (129I), released as off-gas from nuclear fuel reprocessing, have been of significant concern in the waste management field. In this study, bismuth-embedded SBA-15 mesoporous silica was firstly applied for iodine capture and storage. SBA-15 was functionalized with thiol (-SH) groups, followed by bismuth adsorption with Bi-S bonding, which was thermally treated to form Bi2S3 within SBA-15. The bismuth-embedded SBA-15s demonstrated high iodine loading capacities (up to 540 mg-I/g-sorbent), which benefitted from high surface area and porosity of SBA-15 as well as the formation of thermodynamically stable BiI3 compound. Iodine physisorption was effectively suppressed due to the large pores present in SBA-15, resulting in chemisorption as a main mechanism for iodine confinement. Furthermore, a chemically durable iodine-bearing material was made with a facile post-sorption process, during which the iodine-incorporated phase was changed from BiI3 to chemically durable Bi5O7I. Thus, our results showed that both efficient capture and stabilization of 129I would be possible with the bismuth-embedded SBA-15, in contrast to other sorbents mainly focused on iodine capture.

  3. Dismantling and chemical characterization of spent Peltier thermoelectric devices for antimony, bismuth and tellurium recovery.

    Science.gov (United States)

    Balva, Maxime; Legeai, Sophie; Garoux, Laetitia; Leclerc, Nathalie; Meux, Eric

    2017-04-01

    Major uses of thermoelectricity concern refrigeration purposes, using Peltier devices, mainly composed of antimony, bismuth and tellurium. Antimony was identified as a critical raw material by EU and resources of bismuth and tellurium are not inexhaustible, so it is necessary to imagine the recycling of thermoelectric devices. That for, a complete characterization is needed, which is the aim of this work. Peltier devices were manually dismantled in three parts: the thermoelectric legs, the alumina plates on which remain the electrical contacts and the silicone paste used to connect the plates. The characterization was performed using five Peltier devices. It includes mass balances of the components, X-ray diffraction analysis of the thermoelectric legs and elemental analysis of each part of the device. It appears that alumina represents 45% of a Peltier device in weight. The electrical contacts are mainly composed of copper and tin, and the thermoelectric legs of bismuth, tellurium and antimony. Thermoelectric legs appear to be Se-doped Bi2Te3 and (Bi0,5Sb1,5)Te3 for n type and p type semiconductors, respectively. This work shows that Peltier devices can be considered as a copper ore and that thermoelectric legs contain high amounts of bismuth, tellurium and antimony compared to their traditional resources.

  4. Controlled growth of bismuth nanoparticles by electron beam irradiation in TEM

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Seon Ho [College of Environment and Applied Chemistry, Kyung Hee University, Yongin 449-701 (Korea, Republic of); Choi, Young-Suk [Center for Functional Nanomaterials, Brookhaven National Laboratory, Upton, NY 11973 (United States); Kang, Kyongha [Materials Science Department, Brookhaven National Laboratory, Upton, NY 11973 (United States)]. E-mail: kkang@bnl.gov; Yang, Sung Ik [College of Environment and Applied Chemistry, Kyung Hee University, Yongin 449-701 (Korea, Republic of)]. E-mail: siyang@khu.ac.kr

    2007-01-16

    In situ nanometer-sized bismuth particles were synthesized by irradiation of the electron beam in the TEM. The size of the crystalline Bi nanoparticles could be controlled by adjusting the irradiation time of the electron beam. Characterization of TEM reveals that the Bi nanoparticles exist in rhombic structure, same as to bulk Bi.

  5. Controlled oxidative synthesis of Bi nanoparticles and emission centers in bismuth glass nanocomposites for photonic application

    Science.gov (United States)

    Singh, Shiv Prakash; Karmakar, Basudeb

    2011-09-01

    Here we demonstrate an oxidative process to control metallic bismuth (Bi 0) nanoparticles (NPs) creation in bismuth glass nanocomposites by using K 2S 2O 8 as oxidant and enhanced transparency of bismuth glasses. Formation of Bi 0 NPs has been monitored by their distinct surface plasmon resonance (SPR) band at 460 nm in the UV-visible absorption spectra. It is further confirmed by the transmission electron microscopy (TEM) images which disclose the formation of spherical Bi 0 NPs whereas the selected area electron diffraction (SAED) pattern reveals their crystalline rhombohedral phase. These glasses are found to exhibit visible and near infrared (NIR) luminescence bands at 630 and 843 nm respectively on excitation at 460 nm of the SPR band. It is realized that the luminescence center of bismuth species is an uncertain issue, however, it is reasonable to consider that the emission band at 630 nm is due to the combination of 2D 5/2 → 4S 3/2 of Bi 0 and 2P 3/2 (1) → 2P 1/2 of Bi 2+ transitions, and that of NIR emission band at 843 nm is attributed to the 2D 3/2 → 4S 3/2 of Bi 0 transition.

  6. The antimicrobial effects and metabolomic footprinting of carboxyl-capped bismuth nanoparticles against Helicobacter pylori.

    Science.gov (United States)

    Nazari, P; Dowlatabadi-Bazaz, R; Mofid, M R; Pourmand, M R; Daryani, N E; Faramarzi, M A; Sepehrizadeh, Z; Shahverdi, A R

    2014-01-01

    Organic salts of bismuth are currently used as antimicrobial agents against Helicobacter pylori. This study evaluated the antibacterial effect of elemental bismuth nanoparticles (Bi NPs) using a serial agar dilution method for the first time against different clinical isolates and a standard strain of H. pylori. The Bi NPs were biologically prepared and purified by a recently described method and subjected to further characterization by infrared spectroscopy and anti-H. pylori evaluation. Infrared spectroscopy results showed the presence of carboxyl functional groups on the surface of biogenic Bi NPs. These biogenic nanoparticles showed good antibacterial activity against all tested H. pylori strains. The resulting MICs varied between 60 and 100 μg/ml for clinical isolates of H. pylori and H. pylori (ATCC 26695). The antibacterial effect of bismuth ions was also tested against all test strains. The antimicrobial effect of Bi ions was lower than antimicrobial effect of bismuth in the form of elemental NPs. The effect of Bi NPs on metabolomic footprinting of H. pylori was further evaluated by (1)H NMR spectroscopy. Exposure of H. pylori to an inhibitory concentration of Bi NPs (100 μg/ml) led to release of some metabolites such as acetate, formic acid, glutamate, valine, glycine, and uracil from bacteria into their supernatant. These findings confirm that these nanoparticles interfere with Krebs cycle, nucleotide, and amino acid metabolism and shows anti-H. pylori activity.

  7. Microwave-assisted facile and rapid Friedel-Crafts benzoylation of arenes catalysed by bismuth trifluoromethanesulfonate

    DEFF Research Database (Denmark)

    Tran, Phoung Hoang; Hansen, Poul Erik; Pham, Thuy Than;

    2014-01-01

    The catalytic activity of metal triflates was investigated in Friedel–Crafts benzoylation under microwave irradiation. Friedel–Crafts benzoylation with benzoyl chloride of a variety of arenes containing electron-rich and electron-poor rings using bismuth triflate under microwave irradiation is de...

  8. Effect of bismuth citrate, lactose, and organic acid on necrotic enteritis in broilers

    Science.gov (United States)

    Clostridium perfringens – associated necrotic enteritis causes significant losses and increased morbidity in poultry. The objective of this study was to evaluate the effect of bismuth citrate and acidifiers on the development of necrotic enteritis in broilers. The first study was a dose response t...

  9. 1.3 µm Raman-bismuth fiber amplifier pumped by semiconductor disk laser.

    Science.gov (United States)

    Chamorovskiy, A; Rautiainen, J; Rantamäki, A; Golant, K M; Okhotnikov, O G

    2011-03-28

    A hybrid Raman-bismuth fiber amplifier pumped in co-propagation configuration by a single 1.22 µm semiconductor disk laser is presented. The unique attribute of this dual-gain system is that both amplifiers require the pump source with the same wavelength because pump-Stokes spectral shift in 1.3 µm Raman amplifier and pump-gain bandwidth separation in 1.3 µm bismuth fiber amplifier have the same value. Residual pump power at the output of Raman amplifier in this scheme is efficiently consumed by bismuth-doped fiber thus increasing the overall conversion efficiency. The small-signal gain of 18 dB at 1.3 W of pump power has been achieved for hybrid scheme which is by 9 dB higher as compared with isolated Raman amplifier without bismuth fiber. Low noise performance of pump semiconductor disk laser with RIN of -150 dB/Hz combined with nearly diffraction-limited beam quality and Watt-level output powers allows for efficient core-pumping of a single-mode fiber amplifier systems and opens up new opportunities for amplification in O-band spectral range.

  10. Group III-nitride thin films grown using MBE and bismuth

    Science.gov (United States)

    Kisielowski, Christian K.; Rubin, Michael

    2000-01-01

    The present invention comprises growing gallium nitride films in the presence of bismuth using MBE at temperatures of about 1000 K or less. The present invention further comprises the gallium nitride films fabricated using the inventive fabrication method. The inventive films may be doped with magnesium or other dopants. The gallium nitride films were grown on sapphire substrates using a hollow anode Constricted Glow Discharge nitrogen plasma source. When bismuth was used as a surfactant, two-dimensional gallium nitride crystal sizes ranging between 10 .mu.m and 20 .mu.m were observed. This is 20 to 40 times larger than crystal sizes observed when GaN films were grown under similar circumstances but without bismuth. It is thought that the observed increase in crystal size is due bismuth inducing an increased surface diffusion coefficient for gallium. The calculated value of 4.7.times.10.sup.-7 cm.sup.2 /sec. reveals a virtual substrate temperature of 1258 K which is 260 degrees higher than the actual one.

  11. Structural Engineering of Vacancy Defected Bismuth Tellurides for Thermo-electric Applications

    Science.gov (United States)

    Termentzidis, K.; Pokropivny, A.; Xiong, S.-Y.; Chumakov, Y.; Cortona, P.; Volz, S.

    2012-10-01

    Molecular Dynamics and ab-initio simulations are used to find the most stable stoichiometries of Bismuth Tellurides with vacancy defects. The interest is to decrease the thermal conductivity of these compounds a key point to achieve high figure of merits. A reduction of 70% of the thermal conductivity is observed with Te vacancies of only 5%.

  12. Preparation of Bismuth Oxide Photocatalyst and Its Application in White-light LEDs

    Directory of Open Access Journals (Sweden)

    Yen-Chang Chu

    2013-01-01

    Full Text Available Bismuth oxide photocatalysts were synthesized and coated on the front surface of phosphor-converted white light-emitting diodes to produce a safe and environmentally benign lighting source. Bismuth oxide photocatalyst powders were synthesized with a spray pyrolysis method at 500°C, 600°C, 700°C, and 800°C. Using the absorption spectrum in the blue and UV regions of the bismuth oxide photocatalysts, the blue light and UV leakage problems of phosphor-converted white LEDs can be significantly reduced. The experimental results showed that bismuth oxide photocatalyst synthesized at 700°C exhibited the most superior spectrum inhibiting ability. The suppressed ratio reached 52.33% in the blue and UV regions from 360 to 420 nm. Related colorimetric parameters and the photocatalyst decomposition ability of fabricated white-light LEDs were tested. The CIE chromaticity coordinates (x,y were (0.349, 0.393, and the correlated color temperature was 4991 K. In addition, the coating layer of photocatalyst can act as an air purifier and diffuser to reduce glare. A value of 66.2±0.60 ppmv of molecular formaldehyde gas can be decomposed in 120 mins.

  13. Thickness dependence of oxygen permeation through erbia-stabilized bismuth oxide-silver composites

    NARCIS (Netherlands)

    Chen, C.S.; Kruidhof, H.; Bouwmeester, H.J.M.; Verweij, H.; Burggraaf, A.J.

    1997-01-01

    Oxygen permeation measurements were performed on erbia-stabilized bismuth oxide-silver (40 v/o) composite membranes in the range of thickness of 1.60–0.23 mm and temperature of 850–650 °C. Air was fed at one side of the membranes while permeated oxygen on the other side was swept away with helium. A

  14. Dynamic spatial structure of spontaneous beams in photorefractive bismuth sillicon oxide

    DEFF Research Database (Denmark)

    Buchhave, Preben; Lyuksyutov, S.; Vasnetsov, M.

    1996-01-01

    We report the domain structure of spontaneously occurring beams (subharmonics) in photorefractive bismuth silicon oxide with an applied electric field from 1 to 6 kV/cm and a running grating. The subharmonic beams are generated in a pattern of domains that evolve dynamically as they move through...

  15. Bismuth ferrite as low-loss switchable material for plasmonic waveguide modulator.

    Science.gov (United States)

    Babicheva, Viktoriia E; Zhukovsky, Sergei V; Lavrinenko, Andrei V

    2014-11-17

    We propose new designs of plasmonic modulators, which can be used for dynamic signal switching in photonic integrated circuits. We study performance of a plasmonic waveguide modulator with bismuth ferrite as a tunable material. The bismuth ferrite core is sandwiched between metal plates (metal-insulator-metal configuration), which also serve as electrodes. The core changes its refractive index by means of partial in-plane to out-of-plane reorientation of ferroelectric domains in bismuth ferrite under applied voltage. As a result, guided modes change their propagation constant and absorption coefficient, allowing light modulation in both phase and amplitude control schemes. Due to high field confinement between the metal layers, existence of mode cut-offs for certain values of the core thickness, and near-zero material losses in bismuth ferrite, efficient modulation performance is achieved. For the phase control scheme, the π phase shift is provided by a 0.8-μm long device with propagation losses 0.29 dB/μm. For the amplitude control scheme, up to 38 dB/μm extinction ratio with 1.2 dB/μm propagation loss is predicted.

  16. Low-temperature, template-free synthesis of single-crystal bismuth telluride nanorods

    Energy Technology Data Exchange (ETDEWEB)

    Purkayastha, A. [Department of Materials Science and Engineering, Rensselaer Polytechnic Institute, 110 Eighth Street, Troy, NY 12180 (United States); Lupo, F. [Max Planck Institut fuer Metallforschung, Heisenbergstrasse 3, D-70569 Stuttgart (Germany); Kim, S.; Borca-Tasciuc, T. [Department of Mechanical, Aerospace, and Nuclear Engineering, Rensselaer Polytechnic Institute, 110 Eighth Street, Troy, NY 12180 (United States); Ramanath, G. [Department of Materials Science and Engineering, Rensselaer Polytechnic Institute, 110 Eighth Street, Troy, NY 12180 (United States); Max Planck Institut fuer Festkoerperforschung, Heisenbergstrasse 1, D-70569 Stuttgart (Germany)

    2006-02-17

    Synthesis of single-crystal bismuth telluride nanorods is reported by using a low-temperature, template-free approach. Films of thioglycolic acid functionalized nanorods doped with sulfur exhibit n-type behavior with a high Seebeck coefficient, holding promise for thermoelectric device applications. (Abstract Copyright [2006], Wiley Periodicals, Inc.)

  17. 40 CFR 471.10 - Applicability; description of the lead-tin-bismuth forming subcategory.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Applicability; description of the lead-tin-bismuth forming subcategory. 471.10 Section 471.10 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS NONFERROUS METALS FORMING AND METAL...

  18. Response of Ag Thick Film Microstripline due to Superstrate Strontium Substituted Bismuth Manganites

    Directory of Open Access Journals (Sweden)

    S.N. Mathad

    2014-06-01

    Full Text Available The purpose of this paper is to describe the use of strontium-substituted bismuth manganites bulk ceramic superstrate on Ag thick film microstripline, to modify its response and measure complex permittivity as a function of strontium. Bismuth strontium manganites (Bi1 − xSrxMnO3 have been synthesized by solid state sintering technique. The perturbation obtained in the transmittance and reflectance of thick film microstripline due to the Bi1 − xSrxMnO3 (0.20  x  0.50 overlay has been used to obtain the permittivity at microwave frequencies in X and Ku band range. Due to the overlay of Bismuth strontium manganites (BSM pellets a substantial increase in the effective dielectric constant was observed in X band more compared to Ku band. The in-touch overlay method provides ease loading and unloading. The perturbation obtained in the transmittance and reflectance of thick film microstripline due to the bismuth strontium manganites overlay has been used to obtain the permittivity.

  19. 75 FR 34360 - Listing of Color Additives Exempt From Certification; Bismuth Citrate; Confirmation of Effective...

    Science.gov (United States)

    2010-06-17

    ... HUMAN SERVICES Food and Drug Administration 21 CFR Part 73 Listing of Color Additives Exempt From... March 26, 2010. The final rule amended the color additive regulations by increasing the permitted use level of bismuth citrate as a color additive in cosmetics intended for coloring hair on the scalp....

  20. Structural Engineering of Vacancy Defected Bismuth Tellurides for Thermo-electric Applications

    Directory of Open Access Journals (Sweden)

    Chumakov Y.

    2012-10-01

    Full Text Available Molecular Dynamics and ab-initio simulations are used to find the most stable stoichiometries of Bismuth Tellurides with vacancy defects. The interest is to decrease the thermal conductivity of these compounds a key point to achieve high figure of merits. A reduction of 70% of the thermal conductivity is observed with Te vacancies of only 5%.

  1. Nuclear levels and structure from the decays of 213Bi and 209Tl

    Science.gov (United States)

    Ardisson, G.; Barci, V.; El Samad, O.

    1998-02-01

    Direct γ and γ-γ coincidence spectra of pure 209Tl and 213Bi sources obtained by radiochemical continuous separation were measured with coaxial and planar HPGe detectors. In 209Tl the half-life was measured, the β-decay energies and intensities of 11 γ transitions were reported, and a new decay scheme was proposed. In 213Bi β decay 22 transitions were observed, of which 18 were assigned to a new 213Po level scheme accounting for 9 excited states.

  2. Influence of bismuth on the structure and activity of Pt and Pd nanocatalysts for the direct electrooxidation of NaBH{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Simoes, Mario; Baranton, Steve [Laboratoire de Catalyse en Chimie Organique, Equipe Electrocatalyse, UMR 6503 CNRS, 40 avenue du recteur Pineau, F-86022 Poitiers Cedex (France); Coutanceau, Christophe, E-mail: christophe.coutanceau@univ-poitiers.f [Laboratoire de Catalyse en Chimie Organique, Equipe Electrocatalyse, UMR 6503 CNRS, 40 avenue du recteur Pineau, F-86022 Poitiers Cedex (France)

    2010-12-15

    In the past few years, borohydrides have gathered a lot of attention as an energy carrier for fuel cell application. Numerous investigations on both hydrogen generation and direct oxidation of NaBH{sub 4} have been published. Nonetheless, in our knowledge, only a few catalysts are capable to completely perform the direct oxidation of NaBH{sub 4} at low potentials without hydrogen evolution. In this work, carbon supported Pd{sub 1-x}Bi{sub x}/C and Pt{sub 1-x}Bi{sub x}/C nanocatalysts were synthesized by a 'water in oil' microemulsion method. The influence of surface modifications of Pt and Pd by Bi on the electrooxidation of sodium borohydride in alkaline media was evaluated. Physical and electrochemical methods were applied to characterize the structure and surface of the synthesized catalysts. It was verified that bismuth is present at the surface of the bimetallic catalysts and that hydrogen adsorption/desorption reactions are strongly limited on Pt and Pd surfaces with high bismuth coverage. Although the onset potential for NaBH{sub 4} oxidation on Pd{sub x}Bi{sub 1-x}/C catalysts is ca. 0.2 V higher than that for Pd/C, the presence of bismuth on palladium surface influences the reaction mechanism, limiting hydrogen evolution and oxidation in the case of Pd{sub 0.8}Bi{sub 0.2} catalyst. On Pt{sub 0.9}Bi{sub 0.1} catalyst the onset potential remains unchanged comparing to Pt/C and negligible hydrogen evolution was observed in the whole potential range where the catalyst is active. The number of exchanged electrons was calculated using the Koutecky-Levich equation and it was found that for Pt{sub 0.9}Bi{sub 0.1} catalyst, ca. 8 electrons are exchanged per BH{sub 4}{sup -} ion at low potentials. The presented results are remarkable evidencing that NaBH{sub 4} can be directly oxidized at low potentials with high energy efficiency.

  3. Synthesis of mercuric iodide and bismuth tri-iodide nanoparticles for heavy metal iodide films nucleation

    Energy Technology Data Exchange (ETDEWEB)

    Fornaro, L.; Pereira, H.Bentos [Compound Semiconductors Group, CURE, Universidad de la Republica, Rocha (Uruguay); Aguiar, I.; Perez Barthaburu, M. [Compound Semiconductors Group, Facultad de Quimica, Univ. de la Republica, Montevideo (Uruguay)

    2011-12-15

    We synthesized mercuric iodide and bismuth tri-iodide nanoparticles by suspension in octadecene, from Hg(NO{sub 3}){sub 2}.H{sub 2}O and I{sub 2}, and from Bi(NO{sub 3}){sub 3}.5H{sub 2}O and I{sub 2}, respectively. The best synthesis conditions were 2 h at 70-80 C, followed by 10 min at 110 C for mercuric iodide nanoparticles, and 4 h at 80-110 C, followed by 10 min at 180-210 C for bismuth tri-iodide ones. Nanoparticles were then washed and centrifuged with ether repeatedly. Compounds identity was confirmed by X-ray diffraction (XRD) and energy dispersive spectrometry (EDS). We found shifts of the X-ray diffraction maxima for nanoparticles of both compounds. We characterized the nanoparticles by transmission (TEM) and scanning (SEM) electron microscopy. We obtained disk-like and squared mercuric iodide nanostructures, 80-140 nm and 100-125 nm in size respectively. We also obtained rounded and rod-like bismuth tri-iodide nanoparticles, 30-500 nm in size. Acetonitrile and isopropanol suspensions of mercuric iodide nanoparticles, and acetonitrile suspension of bismuth tri-iodide nanoparticles exhibited peak maxima shifts in their UV-Vis spectra. We synthesized for the first time mercuric iodide and bismuth tri-iodide nanoparticles by the suspension method, although we have not yet obtained uniform shape and size distributions. They offer interesting perspectives for crystalline film nucleation and for improving current applications of these materials, as well as for opening new ones. (copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  4. Dose reduction in CT using bismuth shielding: measurements and Monte Carlo simulations.

    Science.gov (United States)

    Chang, Kyung-Hwan; Lee, Wonho; Choo, Dong-Myung; Lee, Choon-Sik; Kim, Youhyun

    2010-03-01

    In this research, using direct measurements and Monte Carlo calculations, the potential dose reduction achieved by bismuth shielding in computed tomography was evaluated. The patient dose was measured using an ionisation chamber in a polymethylmethacrylate (PMMA) phantom that had five measurement points at the centre and periphery. Simulations were performed using the MCNPX code. For both the bare and the bismuth-shielded phantom, the differences of dose values between experiment and simulation were within 9%. The dose reductions due to the bismuth shielding were 1.2-55% depending on the measurement points, X-ray tube voltage and the type of shielding. The amount of dose reduction was significant for the positions covered by the bismuth shielding (34 - 46% for head and 41 - 55% for body phantom on average) and negligible for other peripheral positions. The artefact on the reconstructed images were minimal when the distance between the shielding and the organs was >1 cm, and hence the shielding should be selectively located to protect critical organs such as the eye lens, thyroid and breast. The simulation results using the PMMA phantom was compared with those using a realistically voxelised phantom (KTMAN-2). For eye and breast, the simulation results using the PMMA and KTMAN-2 phantoms were similar with each other, while for thyroid the simulation results were different due to the discrepancy of locations and the sizes of the phantoms. The dose reductions achieved by bismuth and lead shielding were compared with each other and the results showed that the difference of the dose reductions achieved by the two materials was less than 2-3%.

  5. Biomimetic cationic polyannulation reaction catalyzed by Bi(OTf)3: cyclization of 1,6-dienes, 1,6,10-trienes, and aryl polyenes.

    Science.gov (United States)

    Godeau, Julien; Olivero, Sandra; Antoniotti, Sylvain; Duñach, Elisabet

    2011-07-01

    Nonactivated trienes and aryltrienes were cyclized into polycyclic compounds in good to excellent yields under bismuth triflate catalysis in a biomimetic fashion. The reaction showed broad applicability and allowed for the formation of functionalized bicyclic to tetracyclic structures from simple precursors in one pot. For some specific substrates, the cyclization was followed by a methyl shift as encountered in terpenoid biosynthesis.

  6. Hall Plateaus at magic angles in ultraquantum Bismuth

    Science.gov (United States)

    Benoît, Fauqué.

    2009-03-01

    The behaviour of a three-dimensional electron gas in the presence of a magnetic field strong enough to put all carriers in the first Landau level (i.e. beyond the quantum limit) is a longstanding question of theoretical condensed matter physics [1]. This issue has been recently explored by two high-field experiments on elemental semi-metal Bismuth. In a first study of transport coefficients (which are dominated by hole-like carriers), the Nernst coefficient presented three unexpected maxima that are concomitant with quasi-plateaux in the Hall coefficient [2]. In a second series of experiments, torque magnetometry (which mainly probes the three Dirac valley electron pockets) detected a field-induced phase transition [3]. The full understanding of the electron and hole behaviours above the quantum limit of pure Bi is therefore still under debate. In this talk, we will present our measurement of the Hall resistivity and torque magnetometry with magnetic field up to 31 T and rotating in the trigonal-bisectrix plane [4]. The Hall response is dominated by the hole pockets according to its sign as well as the period and the angular dependence of its quantum oscillations. In the vicinity of the quantum limit, it presents additional anomalies which are the fingerprints of the electron pockets. We found that for particular orientations of the magnetic field (namely ``magic angles''), the Hall response becomes field-independent within the experimental resolution around 20T. This drastic dependence of the plateaux on the field orientation provides strong constraints for theoretical scenarios. [4pt] [1] Bertrand I. Halperin, Japanese Journal of Applied Physics, 26, Supplement 26-3 (1987).[0pt] [2] Kamran Behnia, Luis Balicas, Yakov Kopelevich, Science, 317, 1729 (2008).[0pt] [3] Lu Li, J. G. Checkelsky, Y. S. Hor, C. Uher, A. F. Hebard, R. J. Cava, and N. P. Ong , Science, 321, 5888 (2008).[0pt] [4] Benoît Fauqu'e, Luis Balicas, Ilya Sheikin, Jean Paul Issi and Kamran Behnia

  7. 48 CFR 1553.209-71 - EPA Form 1900-27, Project Officer's Evaluation of Contractor Performance.

    Science.gov (United States)

    2010-10-01

    ... Officer's Evaluation of Contractor Performance. 1553.209-71 Section 1553.209-71 Federal Acquisition... EPA Form 1900-27, Project Officer's Evaluation of Contractor Performance. As prescribed in 1509.170-4(a), EPA Form 1900-27 shall be used by the Project Officer to record his/her evaluation of...

  8. Effect of Tween 80 and beta-cyclodextrin on degradation of decabromodiphenyl ether (BDE-209) by White rot fungi.

    Science.gov (United States)

    Zhou, Juan; Jiang, Weiying; Ding, Juan; Zhang, Xingding; Gao, Shixiang

    2007-12-01

    The environmental safety of decabromodiphenyl ether (BDE-209), a widely used flame retardant, has been the topic of controversial discussions during the past several years. Degradation of BDE-209 into lower brominated diphenyl ether congeners, exhibiting a higher bioaccumulation potential, has been a critical issue. White rot fungi are known to degrade a wide variety of recalcitrant pollutants. In this work, white rot fungi were used to degrade BDE-209 in liquid culture medium, and the effects of Tween 80 and beta-cyclodextrin on BDE-209 degradation by white rot fungi were evaluated. On the basis of these results, it appears that BDE-209 could be degraded by white rot fungi, and Tween 80 and beta-cyclodextrin can both increase the biodegradation. The best result in Tween 80 experiments was obtained at a Tween 80 concentration of 500mgl(-1) within 10d, which showed 96.5% (w/w) BDE-209 transformed. Tween 80 at a high concentration will restrain the fungal growth and the degradation of BDE-209. However, beta-cyclodextrin had positive effects both on the BDE-209 degradation and the fungal growth.

  9. 33 CFR 209.325 - Navigation lights, aids to navigation, navigation charts, and related data policy, practices and...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Navigation lights, aids to navigation, navigation charts, and related data policy, practices and procedure. 209.325 Section 209.325 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF...

  10. 48 CFR 252.209-7001 - Disclosure of ownership or control by the government of a terrorist country.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Disclosure of ownership or control by the government of a terrorist country. 252.209-7001 Section 252.209-7001 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT...

  11. The Effect of Beam Intensity on Temperature Distribution in ADS Windowless Lead-Bismuth Eutectic Spallation Target

    Directory of Open Access Journals (Sweden)

    Jie Liu

    2014-01-01

    Full Text Available The spallation target is the component coupling the accelerator and the reactor and is regarded as the “heart” of the accelerator driven system (ADS. Heavy liquid metal lead-bismuth eutectic (LBE is served as core coolant and spallation material to carry away heat deposition of spallation reaction and produce high flux neutron. So it is very important to study the heat transfer process in the target. In this paper, the steady-state flow pattern has been numerically obtained and taken as the input for the nuclear physics calculation, and then the distribution of the extreme large power density of the heat load is imported back to the computational fluid dynamics as the source term in the energy equation. Through the coupling, the transient and steady-state temperature distribution in the windowless spallation target is obtained and analyzed based on the flow process and heat transfer. Comparison of the temperature distribution with the different beam intensity shows that its shape is the same as broken wing of the butterfly. Nevertheless, the maximum temperature as well as the temperature gradient is different. The results play an important role and can be applied to the further design and optimization of the ADS windowless spallation target.

  12. Impact of co-exposure with lead and decabromodiphenyl ether (BDE-209) on thyroid function in zebrafish larvae

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Biran; Wang, Qiangwei; Wang, Xianfeng [State Key Laboratory of Freshwater Ecology and Biotechnology, Institute of Hydrobiology, Chinese Academy of Sciences, Wuhan 430072 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Zhou, Bingsheng, E-mail: bszhou@ihb.ac.cn [State Key Laboratory of Freshwater Ecology and Biotechnology, Institute of Hydrobiology, Chinese Academy of Sciences, Wuhan 430072 (China)

    2014-12-15

    Highlights: • PBDEs and metals are the main contaminants at e-waste recycling sites. • Combined effects of Pb/BDE-209 on thyroid function in zebrafish larvae were studied. • Co-exposure of Pb and BDE-209 elicited synergistic effects on T{sub 3} and T{sub 4} levels. • BDE-209 enhanced Pb uptake, and Pb decreased bioconcentration/metabolism of BDE-209. • Mixtures of Pb and BDE-209 probably result in an increase in toxicological effects. - Abstract: Polybrominated diphenyl ethers (PBDEs) and metals are the main contaminants at waste electrical and electronic equipment (“e-waste”) recycling sites. However, the potential environmental health effects of mixtures of PBDEs and metals are not known. We investigated co-exposure of lead (Pb) with decabromodiphenyl ether (BDE-209) on thyroid function in zebrafish larvae. Seven groups of embryos/larvae of zebrafish were treated with Pb (0, 2, 5, 10, 15, 20, and 30 μg/L), six groups were exposed to BDE-209 (0, 50, 100, 200, 400, and 800 μg/L), and nine groups of zebrafish larvae were treated with Pb and BDE-209 (5, 10, and 20 μg/L Pb; 50, 100, and 200 μg/L BDE-209). Embryos/larvae were exposed from 2 h post-fertilization (hpf) until 144 hpf, and thyroid hormone (TH) content measured. Pb exposure significantly decreased whole-body TH contents (triiodothyroxine (T{sub 3}) and thyroxine (T{sub 4})) but BDE-209 exposure significantly increased T{sub 3} and T{sub 4} levels. Pb or BDE-209 treatment alone caused a predicted downregulation of TH transport (i.e., expression of the mRNA or proteins of transthyretin). Chemical analyses showed Pb uptake to be increased by BDE-209, but BDE-209 bioconcentration was decreased and the ability to metabolize BDE-209 was reduced in the presence of Pb. We also found that a mixture of the two chemicals had a synergistic effect on TH levels in zebrafish.

  13. 48 CFR 52.209-4 - First Article Approval-Government Testing.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false First Article Approval... Clauses 52.209-4 First Article Approval—Government Testing. As prescribed in 9.308-2 (a) and (b), insert the following clause: First Article Approval—Government Testing (SEP 1989) (a) The Contractor...

  14. 48 CFR 52.209-3 - First Article Approval-Contractor Testing.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false First Article Approval... Clauses 52.209-3 First Article Approval—Contractor Testing. As prescribed in 9.308-1 (a) and (b), insert the following clause: First Article Approval—Contractor Testing (SEP 1989) (a) The Contractor...

  15. 41 CFR 101-6.209-3 - Access to sources of information.

    Science.gov (United States)

    2010-07-01

    ...-Nondiscrimination in Programs Receiving Federal Financial Assistance § 101-6.209-3 Access to sources of information... business hours to such of its books, records, accounts, and other sources of information, and its... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Access to sources...

  16. 77 FR 16319 - Amtrak's Petition for Determination of PRIIA Section 209 Cost Methodology

    Science.gov (United States)

    2012-03-20

    ... Amtrak's Petition for Determination of PRIIA Section 209 Cost Methodology AGENCY: Surface Transportation Board. ACTION: Adoption of methodology to establish and allocate costs for state-supported Amtrak routes. SUMMARY: Notice is hereby given of the adoption of a methodology to establish and allocate costs for...

  17. 29 CFR 780.209 - Packing, storage, warehousing, and sale of nursery products.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Packing, storage, warehousing, and sale of nursery products... Operations § 780.209 Packing, storage, warehousing, and sale of nursery products. Employees of a grower of nursery stock who work in packing and storage sheds sorting the stock, grading and trimming it, racking...

  18. Equal Opportunity in Higher Education: The Past and Future of California's Proposition 209

    Science.gov (United States)

    Grodsky, Eric, Ed.; Kurlaender, Michal, Ed.

    2010-01-01

    This timely book examines issues pertaining to equal opportunity--affirmative action, challenges to it, and alternatives for improving opportunities for underrepresented groups--in higher education today. Its starting point is California's Proposition 209, which ended race-based affirmative action in public education and the workplace in 1996. The…

  19. The LEP 2 machine : pushing to the limits 209 GeV! Exhibition LEPFest 2000

    CERN Multimedia

    2000-01-01

    By installing 288 new superconducting accelerating cavities after 1995,and thanks to the excellent work of the CERN teams,energies up to 209 GeV -well beyond LEP 's original design energy -have been achieved.Significant experi- mental data have been collected at energies in excess of 206 GeV.

  20. 29 CFR 778.209 - Method of inclusion of bonus in regular rate.

    Science.gov (United States)

    2010-07-01

    ... LABOR STATEMENTS OF GENERAL POLICY OR INTERPRETATION NOT DIRECTLY RELATED TO REGULATIONS OVERTIME COMPENSATION Payments That May Be Excluded From the âRegular Rateâ Bonuses § 778.209 Method of inclusion of... overtime compensation. No difficulty arises in computing overtime compensation if the bonus covers only...

  1. 7 CFR 1710.209 - Approval requirements for load forecast work plans.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Approval requirements for load forecast work plans... LOANS AND GUARANTEES Load Forecasts § 1710.209 Approval requirements for load forecast work plans. (a... utility plant of $500 million or more must maintain an approved load forecast work plan. RUS...

  2. Recent progress of bismuth-containing photocatalysts%含铋光催化材料的研究进展

    Institute of Scientific and Technical Information of China (English)

    王伟华; 叶红齐; 覃涛; 刘宣业; 黄辉; 赵炜康; 朱坤杰

    2014-01-01

    Bismuth-containing photocatalysts can be used in many fields because of narrow band gap and ability of adsorbing visible light. In this paper , the latest research status and progress of bismuth-containing photocatalysts are reviewed. Bismuth oxide , halide bismuth oxide , bismuth titanate,bismuth tungstate,bismuth vanadate,bismuth molybdate and bismuth ferrite are introduced and the methods of improving photocatalytic performance are highlighted,including improvement of synthesis methods,photocatalysts doping and preparation of photocatalyst composites. Finally,the research directions of bismuth-containing photocatalysts are presented,aimed at improving overall performance and realizing industrial application of bismuth-containing photocatalysts , such as preparing multi-doped photocatalysts,multiple photocatalyst composites and supported catalysts.%含铋光催化材料因其能吸收可见光、催化活性高而具有广阔的应用前景。本文主要回顾了含铋光催化材料近年来的研究概况,详细介绍了铋氧化物、卤氧化铋及钛酸铋、钨酸铋、钒酸铋、钼酸铋、铁酸铋等光催化剂的结构、制备和光催化性能,重点对光催化性能的改进方法进行了综述,包括制备方法的改良、催化剂的掺杂改性及复合催化剂的制备等;最后针对进一步提高光催化剂整体性能、实现工业化应用两点,提出了未来可以利用多元元素掺杂、多元半导体复合进行改性和负载于某些载体制备整体催化剂进行改良的观点。

  3. 钒酸铋掺杂体系的研究进展%DEVELOPMENT OF DOPED BISMUTH VANADATE MATERIALS

    Institute of Scientific and Technical Information of China (English)

    朱振峰; 张炼

    2012-01-01

    This paper mainly introduces development of bismuth vanadate doped with rare earth elements,transition elements,carbon group elements and other elements and put forward a development direction of bismuth vanadate materials in the future.%介绍了稀土元素、过渡元素、碳族元素和其它元素的钒酸铋掺杂体系,并对未来的发展方向做出展望。

  4. Bismuth Based Hybrid Perovskites A3Bi2 I9 (A: Methylammonium or Cesium) for Solar Cell Application.

    Science.gov (United States)

    Park, Byung-Wook; Philippe, Bertrand; Zhang, Xiaoliang; Rensmo, Håkan; Boschloo, Gerrit; Johansson, Erik M J

    2015-11-18

    Low-toxic bismuth-based perovskites are prepared for the possible replacement of lead perovskite in solar cells. The perovskites have a hexagonal crystalline phase and light absorption in the visible region. A power conversion efficiency of over 1% is obtained for a solar cell with Cs3 Bi2 I9 perovskite, and it is concluded that bismuth perovskites have very promising properties for further development in solar cells.

  5. Pharmacokinetics and bioequivalence of ranitidine and bismuth derived from two compound preparations

    Institute of Scientific and Technical Information of China (English)

    Quan Zhou; Zou-Rong Ruan; Hong Yuan; Bo Jiang; Dong-Hang Xu

    2006-01-01

    AIM: To evaluate the bioequivalence of ranitidine and bismuth derived from two compound preparations.METHODS: The bioavailability was measured in 20healthy male Chinese volunteers following a single oral dose (equivalent to 200 mg of ranitidine and 220 mg of bismuth) of the test or reference products in the fasting state. Then blood samples were collected for 24 h.Plasma concentrations of ranitidine and bismuth were analyzed by high-performance liquid chromatography and inductively coupled plasma-mass spectrometry (ICPMS), respectively. The non-compartmental method was used for pharmacokinetic analysis. Log-transformed Cmax,AUC(0-t) and AUC(0-∞) were tested for bioequivalence using ANOVA and Schuirmann two-one sided t-test. Tmax was analyzed by Wilcoxon's test.RESULTS: Various pharmacokinetic parameters of ranitidine derived from the two compound preparations,including Cmax, AUC(0-t), AUC(0-∞), Tmax and T1/2, were nearly consistent with previous observations. These parameters derived from test and reference drug were as follows: Cmax(0.67 ± 0.21 vs 0.68 ± 0.22mg/L), AUC(0-t)(3.1 ± 0.6 vs 3.0 ± 0.7 mg/L per hour),AUC(0-∞)(3.3 ± 0.6 vs 3.2 ± 0.8 mg/L per hour),Tmax (2.3 ± 0.9 vs 2.1 ± 0.9 h) and T1/2 (2.8 ± 0.3 vs 3.1± 0.4 h). In addition, double-peak absorption profiles of ranitidine were found in some Chinese volunteers.For bismuth, those parameters derived from test and reference drug were as follows: Cmax (11.80 ± 7.36 vs 11.40 ± 6.55 μg/L),AUC(0-t) (46.65 ± 16.97 vs 47.03 ±21.49 μg/L per hour), Tmax (0.50 ± 0.20 vs 0.50 ± 0.20 h)and T1/2 (10.2 ± 2.3 vs 13.0 ± 6.9 h). Ninety percent of confidence intervals for the test/reference ratio of Cmax,AUC(0-t) and AUC(0-∞) derived from both ranitidine and bismuth were found within the bioequivalence acceptable range of 80%-125%. No significant difference was found in Tmax derived from both ranitidine and bismuth.CONCLUSION: The two compound preparations are bioequivalent and may be prescribed

  6. Characterization, Leaching, and Filtration Testing for Bismuth Phosphate Sludge (Group 1) and Bismuth Phosphate Saltcake (Group 2) Actual Waste Sample Composites

    Energy Technology Data Exchange (ETDEWEB)

    Lumetta, Gregg J.; Buck, Edgar C.; Daniel, Richard C.; Draper, Kathryn; Edwards, Matthew K.; Fiskum, Sandra K.; Hallen, Richard T.; Jagoda, Lynette K.; Jenson, Evan D.; Kozelisky, Anne E.; MacFarlan, Paul J.; Peterson, Reid A.; Shimskey, Rick W.; Sinkov, Sergey I.; Snow, Lanee A.

    2009-02-19

    A testing program evaluating actual tank waste was developed in response to Task 4 from the M-12 External Flowsheet Review Team (EFRT) issue response plan.() The test program was subdivided into logical increments. The bulk water-insoluble solid wastes that are anticipated to be delivered to the Waste Treatment and Immobilization Plant (WTP) were identified according to type such that the actual waste testing could be targeted to the relevant categories. Eight broad waste groupings were defined. Samples available from the 222S archive were identified and obtained for testing. The actual waste-testing program included homogenizing the samples by group, characterizing the solids and aqueous phases, and performing parametric leaching tests. Two of the eight defined groups—bismuth phosphate sludge (Group 1) and bismuth phosphate saltcake (Group 2)—are the subjects of this report. The Group 1 waste was anticipated to be high in phosphorus and was implicitly assumed to be present as BiPO4 (however, results presented here indicate that the phosphate in Group 1 is actually present as amorphous iron(III) phosphate). The Group 2 waste was also anticipated to be high in phosphorus, but because of the relatively low bismuth content and higher aluminum content, it was anticipated that the Group 2 waste would contain a mixture of gibbsite, sodium phosphate, and aluminum phosphate. Thus, the focus of the Group 1 testing was on determining the behavior of P removal during caustic leaching, and the focus of the Group 2 testing was on the removal of both P and Al. The waste-type definition, archived sample conditions, homogenization activities, characterization (physical, chemical, radioisotope, and crystal habit), and caustic leaching behavior as functions of time, temperature, and hydroxide concentration are discussed in this report. Testing was conducted according to TP-RPP-WTP-467.

  7. Mesures de taux de production d'éléments gazeux et volatiles lors de réactions induites par des protons de 1 et 1,4 GeV sur des cibles épaisses de plomb-bismuth liquides

    CERN Document Server

    Tall, Yoro

    2008-01-01

    The integrated project EUROTRANS (European Research Programme for the Transmutation of High Level Nuclear Waste in an Accelerator Driven System) of the 6th Euratom Framework Programme aims to demonstrate the transmutation of radioactive waste in ADS (Accelerator Driven Sub-critical system). It will carry out a first advanced design of an experimental facility to demonstrate the technical feasibility of transmutation, and will produce a conceptual design of an industrial facility dedicated to transmutation. An ADS consists of three fundamental elements: the accelerator of protons, the sub-critical core and the spallation target which one molten lead-bismuth concept is studied by the SUBATECH (physique SUBAtomique et des TECHnologies associées) laboratory in Nantes. The irradiation of molten lead-bismuth target with energetic proton beam generates volatile and radioactive residues. In order to determine experimentally the production rates of gas and volatile elements following a spallation reaction in a lead-b...

  8. [L'application des radioisotopes a la chromatographie sur colonnes de celluloses substituees-IV L'analyse du mercure et du zinc dans le bismuth].

    Science.gov (United States)

    Muzzarelli, R A; Marcotrigiano, G

    1967-03-01

    The Chromatographic behaviour of nanogram amounts of bismuth has been studied by radioisotope techniques on cellobiose, cellulose and seven substituted celluloses. All celluloses in ethyl ether adsorb bismuth, provided that it is as nitrate, and that excess of nitric acid is avoided. Bismuth can be eluted with thiocyanate in ether-methanol or with hydrochloric acid in methanol, depending on the retention strength of the various functional groups of celluloses. A very simple method of separation of bismuth from mercury over a wide range of concentration is presented.

  9. Accumulation, tissue-specific distribution and debromination of decabromodiphenyl ether (BDE 209) in European starlings (Sturnus vulgaris)

    Energy Technology Data Exchange (ETDEWEB)

    Steen, E. van den [Department of Biology, University of Antwerp (Campus Drie Eiken), Universiteitsplein 1, 2610 Wilrijk (Belgium)]. E-mail: evi.vandensteen@ua.ac.be; Covaci, A. [Toxicological Centre, University of Antwerp, Universiteitsplein 1, 2610 Wilrijk (Belgium); Jaspers, V.L.B. [Department of Biology, University of Antwerp (Campus Drie Eiken), Universiteitsplein 1, 2610 Wilrijk (Belgium); Dauwe, T. [Department of Biology, University of Antwerp (Campus Drie Eiken), Universiteitsplein 1, 2610 Wilrijk (Belgium); Voorspoels, S. [Toxicological Centre, University of Antwerp, Universiteitsplein 1, 2610 Wilrijk (Belgium); Eens, M. [Department of Biology, University of Antwerp (Campus Drie Eiken), Universiteitsplein 1, 2610 Wilrijk (Belgium); Pinxten, R. [Department of Biology, University of Antwerp (Campus Drie Eiken), Universiteitsplein 1, 2610 Wilrijk (Belgium)

    2007-07-15

    In this study we investigated the accumulation, tissue-specific distribution and possible debromination of BDE 209 in a terrestrial songbird species, the European starling, using silastic implants as a method of exposure. BDE 209 accumulated in the blood of the exposed starlings to a mean peak concentration of 16 {+-} 4.1 ng/ml on day 10. After this peak, there was a decline to 3.3 {+-} 0.4 ng/ml blood at the end of the exposure period of 76 days, which suggests elimination of BDE 209. In the exposed group, the muscle concentrations (461 ng/g lipid weight [lw], 430 ng/g lw) were about twofold those in liver (269 ng/g lw, 237 ng/g lw). In addition to BDE 209, other PBDE congeners, particularly octa- and nonaBDEs, were also present in the muscle and liver, suggesting bioformation from BDE 209. To our knowledge, these results are the first indications for the debromination of BDE 209 in birds. - BDE 209 accumulates in the blood and tissues of a terrestrial bird species, the European starling, and can be debrominated to lower PBDE congeners.

  10. Recovery of IR luminescence in photobleached bismuth-doped fibers by thermal annealing

    Science.gov (United States)

    Firstov, S. V.; Firstova, E. G.; Alyshev, S. V.; Khopin, V. F.; Riumkin, K. E.; Melkumov, M. A.; Guryanov, A. N.; Dianov, E. M.

    2016-08-01

    The effect of annealing temperature on the luminescent properties of bismuth-doped fibers bleached by 532 nm laser radiation was investigated. The photoluminescence (PL) measurements were performed in pristine and photobleached samples which were thermally annealed at various temperatures ranging from 100 to 900 °C and slowly cooled. We observed that the intensity of the PL band at 1700 nm in the photobleached fibers recovered its pre-bleached level. Moreover, it was shown that a significant increase of the PL level could be achieved using the special annealing regime. Thereby, we obtained the experimental evidence of a thermally activated recovery process of the PL intensity showing that photoinduced changes of PL in bismuth-doped fibers are completely reversible. The mechanism of the thermal recovery of the PL is discussed.

  11. Bismuth Basic Nitrate as a Novel Adsorbent for Azo Dye Removal

    Directory of Open Access Journals (Sweden)

    E. A. Abdullah

    2012-01-01

    Full Text Available Bismuth basic nitrate (BBN and its TiO2-Ag modified sorbent, PTBA were successfully synthesized via a precipitation method. The structural characteristics of prepared sorbents were determined through different analytical techniques. The potential use of prepared sorbents for organic compounds' removal was evaluated using Methyl Orange and Sunset Yellow dyes as model pollutants in aqueous solutions. The experimental results showed that the presence of TiO2 and Ag particles during the crystal growth of bismuth basic nitrate has an effect on the crystal structure, point of zero charge (pHpzc, pore volume and diameter. The lower binding energy of Ti 2p core level peak indicates the octahedral coordination of TiO2 particles on the PTBA surface. The alteration of hydrophilic-hydrophobic characteristics of sorbent's surface improves the adsorptive performance of the modified sorbent and provides an efficient route for organic contaminants' removal from aqueous solutions.

  12. Sandwich heterostructures of antimony trioxide and bismuth trioxide films: Structural, morphological and optical analysis

    Science.gov (United States)

    Condurache-Bota, Simona; Praisler, Mirela; Gavrila, Raluca; Tigau, Nicolae

    2017-01-01

    Thin film heterostructures can be advantageous since they either exhibit novel or a combination of the properties of their components. Here we propose sandwich-type of heterostructures made of antimony trioxide and bismuth trioxide thin films, which were deposited on glass substrates by thermal vacuum deposition at three substrate temperatures, 50° Celsius apart. Their morphology and optical properties are studied as compared to the corresponding monolayers. It was found that even small substrate temperature changes strongly influence their morphology, increasing their roughness, while the optical transmittance shows a slight decrease as compared with the individual layers. The corresponding absorption coefficient exhibits intermediate values as compared to the component oxides, while the energy bandgaps for the indirect allowed transitions move towards the Infrared when overlapping the antimony and bismuth trioxides.

  13. Mixed-layered bismuth--oxygen--iodine materials for capture and waste disposal of radioactive iodine

    Energy Technology Data Exchange (ETDEWEB)

    Krumhansl, James L; Nenoff, Tina M

    2015-01-06

    Materials and methods of synthesizing mixed-layered bismuth oxy-iodine materials, which can be synthesized in the presence of aqueous radioactive iodine species found in caustic solutions (e.g. NaOH or KOH). This technology provides a one-step process for both iodine sequestration and storage from nuclear fuel cycles. It results in materials that will be durable for repository conditions much like those found in Waste Isolation Pilot Plant (WIPP) and estimated for Yucca Mountain (YMP). By controlled reactant concentrations, optimized compositions of these mixed-layered bismuth oxy-iodine inorganic materials are produced that have both a high iodine weight percentage and a low solubility in groundwater environments.

  14. In situ transmission electron microscopy of solid-liquid phase transition of silica encapsulated bismuth nanoparticles

    Science.gov (United States)

    Hu, Jianjun; Hong, Yan; Muratore, Chris; Su, Ming; Voevodin, Andrey A.

    2011-09-01

    The solid-liquid phase transition of silica encapsulated bismuth nanoparticles was studied by in situ transmission electron microscopy (TEM). The nanoparticles were prepared by a two-step chemical synthesis process involving thermal decomposition of organometallic precursors for nucleating bismuth and a sol-gel process for growing silica. The microstructural and chemical analyses of the nanoparticles were performed using high-resolution TEM, Z-contrast imaging, focused ion beam milling, and X-ray energy dispersive spectroscopy. Solid-liquid-solid phase transitions of the nanoparticles were directly recorded by electron diffractions and TEM images. The silica encapsulation of the nanoparticles prevented agglomeration and allowed particles to preserve their original volume upon melting, which is desirable for applications of phase change nanoparticles with consistently repeatable thermal properties.

  15. Zero-dimensional nanostructured material with metallic bismuth nanoparticles: a new route for thermoelectrics

    Science.gov (United States)

    Benoit, Roland; Treguer, Mona; Saboungi, Marie-Louise

    2011-03-01

    The thermoelectric figure of merit ZT has so far not exceeded the value ZT=3 need to compete with mechanical energy conversion systems. However, theoretical work has shown that it is possible to reach values of ZT higher than this. One of the most promising routes is nanostructured materials, which offer the opportunity to tailor physical properties such as electrical and heat transport, due to the effects of electron filtering and phonon confinement. Dresselhaus et al. (ref.?) were among the first to show that 2D and 1D structures are capable of reaching ZT values higher than 2. The thermoelectric materials of current interest are in the form of nanotubes, nanodots and, more generally, superlattices composed of a matrix and nanoparticles. In our work we synthesize a periodic network of bismuth nanoparticles in a matrix of mesoporous Si O2 . We find that in this form bismuth transforms from a rhombohedral to a cubic structure, with improved filtering of electrons and phonons.

  16. Ab initio lattice dynamics and thermochemistry of layered bismuth telluride (Bi2Te3)

    Science.gov (United States)

    Zurhelle, Alexander F.; Deringer, Volker L.; Stoffel, Ralf P.; Dronskowski, Richard

    2016-03-01

    We present density-functional theory calculations of the lattice dynamics of bismuth telluride, yielding force constants, mean-square displacements and partial densities of phonon states which corroborate and complement previous nuclear inelastic scattering experiments. From these data, we derive an element- and energy-resolved view of the vibrational anharmonicity, quantified by the macroscopic Grüneisen parameter γ which results in 1.56. Finally, we calculate thermochemical properties in the quasiharmonic approximation, especially the heat capacity at constant pressure and the enthalpy of formation for bismuth telluride; the latter arrives at ▵H f (Bi2Te3)  =  -102 kJ mol-1 at 298 K.

  17. A novel antifuse structure based on amorphous bismuth zinc niobate thin films

    Institute of Scientific and Technical Information of China (English)

    Wang Gang; Li Wei; Li Ping; Li Zuxiong; Fan Xue; Jiang Jing

    2012-01-01

    A novel antifuse structure with amorphous bismuth zinc niobate (a-BZN) dielectrics was proposed.The characteristics of the a-BZN antifuse were investigated.Programming direction of up to down was chosen to rupture the a-BZN antifuse.The breakdown voltage of the a-BZN antifuse was obtained at a magnitude of 6.56 V.A large off-state resistance of more than 1 GΩ for the a-BZN antifuse was demonstrated.The surface micrograph of the ruptured a-BZN antifuses was illustrated.Programming characteristics with the programming time of 0.46 ms and on-state properties with the average resistance value of 26.1 Ω of the a-BZN antifuse were exhibited.The difference of characteristics of the a-BZN antifuse from that of a cubic pyrochlore bismuth zinc niobate (cp-BZN) antifuse and gate oxide antifuse was compared and analyzed.

  18. Methylene blue photocatalysis in the presence of bismuth oxide under UV and solar light irradiation

    Directory of Open Access Journals (Sweden)

    Vanessa Rocha Liberatti

    2014-05-01

    Full Text Available Bismuth oxide (Bi2O3, an n-type semiconductor has been satisfactorily investigated for photocatalytic organic contaminant remediation. The Bi2O3 was prepared by solution combustion synthesis (SCS using as the oxidizing bismuth nitrate in acidic medium and urea as fuel. The influence of the type of synthesis on the photocatalytic properties of the oxide formed was investigated by XRD. From the diffractograms was verified that the materials obtained are predominantly of Bi2O3 crystals, it is possible to identify a sample with two crystalline phases, monoclinic (α-Bi2O3 and tetragonal (β-Bi2O3, and the other with only the monoclinic (α-Bi2O3. The two-phase oxide showed higher photocatalytic activity for discoloration of methylene blue under UV irradiation (60.59% and under sunlight (61.64% in 664 nm, followed kinetic law of pseudo-first order.

  19. The photorefractive characteristics of bismuth-oxide doped lithium niobate crystals

    Directory of Open Access Journals (Sweden)

    Dahuai Zheng

    2015-01-01

    Full Text Available Bismuth-doped lithium niobate (LN:Bi crystals were grown by Czochralski method and their optical damage resistance, photorefraction, absorption spectra, and defect energy levels were investigated. The experimental results indicate that the photorefractive properties of LN:Bi were enhanced as compared with congruent one, the photorefractive response time was greatly shortened, the photorefractive sensitivity was increased, and the diffraction efficiency of near-stoichiometric LN:Bi (SLN:Bi reached 31.72% and 49.08% at 532 nm and 488 nm laser, respectively (light intensity of 400 mW/cm2. An absorption peak at about 350 nm was observed in the absorption spectrum of LN:Bi. And the defect energy levels simulation indicates new defect levels appear in the forbidden gap of LN:Bi crystals. Therefore bismuth can act as photorefractive centers in LN crystals.

  20. Evaluation of bismuth shielding effectiveness in reducing breast absorbed dose during thoracic CT scan

    Energy Technology Data Exchange (ETDEWEB)

    Alonso, T. C.; Mourao, A. P.; Santana, P. C.; Silva, T. A. [Federal University of Minas Gerais, Program of Nuclear Science and Techniques, Av. Pte. Antonio Carlos 6627, 31270-901 Belo Horizonte, Minas Gerais (Brazil)

    2015-10-15

    Computed Tomography (CT) is an essential method for tracking neoplasia and efficiently diagnosing a wide variety of thoracic diseases. CT is generally considered the most accurate choice for lung examination. Due to the growing use of CT, breast and other superficial and radiosensitive organs are unnecessarily irradiated during radiological procedures, thus requiring the development of strategies appropriate to optimize and, if possible, to reduce the radiation dose. The use of bismuth shielding to reduce radiation dose absorbed by breast during thoracic CT examinations has been the subject of many studies recently published by Brazilian and foreign authors of various fields. The purpose of this paper is both to accurately determine the glandular dose when breast is exposed to radiation and to assess the reduction in absorbed dose during thoracic CT examinations, using a set of Thermoluminescent Dosimeters, an anthropomorphic phantom and bismuth shielding. (Author)

  1. Synthesis of Bismuth Ferrite Nanoparticles via a Wet Chemical Route at Low Temperature

    Directory of Open Access Journals (Sweden)

    Yongming Hu

    2011-01-01

    Full Text Available Nanoparticles (NPs of multiferroic bismuth ferrite (BiFeO3 with narrow size distributions were synthesized via a wet chemical route using bismuth nitrate and iron nitrate as starting materials and excess tartaric acid and citric acid as chelating agent, respectively, followed by thermal treatment. It was found that BiFeO3 NPs crystallized at ∼350∘C when using citric acid as chelating agent. Such crystallization temperature is much lower than that of conventional chemical process in which other types of chelating agent are used. BiFeO3 NPs with different sizes distributions show obvious ferromagnetic properties, and the magnetization is increased with reducing the particle size.

  2. Effect of Fe2O3 on the physical and structural properties of bismuth silicate glasses

    Science.gov (United States)

    Parmar, Rajesh; Kundu, R. S.; Punia, R.; Aghamkar, P.; Kishore, N.

    2013-06-01

    Iron containing bismuth silicate glasses with compositions 70SiO2ṡ(100-x)Bi2O3ṡxFe2O3 have been prepared using conventional melt-quenching method and their amorphous nature has been investigated using XRD. Density has been measured using Archimedes' principle and molar volume (Vm) have also been estimated. With increase in Fe2O3 content, there is a decrease in density and molar volume of the glass samples. The glass transition temperature (Tg) have been determined using Differential Scanning Calorimetry (DSC) and are observed to increase with increase in Fe2O3 content. In the present glass system bismuth and iron plays the role of network modifier and the symmetry of silicate network goes on increasing with Fe2O3 content and it modifies the physical and structural properties of these glasses.

  3. Synthesis and Electrochemical Sensing Toward Heavy Metals of Bunch-like Bismuth Nanostructures

    Directory of Open Access Journals (Sweden)

    Zhang Zhi

    2009-01-01

    Full Text Available Abstract Large-scale bunch-like bismuth (Bi nanostructures were the first time to be synthesized via two-step electrochemical deposition. The growth mechanism of the nanostructures was discussed. Such a designed bunch-like Bi electrode has high sensitivity to detect the heavy metal ions due to its unique three-dimensional structures and strong ability of adsorbing the heavy metal ions. The bunch-like Bi electrode’s detection of heavy metals was statically performed using anodic stripping voltammetry (ASV. The detection in the Pb(II concentration range of 2.5–50 μg/l was also performed. Based on the experimental results, this bunch-like Bi electrode can be considered as an interesting alternative to common mercury electrodes and bismuth film electrodes for possible use in electrochemical studies and electroanalytical applications.

  4. Gamma-ray shielding and structural properties of barium-bismuth-borosilicate glasses

    Science.gov (United States)

    Bootjomchai, Cherdsak; Laopaiboon, Jintana; Yenchai, Chadet; Laopaiboon, Raewat

    2012-07-01

    The attenuation coefficients of barium-bismuth-borosilicate glasses have been measured for gamma-ray photon energies of 662, 1173 and 1332 keV using a narrow beam transmission geometry. These coefficients were then used to obtain the values of mass attenuation coefficients, effective atomic number, effective electron density and mean free path. Good agreement has been observed between experimental and theoretical values of these parameters. From the obtained results it is reported here that from the barium-bismuth-borosilicate glasses are better shields to gamma-radiations in comparison to the standard radiation shielding concretes from the shielding point of view. The molar volume, FTIR and acoustic investigations have been used to study the structural properties of the prepared glass system. The obtained results reveal that the formation of non-bridging oxygens occurs at higher concentration of Bi2O3.

  5. Compatibility tests on steels in molten lead and lead-bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Fazio, C. E-mail: concetta@netbra.brasimone.enea.it; Benamati, G.; Martini, C.; Palombarini, G

    2001-07-01

    The compatibility of steels with liquid lead and liquid lead-bismuth is a critical issue for the development of accelerator-driven system (ADS). In this work the results of a set of preliminary tests carried out in stagnant molten lead at 737 K and in lead-bismuth at 573, 673 and 749 K are summarised. The tests were conducted for 700, 1200, 1500 and 5000 h. Three steels were tested: two martensitic steels (mod. F82H and MANET II) and one austenitic steel (AISI 316L). The martensitic steels underwent oxidation phenomena at the higher testing temperature, due to oxygen dissolved in the melts. At a lower test temperature (573 K) and higher exposure time (5000 h) the oxidation rate of the martensitic steel seems to be lower and the developed oxide layer protective against liquid metal corrosion. The austenitic steel, in turn, exhibited an acceptable resistance to corrosion-oxidation under the test conditions.

  6. Using polycrystalline bismuth filter in an ultracold neutron source with superfluid helium

    Science.gov (United States)

    Serebrov, A. P.; Lyamkin, V. A.; Runov, V. V.; Ivanov, S. A.; Onegin, M. S.; Fomin, A. K.

    2015-10-01

    Placing polycrystalline bismuth filter in front of an ultracold neutron (UCN) source with superfluid helium at 1 K is shown to be effective. The use of this filter ensures a 30-fold decrease (down to 0.5 W) in the level of heat load in the UCN source, while reducing by 30% the flux of neutrons with 9-Å wavelength (which are converted into UCNs). The phenomenon of small-angle scattering on polycrystalline bismuth has been studied and shown to be insignificant. Cooling of the filter to liquid nitrogen temperature increases the transmission of 9-Å neutrons by only 8%; hence, creation of this cooling system is inexpedient. A project of a technological complex designed for the UCN source at the PIK reactor is presented, which ensures the removal of 1-W heat load from the UCN source with superfluid helium at a 1-K temperature level.

  7. 从铅阳极泥中湿法提取铋、锑试验研究%Extraction of Bismuth and Antimony by Wet-process From Lead Anode Mud

    Institute of Scientific and Technical Information of China (English)

    贾辉; 王兴; 崔家友; 侯绍彬; 林浩

    2014-01-01

    Leaching of bismuth and antimony from lead anode mud oxidized at high temperature using hydrochloric acid as leaching agent ,ferric chloride as oxidant ,sodium chloride to provide more chloride ions was investigated .The effects of oxidizing temperature of lead anode mud ,hydrochloric acid concentration ,leaching temperature ,reaction time ,ratio between liquid volume and solid mass ,the amount of ferric chloride and sodium chloride on leaching of bismuth and antimony were examined . The experimental results show that the pretreatment for lead anode slime has a greater influence on the leaching of bismuth and antimony .Under the conditions of hydrochloric acid concentration of 5 mol/L ,ratio betw een liquid volume and solid mass of 5∶1 ,leaching temperature of 80 ℃ ,reaction time of 3 h ,ferric chloride concentration of 10 g/L ,sodium chloride concentration of 45 g/L ,the leaching of bismuth and antimony reach 99 .44% and 99 .69% respectively for the lead anode mud oxidized at 200 ℃ and through 200 mesh sieve .%介绍了以三氯化铁作氧化剂,氯化钠提供氯离子,用盐酸从高温氧化后的铅阳极泥中浸出铋、锑,考察了氧化温度、盐酸浓度、浸出温度、反应时间、液固体积质量比、三氯化铁和氯化钠用量对铋、锑浸出率的影响。试验结果表明:铅阳极泥预处理对铋、锑浸出率影响较大;铅阳极泥粉磨过200目筛,在氧化温度220℃、盐酸浓度5 mol/L、液固体积质量比5∶1、反应温度80℃、反应时间3 h、三氯化铁质量浓度10 g/L、氯化钠质量浓度45 g/L条件下,铋、锑浸出率分别为99.44%和99.69%,浸出效果较好。

  8. Quantum Interference of Surface States in Bismuth Nanowires in Transverse Magnetic Fields

    Science.gov (United States)

    Konopko, L. A.; Huber, T. E.; Nikolaeva, A. A.; Burceacov, L. A.

    2013-06-01

    We report the results of studies of the magnetoresistance (MR) and electric field effect (EFE) of single-crystal Bi nanowires with diameter dMurakami, bismuth bilayers can exhibit the quantum spin Hall effect. A Bi crystal can be viewed as a stacking of bilayers with a honeycomblike lattice structure along the [111] direction. An interpretation of transverse MR oscillations with using this theory is presented.

  9. Bismuth Infusion of ABS Enables Additive Manufacturing of Complex Radiological Phantoms and Shielding Equipment.

    Science.gov (United States)

    Ceh, Justin; Youd, Tom; Mastrovich, Zach; Peterson, Cody; Khan, Sarah; Sasser, Todd A; Sander, Ian M; Doney, Justin; Turner, Clark; Leevy, W Matthew

    2017-02-24

    Radiopacity is a critical property of materials that are used for a range of radiological applications, including the development of phantom devices that emulate the radiodensity of native tissues and the production of protective equipment for personnel handling radioactive materials. Three-dimensional (3D) printing is a fabrication platform that is well suited to creating complex anatomical replicas or custom labware to accomplish these radiological purposes. We created and tested multiple ABS (Acrylonitrile butadiene styrene) filaments infused with varied concentrations of bismuth (1.2-2.7 g/cm³), a radiopaque metal that is compatible with plastic infusion, to address the poor gamma radiation attenuation of many mainstream 3D printing materials. X-ray computed tomography (CT) experiments of these filaments indicated that a density of 1.2 g/cm³ of bismuth-infused ABS emulates bone radiopacity during X-ray CT imaging on preclinical and clinical scanners. ABS-bismuth filaments along with ABS were 3D printed to create an embedded human nasocranial anatomical phantom that mimicked radiological properties of native bone and soft tissue. Increasing the bismuth content in the filaments to 2.7 g/cm³ created a stable material that could attenuate 50% of (99m)Technetium gamma emission when printed with a 2.0 mm wall thickness. A shielded test tube rack was printed to attenuate source radiation as a protective measure for lab personnel. We demonstrated the utility of novel filaments to serve multiple radiological purposes, including the creation of anthropomorphic phantoms and safety labware, by tuning the level of radiation attenuation through material customization.

  10. Ultrasonic and Thermal Properties of Borate and Phosphate Glasses Containing Bismuth and Lead

    Science.gov (United States)

    Aziz, Sidek Hj. Abd.; Ahmad, Hamezan; Wahab, Zaidan A.; Sulaiman, Zainal Abidin; Talib, Zainal Abidin; Shaari, A. Halim; Senin, H. B.

    2007-05-01

    Systematic series of (B2O3,P2O5)-Bi2O3-PbO glasses have been successfully prepared by using the rapid quenching technique in which each oxide content changes for every series on the basis of its weight percentage. Their amorphous natures were confirmed earlier by the x-ray diffraction technique. The experimental results show that the density of both glasses, determined by using the Archimedes principle, increases with the glass modifier content. This is due to the replacement of Bi2O3 and PbO in the borate and phosphate glassy networks. The molar volume for borate glass increases with the addition of bismuth and lead oxides, but a reverse trend occurs for the phosphate glass. The longitudinal and shear ultrasound velocities, determined by the MBS 8000 system, of both lead bismuth borate and phosphate glasses show a decreasing trend as more PbO and Bi2O3 are added to the glass system. The increase in PbO/Bi2O3 content was probably related to the progressive increase in the concentration of non-bridging oxygen (NBOs). Thermal studies of the glass, using the Labsys DTA-Setaram machine, show that the value of the glass transition temperature (Tg) is closely related to the chemical bond in the system. In lead bismuth borate glasses, the addition of more Pb2+ and Bi3+ results in a more dominant ionic bond character in the system and hence decreases Tg of the sample. However, in lead bismuth phosphate glasses, the addition of Pb2+ and Bi3+ not only failed to weaken the covalent character in P-O-P bonds, but strengthened it further, leading to an increment in the values of Tg.

  11. Compositional dependence of optical band gap and refractive index in lead and bismuth borate glasses

    Energy Technology Data Exchange (ETDEWEB)

    Mallur, Saisudha B.; Czarnecki, Tyler; Adhikari, Ashish; Babu, Panakkattu K.

    2015-08-15

    Highlights: • Refractive indices increase with increasing PbO/Bi{sub 2}O{sub 3} content. • Optical band gap arises due to direct forbidden transition. • Optical band gaps decrease with increasing PbO/Bi{sub 2}O{sub 3} content. • New empirical relation between the optical band gap and the refractive index. - Abstract: We prepared a series of lead and bismuth borate glasses by varying PbO/Bi{sub 2}O{sub 3} content and studied refractive index and optical band gap as a function of glass composition. Refractive indices were measured very accurately using a Brewster’s angle set up while the optical band gaps were determined by analyzing the optical absorption edge using the Mott–Davis model. Using the Lorentz–Lorentz method and the effective medium theory, we calculated the refractive indices and then compared them with the measured values. Bismuth borate glasses show better agreement between the calculated values of the refractive index and experimental values. We used a differential method based on Mott–Davis model to obtain the type of transition and optical band gap (E{sub opt}) which in turn was compared with the value of E{sub opt} obtained using the extinction coefficient. Our analysis shows that in both lead and bismuth borate glasses, the optical band gap arises due to direct forbidden transition. With increasing PbO/Bi{sub 2}O{sub 3} content, the absorption edge shifts toward longer wavelengths and the optical band gap decreases. This behavior can be explained in terms of changes to the Pb−O/Bi−O chemical bonds with glass composition. We obtained a new empirical relation between the optical band gap and the refractive index which can be used to accurately determine the electronic oxide polarizability in lead and bismuth oxide glasses.

  12. Influence of inherent strain on the curie temperature of rare earth ion-doped bismuth vanadate

    OpenAIRE

    Sooryanarayana, K; Row, TNG; R. Somashekar; Varma, KBR

    1998-01-01

    X-ray line broadening is found to be an effective parameter to estimate the strain associated with rare earth ion (Gd3+)-doped polycrystalline bismuth vanadate(Bi2VO5.5). The strain increases with increasing Gd3+ concentration. It is anisotropic and found to be maximum in (111) plane. The Curie temperature which is known to decrease with increase in the rare earth ion concentration in these compounds is correlated with increase in strain.

  13. Photoelectroactivity of Bismuth Vanadate Prepared by Combustion Synthesis: Effect of Different Fuels and Surfactants

    OpenAIRE

    Afonso,Renata; Serafim, Jessica A.; Lucilha,Adriana C.; Marcelo R. Silva; Lepre, Luiz F.; Ando, Romulo A.; Dall'Antonia,Luiz H.

    2014-01-01

    The bismuth vanadate (BiVO4) is a semiconductor that has attracted much attention due to the photocatalytic efficiency in the visible light region. The objective of this work was to synthesize monoclinic BiVO4 by solution combustion synthesis, with different surfactants and fuels and apply it as photoelectrodes. The characterization by infrared spectroscopy and Raman spectroscopy showed that all samples showed characteristic bands of the monoclinic structure BiVO4. The samples synthesized wit...

  14. Mechanistic insights into chemical and photochemical transformations of bismuth vanadate photoanodes

    OpenAIRE

    Toma, Francesca M.; Cooper, Jason K.; Kunzelmann, Viktoria; McDowell, Matthew T.; Yu, Jie; Larson, David M.; Borys, Nicholas J.; Abelyan, Christine; Beeman, Jeffrey W.; Yu, Kin Man; Yang, Jinhui; Chen, Le; Shaner, Matthew R.; Spurgeon, Joshua; Houle, Frances A.

    2016-01-01

    Artificial photosynthesis relies on the availability of semiconductors that are chemically stable and can efficiently capture solar energy. Although metal oxide semiconductors have been investigated for their promise to resist oxidative attack, materials in this class can suffer from chemical and photochemical instability. Here we present a methodology for evaluating corrosion mechanisms and apply it to bismuth vanadate, a state-of-the-art photoanode. Analysis of changing morphology and compo...

  15. Improving the photoactivity of bismuth vanadate thin film photoanodes through doping and surface modification strategies

    OpenAIRE

    Quiñonero, Javier; Lana Villarreal, Teresa; Gómez, Roberto

    2016-01-01

    Currently, one of the most attractive and desirable ways to solve the energy challenge is harvesting energy directly from the sunlight through the so-called artificial photosynthesis. Among the ternary oxides based on earth–abundant metals, bismuth vanadate has recently emerged as a promising photoanode. Herein, BiVO4 thin film photoanodes have been successfully synthesized by a modified metal-organic precursor decomposition method, followed by an annealing treatment. In an attempt to improve...

  16. Dielectric, piezoelectric, and pyroelectric anisotropy in KCL- modified grain-oriented bismuth vanadate ceramics

    OpenAIRE

    Shantha, K; Varma, KBR

    1999-01-01

    The effect of the additive KCl, on the structural, microstructural, and polar properties of bismuth vanadate (BiV) ceramics is investigated. The scanning electron microscopic (SEM) studies reveal a remarkable modification in the microstructure and the occurrence of high grain-orientation (75%) on KCl addition. The energy dispersive x ray (EDX) analyses indicate the presence of chemically inhomogeneous distribution of KCl, with core-shell-like grain structure. The KCl-modified BiV samples exhi...

  17. Bismuth Infusion of ABS Enables Additive Manufacturing of Complex Radiological Phantoms and Shielding Equipment

    Directory of Open Access Journals (Sweden)

    Justin Ceh

    2017-02-01

    Full Text Available Radiopacity is a critical property of materials that are used for a range of radiological applications, including the development of phantom devices that emulate the radiodensity of native tissues and the production of protective equipment for personnel handling radioactive materials. Three-dimensional (3D printing is a fabrication platform that is well suited to creating complex anatomical replicas or custom labware to accomplish these radiological purposes. We created and tested multiple ABS (Acrylonitrile butadiene styrene filaments infused with varied concentrations of bismuth (1.2–2.7 g/cm3, a radiopaque metal that is compatible with plastic infusion, to address the poor gamma radiation attenuation of many mainstream 3D printing materials. X-ray computed tomography (CT experiments of these filaments indicated that a density of 1.2 g/cm3 of bismuth-infused ABS emulates bone radiopacity during X-ray CT imaging on preclinical and clinical scanners. ABS-bismuth filaments along with ABS were 3D printed to create an embedded human nasocranial anatomical phantom that mimicked radiological properties of native bone and soft tissue. Increasing the bismuth content in the filaments to 2.7 g/cm3 created a stable material that could attenuate 50% of 99mTechnetium gamma emission when printed with a 2.0 mm wall thickness. A shielded test tube rack was printed to attenuate source radiation as a protective measure for lab personnel. We demonstrated the utility of novel filaments to serve multiple radiological purposes, including the creation of anthropomorphic phantoms and safety labware, by tuning the level of radiation attenuation through material customization.

  18. STUDY ON THE DETERMINATION OF TRACE BISMUTH(Ⅲ) BY THIN-LAYER RESIN PHASE SPECTROPHOTOMETRY

    Institute of Scientific and Technical Information of China (English)

    YAN Yongsheng; LU Xiaohua; FU Chengguang

    2003-01-01

    In this paper, a new thin-layer ion-exchange resin phase analytical method is introduced. It is based on that, the bismuthous cation can associate with iodic anions, so as to formed an anioncomplex [BiI-4] in a strong acidic environments. This anion complex can also exchanges with a weaker anions on the surface active site of anion exchange resin, so that a [R+] [BiI-4] solid phase binary associational system is produced. Owing to the solid system is a great many dispersive particulates, it can be pressed to a thin-layer by press tools of the so called "thin-layer resin phase"or "resin phase ", and using this solid association system spectrophotometry for the determination of trace metals. So it can increase the analytical sensitivity. This association system exhibits maximum absorbance at 460nm, and obeys Beer's law over the concentration range 0. 01ug/ml~1.20ug/ml of bismuthous(Ⅲ). It has a molar absorptivity of 7.1 ×105 [L/mol cm]. It indicated the resin phase spectrophotometry is a sensitive analytical method for trace bismuthous. It is 18 times higher than routine aqueous spectrophotometry. The relative standard deviations is 1.82% (n=6) for the measurements of 0. 5ug/ml Bi(Ⅲ). The detection limit of Bismuthous(Ⅲ) is 1.4 ×10-8mol/L. The method has applied to the analysis Bi(Ⅲ) in environmental water samples.

  19. Report - Melter Testing of New High Bismuth HLW Formulations VSL-13R2770-1

    Energy Technology Data Exchange (ETDEWEB)

    Kruger, Albert A.; Pegg, I. L.; Kot, W. K.; Gan, H.; Matlack, K. S.

    2013-11-13

    The primary objective of the work described was to test two glasses formulated for a high bismuth waste stream on the DM100 melter system. Testing was designed to determine processing characteristics and production rates, assess the tendency for foaming, and confirm glass properties. The glass compositions tested were previously developed to maintain high waste loadings and processing rates while suppressing the foaming observed in previous tests

  20. Electroless deposition of bismuth on Si(111) wafer from hydrogen fluoride solutions

    Energy Technology Data Exchange (ETDEWEB)

    Romann, T., E-mail: tavo.romann@ut.e [Institute of Chemistry, University of Tartu, 2 Jakobi Street, 51014 Tartu (Estonia); Anderson, E.; Kallip, S. [Institute of Chemistry, University of Tartu, 2 Jakobi Street, 51014 Tartu (Estonia); Maendar, H.; Matisen, L. [Institute of Physics, University of Tartu, 142 Riia Street, 51014 Tartu (Estonia); Lust, E. [Institute of Chemistry, University of Tartu, 2 Jakobi Street, 51014 Tartu (Estonia)

    2010-05-03

    Thin Bi layers were deposited by simple immersion of silicon chip into diluted HF aqueous solution, containing bismuth(III) ions. Bi nanoparticles or continuous up to 300 nm thick Bi film can be grown on silicon by the variation of the temperature and deposition time. Prepared surfaces have been characterized by atomic force microscopy, X-ray diffraction, X-ray photoelectron spectroscopy, Raman scattering, photoluminescence and resistivity measurement methods. It was found that thinner Bi layers have a yellowish colour.

  1. Analysis of the color alteration and radiopacity promoted by bismuth oxide in calcium silicate cement

    Directory of Open Access Journals (Sweden)

    Marina Angelica Marciano

    2013-07-01

    Full Text Available The aim of the study was to determine if the increase in radiopacity provided by bismuth oxide is related to the color alteration of calcium silicate-based cement. Calcium silicate cement (CSC was mixed with 0%, 15%, 20%, 30% and 50% of bismuth oxide (BO, determined by weight. Mineral trioxide aggregate (MTA was the control group. The radiopacity test was performed according to ISO 6876/2001. The color was evaluated using the CIE system. The assessments were performed after 24 hours, 7 and 30 days of setting time, using a spectrophotometer to obtain the ΔE, Δa, Δb and ΔL values. The statistical analyses were performed using the Kruskal-Wallis/Dunn and ANOVA/Tukey tests (p 3 mm equivalent of Al. The MTA group was statistically similar to the CSC / 30% BO group (p > 0.05. In regard to color, the increase of bismuth oxide resulted in a decrease in the ΔE value of the calcium silicate cement. The CSC group presented statistically higher ΔE values than the CSC / 50% BO group (p < 0.05. The comparison between 24 hours and 7 days showed higher ΔE for the MTA group, with statistical differences for the CSC / 15% BO and CSC / 50% BO groups (p < 0.05. After 30 days, CSC showed statistically higher ΔE values than CSC / 30% BO and CSC / 50% BO (p < 0.05. In conclusion, the increase in radiopacity provided by bismuth oxide has no relation to the color alteration of calcium silicate-based cements.

  2. Single crystals of bismuth silicon oxide grown by the Czochralski technique and their characterisation

    Directory of Open Access Journals (Sweden)

    ANDREJA VALCIC

    1999-09-01

    Full Text Available Single crystals of Bi12SiO20 were grown by the Czochralski technique. The critical diameter and the critical rate of rotation were calculated. Suitable polishing and etching solutions were determined. X-Ray measurements were performed on powdered samples to obtain the lattice parameters. The optical properties of the bismuth silicon oxide single crystals were investigated. The obtained results are discussed and compared with published data.

  3. Effect of bismuth addition to the triple therapy of Helicobacter pylori eradication

    Directory of Open Access Journals (Sweden)

    Ezel Taşdemir

    2012-03-01

    Full Text Available Objective: Success rates of amoxicillin, clarithromycin, and proton-pump inhibitor therapy in the Helicobacter pylori (Hp eradication have been decreasing. The aim of this study was to investigate the impact of bismuth subcitrate addition to triple therapy.Materials and methods: 148 patients diagnosed Hp infection with both histology and Hp stool antigen (HpSA tests were examined retrospectively. The patients were divided into 3 groups according to the eradication therapy. The first group received triple therapy with claritromycine 2x 500 mg, amoxicilline 2x1 g and PPI 2x1 for 14 days (n=40. The second group had bismuth subcitrate 4x120 mg with triple therapy for 14 days (n=73. The third group received 14 days pretreatment with bismuth subcitrate 4x1 together with PPI 2x1 then had triple therapy for 14 days (n=35. (14C urea breath and HpSA tests were used to detect posttreatment H.pylori status.Results: There were no statistical difference between the groups in terms of gender and age (p > 0.05. In group one 12 patients, in group two 20 patients and in group three 10 patients were identified as Hp positive after treatment. Eradication rates were 70% for group one, 72.6% for group two and 71.4% for group three respectively. There was no statistical difference between the groups in terms of eradication rates of treatment (p > 0.05.Conclusions: The addition of bismuth to conventional triple therapy did not affect treatment success rates.

  4. Study of some health physics parameters of bismuth-ground granulated blast furnace slag shielding concretes

    Science.gov (United States)

    Kumar, Sandeep; Singh, Sukhpal

    2016-05-01

    The Bismuth-ground granulated blastfurnace slang (Bi-GGBFS) concrete samples were prepared. The weight percentage of different elements present inBi-GGBFS Shielding concretewas evaluated by Energy Dispersive X-ray Microanalysis (EDX). The exposure rate and absorbed dose rate characteristics were calculated theoretically for radioactive sources namely 241Am and 137Cs. Our calculations reveal that the Bi-GGBFS concretes are effective in shielding material for gamma radiations.

  5. Measurement of cross sections for the scattering of neutrons in the energy range from 2 MeV to 4 MeV with the {sup 15}N(p,n) reaction as neutron source; Messung von Wirkungsquerschnitten fuer die Streuung von Neutronen im Energiebereich von 2 MeV bis 4 MeV mit der {sup 15}N(p,n)-Reaktion als Neutronenquelle

    Energy Technology Data Exchange (ETDEWEB)

    Poenitz, Erik

    2010-04-26

    In future nuclear facilities, the materials lead and bismuth can play a more important role than in today's nuclear reactors. Reliable cross section data are required for the design of those facilities. In particular the neutron transport in the lead spallation target of an Accelerator-Driven Subcritical Reactor strongly depends on the inelastic neutron scattering cross sections in the energy region from 0.5 MeV to 6 MeV. In the recent 20 years, elastic and inelastic neutron scattering cross sections were measured with high precision for a variety of elements at the PTB time-of-flight spectrometer. The D(d,n) reaction was primarily used for the production of neutrons. Because of the Q value of the reaction and the available deuteron energies, neutrons in the energy range from 6 MeV to 16 MeV can be produced. For the cross section measurement at lower energies, however, another neutron producing reaction is required. The {sup 15}N(p,n){sup 15}O reaction was chosen, as it allows the production of monoenergetic neutrons with up to 5.7MeV energy. In this work, the {sup 15}N(p,n) reaction was studied with focus on the suitability as a source for monoenergetic neutrons in scattering experiments. This includes the measurement of differential cross sections for the neutron producing reaction and the choice of optimum target conditions. Differential elastic and inelastic neutron scattering cross sections were measured for lead at four energies in the region from 2 MeV to 4 MeV incident neutron energy using the time-of-flight technique. A lead sample with natural isotopic composition was used. NE213 liquid scintillation detectors with well-known detection efficiencies were used for the detection of the scattered neutrons. Angle-integrated cross sections were determined by a Legendre polynomial expansion using least-squares methods. Additionally, measurements were carried out for isotopically pure {sup 209}Bi and {sup 181}Ta samples at 4 MeV incident neutron energy

  6. Facile production of thermoelectric bismuth telluride thick films in the presence of polyvinyl alcohol.

    Science.gov (United States)

    Lei, C; Burton, M R; Nandhakumar, I S

    2016-06-01

    Bismuth telluride is currently the best performing thermoelectric material for room temperature operations in commercial thermoelectric devices. We report the reproducible and facile production of 600 micron thick bismuth telluride (Bi2Te3) layers by low cost and room temperature pulsed and potentiostatic electrodeposition from a solution containing bismuth and tellurium dioxide in 2 M nitric acid onto nickel in the presence of polyvinyl alcohol (PVA). This was added to the electrolyte to promote thick layer formation and its effect on the structure, morphology and composition of the electrodeposits was investigated by SEM and EDX. Well adherent, uniform, compact and stoichiometric n-type Bi2Te3 films with a high Seebeck coefficient of up to -200 μV K(-1) and a high electrical conductivity of up to 400 S cm(-1) resulting in a power factor of 1.6 × 10(-3) W m(-1) K(-2) at film growth rates of 100 μm h(-1) for potentiostatic electrodeposition were obtained. The films also exhibited a well defined hexagonal structure as determined by XRD.

  7. Bismuth Modified Porous Silica Preparation, Characterization and Photocatalytic Activity Evaluation for Degradation of Isoproturon

    Institute of Scientific and Technical Information of China (English)

    Anil Kumar Reddy Police; Srinivas Basavaraju; Durga Kumari Valluri; Subrahmanyam Machiraju

    2013-01-01

    Porous silica prepared by using an acrylic emulsion has been impregnated with bismuth ion resulting in Bi2Sio5 species containing surface.The as-prepared materials have been characterized by X-ray diffraction spectroscopy (XRD),X-ray photoelectron spectroscopy (XPS),UV-Vis diffuse reflectance spectroscopy (UV-Vis DRS),scanning electron microscopy (SEM),energy dispersive analysis of X-ray (EDAX),transmission electron microscopy (TEM),Fourier transform infrared spectroscopy (FTIR) and N2 adsorption/desorption techniques.EDAX analysis confirms the penetration of bismuth ions into the framework of silica to form Bi2Sio5,which is substantiated by XRD.The UV-Vis DRS shows that the catalysts are optically active and XPS confirms the inclusion of bismuth into the framework of silica.FTIR spectra illustrate the formation of Bi-O-Si linkages in the porous silica framework.SEM and TEM show the spherical morphology,whereas N2 adsorption/desorption study confirms the porosity of the prepared materials.The photocatalytic activity of the material is evaluated for the degradation of isoproturon herbicide and it is found that the material is active as compared to the commercial P-25 Degussa Tio2.

  8. Efficient gas sensitivity in mixed bismuth ferrite micro (cubes) and nano (plates) structures

    Energy Technology Data Exchange (ETDEWEB)

    Waghmare, Shivaji D.; Jadhav, Vijaykumar V.; Gore, Shaym K. [Center for Nanomaterials and Energy Devices, School of Physical Sciences, Swami Ramanand Teerth Marathwada University, Nanded 431606, Maharashtra (India); Yoon, Seog-Joon; Ambade, Swapnil B. [Inorganic Nanomaterials Laboratory, Department of Chemistry, Hanyang University, Seoul 133-1791 (Korea, Republic of); Lokhande, B.J. [Department of Physics, Solapur University, Solapur (India); Mane, Rajaram S., E-mail: rsmane_2000@yahoo.com [Center for Nanomaterials and Energy Devices, School of Physical Sciences, Swami Ramanand Teerth Marathwada University, Nanded 431606, Maharashtra (India); Han, Sung-Hwan, E-mail: shhan@hanyang.ac.kr [Inorganic Nanomaterials Laboratory, Department of Chemistry, Hanyang University, Seoul 133-1791 (Korea, Republic of)

    2012-12-15

    Graphical abstract: Display Omitted Highlights: ► Micro (cubes) structure embedded in nano (plates) of bismuth ferrite was prepared by a chemical method. ► These structures were characterized by XRD and SEM. ► LPG, CO{sub 2} and NH{sub 4} gases were exposed. ► Properties related to gas sensors were measured and reported. -- Abstract: Mixed micro (cubes) and nano (plates) structures of bismuth ferrite (BFO) have been synthesized by a simple and cost-effective wet-chemical method. Structural, morphological and phase confirmation characteristics are measured using X-ray diffraction, field-emission scanning electron microscopy (FE-SEM) and energy dispersive X-ray analysis techniques. The digital FE-SEM photo-images of BFO sample confirmed an incubation of discrete micro-cubes into thin and regularly placed large number of nano-plates. The bismuth ferrite, with mixed structures, films show considerable performance when used in liquefied petroleum (LPG), carbon dioxide (CO{sub 2}) and ammonium (NH{sub 3}) gas sensors application. Different chemical entities in LPG have made it more efficient with higher sensitivity, recovery and response times compared to CO{sub 2} and NH{sub 3} gases. Furthermore, effect of palladium surface treatment on the gas sensitivity and the charge transfer resistances of BFO mixed structures is investigated and reported.

  9. Alkali-metal-supported bismuth polyhedra-principles and theoretical studies.

    Science.gov (United States)

    Monakhov, Kirill Yu; Linti, Gerald; Wolters, Lando P; Bickelhaupt, F Matthias

    2011-06-20

    We have quantum chemically investigated the structure, stability, and bonding mechanism in highly aggregated alkali-metal salts of bismuthanediide anions [RBi](2-) using relativistic density functional theory (DFT, at ZORA-BP86/TZ2P) in combination with a quantitative energy decomposition analysis (EDA). Our model systems are alkali-metal-supported bismuth polyhedra [(RBi)(n)M(2n-4)](4-) with unique interpenetrating shells of a bismuth polyhedron and an alkali-metal superpolyhedron. Furthermore, we have analyzed the trianionic inclusion complexes [M'@{(RBi)(n)M(2n-4)}](3-) involving an additional endohedral alkali-metal ion M'. The main objective is to assist the further development of synthetic approaches toward this class of compounds. Our analyses led to electron-counting rules relating, for example, the number of bonding orbitals (N(bond)) of the cage molecules [(RBi)(n)M(2n+Q)](Q) to the number of bismuth atoms (n(Bi)), alkali-metal atoms (n(M)), and net charge Q as N(bond) = n(Bi) + n(M) - Q (R = one-electron donor ligand; M = alkali metal; n = 4-12; Q = -4, -6, -8). Finally, on the basis of our findings, we predict the next members in the 5-fold symmetrical row of alkali-metallobismaspheres with a macroicosahedral arrangement.

  10. Efficient photoelectrochemical hydrogen production from bismuth vanadate-decorated tungsten trioxide helix nanostructures

    Science.gov (United States)

    Shi, Xinjian; Choi, Il Yong; Zhang, Kan; Kwon, Jeong; Kim, Dong Yeong; Lee, Ja Kyung; Oh, Sang Ho; Kim, Jong Kyu; Park, Jong Hyeok

    2014-09-01

    Tungsten trioxide/bismuth vanadate heterojunction is one of the best pairs for solar water splitting, but its photocurrent densities are insufficient. Here we investigate the advantages of using helical nanostructures in photoelectrochemical solar water splitting. A helical tungsten trioxide array is fabricated on a fluorine-doped tin oxide substrate, followed by subsequent coating with bismuth vanadate/catalyst. A maximum photocurrent density of ~5.35±0.15 mA cm-2 is achieved at 1.23 V versus the reversible hydrogen electrode, and related hydrogen and oxygen evolution is also observed from this heterojunction. Theoretical simulations and analyses are performed to verify the advantages of this helical structure. The combination of effective light scattering, improved charge separation and transportation, and an enlarged contact surface area with electrolytes due to the use of the bismuth vanadate-decorated tungsten trioxide helical nanostructures leads to the highest reported photocurrent density to date at 1.23 V versus the reversible hydrogen electrode, to the best of our knowledge.

  11. Simultaneous enhancements in photon absorption and charge transport of bismuth vanadate photoanodes for solar water splitting

    Science.gov (United States)

    Kim, Tae Woo; Ping, Yuan; Galli, Giulia A.; Choi, Kyoung-Shin

    2015-10-01

    n-Type bismuth vanadate has been identified as one of the most promising photoanodes for use in a water-splitting photoelectrochemical cell. The major limitation of BiVO4 is its relatively wide bandgap (~2.5 eV), which fundamentally limits its solar-to-hydrogen conversion efficiency. Here we show that annealing nanoporous bismuth vanadate electrodes at 350 °C under nitrogen flow can result in nitrogen doping and generation of oxygen vacancies. This gentle nitrogen treatment not only effectively reduces the bandgap by ~0.2 eV but also increases the majority carrier density and mobility, enhancing electron-hole separation. The effect of nitrogen incorporation and oxygen vacancies on the electronic band structure and charge transport of bismuth vanadate are systematically elucidated by ab initio calculations. Owing to simultaneous enhancements in photon absorption and charge transport, the applied bias photon-to-current efficiency of nitrogen-treated BiVO4 for solar water splitting exceeds 2%, a record for a single oxide photon absorber, to the best of our knowledge.

  12. Underpotential Deposition Study and Determination of Bismuth on Gold Electrode by Using Voltammetry

    Institute of Scientific and Technical Information of China (English)

    DU,Yong-Ling(杜永令); WANG,Chun-Ming(王春明)

    2002-01-01

    The cyclic voltammetry (CV) and the semidifferential anodic stripping voltanmetry (SdASV) were used for investigation of bismuth(Ⅲ) underpotential deposition (UPD) on gold electrode. Based on the excellent electrochemical properties of Au/Bi UPD system, a new method for determining bismuth (Ⅲ)was established. A solution of 0.1 mol/L HNO3 was selected as the supporting electrolyte. Factors affecting the Bi(Ⅲ) UPD and stripping steps were investigated and an opthmized analytical procedure was developed. The calibration plots for Bi(Ⅲ) concentration in the range 1.25 × 10-8-1.0 × 10-7 mol/L were obtained. The detection limit, calculated as three times the standard deviation of the analytical signal of 8.3×10-8 mol/L for a 90 s electrodeposition at 0.00 V (while the solution magnetically stirred at a speed of 300 rpm), was 7.5× 10-9 mol/ L. For8 successive determinations of 1.25 × 10-7 mol/L Bi(Ⅲ), the obtained RSD (relative standard deviation) was 0.4%. The developed method was applied to bismuth determining in medicine and urine samples. The analytical results were compared with that of atomic emission spectrometry (AES) method.

  13. Effect of bismuth ion substitution on structural properties of zinc ferrite nanoparticles

    Directory of Open Access Journals (Sweden)

    Naraavula Suresh Kumar

    2016-06-01

    Full Text Available Bismuth doped nano zinc ferrite particles having the general formula ZnFe2-xBixO4 (x = 0.00, 0.05, 0.10, 0.15, 0.20 and 0.25 were synthesized by sol-gel combustion method. The effect of bismuth doping on structural properties were investigated. The X-ray diffraction (XRD spectra confirm the single phase cubic spinel structure. The average crystallite sizes of all the samples were determined by Debye-Scherrer equation and are in the range 16–20 nm. The lattice parameter increases with the increase of bismuth ion concentration. This is due to the larger ionic radius of Bi3+ ions substituting smaller Fe3+ ions at octahedral sites (B-sites. The surface morphology of all compounds was studied by scanning electron microscope (SEM. The microstructure analysis and the particle size were examined by transmission electron microscope (TEM. The compositional stoichiometry of these samples was verified by energy dispersive spectroscopy (EDS analysis.

  14. Dirac fermions at high-index surfaces of bismuth chalcogenide topological insulator nanostructures

    Science.gov (United States)

    Virk, Naunidh; Yazyev, Oleg V.

    2016-02-01

    Binary bismuth chalcogenides Bi2Se3, Bi2Te3, and related materials are currently being extensively investigated as the reference topological insulators (TIs) due to their simple surface-state band dispersion (single Dirac cone) and relatively large bulk band gaps. Nanostructures of TIs are of particular interest as an increased surface-to-volume ratio enhances the contribution of surfaces states, meaning they are promising candidates for potential device applications. So far, the vast majority of research efforts have focused on the low-energy (0001) surfaces, which correspond to natural cleavage planes in these layered materials. However, the surfaces of low-dimensional nanostructures (nanoplatelets, nanowires, nanoribbons) inevitably involve higher-index facets. We perform a systematic ab initio investigation of the surfaces of bismuth chalcogenide TI nanostructures characterized by different crystallographic orientations, atomic structures and stoichiometric compositions. We find several stable terminations of high-index surfaces, which can be realized at different values of the chemical potential of one of the constituent elements. For the uniquely defined stoichiometric termination, the topological Dirac fermion states are shown to be strongly anisotropic with a clear dependence of Fermi velocities and spin polarization on the surface orientation. Self-doping effects and the presence of topologically trivial mid-gap states are found to characterize the non-stoichiometric surfaces. The results of our study pave the way towards experimental control of topologically protected surface states in bismuth chalcogenide nanostructures.

  15. Thermochemically evolved nanoplatelets of bismuth selenide with enhanced thermoelectric figure of merit

    Energy Technology Data Exchange (ETDEWEB)

    Ali, Zulfiqar; Cao, Chuanbao, E-mail: cbcao@bit.edu.cn; Butt, Faheem K.; Tahir, Muhammad; Tanveer, M.; Aslam, Imran; Rizwan, Muhammad; Idrees, Faryal; Khalid, Syed [Research Centre of Materials Science, School of Materials Science and Engineering, Beijing Institute of Technology, Beijing 100081 (China); Butt, Sajid [State Key Laboratory of New Ceramics and Fine Processing, School of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China)

    2014-11-15

    We firstly present a simple thermochemical method to fabricate high-quality Bi{sub 2}Se{sub 3} nanoplatelets with enhanced figure of merit using elemental bismuth and selenium powders as precursors. The crystal structure of as synthesized products is characterized via X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and high resolution transmission electron microscopy (HRTEM) measurements. Morphological and chemical synthetic parameters are investigated through a series of experiments; thickness and composition of the platelets are well controlled in large scale production. Subsequently spark plasma sintering (SPS) is performed to fabricate n-type nanostructured bulk thermoelectric materials. Raman Spectroscopy of the two selected samples with approximately of 50 and 100 nm thicknesses shows three vibrational modes. The lower thickness sample exhibits the maximum red shift of about 2.17 cm{sup -1} and maximum broadening of about 10 cm{sup -1} by in-plane vibrational mode E{sup 2}{sub g}. The enhanced value of figure of merit ∼0.41 is obtained for pure phase bismuth selenide to the best of our knowledge. We observe metallic conduction behavior while semiconducting behavior for nanostructured bismuth selenide is reported elsewhere which could be due to different synthetic techniques adopted. These results clearly suggest that our adopted synthetic technique has profound effect on the electronic and thermoelectric transport properties of this material.

  16. Opto-electronic properties of bismuth oxide films presenting different crystallographic phases

    Energy Technology Data Exchange (ETDEWEB)

    Gomez, Celia L. [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico); Posgrado en Ciencia e Ingeniería de Materiales, UNAM, Unidad de Posgrado, Edificio C, Piso 1, Zona Cultural de CU, México, D.F. 04510 (Mexico); Depablos-Rivera, Osmary, E-mail: osmarydep@yahoo.com [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico); Posgrado en Ciencia e Ingeniería de Materiales, UNAM, Unidad de Posgrado, Edificio C, Piso 1, Zona Cultural de CU, México, D.F. 04510 (Mexico); Silva-Bermudez, Phaedra [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico); Instituto Nacional de Rehabilitación, Calz. México Xochimilco No. 289 Col. Arenal de Guadalupe, C.P.14389, Ciudad de México, D.F. (Mexico); Muhl, Stephen [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico); Zeinert, Andreas; Lejeune, Michael; Charvet, Stephane; Barroy, Pierre [Laboratoire de Physique de la Matière Condensée, Université de Picardie Jules Verne, 33 rue Saint Leu, 80039 Amiens Cedex 1 (France); Camps, Enrique [Instituto Nacional de Investigaciones Nucleares, Carretera México-Toluca S/N, kilómetro 36.5. La Marquesa, Municipio de Ocoyoacac, CP 52750, Estado de México (Mexico); Rodil, Sandra E. [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico)

    2015-03-02

    The optical, electrical and structural properties of bismuth oxide thin films deposited by radio frequency reactive magnetron sputtering were studied. The Bi{sub 2}O{sub 3} thin films were grown on Si and glass substrates under different power and substrate temperatures in an oxygen-enriched plasma leading to films with different crystalline phase as evidenced by X-ray diffraction and Raman spectroscopy. The optical properties of the films were measured using ellipsometric spectroscopy and optical transmission spectra. In order to parameterize the optical dispersion functions (n, k) of the films, the Tauc–Lorentz dispersion model was used. The optical bandgap was then assessed by different methods and the results are compared to the thermal variations of the electrical resistivity of the films. It was found that the refractive index, extinction coefficient and optical gap strongly depend on the deposition conditions and the crystalline phase; the fluorite defect cubic δ-Bi{sub 2}O{sub 3} phase showed the lowest optical gap and lower resistivity. - Highlights: • Different bismuth oxide phases were obtained by sputtering. • The power and substrate temperature were the two key parameters. • Room temperature delta-Bi{sub 2}O{sub 3} thin films were obtained. • The optical bandgap was around 1.5 and 2.2 eV, depending on the phase. • The bismuth oxide films presented activation energies around 1 eV.

  17. Landau spectrum and twin boundaries of bismuth in the extreme quantum limit.

    Science.gov (United States)

    Zhu, Zengwei; Fauqué, Benoît; Malone, Liam; Antunes, Arlei Borba; Fuseya, Yuki; Behnia, Kamran

    2012-09-11

    The Landau spectrum of bismuth is complex and includes many angle-dependent lines in the extreme quantum limit. The adequacy of single-particle theory to describe this spectrum in detail has been an open issue. Here, we present a study of angle-resolved Nernst effect in bismuth, which maps the angle-resolved Landau spectrum for the entire solid angle up to 28 T. The experimental map is in good agreement with the results of a theoretical model with parabolic dispersion for holes and an extended Dirac Hamiltonian for electrons. The angular dependence of additional lines in the Landau spectrum allows us to uncover the mystery of their origin. They correspond to the lines expected for the hole Landau levels in a secondary crystal tilted by 108°, the angle between twinned crystals in bismuth. According to our results, the electron reservoirs of the two identical tilted crystals have different chemical potentials, and carriers across the twin boundary have different concentrations. An exceptional feature of this junction is that it separates two electron-hole compensated reservoirs. The link between this edge singularity and the states wrapping a three-dimensional electron gas in the quantum limit emerges as an outstanding open question.

  18. LiBi3S5-A lithium bismuth sulfide with strong cation disorder

    Science.gov (United States)

    Nakhal, Suliman; Wiedemann, Dennis; Stanje, Bernhard; Dolotko, Oleksandr; Wilkening, Martin; Lerch, Martin

    2016-06-01

    Among chalcogenide semiconductors for thermoelectric applications, alkali-metal bismuth compounds occur in many complex compositions favorable for high performance. Although LiBi3S5 had been announced in 1977, the potential 1D lithium-ion conductor has hitherto eluded selective synthesis and structure determination. In this study, we present a solid-state route to phase-pure LiBi3S5 powder starting from LiBiS2 and Bi2S3. Neutron diffractograms and lithium NMR spectra reveal its crystal structure to be a cation-disordered variety of the AgBi3S5 type (synthetic pavonite; monoclinic, C2/m). Topological analyses and lithium NMR relaxometry suggest that correlated lithium-ion diffusion with activation energies up to 0.66(2) eV occurs along the channels in b direction including tetrahedral voids. Because of cation disorder, immobile bismuth(III) ions clog these pathways, making LiBi3S5 a moderate to poor ionic conductor. The synthesis route reported is nonetheless promising for new lithium bismuth sulfides with, possibly ordered, structure types of the pavonite homologous series.

  19. Dirac fermions at high-index surfaces of bismuth chalcogenide topological insulator nanostructures

    Science.gov (United States)

    Virk, Naunidh; Yazyev, Oleg V.

    2016-01-01

    Binary bismuth chalcogenides Bi2Se3, Bi2Te3, and related materials are currently being extensively investigated as the reference topological insulators (TIs) due to their simple surface-state band dispersion (single Dirac cone) and relatively large bulk band gaps. Nanostructures of TIs are of particular interest as an increased surface-to-volume ratio enhances the contribution of surfaces states, meaning they are promising candidates for potential device applications. So far, the vast majority of research efforts have focused on the low-energy (0001) surfaces, which correspond to natural cleavage planes in these layered materials. However, the surfaces of low-dimensional nanostructures (nanoplatelets, nanowires, nanoribbons) inevitably involve higher-index facets. We perform a systematic ab initio investigation of the surfaces of bismuth chalcogenide TI nanostructures characterized by different crystallographic orientations, atomic structures and stoichiometric compositions. We find several stable terminations of high-index surfaces, which can be realized at different values of the chemical potential of one of the constituent elements. For the uniquely defined stoichiometric termination, the topological Dirac fermion states are shown to be strongly anisotropic with a clear dependence of Fermi velocities and spin polarization on the surface orientation. Self-doping effects and the presence of topologically trivial mid-gap states are found to characterize the non-stoichiometric surfaces. The results of our study pave the way towards experimental control of topologically protected surface states in bismuth chalcogenide nanostructures. PMID:26847409

  20. The fabrication and thermal properties of bismuth-aluminum oxide nanothermometers

    Science.gov (United States)

    Wang, Chiu-Yen; Chen, Shih-Hsun; Tsai, Ping-Hsin; Chiou, Chung-Han; Hsieh, Sheng-Jen

    2017-01-01

    Bismuth (Bi) nanowires, well controlled in length and diameter, were prepared by using an anodic aluminum oxide (AAO) template-assisted molding injection process with a high cooling rate. A high performance atomic layer deposition (ALD)-capped bismuth-aluminum oxide (Bi-Al2O3) nanothermometer is demonstrated that was fabricated via a facile, low-cost and low-temperature method, including AAO templated-assisted molding injection and low-temperature ALD-capped processes. The thermal behaviors of Bi nanowires and Bi-Al2O3 nanocables were studied by in situ heating transmission electron microscopy. Linear thermal expansion of liquid Bi within native bismuth oxide nanotubes and ALD-capped Bi-Al2O3 nanocables were evaluated from 275 °C to 700 °C and 300 °C to 1000 °C, respectively. The results showed that the ALD-capped Bi-Al2O3 nanocable possesses the highest working temperature, 1000 °C, and the broadest operation window, 300 °C-1000 °C, of a thermal-expanding type nanothermometer. Our innovative approach provides another way of fabricating core-shell nanocables and to further achieve sensing local temperature under an extreme high vacuum environment.