
Sample records for bismuth 203

  1. Bismuth, Metronidazole, and Tetracycline (United States)

    Helidac® (as a kit containing Bismuth Subsalicylate, Metronidazole, Tetracycline) ... Bismuth, metronidazole, and tetracycline is used along with other ulcer medications to treat duodenal ulcers. It is in a class of medications called ...

  2. Novel Bismuth Nanotubes

    Institute of Scientific and Technical Information of China (English)

    苏长荣; 李家明


    Theoretical investigations show that bismuth nanotubes are semiconductors for all diameters. For smalldiameter bismuth nanotubes, the band structures and bandgaps vary strongly with the strong hybridization effect. When the diameters are larger than 18 A, the bandgaps ofBi (n, n) and (n, 0) nanotubes approach 0.63 e V, corresponding to the bandgap of bismuth sheet at the Γ point. Thus, bismuth nanotubes are expected to be a potential semiconductor nanomaterial in future nanoelectronics.

  3. Nanocalorimetry of bismuth nanoparticles (United States)

    Olson, Eric Ashley

    The properties of nanosized bismuth particles are investigated using a nanocalorimetric technique. A brief description of the experimental method and data analysis procedures is reported. Bismuth nanoparticles are found to melt at a temperature below that of bulk material, but higher than expected using the standard model. Also included is the results of a finite element analysis and simulated melting of bismuth films on various kinds of sensors. Temperature distributions are found to be nonuniform for calorimetric sensors with Al metallizations, but much more uniform for Pt metallized sensors. The consequences of this nonuniformity on caloric data are discussed.

  4. AED 203 Courses Tutorial / indigohelp




    AED 203 Assignment: Science Experiment AED 203 Capstone Discussion Question AED 203 Final Project: Effective Classroom Management Plan AED 203 WEEK 1 ONE DISCUSSION 1 AED 203 WEEK 1 ONE DISCUSSION 2 AED 203 CheckPoint: Room Plan AED 203 CheckPoint: Effective Lesson Plan AED 203 WEEK 3 THREE DISCUSSION 1 AED 203 WEEK 3 THREE DISCUSSION 2 AED 203 CheckPoint: Monitoring Student Progress AED 203 WEEK 5 FIVE DISCUSSION QUESTION 1 AED 203 WEEK 5 FIVE DISC...

  5. Bismuth toxicity in patients treated with bismuth iodoform paraffin packs. (United States)

    Atwal, A; Cousin, G C S


    Bismuth is a heavy metal used in bismuth iodoform paraffin paste (BIPP) antiseptic dressings and in a number of other medical preparations. It can be absorbed systemically and cause toxicity. We report 2 cases of such neurotoxicity after it was used in operations on the jaws.

  6. ECO 203 NEW Tutorial / Uoptutorial




    For more course tutorials visit     ECO 203 Week 1 Question ECO 203 Week 1 DQ 1 Economics Systems ECO 203 Week 1 DQ 2 Role of Government ECO 203 Week 2 Journal Challenges to the American Labor Force ECO 203 Week 2 DQ 1 The Current State of the Economy and Unemployment  ECO 203 Week 2 DQ 2 Who Benefits and Who Loses from Inflation? ECO 203 Week 3 Assignment Efforts to Reduce the Budget Deficit ECO 203 Week 3 Discuss...

  7. Comparative Study of Semiconductors Bismuth Iodate, Bismuth Triiodide and Bismuth Trisulphide Crystals

    Directory of Open Access Journals (Sweden)

    T.K. Patil


    Full Text Available In the present investigation, crystals of Bismuth Iodate[Bi(IO33], Bismuth Iodide[BiI3] and Bismuth- Tri Sulphide [Bi2S3] were grown by a simple gel technique using single diffusion method. The optimum growth conditions were established by varying various parameters such as pH of gel solution, gel concentration, gel setting time, concentration of reactant etc. Gel was prepared by mixing sodium meta silicate (Na2SiO35H2O, glacial acetic acid (CH3COOH and supernant bismuth chloride (BiCl3 at pH value 4.4 and transferred in glass tube of diameter 2.5 cm and 25 cm in length. The mouth of test tube was covered by cotton plug and kept it for the setting. After setting the gel, it was left for aging. After 13 days duration the second supernant K(IO3, KI3 and H2S water gas solution was poured over the set gel by using pipette then it was kept undisturbed. After 72 hours of pouring the second supernatant, the small nucleation growth was observed at below the interface of gel. The good quality crystals of [Bi(IO33], [BiI3] and [Bi2S3] were grown. These grown crystals were characterized by XRD, FTIR, Chemical Analysis and Electrical Conductivity.

  8. Structure of unsupported bismuth nanoparticles (United States)

    Wurl, A.; Hyslop, M.; Brown, S. A.; Hall, B. D.; Monot, R.

    We present new results of electron diffraction experiments on unsupported nanometer-sized bismuth clusters. The high intensity cluster beam, necessary for electron diffraction, is provided by an inert-gas aggregation source. The cluster beam contains particles with average cluster sizes between 4.5 and 10 nm. When using Helium as a carrier gas we are able to observe a transition from crystalline clusters to a new structure, which we identify with that of amorphous or liquid clusters.

  9. Ranitidine bismuth citrate: A review

    Directory of Open Access Journals (Sweden)

    N Chiba


    Full Text Available Recognition of the relationship between Helicobacter pylori infection and the development of gastroduodenal disease has increased greatly in recent years. To avoid complications of H pylori infection, such as the development of recurrent duodenal and gastric ulcers, effective therapies are required for eradication of the infection. This article reviews ranitidine bismuth citrate (RBC, a novel complex of ranitidine, bismuth and citrate, which was developed specifically for the purpose of eradicating H pylori. Dual therapy with RBC in combination with clarithromycin for 14 days yields eradication rates of 76%. Triple therapy bid for one week with a proton pump inhibitor, clarithromycin and either amoxicillin or a nitroimidazole (tinidazole or metronidazole is advocated as the treatment of choice for H pylori eradication. Analogous regimens with RBC in place of proton pump inhibitors show effective eradication rates in comparative studies and with pooled data. RBC, used alone or in combination with other antibiotics, appears to be a safe and effective drug for the treatment of H pylori infection. Bismuth levels do not appear to rise to toxic levels.

  10. In vitro cytotoxicity of surface modified bismuth nanoparticles. (United States)

    Luo, Yang; Wang, Chaoming; Qiao, Yong; Hossain, Mainul; Ma, Liyuan; Su, Ming


    This paper describes in vitro cytotoxicity of bismuth nanoparticles revealed by three complementary assays (MTT, G6PD, and calcein AM/EthD-1). The results show that bismuth nanoparticles are more toxic than most previously reported bismuth compounds. Concentration dependent cytotoxicities have been observed for bismuth nanoparticles and surface modified bismuth nanoparticles. The bismuth nanoparticles are non-toxic at concentration of 0.5 nM. Nanoparticles at high concentration (50 nM) kill 45, 52, 41, 34 % HeLa cells for bare nanoparticles, amine terminated bismuth nanoparticles, silica coated bismuth nanoparticles, and polyethylene glycol (PEG) modified bismuth nanoparticles, respectively; which indicates cytotoxicity in terms of cell viability is in the descending order of amine terminated bismuth nanoparticles, bare bismuth nanoparticles, silica coated bismuth nanoparticles, and PEG modified bismuth nanoparticles. HeLa cells are more susceptible to toxicity from bismuth nanoparticles than MG-63 cells. The simultaneous use of three toxicity assays provides information on how nanoparticles interact with cells. Silica coated bismuth nanoparticles can damage cellular membrane yet keep mitochondria less influenced; while amine terminated bismuth nanoparticles can affect the metabolic functions of cells. The findings have important implications for caution of nanoparticle exposure and evaluating toxicity of bismuth nanoparticles.

  11. Bismuth ions are metabolized into autometallographic traceable bismuth-sulphur quantum dots

    Directory of Open Access Journals (Sweden)

    M Stoltenberg


    Full Text Available Bismuth – sulphur quantum dots can be silver enhanced by autometallography (AMG. In the present study, autometallographic silver enhanced bismuth-sulphur nanocrystals were isolated from unfixed cryo-sections of kidneys and livers of rats exposed to bismuth (Bi207 subnitrate. After being subjected to AMG all the organic material was removed by sonication and enzymatic digestion and the silver enhanced Bi- S quantum dots spun down by an ultracentrifuge and analyzed by scintillation. The analysis showed that the autometallographic technique traces approximately 94% of the total bismuth. This implies that the injected bismuth is ultimately captured in bismuthsulphur quantum dots, i.e., that Bi-S nanocrystals are the end product of bismuth metabolism

  12. SOC 203 ASH Tutorial course/ Uoptutorial


    Michael Crichton


    For more course tutorials visit   SOC 203 Week 1 DQ 1 The Sociological Imagination SOC 203 Week 1 DQ 2 Homelessness SOC 203 Week 2 DQ 1 Education and Equality SOC 203 Week 2 DQ 2 Title IX SOC 203 Week 2 Final Paper Preparation SOC 203 Week 3 DQ 1 Hate Crimes SOC 203 Week 3 DQ 2 Prisons and the War on Drugs SOC 203 Week 3 The Interconnection of Social Problems SOC 203 Week 4 DQ 1 Gay Parenting SOC 203 Week 4 DQ 2 Reinvent...

  13. Preparation of Strontium Bismuth Tantalum (SBT) Fine Powder by Sol-Gel Process Using Bismuth Subnitrate as Bismuth Source

    Institute of Scientific and Technical Information of China (English)


    Strontium bismuth tantalum (SBT) fine power was prepared by Sol-Gel method. Pentaethoxy tantalum, strontium acetate and bismuth subnitrate were used as raw materials, and were dissolved in proper order in ethylene glycol to form transparent sol. The mixed precursor was dried at 80°C and annealed at 800°C for 1 h. Crystallized nanometer sized SBT fine powder was obtained and characterized by XRD.

  14. Electrochemical properties of porous bismuth electrodes

    Energy Technology Data Exchange (ETDEWEB)

    Romann, T., E-mail: tavo.romann@ut.e [Institute of Chemistry, University of Tartu, Ravila 14A, 50411 Tartu (Estonia); Lust, E. [Institute of Chemistry, University of Tartu, Ravila 14A, 50411 Tartu (Estonia)


    The properties of Bi surfaces with different roughnesses were characterized by electron microscopy, cyclic voltammetry, and impedance spectroscopy. Two different strategies were used for preparation of porous bismuth layers onto Bi microelectrode surface in aqueous 0.1 M LiClO{sub 4} solution. Firstly, treatment at potential E < -2 V (vs. Ag|AgCl in sat. KCl) has been applied, resulting in bismuth hydride formation and decomposition into Bi nanoparticles which deposit at the electrode surface. Secondly, porous Bi layer was prepared by anodic dissolution (E = 1 V) of bismuth electrode followed by fast electroreduction of formed Bi{sup 3+} ions at cathodic potentials E = -2 V. The nanostructured porous bismuth electrode, with surface roughness factor up to 220, has negligible frequency dispersion of capacitance and higher hydrogen evolution overvoltage than observed for smooth Bi electrodes.

  15. Thermoelectric properties of pressed bismuth nanoparticles (United States)

    Hostler, Stephen R.; Qu, Yu Qiao; Demko, Michael T.; Abramson, Alexis R.; Qiu, Xiaofeng; Burda, Clemens


    Theory predicts a substantial increase in the dimensionless figure of merit as the dimensionality and characteristic size of a material are decreased. We explore the use of bismuth nanoparticles pressed into pellets as potential increased efficiency thermoelectric materials. The figure of merit of these pellets is determined by independently measuring the electrical conductivity, thermal conductivity and Seebeck coefficient. The results from the nanoparticle sample are compared to microparticle-based samples. Both sample types show a slight reduction in thermal conductivity relative to bulk bismuth and a Seebeck coefficient near or slightly larger in magnitude than bulk bismuth. These changes are dwarfed by a hundred-fold decrease in the electrical conductivity due to porosity and an oxide layer on the particles. The low conductivity leads to figures of merit at least two orders of magnitude smaller than bulk bismuth. Oxide layer removal and reduced pellet porosity will be required to increase the figure of merit.

  16. Effect of phase stability degradation of bismuth on sensor characteristics of nano-bismuth fixed electrode. (United States)

    Lee, Gyoung-Ja; Kim, Chang Kyu; Lee, Min Ku; Rhee, Chang Kyu


    Effect of phase stability degradation of bismuth on sensor characteristics of nano-bismuth fixed electrode has been investigated using square-wave anodic stripping voltammetry technique, scanning electron microscopy (SEM) and X-ray diffraction (XRD) spectroscopy. From the analyses of square-wave anodic stripping voltammograms (SWASV) repetitively measured on the nano-bismuth fixed electrode, it was found that the oxidation peak currents dropped by 81%, 68% and 59% for zinc, cadmium and lead, respectively, after the 100th measurement (about 400 min of operation time). The sphere bismuth nanoparticles gradually changed to the agglomerates with petal shape as the operation time increased. From the analyses of SEM images and XRD patterns, it is confirmed that the oxidation of Bi into BiOCl/Bi(2)O(2)CO(3) and the agglomeration of bismuth nanoparticles caused by the phase change decrease a reproducibility of the stripping voltammetric response. Moreover, most of the bismuth becomes BiOCl at pH 3.0 and bismuth hydroxide, Bi(OH)(3) at pH 7.0, which results in a significant decrease in sensitivity of the nano-bismuth fixed electrode.

  17. Gravimetric Analysis of Bismuth in Bismuth Subsalicylate Tablets: A Versatile Quantitative Experiment for Undergraduate Laboratories (United States)

    Davis, Eric; Cheung, Ken; Pauls, Steve; Dick, Jonathan; Roth, Elijah; Zalewski, Nicole; Veldhuizen, Christopher; Coeler, Joel


    In this laboratory experiment, lower- and upper-division students dissolved bismuth subsalicylate tablets in acid and precipitated the resultant Bi[superscript 3+] in solution with sodium phosphate for a gravimetric determination of bismuth subsalicylate in the tablets. With a labeled concentration of 262 mg/tablet, the combined data from three…

  18. ECO 203 ASH course tutorial/tutorialoutlet


    NARESH 34


    For more course tutorials visit   ECO 203 Week 1 DQ 1 Economics Systems ECO 203 Week 1 DQ 2 Role of Government ECO 203 Week 1 Quiz ECO 203 Week 2 DQ 1 The Current State of the Economy and Unemployment ECO 203 Week 2 DQ 2 Who Benefits and Who Loses from Inflation ? ECO 203 Week 2 Quiz ECO 203 Week 3 DQ 1 Government Fiscal Policy ECO 203 Week 3 DQ 2 Budget Deficits and the National Debt ECO 203 Week 3 Assignment Efforts to Reduce t...

  19. SOC 203 ASH Course Tutorial/Tutorialrank




    For more course tutorials visit Tutorial Purchased: 5 Times, Rating: A+   SOC 203 Week 1 DQ 1 The Sociological Imagination SOC 203 Week 1 DQ 2 Homelessness SOC 203 Week 2 DQ 1 Education and Equality SOC 203 Week 2 DQ 2 Title IX SOC 203 Week 2 Final Paper Preparation SOC 203 Week 3 DQ 1 Hate Crimes SOC 203 Week 3 DQ 2 Prisons and the War on Drugs SOC 203 Week 3 The Interconnection of Social Problems SOC 203 We...

  20. Thermal degradation of ultrabroad bismuth NIR luminescence in bismuth-doped tantalum germanate laser glasses. (United States)

    Wang, Liping; Zhao, Yanqi; Xu, Shanhui; Peng, Mingying


    Because of ultra-broadband luminescence in 1000-1700 nm and consequent applications in fiber amplifier and lasers in the new spectral range where traditional rare earth cannot work, bismuth-doped laser glasses have received rising interest recently. For long-term practical application, thermal degradation must be considered for the glasses. This, however, has seldom been investigated. Here we report the thermal degradation of bismuth-doped germanate glass. Heating and cooling cycle experiments at high temperature reveal strong dependence of the thermal degradation on glass compositions. Bismuth and tantalum lead to the reversible degradation, while lithium can produce permanent irreversible degradation. The degradation becomes worse as lithium content increases in the glass. Absorption spectra show this is due to partial oxidation of bismuth near-infrared emission center. Surprisingly, we notice the emission of bismuth exhibits blueshift, rather than redshift at a higher temperature, and the blueshift can be suppressed by increasing the lithium content. PMID:27192231

  1. 24 CFR 203.203 - Issuance and nature of insured 10-year protection plans. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Issuance and nature of insured 10-year protection plans. 203.203 Section 203.203 Housing and Urban Development Regulations Relating to... Underwriting Procedures Insured Ten-Year Protection Plans (plan) § 203.203 Issuance and nature of insured...

  2. Electrodeposition and Characterization of Bismuth Telluride Nanowires (United States)

    Frantz, C.; Stein, N.; Gravier, L.; Granville, S.; Boulanger, C.


    In this work, we report thermoelectric measurements on electroplated bismuth telluride nanowires. Porous polycarbonate membranes, obtained by ion-track irradiation lithography, were chosen as electroplating templates. Bismuth telluride nanowires were achieved in acidic media under potentiostatic conditions at -100 mV versus saturated silver chloride electrode. The filling ratio of the pores was increased to 80% by adding dimethyl sulfoxide to the electrolyte. Whatever the experimental conditions, the nanowires were polycrystalline in the rhombohedral phase of Bi2Te3. Finally, the power output of arrays of bismuth telluride nanowires was analyzed as a function of load resistance. The results were strongly dependent on the internal resistance, which can be significantly reduced by the presence of dimethyl sulfoxide during electroplating.

  3. AED 203 uop course tutorial/uop help




    For more course tutorials visit     AED 203 Assignment: Science Experiment AED 203 Capstone Discussion Question AED 203 Final Project: Effective Classroom Management Plan AED 203 WEEK 1 ONE DISCUSSION 1 AED 203 WEEK 1 ONE DISCUSSION 2 AED 203 CheckPoint: Room Plan AED 203 CheckPoint: Effective Lesson Plan AED 203 WEEK 3 THREE DISCUSSION 1 AED 203 WEEK 3 THREE DISCUSSION 2 AED 203 CheckPoint: Monitoring Student Progr...

  4. AED 203 UOP Course Tutorial/TutorialRank




    For more course tutorials visit Tutorial Purchased: 5 Times, Rating: A+ AED 203 Assignment: Science Experiment AED 203 Capstone Discussion Question AED 203 Final Project: Effective Classroom Management Plan AED 203 WEEK 1 ONE DISCUSSION 1 AED 203 WEEK 1 ONE DISCUSSION 2 AED 203 CheckPoint: Room Plan AED 203 CheckPoint: Effective Lesson Plan AED 203 WEEK 3 THREE DISCUSSION 1 AED 203 WEEK 3 THREE DISCUSSION 2 AED 203 CheckPoint: Monitori...

  5. Burnout current density of bismuth nanowires (United States)

    Cornelius, T. W.; Picht, O.; Müller, S.; Neumann, R.; Völklein, F.; Karim, S.; Duan, J. L.


    Single bismuth nanowires with diameters ranging from 100nmto1μm were electrochemically deposited in ion track-etched single-pore polycarbonate membranes. The maximum current density the wires are able to carry was investigated by ramping up the current until failure occurred. It increases by three to four orders of magnitude for nanowires embedded in the template compared to bulk bismuth and rises with diminishing diameter. Simulations show that the wires are heated up electrically to the melting temperature. Since the surface-to-volume ratio rises with diminishing diameter, thinner wires dissipate the heat more efficiently to the surrounding polymer matrix and, thus, can tolerate larger current densities.

  6. Hyperfine splitting in lithium-like bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Lochmann, Matthias; Froemmgen, Nadja; Hammen, Michael; Will, Elisa [Universitaet Mainz (Germany); Andelkovic, Zoran; Kuehl, Thomas; Litvinov, Yuri; Winters, Danyal; Sanchez, Rodolfo [GSI Helmholtzzentrum, Darmstadt (Germany); Botermann, Benjamin; Noertershaeuser, Wilfried [Technische Universitaet Darmstadt (Germany); Bussmann, Michael [Helmholtzzentrum Dresden-Rossendorf (Germany); Dax, Andreas [CERN, Genf (Switzerland); Hannen, Volker; Joehren, Raphael; Vollbrecht, Jonas; Weinheimer, Christian [Universitaet Muenster (Germany); Geppert, Christopher [Universitaet Mainz (Germany); GSI Helmholtzzentrum, Darmstadt (Germany); Stoehlker, Thomas [GSI Helmholtzzentrum, Darmstadt (Germany); Universitaet Heidelberg (Germany); Thompson, Richard [Imperial College, London (United Kingdom); Volotka, Andrey [Technische Universitaet Dresden (Germany); Wen, Weiqiang [IMP Lanzhou (China)


    High-precision measurements of the hyperfine splitting values on Li- and H-like bismuth ions, combined with precise atomic structure calculations allow us to test QED-effects in the regime of the strongest magnetic fields that are available in the laboratory. Performing laser spectroscopy at the experimental storage ring (ESR) at GSI Darmstadt, we have now succeeded in measuring the hyperfine splitting in Li-like bismuth. Probing this transition has not been easy because of its extremely low fluorescence rate. Details about this challenging experiment will be given and the achieved experimental accuracy are presented.

  7. Bismuth titanate nanorods and their visible light photocatalytic properties

    Energy Technology Data Exchange (ETDEWEB)

    Pei, L.Z., E-mail:; Liu, H.D.; Lin, N.; Yu, H.Y.


    Highlights: • Bismuth titanate nanorods have been synthesized by a simple hydrothermal process. • The size of bismuth titanate nanorods can be controlled by growth conditions. • Bismuth titanate nanorods show good photocatalytic activities of methylene blue and Rhodamine B. - Abstract: Bismuth titanate nanorods have been prepared using a facile hydrothermal process without additives. The bismuth titanate products were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), high-resolution TEM (HRTEM) and UV-vis diffusion reflectance spectrum. XRD pattern shows that the bismuth titanate nanorods are composed of cubic Bi{sub 2}Ti{sub 2}O{sub 7} phase. Electron microscopy images show that the length and diameter of the bismuth titanate nanorods are 50-200 nm and 2 μm, respectively. Hydrothermal temperature and reaction time play important roles on the formation and size of the bismuth titanate nanorods. UV-vis diffusion reflectance spectrum indicates that bismuth titanate nanorods have a band gap of 2.58 eV. The bismuth titanate nanorods exhibit good photocatalytic activities in the photocatalytic degradation of methylene blue (MB) and Rhodamine B (RB) under visible light irradiation. The bismuth titanate nanorods with cubic Bi{sub 2}Ti{sub 2}O{sub 7} phase are a promising candidate as a visible light photocatalyst.

  8. Probing bismuth ferrite nanoparticles by hard x-ray photoemission: Anomalous occurrence of metallic bismuth

    International Nuclear Information System (INIS)

    We have investigated bismuth ferrite nanoparticles (∼75 nm and ∼155 nm) synthesized by a chemical method, using soft X-ray (1253.6 eV) and hard X-ray (3500, 5500, and 7500 eV) photoelectron spectroscopy. This provided an evidence for the variation of chemical state of bismuth in crystalline, phase pure nanoparticles. X-ray photoelectron spectroscopy analysis using Mg Kα (1253.6 eV) source showed that iron and bismuth were present in both Fe3+ and Bi3+ valence states as expected for bismuth ferrite. However, hard X-ray photoelectron spectroscopy analysis of the bismuth ferrite nanoparticles using variable photon energies unexpectedly showed the presence of Bi0 valence state below the surface region, indicating that bismuth ferrite nanoparticles are chemically inhomogeneous in the radial direction. Consistently, small-angle X-ray scattering reveals a core-shell structure for these radial inhomogeneous nanoparticles.

  9. 24 CFR 203.443 - Insurance premium. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance premium. 203.443 Section 203.443 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued... premium. All of the provisions of §§ 203.260 through 203.269 1 concerning mortgage insurance...

  10. Effect of Lipophilic Bismuth Nanoparticles on Erythrocytes

    Directory of Open Access Journals (Sweden)

    Rene Hernandez-Delgadillo


    Full Text Available Lipophilic bismuth dimercaptopropanol nanoparticles (BisBAL NPs have a very important antimicrobial activity; however their effect on human cells or tissues has not been completely studied. Undesirable effects of bismuth include anemia which could result from suicidal erythrocyte death or eryptosis. The objective of this research was to determine the effect of bismuth dimercaptopropanol nanoparticles on blood cells. The nanoparticles are composed of 53 nm crystallites on average and have a spherical structure, agglomerating into clusters of small nanoparticles. Based on cell viability assays and optical microscopy, cytotoxicity on erythrocytes was observed after growing with 500 and 1000 µM of BisBAL NPs for 24 h. AM Calcein was retained inside erythrocytes when they were exposed to 100 µM (or lower concentrations of BisBAL NPs for 24 h, suggesting the absence of damage in plasmatic membrane. Genotoxic assays revealed no damage to genomic DNA of blood cells after 24 h of exposition to BisBAL NPs. Finally, 100–1000 µM of bismuth nanoparticles promotes apoptosis between blood cells after 24 h of incubation. Hence BisBAL NPs at concentrations lower than 100 µM do not cause damage on blood cells; they could potentially be used by humans without affecting erythrocytes and leukocytes.

  11. Bismuth( Ⅲ ) Salts: Green Catalysts for Organic Transformations

    Institute of Scientific and Technical Information of China (English)

    C. Le Roux


    @@ 1Introduction Bismuth, the heaviest stable element in the periodic table, stands out from other heavy elements (such as mercury, thallium and lead) due to its relatively non-toxic character which confers on bismuth the enviable status of being an eco-friendly element. Therefore, bismuth and its compounds hold considerable promise as useful catalysts for green chemistry. The research presented in this communication is devoted to the applications of bismuth( Ⅲ ) salts as catalysts for organic transformations.After some general comments about bismuth and a short presentation of the various applications of bismuth( Ⅲ ) salts in organic synthesis, this communication will focus on the works done in our research group during the last several years which deals mainly with electrophilic substitutions. When appropriate, some mechanistic details will be given.

  12. Electroanalysis of organic compounds at bismuth electrodes: a short review


    Lezi, Nikolitsa; Vyskočil, Vlastimil; Economou, Anastasios; Barek, Jiří


    Over the last twelve years, it has been demonstrated that bismuth electrodes have comparable electroanalytical performance to mercury electrodes in the negative potential range. Since the toxicicty of bismuth is lower than that of mercury, bismuth can serve as an alternative “green” electrode material to mercury. However, the great majority of published work at bismuth–based electrodes is concerned with the determination of trace metals by voltammetric techniques with only few applications de...

  13. Magnetoconductance fluctuations in open bismuth quantum dots (United States)

    Hackens, B.; Minet, J. P.; Farhi, G.; Crahay, A.; Faniel, S.; Gustin, C.; Bayot, V.


    We investigate the low temperature (300 mK - 10 K) magnetoconductance of open circular bismuth quantum dots (diameter: 500 nm). The structures are fabricated using a combination of electron beam lithography, lift off and plasma etching techniques on bismuth thin films evaporated on heated SiO2 substrates. We observe reproducible magnetoconductance fluctuations (UCFs) up to 5T, qualitatively similar to conductance fluctuations evidenced in open quantum dots patterned in high mobility semiconductor heterostructures. In our samples, UCFs are superposed on a slowly varying negative magnetoconductance background. We also observe a sharp conductance maximum centered in B=0, which is reminescent of the spin-orbit induced anti-localisation phenomenon. The behavior of UCFs and of the conductance maximum is discussed as a function of the temperature, thickness and degree of cristallinity of the cavity.

  14. Electrocatalytic activity of bismuth doped silver electrodes

    CERN Document Server

    Amjad, M


    Investigation of redox reactions on silver, and bismuth doped silver electrodes in aqueous KOH solutions, by using potentiostatic steady-state polarization technique, has been carried out. The redox wave potential and current displacements along with multiplicity of the latter have been examined. These electrodes were employed for the oxidation of organic molecules such as ethylamine in alkaline media. Subsequently, these electrodes were ranked with respect to their activity for the redox reactions. (author)

  15. Influence of bismuth content on viscosity of lead-bismuth alloy

    International Nuclear Information System (INIS)

    In this paper, viscosities of Pb44.5 Bi55.5 (LBE), Pb60 Bi40, Pb70 Bi30, Pb80 Bi20 and Pb are studied in a certain temperature range above liquidus, the results show that the viscosities of five melts decrease with the increase of temperature. Excepting for pure Pb, anomalous changes in the viscosity values are found in LBE, Pb60 Bi40, Pb70 Bi30 and Pb80 Bi20 in the test temperature range, it is presumed that melts structure occurs at the anomalous point of the viscosity. In the temperature range of 623∼923 K, viscosity value of Pb60 Bi40 is obviously higher than that of the other proportion of lead bismuth alloy, and it increases with the decrease of bismuth content at temperature above 1023 K. The experimental results provide data support for the choice of lead-bismuth hypoeutectic applied in advanced nuclear reactor. (authors)

  16. Flame spray synthesis under a non-oxidizing atmosphere: Preparation of metallic bismuth nanoparticles and nanocrystalline bulk bismuth metal

    Energy Technology Data Exchange (ETDEWEB)

    Grass, Robert N.; Stark, Wendelin J. [Institute for Chemical and Bioengineering, ETH Zuerich (Switzerland)], E-mail:


    Metallic bismuth nanoparticles of over 98% purity were prepared by a modified flame spray synthesis method in an inert atmosphere by oxygen-deficient combustion of a bismuth-carboxylate based precursor. The samples were characterized by X-ray diffraction, thermal analysis and scanning electron microscopy confirming the formation of pure, crystalline metallic bismuth nanoparticles. Compression of the as-prepared powder resulted in highly dense, nanocrystalline pills with strong electrical conductivity and bright metallic gloss.

  17. Spin dynamics of complex oxides, bismuth-antimony alloys, and bismuth chalcogenides (United States)

    Sahin, Cuneyt

    The emerging field of spintronics relies on the manipulation of electron spin in order to use it in spin-based electronics. Such a paradigm change has to tackle several challenges including finding materials with sufficiently long spin lifetimes and materials which are efficient in generating pure spin currents. This thesis predicts that two types of material families could be a solution to the aforementioned challenges: complex oxides and bismuth based materials. We derived a general approach for constructing an effective spin-orbit Hamiltonian which is applicable to all nonmagnetic materials. This formalism is useful for calculating spin-dependent properties near an arbitrary point in momentum space. We also verified this formalism through comparisons with other approaches for III-V semiconductors, and its general applicability is illustrated by deriving the spin-orbit interaction and predicting spin lifetimes for strained strontium titanate (STO) and a two-dimensional electron gas in STO (such as at the LAO/STO interface). Our results suggest robust spin coherence and spin transport properties in STO related materials even at room temperature. In the second part of the study we calculated intrinsic spin Hall conductivities for bismuth-antimony (BISb) semimetals with strong spin-orbit couplings, from the Kubo formula and using Berry curvatures evaluated throughout the Brillouin zone from a tight-binding Hamiltonian. Nearly crossing bands with strong spin-orbit interaction generate giant spin Hall conductivities in these materials, ranging from 474 ((h/e)O--1cm--1) for bismuth to 96((h/e)O--1cm --1) for antimony; the value for bismuth is more than twice that of platinum. The large spin Hall conductivities persist for alloy compositions corresponding to a three-dimensional topological insulator state, such as Bi0.83Sb0.17. The spin Hall conductivity could be changed by a factor of 5 for doped Bi, or for Bi0.83Sb0.17, by changing the chemical potential by 0.5 e

  18. 40 CFR 240.203 - General design. (United States)


    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false General design. 240.203 Section 240.203 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR... design....

  19. 5 CFR 850.203 - Other elections. (United States)


    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Other elections. 850.203 Section 850.203...) RETIREMENT SYSTEMS MODERNIZATION Applications for Benefits; Elections § 850.203 Other elections. (a) Any other election may be effected in such form as the Director prescribes under § 850.104. Such...

  20. 46 CFR 109.203 - Sanitation. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Sanitation. 109.203 Section 109.203 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS OPERATIONS Tests, Drills, and Inspections § 109.203 Sanitation. (a) The master or person in charge shall insure that the...

  1. 49 CFR 37.203 - Lift maintenance. (United States)


    ... 49 Transportation 1 2010-10-01 2010-10-01 false Lift maintenance. 37.203 Section 37.203... DISABILITIES (ADA) Over-the-Road Buses (OTRBs) § 37.203 Lift maintenance. (a) The entity shall establish a system of regular and frequent maintenance checks of lifts sufficient to determine if they are...

  2. 24 CFR 203.7 - Commitment process. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Commitment process. 203.7 Section 203.7 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued... Insurance, and Commitments § 203.7 Commitment process. For single family mortgage programs that are...

  3. 48 CFR 203.1004 - Contract clauses. (United States)


    ... OF DEFENSE GENERAL IMPROPER BUSINESS PRACTICES AND PERSONAL CONFLICTS OF INTEREST Contractor Code of Business Ethics and Conduct 203.1004 Contract clauses. (a) Use the clause at 252.203-7003 in solicitations and contracts that include the FAR clause 52.203-13, Contractor Code of Business Ethics and...

  4. 14 CFR 25.203 - Stall characteristics. (United States)


    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Stall characteristics. 25.203 Section 25.203 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY AIRPLANES Flight Stalls § 25.203 Stall characteristics. (a) It...

  5. 40 CFR 240.203-1 - Requirement. (United States)


    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirement. 240.203-1 Section 240.203-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.203-1...

  6. 5 CFR 302.203 - Disqualifying factors. (United States)


    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Disqualifying factors. 302.203 Section 302.203 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS EMPLOYMENT IN THE EXCEPTED SERVICE Eligibility Standards § 302.203 Disqualifying factors. (a) The...

  7. 49 CFR 215.203 - Restricted cars. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Restricted cars. 215.203 Section 215.203..., DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Restricted Equipment § 215.203 Restricted cars. (a) This section restricts the operation of any railroad freight car that is— (1) More than...

  8. 47 CFR 97.203 - Beacon station. (United States)


    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Beacon station. 97.203 Section 97.203... SERVICE Special Operations § 97.203 Beacon station. (a) Any amateur station licensed to a holder of a Technician, Technician Plus, General, Advanced or Amateur Extra Class operator license may be a beacon....

  9. 30 CFR 75.203 - Mining methods. (United States)


    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Mining methods. 75.203 Section 75.203 Mineral... SAFETY STANDARDS-UNDERGROUND COAL MINES Roof Support § 75.203 Mining methods. (a) The method of mining... faulty pillar recovery methods. Pillar dimensions shall be compatible with effective control of the...

  10. 12 CFR 203.3 - Exempt institutions. (United States)


    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Exempt institutions. 203.3 Section 203.3 Banks... DISCLOSURE (REGULATION C) § 203.3 Exempt institutions. (a) Exemption based on state law. (1) A state-chartered or state-licensed financial institution is exempt from the requirements of this regulation if...

  11. 32 CFR 203.13 - Procurement. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Procurement. 203.13 Section 203.13 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS TECHNICAL ASSISTANCE FOR PUBLIC PARTICIPATION (TAPP) IN DEFENSE ENVIRONMENTAL RESTORATION ACTIVITIES § 203.13 Procurement. Procurements will...

  12. 48 CFR 16.203-1 - Description. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Description. 16.203-1 Section 16.203-1 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Fixed-Price Contracts 16.203-1 Description. (a) A...

  13. 48 CFR 5416.203-1 - Description. (United States)


    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Description. 5416.203-1 Section 5416.203-1 Federal Acquisition Regulations System DEFENSE LOGISTICS AGENCY, DEPARTMENT OF DEFENSE TYPES OF CONTRACTS Fixed Price Contracts 5416.203-1 Description. (a)(S-90) Adjustments based...

  14. 46 CFR 169.203 - Description. (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Description. 169.203 Section 169.203 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS SAILING SCHOOL VESSELS Inspection and Certification Certificate of Inspection § 169.203 Description. The certificate of...

  15. Optical spectroscopy of Bismuth-doped pure silica fiber preform


    Razdobreev, Igor,; El Hamzaoui, Hicham; Ivanov, V. Yu; Kustov, E. F.; Capoen, Bruno; Bouazaoui, Mohamed


    International audience We report on the optical spectroscopy of monolithic fiber preform prepared from nanoporous bismuth-doped silica glass. The experiments reveal the existence of at least two different types of active centers and clearly demonstrate that the presence in the glass matrix of other dopant is not necessary to obtain the near-IR photoluminescence connected to Bismuth.

  16. Hall-Effect Thruster Utilizing Bismuth as Propellant (United States)

    Szabo, James; Gasdaska, Charles; Hruby, Vlad; Robin, Mike


    A laboratory-model Hall-effect spacecraft thruster was developed that utilizes bismuth as the propellant. Xenon was used in most prior Hall-effect thrusters. Bismuth is an attractive alternative because it has a larger atomic mass, a larger electron-impact-ionization cross-section, and is cheaper and more plentiful.

  17. Bismuth(III) dialkyldithiophosphates: Facile single source precursors for the preparation of bismuth sulfide nanorods and bismuth phosphate thin films

    Energy Technology Data Exchange (ETDEWEB)

    Biswal, Jasmine B. [Department of Chemistry, University of Mumbai, Vidyanagari, Santacruz (East), Mumbai 400098 (India); Garje, Shivram S., E-mail: [Department of Chemistry, University of Mumbai, Vidyanagari, Santacruz (East), Mumbai 400098 (India); Nuwad, Jitendra; Pillai, C.G.S. [Chemistry Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India)


    Two different phase pure materials (Bi{sub 2}S{sub 3} and Bi{sub 2}P{sub 4}O{sub 13}) have been prepared under different conditions using the same single source precursors. Solvothermal decomposition of the complexes, Bi(S{sub 2}P(OR){sub 2}){sub 3} [where, R=Methyl (Me) (1), Ethyl (Et) (2), n-Propyl (Pr{sup n}) (3) and iso-Propyl (Pr{sup i}) (4)] in ethylene glycol gave orthorhombic bismuth sulfide nanorods, whereas aerosol assisted chemical vapor deposition (AACVD) of the same precursors deposited monoclinic bismuth tetraphosphate (Bi{sub 2}P{sub 4}O{sub 13}) thin films on glass substrates. Surface study of the thin films using SEM illustrated the formation of variety of nanoscale morphologies (spherical-, wire-, pendent-, doughnut- and flower-like) at different temperatures. AFM studies were carried out to evaluate quality of the films in terms of uniformity and roughness. Thin films of average roughness as low as 1.4 nm were deposited using these precursors. Photoluminescence studies of Bi{sub 2}P{sub 4}O{sub 13} thin films were also carried out. - Graphical abstract: Solvothermal decomposition of bismuth(III) dialkyldithiophosphates in ethylene glycol gave Bi{sub 2}S{sub 3} nanoparticles, whereas aerosol assisted chemical vapor deposition of these single source precursors deposited Bi{sub 2}P{sub 4}O{sub 13} thin films. Display Omitted - Highlights: • Preparation of phase pure orthorhombic Bi{sub 2}S{sub 3} nanorods and monoclinic Bi{sub 2}P{sub 4}O{sub 13} thin films. • Use of single source precursors for deposition of bismuth phosphate thin films. • Use of solvothermal decomposition and AACVD methods. • Morphology controlled synthesis of Bi{sub 2}P{sub 4}O{sub 13} thin films. • Bi{sub 2}S{sub 3} nanorods and Bi{sub 2}P{sub 4}O{sub 13} thin films using same single source precursors.

  18. Electron Paramagnetic Resonance Study of Thermally Treated Bismuth Subgallate

    Directory of Open Access Journals (Sweden)

    Paweł Ramos


    Full Text Available Complex of bismuth, an anti-inflammatory drug, was studied by EPR spectroscopy. The aim of this study was to determine concentrations and properties of free radicals formed during thermal sterilization of bismuth subgallate according to pharmacopoeia norms to optimize its sterilization process. Different temperatures (160°C, 170°C, and 180°C and times (120 minutes, 60 minutes, and 30 minutes of sterilization were used. Interactions of bismuth subgallate with DPPH, the model free radical reference, were checked. g-Factors, amplitudes (A, integral intensities (I, and linewidths (ΔBpp were obtained. Integral intensities were obtained by double integration of the first-derivative EPR lines. The influence of microwave power in the range of 2.2–70 mW on shape and parameters of the EPR spectra was examined. Thermal sterilization produced free radicals in bismuth subgallate in all tested cases. Strong interactions with free radicals were pointed out for all the analysed samples containing bismuth independent of sterilization conditions. Optimal conditions of thermal sterilization for bismuth subgallate with the lowest free radical formation are temperature 170°C and time of heating 60 minutes. Strong dipolar interactions exist in thermally sterilized bismuth subgallate. EPR spectroscopy is a useful method of examination of thermal sterilization conditions.

  19. Determining the background levels of bismuth in tissues of wild game birds: a first step in addressing the environmental consequences of using bismuth shotshells. (United States)

    Jayasinghe, R; Tsuji, L J S; Gough, W A; Karagatzides, J D; Perera, D; Nieboer, E


    Bismuth shotshells have been approved as a "nontoxic" alternative to lead in North America. Approval was based on a limited number of studies; even background levels of bismuth in wildfowl were unknown. We report on the concentration of bismuth (and lead) in muscle and liver tissues of wildfowl (Anas platyrhynchos, Anas acuta, Anas crecca, Branta canadensis, Chen caerulescens) harvested with lead shotshell. Average liver-bismuth levels detected in the present study (e.g., teal, 0.05 microg/g dw; mallard, 0.09 microg/g dw) suggest analytical error in other studies examining the effects of bismuth in birds. Significant positive relationships between bismuth- and lead-tissue levels for muscle when all species were combined (and for B. canadensis and C. caerulescens separately) can be explained by noting that bismuth is a contaminant of lead. Thus, more research is recommended to confirm the appropriateness of bismuth as a "nontoxic" shot alternative.

  20. Dicty_cDB: AFG203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFG203 (Link to dictyBase) - - - Contig-U16382-1 AFG203E (Link to Original site) AFG20...3F 611 AFG203Z 741 AFG203P 1352 AFG203E 1195 Show AFG203 Library AF (Link to library) Clone ID AFG20...ginal site URL Re...presentative seq. ID AFG203E (Link to Original site) Representative DNA sequence >AFG203 (AFG203Q) /CSM/AF/AFG2-A/AFG20...SM-cDNA Score E Sequences producing significant alignments: (bits) Value AFG203 (AFG203Q) /CSM/AF/AFG2-A/AFG20

  1. SOC 203 uop course tutorial/tutorial rank




    For more course tutorials visit Tutorial Purchased: 5 Times, Rating: A+   SOC 203 Week 1 DQ 1 The Sociological Imagination SOC 203 Week 1 DQ 2 Homelessness SOC 203 Week 2 DQ 1 Education and Equality SOC 203 Week 2 DQ 2 Title IX SOC 203 Week 2 Final Paper Preparation SOC 203 Week 3 DQ 1 Hate Crimes SOC 203 Week 3 DQ 2 Prisons and the War on Drugs SOC 203 Week 3 The Interconnection of Social Problems SOC 203 We...

  2. Hierarchical bismuth phosphate microspheres with high photocatalytic performance

    Energy Technology Data Exchange (ETDEWEB)

    Pei, Lizhai; Wei, Tian; Lin, Nan; Yu, Haiyun [Anhui University of Technology, Ma' anshan (China). Key Laboratory of Materials Science and Processing of Anhui Province


    Hierarchical bismuth phosphate microspheres have been prepared by a simple hydrothermal process with polyvinyl pyrrolidone. Scanning electron microscopy observations show that the hierarchical bismuth phosphate microspheres consist of nanosheets with a thickness of about 30 nm. The diameter of the microspheres is about 1 - 3 μm. X-ray diffraction analysis shows that the microspheres are comprised of triclinic Bi{sub 23}P{sub 4}O{sub 44.5} phase. The formation of the hierarchical microspheres depends on polyvinyl pyrrolidone concentration, hydrothermal temperature and reaction time. Gentian violet acts as the pollutant model for investigating the photocatalytic activity of the hierarchical bismuth phosphate microspheres under ultraviolet-visible light irradiation. Irradiation time, dosage of the hierarchical microspheres and initial gentian violet concentration on the photocatalytic efficiency are also discussed. The hierarchical bismuth phosphate microspheres show good photocatalytic performance for gentian violet removal in aqueous solution.

  3. 48 CFR 203.1003 - Requirements. (United States)


    ... OF DEFENSE GENERAL IMPROPER BUSINESS PRACTICES AND PERSONAL CONFLICTS OF INTEREST Contractor Code of Business Ethics and Conduct 203.1003 Requirements. (b) Notification of possible contractor violation....

  4. Bismuth electrodes, an alternative in stripping voltammetry

    International Nuclear Information System (INIS)

    The heavy metals are known as highly toxic contaminants, the processes carried out in industry contribute that finally they remain dispersed in effluents and sewage, doing part of the food chain. The importance of controlling the levels of these heavy metals has become an international policy, so it has generated interest in developing new analytical methodologies for its determination [1, 2, 3, 4]. The stripping voltammetry has been considered as a family of electro-sensitive analytical techniques useful for the determination of trace levels of many metals in environmental, clinical and industrial samples [3, 4]. This work presents an overview of these bismuth-based electrodes which were introduced around 2000, which have interesting characteristics for detection of heavy metals and which represent an alternative to mercury electrodes

  5. Bismuth electrodes, an alternative in stripping voltammetry (United States)

    Barón-Jaimez, J.; Joya, M. R.; Barba-Ortega, J.


    The heavy metals are known as highly toxic contaminants, the processes carried out in industry contribute that finally they remain dispersed in effluents and sewage, doing part of the food chain. The importance of controlling the levels of these heavy metals has become an international policy, so it has generated interest in developing new analytical methodologies for its determination [1, 2, 3, 4]. The stripping voltammetry has been considered as a family of electro-sensitive analytical techniques useful for the determination of trace levels of many metals in environmental, clinical and industrial samples [3, 4]. This work presents an overview of these bismuth-based electrodes which were introduced around 2000, which have interesting characteristics for detection of heavy metals and which represent an alternative to mercury electrodes.

  6. Platinum-Bismuth Bimetallic Catalysts: Synthesis, Characterization and Applications


    Saucedo, Jose A, Jr; Xiao, Yang; Varma, Arvind


    Bimetallic catalysts have been explored and shown to exhibit unique characteristics which are not present in monometallic catalysts. Platinum is well known as an effective catalyst for oxidation and reduction reactions, and it can be made more effective when bismuth is introduced as a promotor. Thus, the effectiveness of the Pt-Bi catalyst was demonstrated in prior work. What is not clear, however, is the mechanism behind the catalyst function; why addition of bismuth to platinum decreases de...

  7. Electron cooling and Debye-Waller effect in photoexcited bismuth


    Arnaud, B.; Giret, Y.


    By means of first principles calculations, we computed the effective electron-phonon coupling constant $G_0$ governing the electron cooling in photoexcited bismuth. $G_0$ strongly increases as a function of electron temperature, which can be traced back to the semi-metallic nature of bismuth. We also used a thermodynamical model to compute the time evolution of both electron and lattice temperatures following laser excitation. Thereby, we simulated the time evolution of (1 -1 0), (-2 1 1) and...

  8. Melting and solidification of bismuth inclusions in aluminium

    DEFF Research Database (Denmark)

    Thoft, N.B.; Bohr, J.; Buras, B.;


    Supercooling of crystalline bismuth inclusions in aluminium crystals has been observed and studied with different techniques: x-ray diffraction, in situ Rutherford backscattering/channelling spectrometry and transmission electron microscopy. The results of the measurements with different experime......Supercooling of crystalline bismuth inclusions in aluminium crystals has been observed and studied with different techniques: x-ray diffraction, in situ Rutherford backscattering/channelling spectrometry and transmission electron microscopy. The results of the measurements with different...

  9. Piezoelectric bismuth titanate ceramics for high temperature applications


    Shulman, Holly Sue; Setter, Nava


    Bismuth titanate (Bi4Ti3O12) shows promise in piezoelectric applications in a temperature range (300-600 °C) which is not well served by standard piezoelectric ceramics. The proposal to use bismuth titanate ceramics for these applications has a major flaw, namely that the high electrical conductivity precludes the efficient polarization of these materials in an electric field. The degree of polarization is critical since it is directly related to the piezoelectric response. In addition, once ...

  10. In situ electron beam irradiated rapid growth of bismuth nanoparticles in bismuth-based glass dielectrics at room temperature

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Shiv Prakash; Karmakar, Basudeb, E-mail: [Central Glass and Ceramic Research Institute (CSIR, India), Glass Science and Technology Section, Glass Division (India)


    In this study, in situ control growth of bismuth nanoparticles (Bi{sup 0} NPs) was demonstrated in bismuth-based glass dielectrics under an electron beam (EB) irradiation at room temperature. The effects of EB irradiation were investigated in situ using transmission electron microscopy (TEM), selected-area electron diffraction and high-resolution transmission electron microscopy. The EB irradiation for 2-8 min enhanced the construction of bismuth nanoparticles with a rhombohedral structure and diameter of 4-9 nm. The average particle size was found to increase with the irradiation time. Bismuth metal has a melting point of 271 Degree-Sign C and this low melting temperature makes easy the progress of energy induced structural changes during in situ TEM observations. This is a very useful technique in nano-patterning for integrated optics and other applications.

  11. Studies on bismuth carboxylates—synthesis and characterization of a new structural form of bismuth(III) dipicolinate

    Indian Academy of Sciences (India)

    O Anjaneyulu; K C Kumara Swamy


    Synthesis and X-ray structure of a new bismuth dipicolinate cooordination polymer, {[Bi((2,6-O2C)2C5H3N)((2-HO2C-6-O2C)C5H3N)(H2O)]2.5H2O} (7) are presented. Compound 7 has dimeric units with a Bi2O2 skeleton that are linked by additional weak Bi-O interactions leading to a polymeric structure. The overall coordination number at bismuth is 9 [two Bi-N and seven Bi-O bonds]. New routes to a second crystalline modification (4′) of the previously reported coordination polymer, bismuth tris(picolinate), [Bi(2-O2C-C5H4N)3] (4), are described; bond parameters in the two crystalline forms (4 and 4′) are compared. In both the compounds 4′ and 7, bismuth has a distorted tricapped trigonal prismatic geometry.

  12. 23 CFR 230.203 - Policy. (United States)


    ... 23 Highways 1 2010-04-01 2010-04-01 false Policy. 230.203 Section 230.203 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CIVIL RIGHTS EXTERNAL PROGRAMS Supportive Services for Minority... participation of minority business enterprises in Federal-aid highway contracts in part through the...

  13. 41 CFR 50-203.18 - Evidence. (United States)


    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Evidence. 50-203.18...-Healey Public Contracts Act § 50-203.18 Evidence. (a) Witnesses appearing at the hearing need not be... shall be tendered in quadruplicate. When evidence is embraced in a document containing matter...

  14. 48 CFR 570.203-2 - Competition. (United States)


    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Competition. 570.203-2... 570.203-2 Competition. (a) Solicit at least three sources to promote competition to the maximum extent..., document the file to explain the lack of competition....

  15. 41 CFR 50-203.11 - Review. (United States)


    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Review. 50-203.11 Section...-Healey Public Contracts Act § 50-203.11 Review. (a) Within twenty (20) days after service of the decision... administrative law judge an original and four copies of a petition for review of the decision. The petition...

  16. 5 CFR 250.203 - Agency responsibilities. (United States)


    ... 250.203 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERSONNEL MANAGEMENT IN AGENCIES Strategic Human Capital Management § 250.203 Agency responsibilities. (a) To assist in the assessment of the management of human capital in the Federal Government, and to help meet...

  17. 32 CFR 203.19 - Appeals process. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Appeals process. 203.19 Section 203.19 National....19 Appeals process. DoD Components will establish an appeals process to settle potential disputes... process. The Department of Defense recognizes that the RAB/TRC may disagree with the findings of...

  18. 32 CFR 203.5 - TAPP process. (United States)


    ... to follow the rules and regulations for purchase orders as outlined in the FAR (48 CFR part 13). As a... 32 National Defense 2 2010-07-01 2010-07-01 false TAPP process. 203.5 Section 203.5 National... TAPP process. This section provides an overview of the TAPP process. Specific details referred to...

  19. 14 CFR 1212.203 - Disclosures. (United States)


    ... Records § 1212.203 Disclosures. (a) The system manager shall keep a disclosure accounting for each... (2) In accordance with § 1212.203(g) (1) and (2), below. (c) The disclosure accounting required by...) The name and address of the recipient person or Agency. (d) The disclosure accounting shall...

  20. 40 CFR 86.203-94 - Abbreviations. (United States)


    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Abbreviations. 86.203-94 Section 86.203-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New...

  1. 24 CFR 945.203 - Allocation plan. (United States)


    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Allocation plan. 945.203 Section... FAMILIES Application and Approval Procedures § 945.203 Allocation plan. (a) Applicable terminology. (1) As used in this section, the terms “initial allocation plan” refers to the PHA's first submission of...

  2. 48 CFR 2944.203 - Consent limitations. (United States)


    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Consent limitations. 2944.203 Section 2944.203 Federal Acquisition Regulations System DEPARTMENT OF LABOR CONTRACT MANAGEMENT... rationale), signed by the contracting officer, and included in the contract file....

  3. 7 CFR 1260.203 - Confidential treatment. (United States)


    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Confidential treatment. 1260.203 Section 1260.203 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE BEEF PROMOTION AND RESEARCH...

  4. 14 CFR 67.203 - Eye. (United States)


    ... separately, with or without corrective lenses. If corrective lenses (spectacles or contact lenses) are... equivalent, at 16 inches in each eye separately, with or without corrective lenses. If age 50 or older, near... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Eye. 67.203 Section 67.203 Aeronautics...

  5. 24 CFR 203.34 - Credit standing. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Credit standing. 203.34 Section 203.34 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued....34 Credit standing. A mortgagor must have a general credit standing satisfactory to the Commissioner....

  6. 22 CFR 203.2 - Definitions. (United States)


    ... information may be accessed in the daily course of conducting business. (e) International Private Voluntary... Voluntary Organization (LPVO) means a non-U.S. based PVO that meets the definition of an International... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 203.2 Section 203.2...

  7. 27 CFR 24.203 - Honey wine. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Honey wine. 24.203 Section... THE TREASURY LIQUORS WINE Production of Agricultural Wine § 24.203 Honey wine. (a) Subject to paragraph (b) of this section, a winemaker, in the production of wine from honey, may add the following:...

  8. 5 CFR 844.203 - Supporting documentation. (United States)


    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Supporting documentation. 844.203 Section... § 844.203 Supporting documentation. (a) An individual or agency filing an application for disability... whatever documentation OPM requires in order to determine whether the individual meets the...

  9. 33 CFR 203.62 - Drought assistance. (United States)


    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Drought assistance. 203.62... Supplies: Contaminated Water Sources and Drought Assistance § 203.62 Drought assistance. (a) Authority. The... political subdivisions, within areas determined to be drought-distressed. (b) General policy. (1) It is...

  10. 40 CFR 600.203-77 - Abbreviations. (United States)


    ....203-77 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures for Calculating Fuel Economy Values § 600.203-77 Abbreviations....

  11. 41 CFR 50-203.8 - Hearing. (United States)


    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Hearing. 50-203.8 Section 50-203.8 Public Contracts and Property Management Other Provisions Relating to Public Contracts..., examine, and cross-examine witnesses and to introduce into the record documentary or other evidence....

  12. Bismuth nanoparticles for phenolic compounds biosensing application. (United States)

    Mayorga-Martinez, Carmen C; Cadevall, Miquel; Guix, Maria; Ros, Josep; Merkoçi, Arben


    The rapid determination of trace phenolic compounds is of great importance for evaluating the total toxicity of contaminated water samples. Nowadays, electrochemical tyrosinase (Tyr) based biosensors constitute a promising technology for the in situ monitoring of phenolic compounds because of their advantages such as high selectivity, low production cost, promising response speed, potential for miniaturization, simple instrumentation and easy automatization. A mediator-free amperometric biosensor for phenolic compounds detection based on the combination of bismuth nanoparticles (BiNPs) and Tyr for phenol detections will be hereby reported. This is achieved through the integration of BiNPs/Tyr onto the working electrode of a screen printed electrode (SPE) by using glutaraldehyde as a cross-linking agent. BiNPs/Tyr biosensor is evaluated by amperometric measurements at -200 mV DC and a linear range of up to 71 μM and 100 μM and a correlation coefficient of 0.995 and 0.996 for phenol and catechol, respectively. The very low DC working potential ensures the avoidance of interferences making this biosensor an advantageous device for real sample applications. In addition, the response mechanism including the effect of BiNPs based on electrochemical studies and optical characterizations will be also discussed. The obtained results may open the way to many other BiNPs applications in the biosensing field.

  13. Ultrasound in lead-bismuth eutectic

    Energy Technology Data Exchange (ETDEWEB)

    Dierckx, M.; Van Dyck, D. [SCK.CEN, Belgian Nuclear Research Centre, Boeretang 200, BE-2400, Mol (Belgium)


    The Belgian Nuclear Research Centre (SCK.CEN) is in the process of designing MYRRHA, a new multi-purpose irradiation facility to replace the ageing BR2. MYRRHA is a fast spectrum reactor cooled with lead-bismuth eutectic (LBE). As liquid metal is opaque to visual light, ultrasonic measurement techniques are selected to fulfill essential tasks that, according to our assessment, will be demanded by licensing authorities, in particular: fuel assembly identification and localization of a lost fuel assembly. To that end, a considerable research effort at SCK.CEN is devoted to study ultrasonic propagation in LBE. As ultrasonic experiments in LBE are elaborate and expensive to set up, we are particularly interested in to what extent experiments in water can be extrapolated to LBE - one of the main focuses of this article. We describe and present results of a first experiment with this goal which shows that the signal to noise ratio is better in LBE and that we even see small diffuse reflections up to 40 deg. off normal. On the other hand, we do not see internal reflections in stainless steel objects in LBE which we do in water. Therefore, we conclude that experiments in water can be used to validate algorithms for LBE on the condition that they do not rely on internal reflections. We also present solutions to tackle the essential tasks: fuel assembly identification and lost object localization. The requirements for the ultrasonic equipment implementing these solutions are also discussed. (authors)

  14. Laser Spectroscopy of Neutron Rich Bismuth Isotopes

    CERN Multimedia


    %IS344 :\\\\ \\\\ The aim of the experiment is to measure the optical isotope shifts and hyperfine structures of bismuth isotopes across the N=126 shell closure in order to extract the change in mean square charge radii ($\\delta\\langle r^{2}\\rangle$) and static moments. These include the first isotones of lead to be measured directly above the shell closure and will provide new information on the systematics of the kink ($\\delta\\langle r^{2}\\rangle)$ seen in the lead isotopic chain. After two very successful runs the programme has been extended to include the neutron deficient isotopes below $^{201}$Bi to study the systematics across the $i_{13/2}$ neutron sub-shell closure at N=118.\\\\ \\\\ During the initial 2 runs (9 shifts) the isotope shifts and hyperfine structures of three new isotopes, $ ^{210,212,213}$Bi and the 9$^{-}$ isomer of $^{210}$Bi have been measured. The accuracy of the previous measurements of $^{205,206,208}$Bi have been greatly improved. The samples of $ ^{208,210,210^{m}}$Bi were prepared by c...

  15. LMO dielectronic resonances in highly charged bismuth (United States)

    Smiga, Joseph; Gillaspy, John; Podpaly, Yuri; Ralchenko, Yuri


    Dielectronic resonances from high-Z elements are important for the analysis of high temperature plasmas. Thus, the extreme ultraviolet spectra of highly charged bismuth were measured using the NIST electron beam ion trap (EBIT) at beam energies ranging from 8.7 keV to 9.2 keV. The measured intensity ratios between forbidden magnetic-dipole lines in Bi64+ and Bi63+ show strong resonance features. The experimental data were compared to theoretical predictions from a large-scale collisional-radiative model with the code NOMAD, and good agreement was found that allowed the identification of observed resonance features as the LMO inner-shell dielectronic resonances. It is common practice in EBIT experiments that ions are periodically dumped from the trap and replaced. However, in this particular experiment, the contents of the trap were not dumped for the duration of each 10 minute sampling. The effects of trap stability were studied and a small but noticeable shift in beam energy over time was observed. Potential explanations for this are considered.

  16. Photoreductive generation of amorphous bismuth nanoparticles using polysaccharides--bismuth-cellulose nanocomposites. (United States)

    Breitwieser, Doris; Kriechbaum, Margit; Ehmann, Heike M A; Monkowius, Uwe; Coseri, Sergiu; Sacarescu, Liviu; Spirk, Stefan


    A simple and highly reproducible synthesis of amorphous bismuth nanoparticles incorporated into a polysaccharide matrix using a photoreduction process is presented. As precursor for the generation of the Bi nanoparticles, organosoluble triphenylbismuth is used. The precursor is dissolved in toluene and mixed with a hydrophobic organosoluble polysaccharide, namely trimethylsilyl cellulose (TMSC) with high DSSi. The solution is subjected to UV exposure, which induces the homolytic cleavage of the bismuth-carbon bond in BiPh3 resulting in the formation of Bi(0) and phenyl radicals. The aggregation of the Bi atoms can be controlled in the TMSC matrix and yields nanoparticles of around 20 nm size as proven by TEM. The phenyl radicals undergo recombination to form small organic molecules like benzene and biphenyl, which can be removed from the nanocomposite after lyophilization and exposure to high vacuum. Finally, the TMSC matrix is converted to cellulose after exposure to HCl vapors, which remove the trimethylsilyl groups from the TMSC derivative. Although TMSC is converted to cellulose, the formed TMS-OH is not leaving the nanocomposite but reacts instead with surface oxide layer of the Bi nanoparticles to form silylated Bi nanoparticles as proven by TEM/EDX.

  17. Characterization of bismuth nanospheres deposited by plasma focus device

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, M., E-mail: [IBA Laboratory, Chemistry Department, Atomic Energy Commission of Syria, P.O. Box 6091, Damascus (Syrian Arab Republic); Al-Hawat, Sh.; Akel, M. [Physics Department, Atomic Energy Commission of Syria, P.O. Box 6091, Damascus (Syrian Arab Republic); Mrad, O. [Chemistry Department, Atomic Energy Commission of Syria, P.O. Box 6091, Damascus (Syrian Arab Republic)


    A new method for producing thin layer of bismuth nanospheres based on the use of low energy plasma focus device is demonstrated. Various techniques such as scanning electron microscopy, Rutherford backscattering spectroscopy, X-ray diffraction, X-ray photoelectron spectroscopy, and Raman spectroscopy have been used to characterize the morphology and the composition of the nanospheres. Experimental parameters may be adjusted to favour the formation of bismuth nanospheres instead of microspheres. Therefore, the formation of large surface of homogeneous layer of bismuth nanospheres with sizes of below 100 nm can be obtained. The natural snowball phenomenon is observed to be reproduced in nanoscale where spheres roll over the small nanospheres and grow up to bigger sizes that can reach micro dimensions. The comet-like structure, a reverse phenomenon to snowball is also observed.

  18. Inexpensive laser-induced surface modification in bismuth thin films

    International Nuclear Information System (INIS)

    Highlights: • Laser-induced microbumps were formed on bismuth films using a simple, low-cost, laser setup. • The patterns, similar to those typically obtained with high-power lasers, were characterized. • Control of laser ablation conditions is critical in the fabrication of surface microbumps. - Abstract: In this work, we present results on texturing a 500 nm thick bismuth film, deposited by sputtering onto a glass slide using a low-cost homemade, near-infrared pulsed laser platform. A 785 nm laser diode of a CD–DVD pickup head was precisely focused on the sample mounted on a motorized two-axis translation stage to generate localized surface microbumps on the bismuth films. This simple method successfully transferred desired micropatterns on the films in a computer-numerical control fashion. Irradiated zones were characterized by atomic force microscopy and scanning electron microscopy. It was observed that final results are strongly dependent on irradiation parameters

  19. Thermal, structural and electrical studies of bismuth zinc borate glasses (United States)

    Shanmugavelu, B.; Ravi Kanth Kumar, V. V.


    Bismuth Zinc Borate glasses with compositions xBi2O3-30ZnO-(70 - x)B2O3 (where x = 30, 35, 40 and 45 mol %) have been prepared by melt quenching method. These glasses were characterized by X-ray diffraction (XRD), Differential Thermal Analysis (DTA), Fourier Transform Infrared Spectrometer (FTIR) and Broad Band Dielectric Spectrometer (BDS). DTA and FTIR analysis reveals that Non-Bridging Oxygens (NBOs) increase with increase of bismuth content in the glass. Electrical data have been analyzed in the framework of impedance and modulus formalisms. The activation energy for dc conductivity decreases with increase of bismuth concentration. The imaginary part of modulus spectra has been fitted to non-exponential Kohlrausch-Williams-Watts (KWW) function and the value of the stretched exponent (β) is found to be almost independent of temperature but slightly dependent on composition.

  20. Phase transitions in the Hubbard model for the bismuth nickelate (United States)

    Kojima, Shoya; Nasu, Joji; Koga, Akihisa


    We study low temperature properties of the Hubbard model for the bismuth nickelate, where degenerate orbitals in the nickel ions and a single orbital in the bismuth ions are taken into account, combining dynamical mean-field theory with the continuous-time quantum Monte Carlo method. We discuss the effect of the attractive interactions to mimic the valence skipping phenomenon in the bismuth ions. We demonstrate how the charge and magnetically ordered states are stable against thermal fluctuations. It is furthermore clarified that the ferromagnetically ordered and orbital ordered states are stabilized due to the presence of the orbital degeneracy at low temperatures. The crossover between metallic and insulating states is also discussed.

  1. Inexpensive laser-induced surface modification in bismuth thin films

    Energy Technology Data Exchange (ETDEWEB)

    Contreras, A. Reyes [Facultad de Ciencias, Universidad Autónoma del Estado de México, Carretera Toluca, Ixtlahuaca Kilómetro 15.5, C.P. 50200 Edo. de México (Mexico); Hautefeuille, M., E-mail: [Facultad de Ciencias, Universidad Nacional Autónoma de México, Avenida Universidad 3000, Circuito Exterior S/N, Coyoacán, Ciudad Universitaria, C.P. 04510 D.F. Mexico (Mexico); García, A. Esparza [Fotofísica y Películas Delgadas, Departamento de Tecnociencias, CCADET-UNAM, Circuito exterior s/n C.P. 04510 Cd. Universitaria, D.F. Mexico (Mexico); Mejia, O. Olea [Centro Conjunto de Investigación en Química Sustentable UAEM-UNAM, Carretera Toluca-Atlacomulco, Km 14.5, Unidad El Rosedal, 50200 San Cayetano, Estado de México (Mexico); López, M.A. Camacho [Facultad de Química, Universidad Autónoma del Estado de México, Tollocan s/n, esq. Paseo Colón, Toluca, Estado de México 50110 (Mexico)


    Highlights: • Laser-induced microbumps were formed on bismuth films using a simple, low-cost, laser setup. • The patterns, similar to those typically obtained with high-power lasers, were characterized. • Control of laser ablation conditions is critical in the fabrication of surface microbumps. - Abstract: In this work, we present results on texturing a 500 nm thick bismuth film, deposited by sputtering onto a glass slide using a low-cost homemade, near-infrared pulsed laser platform. A 785 nm laser diode of a CD–DVD pickup head was precisely focused on the sample mounted on a motorized two-axis translation stage to generate localized surface microbumps on the bismuth films. This simple method successfully transferred desired micropatterns on the films in a computer-numerical control fashion. Irradiated zones were characterized by atomic force microscopy and scanning electron microscopy. It was observed that final results are strongly dependent on irradiation parameters.

  2. Dependence of optical properties of calcium bismuthates on synthesis conditions (United States)

    Shtarev, D. S.; Shtareva, A. V.


    The article studies optical properties of calcium bismuthate nanoparticles of different composition. For the first time the synthesis of these compounds was produced by the pyrolysis of organic precursors using an organic solvent. Characterization of particles was made by scanning electron microscopy and X-ray analysis. The optical properties were investigated by diffuse reflectance spectroscopy (DRS). It is shown that the type of crystal lattice of the particles of calcium bismuthate determines the possibility to control the optical properties of nanoparticles by varying their composition. The conclusions about the production process and the composition of calcium bismuthate, the most promising for use as a photocatalyst of visible light and solar cells, were made.

  3. Compact and Integrated Liquid Bismuth Propellant Feed System (United States)

    Polzin, Kurt A.; Stanojev, Boris; Korman, Valentin; Gross, Jeffrey T.


    Operation of Hall thrusters with bismuth propellant has been shown to be a promising path toward high-power, high-performance, long-lifetime electric propulsion for spaceflight missions [1]. There has been considerable effort in the past three years aimed at resuscitating this promising technology and validating earlier experimental results indicating the advantages of a bismuth-fed Hall thruster. A critical element of the present effort is the precise metering of propellant to the thruster, since performance cannot be accurately assessed without an accurate accounting of mass flow rate. Earlier work used a pre./post-test propellant weighing scheme that did not provide any real-time measurement of mass flow rate while the thruster was firing, and makes subsequent performance calculations difficult. The motivation of the present work is to develop a precision liquid bismuth Propellant Management System (PMS) that provides hot, molten bismuth to the thruster while simultaneously monitoring in real-time the propellant mass flow rate. The system is a derivative of our previous propellant feed system [2], but the present system represents a more compact design. In addition, all control electronics are integrated into a single unit and designed to reside on a thrust stand and operate in the relevant vacuum environment where the thruster is operating, significantly increasing the present technology readiness level of liquid metal propellant feed systems. The design of various critical components in a bismuth PMS are described. These include the bismuth reservoir and pressurization system, 'hotspot' flow sensor, power system and integrated control system. Particular emphasis is given to selection of the electronics employed in this system and the methods that were used to isolate the power and control systems from the high-temperature portions of the feed system and thruster. Open loop calibration test results from the 'hotspot' flow sensor are reported, and results of

  4. Electrical and optical properties of gadolinium doped bismuth ferrite nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Mukherjee, A., E-mail:; Banerjee, M., E-mail:; Basu, S., E-mail: [Department of Physics, National Institute of Technology, Durgapur-713209 (India); Pal, M. [CSIR-Central Mechanical Engineering Research Institute, Durgapur-713209 (India)


    Multiferroic bismuth ferrite (BFO) and gadolinium (Gd) doped bismuth ferrite had been synthesized by a sol-gel method. Particle size had been estimated by Transmission electron microscopy (TEM) and found to decrease with Gd doping. We studied the temperature and frequency dependence of impedance and electric modulus and calculated the grain and grain boundary resistance and capacitance of the investigated samples. We observed that electrical activation energy increases for all the doped samples. Optical band gap also increases for the doped samples which can be used in photocatalytic application of BFO.

  5. Lead–bismuth eutectic technology for Hyperion reactor

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, J., E-mail: [Dept. of Mechanical and Aerospace Engineering, The Ohio State University, 201 W, 19th Avenue, Columbus, OH 43210 (United States); Nuclear Engineering and Nonproliferation Division, Los Alamos National Laboratory, Los Alamos, NM 87544 (United States); Kapernick, R.J.; McClure, P.R. [Nuclear Engineering and Nonproliferation Division, Los Alamos National Laboratory, Los Alamos, NM 87544 (United States); Trapp, T.J. [Hyperion Power Generation (United States)


    A small lead–bismuth eutectic-cooled reactor concept (referred to as the Hyperion reactor concept) is being studied at Los Alamos National Laboratory and Hyperion Power Generation. In this report, a critical assessment of the lead–bismuth eutectic technology for Hyperion reactor is presented based on currently available knowledge. Included are: material compatibility, oxygen control, thermal hydraulics, polonium control. The key advances in the technology and their applications to Hyperion reactor design are analyzed. Also, the near future studies in main areas of the technology are recommended for meeting the design requirements.

  6. High-Q bismuth silicate nonlinear glass microsphere resonators


    Wang, Pengfei; Murugan, Ganapathy; Lee, Timothy; Ding, Ming; Brambilla, Gilberto; Semenova, Yuliya; Wu, Qiang; Koizumi,Fumihito; Farrell, Gerald


    The fabrication and characterization of a bismuth-silicate glass microsphere resonator has been demonstrated. At wavelengths near 1550 nm, high-modes can be efficiently excited in a 179-μm diameter bismuth-silicate glass microsphere via evanescent coupling using a tapered silica fiber with a waist diameter of circa 2 μm. Resonances with Q-factors as high as were observed. The dependence of the spectral response on variations in the input power level was studied in detail to gain an insight in...

  7. Polymeric architectures of bismuth citrate based on dimeric building blocks

    Institute of Scientific and Technical Information of China (English)


    Four bismuth complexes, (H2En)[Bi2(cit)2(H2O)4/3]·(H2O)x (1), (H2En)3[Bi2(cit)2Cl4]·(H2O)x (2), (HPy)2[Bi2(cit)2(H2O)8/5]·(H2O)x (3) and (H2En)[Bi2(cit)2](H2O)x (4) [cit = citrate4-; En = ethylenediamine; Py = pyridine] have been synthesized and crystallized. The crystal structures reveal that the basic building blocks in all of these complexes are bismuth citrate dimeric units which combine to form polymeric architectures. The embedded protonated ethylenediamine and pyridine moieties in the polymeric frameworks have been identified by X-ray crystallography and solid-state cross polarization/magic angle spinning (CP/MAS) 13C NMR. Based on the framework of complex 1, a structural model of a clinically used antiulcer drug, ranitidine bismuth citrate (RBC) was generated. The behavior of the protonated amine-bismuth citrate complexes in acidic aqueous solution has been studied by electrospray ionization-mass spectrometry (ESI-MS).

  8. Highly monodisperse bismuth nanoparticles and their three-dimensional superlattices. (United States)

    Yarema, Maksym; Kovalenko, Maksym V; Hesser, Günter; Talapin, Dmitri V; Heiss, Wolfgang


    A simple and reproducible synthesis of highly monodisperse and ligand-protected bismuth nanoparticles (Bi NPs) is reported. The size of the single-crystalline and spherically shaped NPs is controlled between 11 and 22 nm mainly by the reaction temperature. The high uniformity of the NPs allows their self-assembly into long-range-ordered two- and three-dimensional superstructures.

  9. Phase transition of bismuth telluride thin films grown by MBE

    DEFF Research Database (Denmark)

    Fülöp, Attila; Song, Yuxin; Charpentier, Sophie;


    A previously unreported phase transition between Bi2Te3 and Bi4Te3 in bismuth telluride grown by molecular beam epitaxy is recorded via XRD, AFM, and SIMS observations. This transition is found to be related to the Te/Bi beam equivalent pressure (BEP) ratio. BEP ratios below 17 favor the formatio...

  10. Bismuth Ferrite for Active Control of Surface Plasmon Polariton Modes

    DEFF Research Database (Denmark)

    Babicheva, Viktoriia; Zhukovsky, Sergei; Lavrinenko, Andrei


    We propose and investigate several layouts of m etal-insulator-metal waveguide with active core which can be utilized for dynamic switching in photonic integrated circuits. The active material, bismuth ferrite (BiFeO3), is sandwiched between metal plates and changes i ts refractive index through...

  11. Third order nonlinear optical properties of bismuth zinc borate glasses

    International Nuclear Information System (INIS)

    Third order nonlinear optical characterization of bismuth zinc borate glasses are reported here using different laser pulse durations. Bismuth zinc borate glasses with compositions xBi2O3-30ZnO-(70-x) B2O3 (where x = 30, 35, 40, and 45 mol. %) have been prepared by melt quenching method. These glasses were characterized by Raman, UV-Vis absorption, and Z scan measurements. Raman and UV-Vis spectroscopic results indicate that non-bridging oxygens increase with increase of bismuth content in the glass. Nonlinear absorption and refraction behavior in the nanosecond (ns), picosecond (ps), and femtosecond (fs) time domains were studied in detail. Strong reverse saturable absorption due to dominant two-photon absorption (TPA) was observed with both ps and fs excitations. In the case of ns pulse excitations, TPA and free-carrier absorption processes contribute for the nonlinear absorption. Two-photon absorption coefficient (β) and the absorption cross section due to free carriers (σe) are estimated by theoretical fit of the open aperture Z-scan measurements and found to be dependent on the amount of bismuth oxide in the glass composition. In both ns and fs regimes the sign and magnitude of the third order nonlinearity are evaluated, and the optical limiting characteristics are also reported

  12. Third order nonlinear optical properties of bismuth zinc borate glasses (United States)

    Shanmugavelu, B.; Ravi Kanth Kumar, V. V.; Kuladeep, R.; Narayana Rao, D.


    Third order nonlinear optical characterization of bismuth zinc borate glasses are reported here using different laser pulse durations. Bismuth zinc borate glasses with compositions xBi2O3-30ZnO-(70-x) B2O3 (where x = 30, 35, 40, and 45 mol. %) have been prepared by melt quenching method. These glasses were characterized by Raman, UV-Vis absorption, and Z scan measurements. Raman and UV-Vis spectroscopic results indicate that non-bridging oxygens increase with increase of bismuth content in the glass. Nonlinear absorption and refraction behavior in the nanosecond (ns), picosecond (ps), and femtosecond (fs) time domains were studied in detail. Strong reverse saturable absorption due to dominant two-photon absorption (TPA) was observed with both ps and fs excitations. In the case of ns pulse excitations, TPA and free-carrier absorption processes contribute for the nonlinear absorption. Two-photon absorption coefficient (β) and the absorption cross section due to free carriers (σe) are estimated by theoretical fit of the open aperture Z-scan measurements and found to be dependent on the amount of bismuth oxide in the glass composition. In both ns and fs regimes the sign and magnitude of the third order nonlinearity are evaluated, and the optical limiting characteristics are also reported.

  13. Third order nonlinear optical properties of bismuth zinc borate glasses

    Energy Technology Data Exchange (ETDEWEB)

    Shanmugavelu, B.; Ravi Kanth Kumar, V. V., E-mail: [Department of Physics, Pondicherry University, Puducherry 605 014 (India); Kuladeep, R.; Narayana Rao, D. [School of Physics, University of Hyderabad, Hyderabad 500046, Andhra Pradesh (India)


    Third order nonlinear optical characterization of bismuth zinc borate glasses are reported here using different laser pulse durations. Bismuth zinc borate glasses with compositions xBi{sub 2}O{sub 3}-30ZnO-(70-x) B{sub 2}O{sub 3} (where x = 30, 35, 40, and 45 mol. %) have been prepared by melt quenching method. These glasses were characterized by Raman, UV-Vis absorption, and Z scan measurements. Raman and UV-Vis spectroscopic results indicate that non-bridging oxygens increase with increase of bismuth content in the glass. Nonlinear absorption and refraction behavior in the nanosecond (ns), picosecond (ps), and femtosecond (fs) time domains were studied in detail. Strong reverse saturable absorption due to dominant two-photon absorption (TPA) was observed with both ps and fs excitations. In the case of ns pulse excitations, TPA and free-carrier absorption processes contribute for the nonlinear absorption. Two-photon absorption coefficient (β) and the absorption cross section due to free carriers (σ{sub e}) are estimated by theoretical fit of the open aperture Z-scan measurements and found to be dependent on the amount of bismuth oxide in the glass composition. In both ns and fs regimes the sign and magnitude of the third order nonlinearity are evaluated, and the optical limiting characteristics are also reported.

  14. Light-Induced Absorption in Nominally Pure Bismuth Silicon Oxide

    Institute of Scientific and Technical Information of China (English)

    李飞飞; 许京军; 孔勇发; 黄辉; 张光寅; 杨春晖; 徐玉恒


    Light-induced absorption in the nominally pure bismuth silicon oxide is investigated experimentally and the result shows that it consists of transient and persistent parts. The experimental evidence is analysed based on the model of three groups of trap (donor) centres.

  15. Experimenting with lead-bismuth technology in Belgium

    Energy Technology Data Exchange (ETDEWEB)

    Mitev, Lubomir [NucNet, Brussels (Belgium)


    Dr Hamid Ait Abderrahim, director of the Myrrha research reactor project, talks to NucNet about the technical specifications, the challenges, opportunities and partnerships of Belgium's new nuclear research infrastructure. Myrrha is a large research infrastructure which is based on a sub-critical reactor which is cooled with lead-bismuth as a coolant. (orig.)

  16. Ultrafast electronic dynamics in laser-excited crystalline bismuth

    Directory of Open Access Journals (Sweden)

    Chekalin S.


    Full Text Available Femtosecond spectroscopy was applied to capture complex dynamics of non equilibrium electrons in bismuth. Data analysis reveals significant wavevector dependence of electron-hole and electron-phonon coupling strength along the Γ-T direction of the Brillouin zone

  17. Measured and evaluated neutron cross sections of elemental bismuth

    International Nuclear Information System (INIS)

    Neutron total cross sections of elemental bismuth are measured with broad resolution from 1.2 to 4.5 MeV to accuracies of approx. = 1%. Neutron-differential-elastic-scattering cross sections of bismuth are measured from 1.5 to 4.0 MeV at incident neutron energy intervals of approx.< 0.2 MeV over the scattered-neutron angular range approx. = 20 to 160 deg. Differential neutron cross sections for the excitation of observed states in bismuth at 895 +- 12, 1606 +- 14, 2590 +- 15, 2762 +- 29, 3022 +- 21, and 3144 +- 15 keV are determined at incident neutron energies up to 4.0 MeV. An optical-statistical model is deduced from the measured values. This model, the present experimental results, and information available elsewhere in the literature are used to construct a comprehensive evaluated nuclear data file for elemental bismuth in the ENDF format. The evaluated file is particularly suited to the neutronic needs of the fusion-fission hybrid designer. 87 references, 10 figures, 6 tables

  18. Discovery of the thallium, lead, bismuth, and polonium isotopes


    Fry, C; Thoennessen, M


    Currently, forty-two thallium, forty-two lead, forty-one bismuth, and forty-two polonium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  19. Ultrafast electron diffraction studies of optically excited thin bismuth films

    Energy Technology Data Exchange (ETDEWEB)

    Rajkovic, Ivan


    This thesis contains work on the design and the realization of an experimental setup capable of providing sub-picosecond electron pulses for ultrafast electron diffraction experiments, and performing the study of ultrafast dynamics in bismuth after optical excitation using this setup. (orig.)

  20. Bismuth-based oxide semiconductors: Mild synthesis and practical applications (United States)

    Timmaji, Hari Krishna

    In this dissertation study, bismuth based oxide semiconductors were prepared using 'mild' synthesis techniques---electrodeposition and solution combustion synthesis. Potential environmental remediation and solar energy applications of the prepared oxides were evaluated. Bismuth vanadate (BiVO4) was prepared by electrodeposition and solution combustion synthesis. A two step electrosynthesis strategy was developed and demonstrated for the first time. In the first step, a Bi film was first electrodeposited on a Pt substrate from an acidic BiCl3 medium. Then, this film was anodically stripped in a medium containing hydrolyzed vanadium precursor, to generate Bi3+, and subsequent BiVO4 formation by in situ precipitation. The photoelectrochemical data were consistent with the in situ formation of n-type semiconductor films. In the solution combustion synthesis procedure, BiVO4 powders were prepared using bismuth nitrate pentahydrate as the bismuth precursor and either vanadium chloride or vanadium oxysulfate as the vanadium precursor. Urea, glycine, or citric acid was used as the fuel. The effect of the vanadium precursor on the photocatalytic activity of combustion synthesized BiVO 4 was evaluated in this study. Methyl orange was used as a probe to test the photocatalytic attributes of the combustion synthesized (CS) samples, and benchmarked against a commercial bismuth vanadate sample. The CS samples showed superior activity to the commercial benchmark sample, and samples derived from vanadium chloride were superior to vanadium oxysulfate counterparts. The photoelectrochemical properties of the various CS samples were also studied and these samples were shown to be useful both for environmental photocatalytic remediation and water photooxidation applications. Silver bismuth tungstate (AgBiW2O8) nanoparticles were prepared for the first time by solution combustion synthesis by using silver nitrate, bismuth nitrate, sodium tungstate as precursors for Ag, Bi, and W

  1. Bismuth tri-iodide radiation detector development (United States)

    Gokhale, Sasmit S.

    Bismuth tri-iodide is an attractive material for room temperature radiation detection. BiI3 demonstrates a number of properties that are apt for semiconductor radiation detection, especially gamma ray spectroscopy. The high atomic number (ZBi = 83 and ZI = 53) and the relatively high density (5.78 g/cm3) cause the material to have good photon stopping power, while the large band-gap (1.67 eV ) allows it to function as a room temperature radiation detector without any cooling mechanism. This work presents the fabrication and characterization of BiI3 radiation detectors. For the purpose of this research detectors were fabricated by cutting BiI3 crystal boules, followed by mechanical and chemical surface treatments. Detectors with various electrode geometries enabling single polarity charge sensing were fabricated. The electrical characteristics and the radiation response of the detectors were measured. The radiation response measurement was performed at room temperature using a 241Am alpha particle source and a 241Am sealed gamma-ray source. The spectral resolutions of the detectors varied from 2.09% - 6.1% for 59.5 keV gamma-rays and between 26% - 40% for 5.48 MeV alpha particles. Charge carrier properties such as the electron and hole mobility and lifetime were also estimated. The electron mobility for an ultrapure BiI 3 detector was estimated to be approximately 433 cm 2/Vs while that for antimony doped BiI3 was estimated to be around 956 cm2/Vs and the mobility-lifetime product for electrons was estimated to be around 5.44 x 10-4 cm 2/V. Detector simulation was performed using the Monte Carlo simulation code MCNP5. A Matlab script which incorporates charge carrier trapping and statistical variation was written to generate a gamma-ray spectrum from the simulated energy deposition spectra. Measured and simulated spectra were compared to extract the charge carrier mobility-lifetime products, which for electrons and holes were estimated to be 5 x 10-3 cm2/V and 1.3 x

  2. Determining the background levels of bismuth in tissues of wild game birds: a first step in addressing the environmental consequences of using bismuth shotshells

    Energy Technology Data Exchange (ETDEWEB)

    Jayasinghe, R.; Tsuji, L.J.S.; Gough, W.A.; Karagatzides, J.D.; Perera, D.; Nieboer, E


    Bismuth shotshells have been approved as a 'nontoxic' alternative to lead in North America. Approval was based on a limited number of studies; even background levels of bismuth in wildfowl were unknown. We report on the concentration of bismuth (and lead) in muscle and liver tissues of wildfowl (Anas platyrhynchos, Anas acuta, Anas crecca, Branta canadensis, Chen caerulescens) harvested with lead shotshell. Average liver-bismuth levels detected in the present study (e.g., teal, 0.05 {mu}g/g dw; mallard, 0.09 {mu}g/g dw) suggest analytical error in other studies examining the effects of bismuth in birds. Significant positive relationships between bismuth- and lead-tissue levels for muscle when all species were combined (and for B. canadensis and C. caerulescens separately) can be explained by noting that bismuth is a contaminant of lead. Thus, more research is recommended to confirm the appropriateness of bismuth as a 'nontoxic' shot alternative.

  3. 48 CFR 828.203 - Acceptability of individual sureties. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Acceptability of individual sureties. 828.203 Section 828.203 Federal Acquisition Regulations System DEPARTMENT OF VETERANS... Acceptability of individual sureties....

  4. Dicty_cDB: CHS203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHS203 (Link to dictyBase) - - - Contig-U11332-1 - (Link to Or...iginal site) - - CHS203Z 727 - - - - Show CHS203 Library CH (Link to library) Clone ID CHS203 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11332-1 Original site URL http://dictycdb.b...LSYDILSLLDS HLWLKKPLTISPQFLTMIGPELDPTLPNNPFKEFFNKLGTSSHDSGDNIDFKIPSFFEDN SRRHWGVETELSTGSCPICTLSLAENPESSFLGST...SYDILSLLDS HLWLKKPLTISPQFLTMIGPELDPTLPNNPFKEFFNKLGTSSHDSGDNIDFKIPSFFEDN SRRHWGVETELSTGSCPICTLSLAENPESSFLGSTP

  5. Bismuth nitrate-induced microwave-assisted expeditious synthesis of vanillin from curcumin


    Bandyopadhyay, Debasish; Banik, Bimal K


    Background Curcumin and vanillin are the two useful compounds in food and medicine. Bismuth nitrate pentahydrate is an economical and ecofriendly reagent. Method Bismuth nitrate pentahydrate impregnated montmorillonite KSF clay and curcumin were subjected to microwave irradiation. Results Microwave-induced bismuth nitrate-promoted synthesis of vanillin from curcumin has been accomplished in good yield under solvent-free condition. Twenty-five different reaction conditions have been studied to...

  6. Standard triple, bismuth pectin quadruple and sequential therapies for Helicobacter pylori eradication

    Institute of Scientific and Technical Information of China (English)


    AIM: To compare the effectiveness of standard triple, bismuth pectin quadruple and sequential therapies for Helicobacter pylori (H. pylori ) eradication in a randomized, double-blinded, comparative clinical trial in China. METHODS: A total of 215 H. pylori -positive patients were enrolled in the study and randomly allocated into three groups: group A (n = 72) received a 10-d bismuth pectin quadruple therapy (20 mg rabeprazole bid , 1000 mg amoxicillin bid , 100 mg bismuth pectin qid , and 500 mg levofloxaci...

  7. 5 CFR 2601.203 - Conflict of interest analysis. (United States)


    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Conflict of interest analysis. 2601.203 Section 2601.203 Administrative Personnel OFFICE OF GOVERNMENT ETHICS ORGANIZATION AND PROCEDURES... Acceptance of Gifts § 2601.203 Conflict of interest analysis. (a) A gift shall not be solicited or...

  8. 24 CFR 203.37 - Nature of title to realty. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Nature of title to realty. 203.37 Section 203.37 Housing and Urban Development Regulations Relating to Housing and Urban Development... § 203.37 Nature of title to realty. A mortgage, to be eligible for insurance, must be on real...

  9. 48 CFR 1815.203-72 - Risk management. (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Risk management. 1815.203-72 Section 1815.203-72 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND SPACE... Proposals and Information 1815.203-72 Risk management. In all RFPs and RFOs for supplies or services...

  10. 9 CFR 113.203 - Feline Panleukopenia Vaccine, Killed Virus. (United States)


    ... Virus. 113.203 Section 113.203 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.203 Feline Panleukopenia Vaccine, Killed Virus. Feline...

  11. 24 CFR 203.18a - Solar energy system. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Solar energy system. 203.18a... § 203.18a Solar energy system. (a) The dollar limitation provided in § 203.18(a) may be increased by up... to the installation of a solar energy system. (b) Solar energy system is defined as any...

  12. 24 CFR 203.261 - Calculation of periodic MIP. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Calculation of periodic MIP. 203.261 Section 203.261 Housing and Urban Development Regulations Relating to Housing and Urban...-Periodic Payment § 203.261 Calculation of periodic MIP. The amount of any periodic MIP shall be...

  13. 48 CFR 9.203 - QPL's, QML's, and QBL's. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false QPL's, QML's, and QBL's. 9.203 Section 9.203 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION ACQUISITION PLANNING CONTRACTOR QUALIFICATIONS Qualifications Requirements 9.203 QPL's, QML's, and QBL's....

  14. 5 CFR 2610.203 - Documentation of fees and expenses. (United States)


    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Documentation of fees and expenses. 2610.203 Section 2610.203 Administrative Personnel OFFICE OF GOVERNMENT ETHICS ORGANIZATION AND PROCEDURES IMPLEMENTATION OF THE EQUAL ACCESS TO JUSTICE ACT Information Required From Applicants § 2610.203...

  15. 31 CFR 203.10 - Electronic payment methods. (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Electronic payment methods. 203.10 Section 203.10 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... TAX AND LOAN PROGRAM Electronic Federal Tax Payments § 203.10 Electronic payment methods. (a)...

  16. 31 CFR 203.9 - Scope of the subpart. (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Scope of the subpart. 203.9 Section 203.9 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE... LOAN PROGRAM Electronic Federal Tax Payments § 203.9 Scope of the subpart. This subpart prescribes...

  17. 31 CFR 203.12 - EFTPS interest assessments. (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false EFTPS interest assessments. 203.12 Section 203.12 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... TAX AND LOAN PROGRAM Electronic Federal Tax Payments § 203.12 EFTPS interest assessments....

  18. 31 CFR 203.13 - Appeal and dispute resolution. (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Appeal and dispute resolution. 203.13 Section 203.13 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... TAX AND LOAN PROGRAM Electronic Federal Tax Payments § 203.13 Appeal and dispute resolution....

  19. 48 CFR 1336.203 - Government estimate of construction costs. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Government estimate of construction costs. 1336.203 Section 1336.203 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE... Contracting for Construction 1336.203 Government estimate of construction costs. After award, the...

  20. 24 CFR 203.259 - Method of payment of MIP. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Method of payment of MIP. 203.259 Section 203.259 Housing and Urban Development Regulations Relating to Housing and Urban Development... § 203.259 Method of payment of MIP. The payment of any MIP under this subpart shall be made to...

  1. 32 CFR 203.15 - Method of payment. (United States)


    ... ACTIVITIES § 203.15 Method of payment. The SAP set forth in FAR (48 CFR part 13) require purchase orders to... 32 National Defense 2 2010-07-01 2010-07-01 false Method of payment. 203.15 Section 203.15 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE...

  2. Influence of bismuth on structural, elastic and spectroscopic properties of Nd{sup 3+} doped Zinc–Boro-Bismuthate glasses

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, Gaurav; Sontakke, Atul D.; Karmakar, P.; Biswas, K.; Balaji, S.; Saha, R.; Sen, R.; Annapurna, K., E-mail:


    The present investigation reports, influence of bismuth addition on structural, elastic and spectral properties of [(99.5−x) {4ZnO−3B_2O_3}−0.5Nd{sub 2}O{sub 3}−x Bi{sub 2}O{sub 3} where x=0, 5, 10, 20, 30, 40, 50 and 60] glasses. The measured FTIR reflectance spectra facilitated a thorough insight of methodical modifications that are arising in the glass structure from borate (build by BO{sub 3} and BO{sub 4} units) to bismuthate (BiO{sub 3} and BiO{sub 6} units) network due to the increase of bismuth content ensuing with a steady decrease in host phonon energy (ν{sub ph}). The elastic properties estimated from measured longitudinal and shear ultrasonic velocities (U{sub L} and U{sub s}) demonstrated the reduction in network rigidity of glasses on Bi{sub 2}O{sub 3} inclusion. The three phenomenological Judd–Ofelt intensity parameters (Ω{sub 2,4,6}) were obtained from recorded absorption spectra of Nd{sup 3+} ions in these glasses and have been used to predict radiative properties as a function of variation in bismuth content. The reduced host phonon energy and high optical basicity effect due to Bi{sub 2}O{sub 3} incorporation remarkably improved the Nd{sup 3+} luminescence properties such as emission intensity, quantum yield and emission cross-section. The quantum yield showed a strong increase from mere 16% in Zinc–Borate glass to almost 73% in 60 mol% Bi{sub 2}O{sub 3} containing glass. Similarly, the emission cross-section for Nd{sup 3+4}F{sub 3/2}→{sup 4}I{sub 11/2} laser transition raised from 2.43×10{sup −20} cm{sup 2} to 3.95×10{sup −20} cm{sup 2} in studied concentration suggesting a strong improvement in Nd{sup 3+} laser spectroscopic properties in Zinc–Boro-Bismuthate glass. These materials may be promising for compact solid state infrared lasers. - Highlights: • Continuous structural changes associated with reduction in host phonon energy by Bi{sub 2}O{sub 3} inclusion. • Ultrasonic velocity study revealed reduced Debye

  3. Influence of bismuth on structural, elastic and spectroscopic properties of Nd3+ doped Zinc–Boro-Bismuthate glasses

    International Nuclear Information System (INIS)

    The present investigation reports, influence of bismuth addition on structural, elastic and spectral properties of [(99.5−x) {4ZnO−3B2O3}−0.5Nd2O3−x Bi2O3 where x=0, 5, 10, 20, 30, 40, 50 and 60] glasses. The measured FTIR reflectance spectra facilitated a thorough insight of methodical modifications that are arising in the glass structure from borate (build by BO3 and BO4 units) to bismuthate (BiO3 and BiO6 units) network due to the increase of bismuth content ensuing with a steady decrease in host phonon energy (νph). The elastic properties estimated from measured longitudinal and shear ultrasonic velocities (UL and Us) demonstrated the reduction in network rigidity of glasses on Bi2O3 inclusion. The three phenomenological Judd–Ofelt intensity parameters (Ω2,4,6) were obtained from recorded absorption spectra of Nd3+ ions in these glasses and have been used to predict radiative properties as a function of variation in bismuth content. The reduced host phonon energy and high optical basicity effect due to Bi2O3 incorporation remarkably improved the Nd3+ luminescence properties such as emission intensity, quantum yield and emission cross-section. The quantum yield showed a strong increase from mere 16% in Zinc–Borate glass to almost 73% in 60 mol% Bi2O3 containing glass. Similarly, the emission cross-section for Nd3+4F3/2→4I11/2 laser transition raised from 2.43×10−20 cm2 to 3.95×10−20 cm2 in studied concentration suggesting a strong improvement in Nd3+ laser spectroscopic properties in Zinc–Boro-Bismuthate glass. These materials may be promising for compact solid state infrared lasers. - Highlights: • Continuous structural changes associated with reduction in host phonon energy by Bi2O3 inclusion. • Ultrasonic velocity study revealed reduced Debye temperature and elastic properties with bismuth addition. • Correlation of Judd–Ofelt parameters with structural modifications. • Realization of enhanced fluorescence quantum yield with

  4. Effects of microwave sintering power on microstructure, dielectric, ferroelectric and magnetic properties of bismuth ferrite ceramics

    International Nuclear Information System (INIS)

    Highlights: ► Single-phase BFO ceramics have been prepared by microwave sintering. ► The lower sintering power is benefit for the decrease of its dielectric loss and leakage. ► Pr and Ec decrease with the increase of sintering power. ► Mr and Hc increase as sintering power increases. -- Abstract: Multiferroic bismuth ferrite ceramics were fabricated via microwave sintering. The microstructure, dielectric, ferroelectric and magnetic properties of bismuth ferrite ceramics sintered at different microwave powers are characterized by X-ray diffraction, scanning electron microscope, impedance analyzers, ferroelectric test system and vibrating sample magnetometer. Bismuth ferrite ceramics sintered at 3.4 kW is single phase and has dense structure and uniform grains. The lower microwave sintering power for bismuth ferrite ceramics is benefit for the decrease of its dielectric loss. The remnant polarization and coercive electric field of bismuth ferrite ceramics decrease with the increasing of microwave sintering power. The remnant polarization and the coercive electric field of bismuth ferrite ceramics decrease simultaneously as frequency increases. The leakage current of bismuth ferrite ceramics increases with the increase of microwave sintering power. Bismuth ferrite ceramics prepared by microwave sintering exhibit typical antiferromagnetic behaviors and the remnant magnetization and coercive magnetic field increase as the microwave sintering power increases. It is inferred that the optimum microwave sintering power for bismuth ferrite ceramics is 3.4 kW

  5. Preparation of high-purity bismuth by sulphur deleadization in vacuum distillation

    Institute of Scientific and Technical Information of China (English)

    熊利芝; 何则强; 刘文萍; 麻成金; 戴永年


    The feasibility of separation of impurities in refined bismuth and sulphur deleadization with vacuum distillation was studied theoretically. Experimental studies on sulphur deleadization were carried out under vacuum.The influences of amount of sulphur, distillation temperature, vacuum degree and distillation time on deleadization were investigated and an optimal technical condition was achieved. The content of lead in refined bismuth can be decreased from 30 μg/g to 0.21 μg/g, which has reached the level of "5N" high-purity bismuth. Other impurities in refined bismuth can be also removed effectively under certain conditions.

  6. Bismuth-Induced Raman Modes in GaP1-xBix

    Energy Technology Data Exchange (ETDEWEB)

    Christian, Theresa M.; Fluegel, Brian; Beaton, Daniel A.; Alberi, Kirstin; Mascarenhas, Angelo


    Dilute bismide semiconductor alloys are a promising material platform for optoelectronic devices due to drastic impacts of bismuth on the electronic structure of the alloy. At the same time, the details of bismuth incorporation in the lattice are not fully understood. In this work, we conduct Raman scattering spectroscopy on GaP1- x Bi x epilayers grown by molecular beam epitaxy (MBE) and identify several bismuth-related Raman features including gap vibration modes at 296, 303, and 314 cm-1. This study paves the way for more detailed analysis of the local symmetry at bismuth incorporation sites in the dilute bismide alloy regime.

  7. Optimal biliary drainage for inoperable Klatskin's tumor based on Bismuth type

    Institute of Scientific and Technical Information of China (English)


    AIM: To investigate differences in the effects of biliary drainage procedures in patients with inoperable Klatskin's tumor based on Bismuth type, considering endoscopic retrograde biliary drainage (ERBD), external percutaneous transhepatic biliary drainage (EPTBD) and internal biliary stenting via the PTBD tract (IPTBD).METHODS: The initial success rate, cumulative patency rate, and complication rate were compared retrospectively, according to the Bismuth type and ERBD,EPTBD, and IPTBD. Patency was defined as the duration for adequate initial bile drainage or to the point of the patient's death associated with inadequate drainage.RESULTS: One hundred thirty-four patients (93 men,41 women; 21 Bismuth type Ⅱ, 47 Ⅲ, 66 Ⅳ; 34 ERBD,66 EPTBD, 34 IPTBD) were recruited. There were no differences in demographics among the groups.Adequate initial relief of jaundice was achieved in 91% of patients without a significant difference in the results among different procedures or Bismuth types. The cumulative patency rates for ERBD and IPTBD were better than those for EPTBD with Bismuth type Ⅲ.IPTBD provided an excellent response for Bismuth type Ⅳ. However, there was no difference in the patency rate among drainage procedures for Bismuth type Ⅱ.Procedure-related cholangitis occurred less frequently with EPTBD than with ERBD and IPTBD.CONCLUSION: ERBD is recommended as the firstline drainage procedure for the palliation of jaundice in patients with inoperable Klatskin's tumor of Bismuth type Ⅱ or Ⅲ, but IPTBD is the best option for Bismuth type Ⅳ.

  8. Bismuth-induced Raman modes in GaP1- x Bi x (United States)

    Christian, Theresa M.; Fluegel, Brian; Beaton, Daniel A.; Alberi, Kirstin; Mascarenhas, Angelo


    Dilute bismide semiconductor alloys are a promising material platform for optoelectronic devices due to drastic impacts of bismuth on the electronic structure of the alloy. At the same time, the details of bismuth incorporation in the lattice are not fully understood. In this work, we conduct Raman scattering spectroscopy on GaP1- x Bi x epilayers grown by molecular beam epitaxy (MBE) and identify several bismuth-related Raman features including gap vibration modes at 296, 303, and 314 cm-1. This study paves the way for more detailed analysis of the local symmetry at bismuth incorporation sites in the dilute bismide alloy regime.

  9. Ab initio electronic structure and optical conductivity of bismuth tellurohalides

    CERN Document Server

    Schwalbe, Sebastian; Starke, Ronald; Schober, Giulio A H; Kortus, Jens


    We investigate the electronic structure, dielectric and optical properties of bismuth tellurohalides BiTeX (X = I, Cl, Br) by means of all-electron density functional theory. In particular, we present the ab initio conductivities and dielectric tensors calculated over a wide frequency range, and compare our results with the recent measurements by Akrap et al. , Makhnev et al. , and Rusinov et al. . We show how the low-frequency branch of the optical conductivity can be used to identify characteristic intra- and interband transitions between the Rashba spin-split bands in all three bismuth tellurohalides. We further calculate the refractive indices and dielectric constants, which in turn are systematically compared to previous predictions and measurements. We expect that our quantitative analysis will contribute to the general assessment of bulk Rashba materials for their potential use in spintronics devices.

  10. Large area bismuth absorbers for X-ray microcalorimeters

    Energy Technology Data Exchange (ETDEWEB)

    Vaillancourt, J.E. E-mail:; Allen, C.A.; Brekosky, R.; Dosaj, A.; Galeazzi, M.; Kelley, R.; Liu, D.; McCammon, D.; Porter, F.S.; Rocks, L.E.; Sanders, W.T.; Stahle, C.K


    Two challenges facing the use of large area (2 mmx2 mm) bismuth absorbers for microcalorimetry are uncertainties in the heat capacity of bismuth and the effects of lateral heat conduction and position dependence due to the absorber's large size. We have measured the heat capacity of three Bi samples to be 0.3-0.6 J K{sup -1} m{sup -3} at 100 mK. These absorbers also exhibit response variations as phonons created by an X-ray event at an absorber edge will take longer to propagate to the thermometer attachment point than those at the absorber center. This effect may degrade the detector's energy resolution if the propagation time is not very short compared to the thermometer time constant. We show that the response of the largest absorber varies by {approx}4% across its area.

  11. Thermophysical properties of liquid lead-bismuth eutectic

    International Nuclear Information System (INIS)

    Background: Liquid lead-bismuth eutectic (LBE) is important spallation target materials and candidate coolant materials in accelerator driven subcritical (ADS) system. Purpose: Its thermodynamic physical properties are keys to understand the basic problems in ADS R&D. Methods: By the calculation of scientific laws as well as fitting other scholars' experimental results, we tried to obtain the above thermodynamics physical properties. Results: By the calculation, we got formula about characteristic temperatures, density, specific heat, viscosity and thermal conductivity of liquid lead-bismuth alloy. And by fitting other scholars' experimental results, we got the fitting formula. Conclusions: Finally, by the contrast analysis, we found that the fitting formula and calculation formula agree well, and fitting formula more approaches the experimental value with a high accuracy whose differential deviation is not over 1%. (authors)

  12. Colloidal bismuth subcitrate in non-ulcer dyspepsia.

    Directory of Open Access Journals (Sweden)

    Khanna M


    Full Text Available The effect of colloidal bismuth subcitrate (De-Nol on symptoms, Helicobacter pylori status and histological features was studied in 35 patients with non-ulcer dyspepsia. Pain (34 cases and gas bloat (18 were the predominant symptoms. H pylori was present in 26 (74.3% patients. Gastritis and duodenitis were present in 29 of 32 and 22 of 31 cases respectively in whom biopsies were available. Relief in symptoms after treatment was seen in 29 (82.8% cases. Improvement in gastritis and duodenitis was noted in 60.8% and 58.8% respectively; over 70% of H pylori positive patients cleared the organism. These changes did not correlate with the relief in symptoms. We conclude that colloidal bismuth subcitrate is effective in the short term treatment of non-ulcer dyspepsia. It also clears H pylori infection and results in improvement of histological features.

  13. Dose reduction using Bismuth protectors in chest computed tomography

    International Nuclear Information System (INIS)

    This monography is about the Dose reduction using Bismuth protectors in chest CT. The radiation protection of specific areas is necessary when the tissues or radiosensitive organs are near the path of light beam. The correct use of protection represents a challenge for the radiologist because of the time and materials required. The method used was a prospective investigatio in CHPR (TC service) and the doses was measured with TLD dosimeters. It is important to use these protectors in children hospitals.

  14. In vivo cellular uptake of bismuth ions from shotgun pellets


    Stoltenberg, M; Locht, L.; Larsen, Agnete; Jensen, D.


    Shotgun pellets containing bismuth (Bi) are widely used and may cause a rather intense exposure of some wild animals to Bi. A Bi shotgun pellet was implanted intramuscularly in the triceps surae muscle of 18 adult male Wistar rats. Another group of 9 animals had a Bi shotgun pellet implanted intracranially in the neocortex. Eight weeks to 12 months later the release of Bi ions was analysed by autometallography (AMG) of tissue sections from different organs (bra...

  15. Weak antilocalization and UCFs in an open bismuth quantum dot (United States)

    Hackens, B.; Minet, J. P.; Farhi, G.; Faniel, G.; Gustin, C.; Bayot, V.


    We report on the observation of weak antilocalization and universal conductance fluctuations in the magnetoconductance of an open quasi-ballistic bismuth nano-cavity. The electron decoherence length is comparable to sample dimensions at low temperature, while the spin-orbit coupling length is smaller. The temperature dependence of both the conductance and the dephasing length are consistent with two-dimensional electron-electron interactions being the dominant decoherence process.

  16. Tunneling behavior of bismuth telluride nanoplates in electrical transport


    Eginligil, Mustafa; Zhang, Weiqing; Kalitsov, Alan; Lu, Xianmao; Yang, Hyunsoo


    We study the electrical transport properties of ensembles of bismuth telluride (Bi2Te3) nanoplates grown by solution based chemical synthesis. Devices consisting of Bi2Te3 nanoplates are fabricated by surface treatment after dropping the solution on the structured gold plates and the temperature dependence of resistance shows a nonmetallic behavior. Symmetric tunneling behavior in I-V was observed in both our experimental results and theoretical calculation of surface conductance based on a s...

  17. Proton irradiation on textured bismuth based cuprate superconductors

    International Nuclear Information System (INIS)

    Textured bulk polycrystalline samples of bismuth based cuprate superconductors have been subjected to irradiation with 15 MeV protons. In case of Bi-2212, there has been substantial increase in Tc, which may be due to proton induced knock-out of loosely bound oxygen. In case of (Bi,Pb)-2223, there has been a reduction in Tc. The difference in behaviour in these two systems towards proton irradiation has been explained. (author). 7 refs., 3 figs., 1 tab

  18. Magnetic Properties of Bismuth Ferrite Nanopowder Obtained by Mechanochemical Synthesis


    Szafraniak-Wiza, I.; Andrzejewski, B.; Hilczer, B.


    Multiferroic bismuth ferrite (BiFeO3) nanopowders have been obtained in room temperature by mechanical synthesis. Depending on the post-synthesis processing the nanopowders have exhibited differences in the mean sizes, presence of amorphous layer and/or secondary phases. Extended magnetic study performed for fresh, annealed and hot-pressed nanopowders have revealed substantial improvement of the magnetic properties in the as-prepared powder.

  19. 20 CFR 404.203 - Definitions. (United States)


    ... Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL OLD-AGE, SURVIVORS AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts General § 404.203 Definitions. (a) General definitions. As used in this subpart— Ad hoc increase in primary insurance amounts means an increase in primary insurance...

  20. 40 CFR 156.203 - Definitions. (United States)


    ... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS LABELING REQUIREMENTS FOR PESTICIDES AND DEVICES Worker Protection Statements § 156.203 Definitions. Terms in this subpart have the same meanings as they do in the Federal Insecticide, Fungicide, and Rodenticide Act,...

  1. 18 CFR 1304.203 - Vegetation management. (United States)


    ... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Vegetation management...-Owned Residential Access Shoreland § 1304.203 Vegetation management. No vegetation management shall be approved on TVA-owned Residential Access Shoreland until a Vegetation Management Plan meeting...

  2. 24 CFR 203.342 - Mortgage modification. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage modification. 203.342... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Continuation of Insurance §...

  3. 7 CFR 765.203 - Protective advances. (United States)


    ... AGRICULTURE SPECIAL PROGRAMS DIRECT LOAN SERVICING-REGULAR Protecting the Agency's Security Interest § 765.203 Protective advances. When necessary to protect the Agency's security interest, costs incurred for the..., hazard, or flood insurance; (e) Pay harvesting costs; (f) Maintain Agency security instruments; (g)...

  4. 5 CFR 2606.203 - Granting access. (United States)


    ....203 Administrative Personnel OFFICE OF GOVERNMENT ETHICS ORGANIZATION AND PROCEDURES PRIVACY ACT RULES...) When the data subject seeks to obtain original documentation, the Office and the other agencies... the records, adequate identification documentation will be required, e.g., an employee...

  5. 28 CFR 20.3 - Definitions. (United States)


    ... Administration DEPARTMENT OF JUSTICE CRIMINAL JUSTICE INFORMATION SYSTEMS General Provisions § 20.3 Definitions... justice users with respect to the various systems managed by the FBI CJIS Division. (d) Criminal history... such information does not indicate the individual's involvement with the criminal justice system....

  6. Proposition 203: A Critical Metaphor Analysis (United States)

    Johnson, Eric


    This project draws on Lakoff and Johnson's (1980) work with metaphor analysis to uncover the rhetorical strategies applied by supporters of the English for the Children organization during the 2000 Arizona Proposition 203 campaign. The data were collected from three sources: (a) "The Arizona Republic"; (b) the "East Valley Tribune"; and (c) the…

  7. 32 CFR 203.3 - Definitions. (United States)


    ... TECHNICAL ASSISTANCE FOR PUBLIC PARTICIPATION (TAPP) IN DEFENSE ENVIRONMENTAL RESTORATION ACTIVITIES § 203.3... or may be endangered by the release of hazardous substances at the facility. Applicant. Any group of... include a TAPP project description. Assistance provider. An individual, group of individuals, or...

  8. 5 CFR 340.203 - Technical assistance. (United States)


    ... filling part-time positions; (4) Interpretations of part-time employment law, regulations and policy; (5...-TIME CAREER EMPLOYMENT (PART-TIME, SEASONAL, ON-CALL, AND INTERMITTENT) Regulatory Requirements-Part-Time Employment § 340.203 Technical assistance. (a) The Office of Personnel Management shall...

  9. Tank 241-C-203: Tank characterization plan

    Energy Technology Data Exchange (ETDEWEB)

    Schreiber, R.D.


    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, and WHC 222-S Laboratory. Scope of this plan is to provide guidance for sampling and analysis of samples for tank 241-C-203.

  10. 33 CFR 203.13 - Available assistance. (United States)


    ... Secretary of the Army or his delegated nominee) to construct wells and to transport water for human... Section 203.13 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE EMERGENCY EMPLOYMENT OF ARMY AND OTHER RESOURCES, NATURAL DISASTER PROCEDURES Introduction §...

  11. 42 CFR 56.203 - Project elements. (United States)


    ... Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR MIGRANT HEALTH SERVICES Grants for Planning and Developing Migrant Health Centers § 56.203 Project elements. A project for planning and developing a migrant health center supported under this subpart must: (a) Determine (by...

  12. 48 CFR 50.203 - General. (United States)


    ... that will enhance the protection of the nation; and (2) Provide risk management and litigation management protections for sellers of QATTs and others in the supply and distribution chain. (b) The SAFETY....203 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT...

  13. 48 CFR 11.203 - Customer satisfaction. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Customer satisfaction. 11... PLANNING DESCRIBING AGENCY NEEDS Using and Maintaining Requirements Documents 11.203 Customer satisfaction... reflects the customer's needs and to obtain suggestions for corrective actions. Whenever practicable,...

  14. Study of barium bismuth titanate prepared by mechanochemical synthesis

    Directory of Open Access Journals (Sweden)

    Lazarević Z.Ž.


    Full Text Available Barium-bismuth titanate, BaBi4Ti4O15 (BBT, a member of Aurivillius bismuth-based layer-structure perovskites, was prepared from stoichiometric amounts of barium titanate and bismuth titanate obtained via mechanochemical synthesis. Mechanochemical synthesis was performed in air atmosphere in a planetary ball mill. The reaction mechanism of BaBi4Ti4O15 and the preparation and characteristics of BBT ceramic powders were studied using XRD, Raman spectroscopy, particle analysis and SEM. The Bi-layered perovskite structure of BaBi4Ti4O15 ceramic forms at 1100 °C for 4 h without a pre-calcination step. The microstructure of BaBi4Ti4O15 exhibits plate-like grains typical for the Bi-layered structured material and spherical and polygonal grains. The Ba2+ addition leads to changes in the microstructure development, particularly in the change of the average grain size.

  15. Bismuth pyrochlore-based thin films for dielectric energy storage (United States)

    Michael, Elizabeth K.

    The drive towards the miniaturization of electronic devices has created a need for dielectric materials with large energy storage densities. These materials, which are used in capacitors, are a critical component in many electrical systems. Here, the development of dielectric energy storage materials for pulsed power applications, which require materials with the ability to accumulate a large amount of energy and then deliver it to the system rapidly, is explored. The amount of electrostatic energy that can be stored by a material is a function of the induced polarization and the dielectric breakdown strength of the material. An ideal energy storage dielectric would possess a high relative permittivity, high dielectric breakdown strength, and low loss tangent under high applied electric fields. The bismuth pyrochlores are a compositionally tunable family of materials that meet these requirements. Thin films of cubic pyrochlore bismuth zinc niobate, bismuth zinc tantalate, and bismuth zinc niobate tantalate, were fabricated using a novel solution chemistry based upon the Pechini method. This solution preparation is advantageous because it avoids the use of teratogenic solvents, such as 2-methoxyethanol. Crystalline films fabricated using this solution chemistry had very small grains that were approximately 27 nm in lateral size and 35 nm through the film thickness. Impedance measurements found that the resistivity of the grain boundaries was two orders of magnitude higher than the resistivity of the grain interior. The presence of many resistive grain boundaries impeded conduction through the films, resulting in high breakdown strengths for these materials. In addition to high breakdown strengths, this family of materials exhibited moderate relative permittivities of between 55 +/- 2 and 145 +/- 5, for bismuth zinc tantalate and bismuth zinc niobate, respectively, and low loss tangents on the order of 0.0008 +/- 0.0001. Increases in the concentration of the tantalum

  16. Aerosol deposition of (Cu,Ti) substituted bismuth vanadate films

    International Nuclear Information System (INIS)

    Bismuth vanadate, Bi4V2O11, and related compounds with various metal (Me) substitutions, Bi4(MexV1−x)2O11−δ, show some of the highest ionic conductivities among the known solid oxide electrolytes. Films of Cu and Ti substituted bismuth vanadate were prepared by an aerosol deposition method, a spray coating process also described as room temperature impact consolidation. Resultant films, several microns in thickness, were dense with good adhesion to the substrate. Scanning electron microscopy and high temperature X-ray diffraction were used to monitor the effects of temperature on the structure and microstructure of the film. The particle size remained nano-scale while microstrain decreased rapidly up to 500 °C, above which coarsening and texturing increased rapidly. Impedance measurements of films deposited on inter-digital electrodes revealed an annealing effect on the ionic conductivity, with the conductivity exceeding that of a screen printed film, and approaching that of bulk ceramic. - Highlights: • Cu and Ti doped bismuth vanadate films were prepared by aerosol deposition (AD). • Dense 3–5 μm thick films were deposited on alumina, silicon and gold electrodes. • Annealing of the AD-layer increases the conductivity by 1.5 orders of magnitude. • Effect of temperature on structure and microstructure was investigated

  17. Resistivity and Seebeck coefficient measurements of a bismuth microwire array

    Energy Technology Data Exchange (ETDEWEB)

    Ishikawa, Y. [Graduate School of Science and Engineering, Saitama University, 338-8570 (Japan)]. E-mail:; Hasegawa, Y. [Graduate School of Science and Engineering, Saitama University, 338-8570 (Japan); Morita, H. [Saitama Industrial Technology Center, Saitama Prefecture, 333-0844 (Japan); Kurokouchi, A. [Saitama Industrial Technology Center, Saitama Prefecture, 333-0844 (Japan); Wada, K. [Saitama Industrial Technology Center, Saitama Prefecture, 333-0844 (Japan); Komine, T. [Department of Media and Telecommunications Engineering, Ibaraki University, 316-8511 (Japan); Nakamura, H. [National Institute for Fusion Science, 322-6 Oroshi-cho, Toki, Gifu 509-5252 (Japan)


    The resistivity and Seebeck coefficient of a bismuth microwire array (wire diameter: 25 {mu}m) were successfully measured from 25 to 300 K. To eliminate the influence of the contact resistance between the wire edges of the microwire array and copper electrodes, the titanium (100 nm)/copper (500 nm) film layers were deposited as interlayer on the wire edge by ion plating method. Copper electrodes were glued by using Pb-Sn solder. The resistivity and the Seebeck coefficient at 300 K were approximately 1.8x10{sup -6} {omega}m and -54x10{sup -6} V/K, respectively. The value of the resistivity and the Seebeck coefficient were in good agreement with those of bulk polycrystalline bismuth reported previously. Thus, the effects of the contact resistance for the microwire array were almost resolved, and the chemical reaction of the Pb-Sn solder and bismuth was prevented by using the thin-film layer. The technique is expected to be applicable to nanowire arrays as well.

  18. Aerosol deposition of (Cu,Ti) substituted bismuth vanadate films

    Energy Technology Data Exchange (ETDEWEB)

    Exner, Jörg, E-mail: [University of Bayreuth, Department of Functional Materials, Universitätsstraße 30, 95440 Bayreuth (Germany); Fuierer, Paul [Materials and Metallurgical Engineering Department, New Mexico Institute of Mining and Technology, Socorro, NM 87801 (United States); Moos, Ralf [University of Bayreuth, Department of Functional Materials, Universitätsstraße 30, 95440 Bayreuth (Germany)


    Bismuth vanadate, Bi{sub 4}V{sub 2}O{sub 11}, and related compounds with various metal (Me) substitutions, Bi{sub 4}(Me{sub x}V{sub 1−x}){sub 2}O{sub 11−δ}, show some of the highest ionic conductivities among the known solid oxide electrolytes. Films of Cu and Ti substituted bismuth vanadate were prepared by an aerosol deposition method, a spray coating process also described as room temperature impact consolidation. Resultant films, several microns in thickness, were dense with good adhesion to the substrate. Scanning electron microscopy and high temperature X-ray diffraction were used to monitor the effects of temperature on the structure and microstructure of the film. The particle size remained nano-scale while microstrain decreased rapidly up to 500 °C, above which coarsening and texturing increased rapidly. Impedance measurements of films deposited on inter-digital electrodes revealed an annealing effect on the ionic conductivity, with the conductivity exceeding that of a screen printed film, and approaching that of bulk ceramic. - Highlights: • Cu and Ti doped bismuth vanadate films were prepared by aerosol deposition (AD). • Dense 3–5 μm thick films were deposited on alumina, silicon and gold electrodes. • Annealing of the AD-layer increases the conductivity by 1.5 orders of magnitude. • Effect of temperature on structure and microstructure was investigated.

  19. Atomic Layer Deposition of Bismuth Vanadates for Solar Energy Materials. (United States)

    Stefik, Morgan


    The fabrication of porous nanocomposites is key to the advancement of energy conversion and storage devices that interface with electrolytes. Bismuth vanadate, BiVO4 , is a promising oxide for solar water splitting where the controlled fabrication of BiVO4 layers within porous, conducting scaffolds has remained a challenge. Here, the atomic layer deposition of bismuth vanadates is reported from BiPh3 , vanadium(V) oxytriisopropoxide, and water. The resulting films have tunable stoichiometry and may be crystallized to form the photoactive scheelite structure of BiVO4 . A selective etching process was used with vanadium-rich depositions to enable the synthesis of phase-pure BiVO4 after spinodal decomposition. BiVO4 thin films were measured for photoelectrochemical performance under AM 1.5 illumination. The average photocurrents were 1.17 mA cm(-2) at 1.23 V versus the reversible hydrogen electrode using a hole-scavenging sulfite electrolyte. The capability to deposit conformal bismuth vanadates will enable a new generation of nanocomposite architectures for solar water splitting. PMID:27246652

  20. Atomic Layer Deposition of Bismuth Vanadates for Solar Energy Materials. (United States)

    Stefik, Morgan


    The fabrication of porous nanocomposites is key to the advancement of energy conversion and storage devices that interface with electrolytes. Bismuth vanadate, BiVO4 , is a promising oxide for solar water splitting where the controlled fabrication of BiVO4 layers within porous, conducting scaffolds has remained a challenge. Here, the atomic layer deposition of bismuth vanadates is reported from BiPh3 , vanadium(V) oxytriisopropoxide, and water. The resulting films have tunable stoichiometry and may be crystallized to form the photoactive scheelite structure of BiVO4 . A selective etching process was used with vanadium-rich depositions to enable the synthesis of phase-pure BiVO4 after spinodal decomposition. BiVO4 thin films were measured for photoelectrochemical performance under AM 1.5 illumination. The average photocurrents were 1.17 mA cm(-2) at 1.23 V versus the reversible hydrogen electrode using a hole-scavenging sulfite electrolyte. The capability to deposit conformal bismuth vanadates will enable a new generation of nanocomposite architectures for solar water splitting.

  1. Bismuth Propellant Feed System Development at NASA-MSFC (United States)

    Polzin, Kurt A.


    NASA-MSFC has been developing liquid metal propellant feed systems capable of delivering molten bismuth at a prescribed mass flow rate to the vaporizer of an electric thruster. The first such system was delivered to NASA-JPL as part of the Very High Isp Thruster with Anode Layer (VHITAL) program. In this system, the components pictured were placed in a vacuum chamber and heated while the control electronics were located outside the chamber. The system was successfully operated at JPL in conjunction with a propellant vaporizer, and data was obtained demonstrating a new liquid bismuth flow sensing technique developed at MSFC. The present effort is aimed at producing a feed-system for use in conjunction with a bismuth-fed Hall thruster developed by Busek Co. Developing this system is more ambitious, however, in that it is designed to self-contain all the control electronics inside the same vacuum chamber as an operating bismuth-fed thruster. Consequently, the entire system, including an on-board computer, DC-output power supplies, and a gas-pressurization electro-pneumatic regulator, must be designed to survive a vacuum environment and shielded to keep bismuth plasma from intruding on the electronics and causing a shortcircuit. In addition, the hot portions of the feed system must be thermally isolated from the electronics to avoid failure due to high heat loads. This is accomplished using a thermal protection system (TPS) consisting of multiple layers of aluminum foil. The only penetrations into the vacuum chamber are an electrically isolated (floating) 48 VDC line and a fiberoptic line. The 48 VDC provides power for operation of the power supplies and electronics co-located with the system in the vacuum chamber. The fiberoptic Ethernet connection is used to communicate user-input control commands to the on-board computer and transmit real-time data back to the external computer. The partially assembled second-generation system is shown. Before testing at Busek, a

  2. Study on corrosion test techniques in lead bismuth eutectic flow. Joint research report in JFY2002

    International Nuclear Information System (INIS)

    The evaluation of corrosion behaviors of core and structural materials in lead bismuth eutectic is one of the key issues for the utilization of lead bismuth eutectic as a coolant of the primary loops of lead bismuth cooled fast breeder reactors (FBRs) and the intermediate heat transport media of new-type steam generators of the sodium cooled FBRs. The purpose of the present study is to establish corrosion test techniques in lead bismuth eutectic flow. The techniques of steel corrosion test and oxygen control in flowing lead bismuth eutectic, and the technologies of a lead bismuth flow test at high temperature and high velocity were developed through corrosion test using a lead bismuth flow test loop of the Tokyo Institute of Technology in JFY2002. The major results are summarized as follows: (1) Techniques of fabrication, mount and rinse of corrosion specimens, measurement method of weight loss, and SEM/EDX analysis method have been established through lead bismuth corrosion test. (2) Weight losses were measured, corrosion and lead bismuth-adhered layers and eroded parts were observed in two 1000 hr-corrosion tests, and the results were compared with each other for twelve existing steels including ODS, F82H and SUH-3. (3) An oxygen sensor made of zirconia electrolyte structurally resistant to thermal stress and thermal shock was developed and tested in the lead bismuth flow loop. Good performance has been obtained. (4) An oxygen control method by injecting argon and hydrogen mixture gas containing steam into lead bismuth was applied to the lead bismuth flow loop, and technical issues for the development of the oxygen control method were extracted. (5) Technical measures for freezing and leakage of lead bismuth in the flow loop were accumulated. (6) Technical measures for flow rate decrease/blockage due to precipitation of oxide and corrosion products in a low temperature section of the lead bismuth flow loop were accumulated. (7) Electromagnetic flow meters with MI

  3. Solvothermal synthesis and study of nonlinear optical properties of nanocrystalline thallium doped bismuth telluride

    Energy Technology Data Exchange (ETDEWEB)

    Molli, Muralikrishna, E-mail: [Department of Physics, Sri Sathya Sai Institute of Higher Learning, Prasanthinilayam-515 134 (India); Parola, Sowmendran; Avinash Chunduri, L.A.; Aditha, Saikiran; Sai Muthukumar, V; Mimani Rattan, Tanu; Kamisetti, Venkataramaniah [Department of Physics, Sri Sathya Sai Institute of Higher Learning, Prasanthinilayam-515 134 (India)


    Nanocrystalline Bismuth telluride and thallium (4 mol %) doped Bismuth telluride were synthesized through hydrothermal method. The as-prepared products were characterized using Powder X-ray Diffraction, High Resolution Transmission Electron Microscopy, Energy Dispersive X-Ray Spectroscopy, UV-Visible spectroscopy and Fourier Transform Infrared Spectroscopy. Powder XRD results revealed the crystalline nature of the obtained phases. HRTEM showed the particle-like morphology of the products. The decrease in the absorption coefficient due to thallium doping was observed in FTIR spectra. The intensity dependent nonlinear optical properties of nanocrystalline bismuth telluride and thallium doped bismuth telluride were studied using the Z-scan technique in open-aperture configuration. Bismuth telluride doped with thallium showed enhanced nonlinear optical response compared to pristine bismuth telluride and hence could be used as a potential candidate for optical power limiting applications. - Graphical Abstract: Nonlinear transmission (Z-scan) curves of nanocrystalline bismuth telluride ({Delta}) and thallium doped bismuth telluride ({open_square}). Thallium doped bismuth telluride showed enhanced nonlinear absorption compared to bismuth telluride. Inset: TEM micrograph of bismuth telluride nanocrystallites. Highlights: Black-Right-Pointing-Pointer Synthesis of Nanocrystalline Bi{sub 2}Te{sub 3} and Thallium doped Bi{sub 2}Te{sub 3} through solvothermal method. Black-Right-Pointing-Pointer Reduced absorption coefficient due to thallium doping found from IR spectroscopy. Black-Right-Pointing-Pointer Open-aperture Z-scan technique for nonlinear optical studies. Black-Right-Pointing-Pointer Two photon absorption based model for theoretical fitting of Z-scan data. Black-Right-Pointing-Pointer Enhanced nonlinear absorption in Thallium doped Bi{sub 2}Te{sub 3} - potential candidate for optical power limiting applications.

  4. Unusual anti-thermal degradation of bismuth NIR luminescence in bismuth doped lithium tantalum silicate laser glasses. (United States)

    Tan, Linling; Wang, Liping; Peng, Mingying; Xu, Shanhui; Zhang, Qinyuan


    For application of bismuth laser glasses in either fiber amplifier or laser, their performance stability in long run should be understood especially in extreme conditions. However, so far, there are few reports on it. Here, we found, after the cycle experiments on heating and cooling, that the proper increase of lithium content in lithium tantalum silicate laser glass can lead to unusual anti-thermal degradation of bismuth NIR luminescence, which completely differs from the scenario in germanate glass. FTIR, 29Si MAS NMR spectra, absorption and dynamic photoluminescence spectra are employed to unravel how this happens. The results illustrate that it should be due to the decrease of polymerization of silicate glass network, which in turn allows the regeneration at 250°C, and therefore, the content increase of bismuth NIR emission centers. In the meanwhile, we noticed though Bi luminescence can be thermally quenched its peak does not shift along with temperature, which seldom appears in laser materials. The unique property might guarantee the unshift of Bi fiber laser wavelength once such glass was made into fiber devices even as the environmental temperature changes. The role of lithium is discussed in the evolution of glass structures, the suppression of glass heterogeneity, and the thermal stability of Bi luminescence, and it should be helpful to design homogeneous silicate laser glass with outstanding thermal stability. PMID:27505827

  5. Method of Creating Micro-scale Silver Telluride Grains Covered with Bismuth Nanoparticles (United States)

    Kim, Hyun-Jung (Inventor); Choi, Sang Hyouk (Inventor); King, Glen C. (Inventor); Park, Yeonjoon (Inventor); Lee, Kunik (Inventor)


    Provided is a method of enhancing thermoelectric performance by surrounding crystalline semiconductors with nanoparticles by contacting a bismuth telluride material with a silver salt under a substantially inert atmosphere and a temperature approximately near the silver salt decomposition temperature; and recovering a metallic bismuth decorated material comprising silver telluride crystal grains.

  6. Biosynthesis of bismuth nanoparticles using Serratia marcescens isolated from the Caspian Sea and their characterisation. (United States)

    Nazari, P; Faramarzi, M A; Sepehrizadeh, Z; Mofid, M R; Bazaz, R D; Shahverdi, A R


    Today, synthesis of nanoparticles (NPs) using micro-organisms has been receiving increasing attention. In this investigation, a bismuth-reducing bacterium was isolated from the Caspian Sea in Northern Iran and was used for intracellular biosynthesis of elemental bismuth NPs. This isolate was identified as non-pigmented Serratia marcescens using conventional identification assays and the 16s rDNA fragment amplification method and used to prepare bismuth NPs. The biogenic bismuth NPs were released by liquid nitrogen and highly purified using an n-octanol water two-phase extraction system. Different characterisations of the purified NPs such as particle shapes, size and purity were carried out with different instruments. The energy-dispersive X-ray and X-ray diffraction (XRD) patterns demonstrated that the purified NPs consisted of only bismuth and are amorphous. In addition, the transmission electron micrograph showed that the small NPs formed larger aggregated NPs around <150 nm. Although the chemical syntheses of elemental bismuth NPs have been reported in the literature, the biological synthesis of elemental bismuth NPs has not been published yet. This is the first report to demonstrate a biological method for synthesising bismuth NPs and their purification with a simple solvent partitioning method.

  7. Attenuation and image quality in the use of protective bismuth in chest CT scans

    International Nuclear Information System (INIS)

    For chest CT scans are protective of bismuth (Bi) with the aim of reducing the dose in the breast. The aim of this study was to evaluate the attenuation with thermoluminescent dosimeters in the glandular dose average when using these protective breast CT scans and to evaluate the image quality with and without protective Bismuth.

  8. Selective oxidation of propylene to acrolein by silica-supported bismuth molybdate catalysts

    DEFF Research Database (Denmark)

    Duc, Duc Truong; Ha, Hanh Nguyen; Fehrmann, Rasmus;


    Silica-supported bismuth molybdate catalysts have been prepared by impregnation, structurally characterized and examined as improved catalysts for the selective oxidation of propylene to acrolein. Catalysts with a wide range of loadings (from 10 to 90 wt%) of beta bismuth molybdate (β-Bi2Mo2O9...

  9. Cytotoxic Effect of Lipophilic Bismuth Dimercaptopropanol Nanoparticles on Epithelial Cells. (United States)

    Rene, Hernandez-Delgadillo; Badireddy, Appala Raju; José, Martínez-Sanmiguel Juan; Francisco, Contreras-Cordero Juan; Israel, Martinez-Gonzalez Gustavo; Isela, Sánchez-Nájera Rosa; Chellam, Shankararaman; Claudio, Cabral-Romero


    Bismuth nanoparticles have many interesting properties to be applied in biomedical and medicinal sectors, however their safety in humans have not been comprehensively investigated. The objective of this research was to determine the cytotoxic effect of bismuth dimercaptopropanol nanoparticles (BisBAL NPs) on epithelial cells. The nanoparticles are composed of 18.7 nm crystallites on average and have a rhombohedral structure, agglomerating into chains-like or clusters of small nanoparticles. Based on MTT viability assay and fluorescence microscopy, cytotoxicity was not observed on monkey kidney cells after growing with 5 µM of BisBAL NPs for 24 h. Employing same techniques, identical results were obtained with human epithelial cells (HeLa), showing a not strain-dependent phenomenon. The absence of toxic effects on epithelial cells growing with BisBAL NPs was corroborated with long-time experiments (24-72 hrs.), showing no difference in comparison with growing control (cells without nanoparticles). Further, genotoxicity assays, comet assay and fluorescent microscopy and electrophoresis in bromide-stained agarose gel revealed no damage to genomic DNA of MA104 cells after 24 h. of exposition to BisBAL NPs. Finally, the effect of bismuth nanoparticles on protein synthesis was studied in cells growing with BisBAL NPs for 24 h. SDS-PAGE assays showed no difference between treated and untreated cells, suggesting that BisBAL NPs did not interfere with protein synthesis. Hence BisBAL NPs do not appear to exert cytotoxic effects suggesting their biological compatibility with epithelial cells.

  10. Conduction mechanism in bismuth silicate glasses containing titanium (United States)

    Dult, Meenakshi; Kundu, R. S.; Murugavel, S.; Punia, R.; Kishore, N.


    Bismuth silicate glasses mixed with different concentrations of titanium dioxide having compositions xTiO2-(60-x)Bi2O3-40SiO2 with x=0, 5, 10, 15 and 20 were prepared by the normal melt quench technique. The frequency dependence of the ac electrical conductivity of different compositions of titanium bismuth silicate glasses has been studied in the frequency range 10-1 Hz to 10 MHz and in the temperature range 623-703 K. The temperature and frequency dependent conductivity is found to obey Jonscher's universal power law for all the compositions of titanium bismuth silicate glass system. The dc conductivity (σdc), so called crossover frequency (ωH), and frequency exponent (s) have been estimated from the fitting of experimental data of ac conductivity with Jonscher's universal power law. Enthalpy to dissociate the cation from its original site next to a charge compensating center (Hf) and enthalpy of migration (Hm) have also been estimated. The conductivity data have been analyzed in terms of different theoretical models to determine the possible conduction mechanism. Analysis of the conductivity data and the frequency exponent shows that the correlated barrier hopping of electrons between Ti3+ and Ti4+ ions in the glasses is the most favorable mechanism for ac conduction. The temperature dependent dc conductivity has been analyzed in the framework of theoretical variable range hopping model (VRH) proposed by Mott which describe the hopping conduction in disordered semiconducting systems. The various polaron hopping parameters have also been deduced. Mott's VRH model is found to be in good agreement with experimental data and the values of inverse localization length of s-like wave function (α) obtained by this model with modifications suggested by Punia et al. are close to the ones reported for a number of oxide glasses.

  11. Yttrium bismuth titanate pyrochlore mixed oxides for photocatalytic hydrogen production

    Energy Technology Data Exchange (ETDEWEB)

    Merka, Oliver


    In this work, the sol-gel synthesis of new non-stoichiometric pyrochlore titanates and their application in photocatalytic hydrogen production is reported. Visible light response is achieved by introducing bismuth on the A site or by doping the B site by transition metal cations featuring partially filled d orbitals. This work clearly focusses on atomic scale structural changes induced by the systematical introduction of non-stoichiometry in pyrochlore mixed oxides and the resulting influence on the activity in photocatalytic hydrogen production. The materials were characterized in detail regarding their optical properties and their atomic structure. The pyrochlore structure tolerates tremendous stoichiometry variations. The non-stoichiometry in A{sub 2}O{sub 3} rich compositions is compensated by distortions in the cationic sub-lattice for the smaller Y{sup 3+} cation and by evolution of a secondary phase for the larger Bi{sup 3+} cation on the A site. For TiO{sub 2} rich compositions, the non-stoichiometry leads to a special vacancy formation in the A and optionally O' sites. It is shown that pyrochlore mixed oxides in the yttrium bismuth titanate system represent very active and promising materials for photocatalytic hydrogen production, if precisely and carefully tuned. Whereas Y{sub 2}Ti{sub 2}O{sub 7} yields stable hydrogen production rates over time, the bismuth richer compounds of YBiTi{sub 2}O{sub 7} and Bi{sub 2}Ti{sub 2}O{sub 7} are found to be not stable under irradiation. This drawback is overcome by applying a special co-catalyst system consisting of a precious metal core and a Cr{sub 2}O{sub 3} shell on the photocatalysts.

  12. Concentration Quenching in Erbium Doped Bismuth Silicate Glasses

    Institute of Scientific and Technical Information of China (English)

    DAI Shi-Xun; XU Tie-Feng; NIE Qiu-Hua; SHEN Xiang; WANG Xun-Si


    @@ Er2 O3-doped bismuth silicate glasses are prepared by the conventional melt-quenching method, and the Er3+ : 4 I13/2 → 4I15/2 fluorescence properties are studied for different Er3+ concentrations. Infrared spectra are measured to estimate the exact content of OH- groups in the samples. Based on the electric dipole-dipole interaction theory,the interaction parameter CEr,Er for the migration rate of Er3+ :4 I13/2 → 4 I13/2 in proposed glasses is calculated.

  13. Coherent phonon coupling to individual Bloch states in photoexcited bismuth. (United States)

    Papalazarou, E; Faure, J; Mauchain, J; Marsi, M; Taleb-Ibrahimi, A; Reshetnyak, I; van Roekeghem, A; Timrov, I; Vast, N; Arnaud, B; Perfetti, L


    We investigate the temporal evolution of the electronic states at the bismuth (111) surface by means of time- and angle-resolved photoelectron spectroscopy. The binding energy of bulklike bands oscillates with the frequency of the A(1g) phonon mode, whereas surface states are insensitive to the coherent displacement of the lattice. A strong dependence of the oscillation amplitude on the electronic wave vector is correctly reproduced by ab initio calculations of electron-phonon coupling. Besides these oscillations, all the electronic states also display a photoinduced shift towards higher binding energy whose dynamics follows the evolution of the electronic temperature.

  14. Gamma-ray attenuation coefficients in bismuth borate glasses

    International Nuclear Information System (INIS)

    Mass attenuation coefficients of glasses in the system: xBi2O3(1-x)B2O3 (x=0.30, 0.35, 0.40, 0.45 and 0.55) were determined at 356, 662, 1173 and 1332 keV photon energies using a narrow beam transmission method. Appreciable variations were observed in these coefficients due to changes in the chemical composition of glasses. These coefficients were then used to determine effective atomic numbers of glass samples, which were found to be constant with bismuth concentration and energy

  15. Colloidal bismuth subcitrate in non-ulcer dyspepsia.


    Khanna M; Abraham P; Nair N; Mistry F; Vora I


    The effect of colloidal bismuth subcitrate (De-Nol) on symptoms, Helicobacter pylori status and histological features was studied in 35 patients with non-ulcer dyspepsia. Pain (34 cases) and gas bloat (18) were the predominant symptoms. H pylori was present in 26 (74.3%) patients. Gastritis and duodenitis were present in 29 of 32 and 22 of 31 cases respectively in whom biopsies were available. Relief in symptoms after treatment was seen in 29 (82.8%) cases. Improvement in gastri...

  16. Kinetics of Propagating Phase Transformation in Compressed Bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Bastea, M; Bastea, S; Emig, J; Springer, P; Reisman, D


    The authors observed dynamically driven phase transitions in isentropically compressed bismuth. By changing the stress loading conditions they explored two distinct cases one in which the experimental signature of the phase transformation corresponds to phase-boundary crossings initiated at both sample interfaces, and another in which the experimental trace is due to a single advancing transformation front in the bulk of the material. They introduce a coupled kinetics-hydrodynamics model that for this second case enables them, under suitable simplifying assumptions, to directly extract characteristic transition times from the experimental measurements.

  17. Fano interference for large-amplitude coherent phonons in bismuth

    International Nuclear Information System (INIS)

    We report femtosecond time-resolved measurements of lattice dynamics in bismuth made over a wide range of temperatures and excitation levels. We demonstrate that time-integrated Fourier transforms for both the fully symmetric A1g and doubly degenerate Eg coherent oscillations of large amplitude exhibit asymmetric line shapes described by the Fano formula. Measuring the real and imaginary part of the phonon self-energy, we attempt to identify the nature of the continuum responsible for the configuration mixing. Based on the measured pump and temperature dependences, we suggest that the continuum responsible for the interference includes both the electronic and lattice degrees of freedom

  18. Investigation of corrosion, water reaction, polonium evaporation and bismuth resource in liquid metal lead-bismuth technology

    International Nuclear Information System (INIS)

    Lead-bismuth is the first candidate material for liquid metal target find coolant of fueled blanket system in accelerator-driven system (ADS) studied at JAERI. Advantages of the lead-bismuth utilization are non-active material, very low capture cross section, low melting point of 125degC and high boiling point of 1670degC, and beside coolant void reactivity become negative. But problems are due to the high corrosivity to most of the structural materials and the corrosive data are scarcity. In this report, corrosivity, reaction with water, thermal-hydraulics, chemical toxicity etc. are studied by investigating some facilities utilized and researched really for lead or lead-bismuth. And, furthermore, polonium evaporation rate and bismuth resource are investigated. Main results obtained are as follows: (1) In a refinery, there are enough employment experience for liquid Pb-Bi in period of about 17 years and not corrosion for the thermal conductive materials (1Cr-0.5Mo steel) used under the condition of natural convection with temperature around 400degC. (2) In Russia, extensive experience in the use as Russian submarines and in R and D during about 50 years are available. And as a result, it will be able to lead approximately zero corrosion for Cr-Si materials by adjusting oxygen film with oxygen concentration control between 10-7 to 10-5% mass. However, the corrosion data are not enough systematically collected involving them in radiation dose field. (3) In liquid-dropping experiment, it is shown that interaction between water and high temperature liquid Pb-Bi is reduced steeply with rising of atmosphere pressure. But, in order to design the second circuit removal model of ADS, the interaction should be evaluated by water continuous injection experiment. (4) Polonium forms PbPo in Pb-Bi, and the evaporation rate become less three factor than that of Po, and furthermore, the rate decreases in the atmosphere. The effects of Po on employee and environment will not be

  19. Investigation of corrosion, water reaction, polonium evaporation and bismuth resource in liquid metal lead-bismuth technology

    Energy Technology Data Exchange (ETDEWEB)

    Takano, Hideki; Takizuka, Takakazu [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kitano, Teruaki [Mitsui Shipbuilding and Engineering Co. Ltd., Tokyo (Japan)


    Lead-bismuth is the first candidate material for liquid metal target find coolant of fueled blanket system in accelerator-driven system (ADS) studied at JAERI. Advantages of the lead-bismuth utilization are non-active material, very low capture cross section, low melting point of 125degC and high boiling point of 1670degC, and beside coolant void reactivity become negative. But problems are due to the high corrosivity to most of the structural materials and the corrosive data are scarcity. In this report, corrosivity, reaction with water, thermal-hydraulics, chemical toxicity etc. are studied by investigating some facilities utilized and researched really for lead or lead-bismuth. And, furthermore, polonium evaporation rate and bismuth resource are investigated. Main results obtained are as follows: (1) In a refinery, there are enough employment experience for liquid Pb-Bi in period of about 17 years and not corrosion for the thermal conductive materials (1Cr-0.5Mo steel) used under the condition of natural convection with temperature around 400degC. (2) In Russia, extensive experience in the use as Russian submarines and in R and D during about 50 years are available. And as a result, it will be able to lead approximately zero corrosion for Cr-Si materials by adjusting oxygen film with oxygen concentration control between 10{sup -7} to 10{sup -5}% mass. However, the corrosion data are not enough systematically collected involving them in radiation dose field. (3) In liquid-dropping experiment, it is shown that interaction between water and high temperature liquid Pb-Bi is reduced steeply with rising of atmosphere pressure. But, in order to design the second circuit removal model of ADS, the interaction should be evaluated by water continuous injection experiment. (4) Polonium forms PbPo in Pb-Bi, and the evaporation rate become less three factor than that of Po, and furthermore, the rate decreases in the atmosphere. The effects of Po on employee and environment

  20. 7 CFR 1219.203 - Reapportionment of membership. (United States)



  1. Ultra-flat bismuth films for diamagnetic levitation by template-stripping

    Energy Technology Data Exchange (ETDEWEB)

    Kokorian, J. [University of Twente, P.O. Box 217, 7500 AE Enschede (Netherlands); TU Delft — 3mE-PME, Mekelweg 2, 2628 CD Delft (Netherlands); Engelen, J.B.C. [University of Twente, P.O. Box 217, 7500 AE Enschede (Netherlands); IBM Research — Zurich, Säumerstrasse 4, CH-8803 Rüschlikon (Switzerland); Vries, J. de; Nazeer, H.; Woldering, L.A. [University of Twente, P.O. Box 217, 7500 AE Enschede (Netherlands); Abelmann, L., E-mail: [University of Twente, P.O. Box 217, 7500 AE Enschede (Netherlands)


    In this paper we present a method to deposit thin films of bismuth with sub-nanometer surface roughness for application to diamagnetic levitation. Evaporated films of bismuth have a high surface roughness with peak to peak values in excess of 100 nm and average values on the order of 20 nm. We expose the smooth backside of the films using a template stripping method, resulting in a great reduction of the average surface roughness, to 0.8 nm. Atomic force microscope and X-ray diffraction measurements show that the films have a polycrystalline texture with preferential c-axis orientation. On the back side of the film, fine grains are grouped into larger clusters. Cantilever resonance shift measurements indicate that the Young's modulus of the films is on the order of 20 GPa. - Highlights: • We deposited continuous but rough bismuth films of 200–500 nm in thickness by thermal evaporation. • We analyzed the material properties of bismuth films using a variety of measurement techniques. • We reduced the roughness of bismuth films from 20 nm to 0.8 nm by a template stripping method. • The Young's modulus of bismuth thin films is comparable to bulk bismuth.

  2. Layered bismuth oxyhalide nanomaterials for highly efficient tumor photodynamic therapy (United States)

    Xu, Yu; Shi, Zhenzhi; Zhang, Ling'e.; Brown, Eric Michael Bratsolias; Wu, Aiguo


    Layered bismuth oxyhalide nanomaterials have received much more interest as promising photocatalysts because of their unique layered structures and high photocatalytic performance, which can be used as potential inorganic photosensitizers in tumor photodynamic therapy (PDT). In recent years, photocatalytic materials have been widely used in PDT and photothermal therapy (PTT) as inorganic photosensitizers. This investigation focuses on applying layered bismuth oxyhalide nanomaterials toward cancer PDT, an application that has never been reported so far. The results of our study indicate that the efficiency of UV-triggered PDT was highest when using BiOCl nanoplates followed by BiOCl nanosheets, and then TiO2. Of particular interest is the fact that layered BiOCl nanomaterials showed excellent PDT effects under low nanomaterial dose (20 μg mL-1) and low UV dose (2.2 mW cm-2 for 10 min) conditions, while TiO2 showed almost no therapeutic effect under the same parameters. BiOCl nanoplates and nanosheets have shown excellent performance and an extensive range of applications in PDT.

  3. Mechanically activating formation of layered structured bismuth titanate

    International Nuclear Information System (INIS)

    Bismuth titanate-Bi4Ti3O12 (BIT) with wide application in the electronic industry as capacitors, memory devices and sensors is the simplest compound in the Aurivillius family, which consists of (Bi2O2)2+ sheets alternating with (Bi2Ti3O10)2- perovskite-like layers. The synthesis of more resistive BIT ceramics would be preferable advance in obtaining of well-densified ceramic with small grains randomly oriented to limit the conductivity along the (Bi2O2)2+ layers. Having in mind that the conventional ceramic route for the synthesis can lead to non-stoichiometry in composition, in consequence of the undesirable loss in bismuth content through volatilization of Bi2O3 at elevated temperature, our efforts were addressed to preparation of BIT by mechanical activation the constituent oxides. The nucleation and phase formation of BIT, crystal structure, microstructure, powder particle size and specific surface area were followed by XRD, Rietveld refinement analysis, thermal analysis, scanning electron microscopy (SEM) and the BET specific surface area measurements

  4. Superconductivity in Bismuth. A New Look at an Old Problem (United States)


    To investigate the relationship between atomic topology, vibrational and electronic properties and superconductivity of bismuth, a 216-atom amorphous structure (a-Bi216) was computer-generated using our undermelt-quench approach. Its pair distribution function compares well with experiment. The calculated electronic and vibrational densities of states (eDOS and vDOS, respectively) show that the amorphous eDOS is about 4 times the crystalline at the Fermi energy, whereas for the vDOS the energy range of the amorphous is roughly the same as the crystalline but the shapes are quite different. A simple BCS estimate of the possible crystalline superconducting transition temperature gives an upper limit of 1.3 mK. The e-ph coupling is more preponderant in a-Bi than in crystalline bismuth (x-Bi) as indicated by the λ obtained via McMillan’s formula, λc = 0.24 and experiment λa = 2.46. Therefore with respect to x-Bi, superconductivity in a-Bi is enhanced by the higher values of λ and of eDOS at the Fermi energy. PMID:26815431

  5. New Bismuth-Substituted Hydroxyapatite Nanoparticles for Bone Tissue Engineering (United States)

    Ciobanu, Gabriela; Bargan, Ana Maria; Luca, Constantin


    New bismuth-substituted hydroxyapatite [Ca10- x Bi x (PO4)6(OH)2 where x = 0-2.5] nanoparticles were synthesized by the co-precipitation method from aqueous solutions. The structural properties of the samples were analyzed by scanning electron microscopy coupled with x-ray analysis, x-ray powder diffraction, x-ray photoelectron spectroscopy, Fourier transform infrared spectroscopy and Brunauer-Emmett-Teller surface area analysis. The results confirm that bismuth ions have been incorporated into the hydroxyapatite lattice. The prepared nanocrystalline powders consisted of hydroxyapatite as single phase with hexagonal structure, crystal sizes smaller than 60 nm and (Bi + Ca)/P atomic ratio of around 1.67. The hydroxyapatite samples doped with Bi have mesoporous textures with pores size of around 2 nm and specific surface area in the range of 12-25 m2/g. The Bi-substituted hydroxyapatite powders are more effective against Gram-negative Escherichia coli bacteria than Gram-positive Staphylococcus aureus bacteria.

  6. Electrodeposition of bismuth alloys by the controlled potential method

    International Nuclear Information System (INIS)

    We worked with the electrodeposition of three bismuth alloys, the composition of the first electrolyte was: 0.3 g/l. Bi; 20 g/l. Ni; and the conditions were pH = 5.2 - 5.6; T = 25 Centigrade degrees; current density 0.3 A / dm2 - 6.6 A / dm2. Following alloy was between Bi - Pb, composition of the electrolyte was 3.18 g/l. Bi (metallic); 31.81 g/l. Pb (Pb(NO3)2) pH : 1; T = 20 Centigrade degrees; current density 10.20 A/dm2 . The third electrolyte was Bi-Cu, its composition was: 20.89 g/l. Bi; (metallic) 63.54 g/l Cu (Cu(NO3)2) pH : 1.5 - 1.8; T = 25-30 Centigrade degrees; current density 1-2 A/dm2 . The best results were obtained with the third electrolyte. The purpose of this work was to experiment with different parameters like temperature, pH and the electrolyte concentration to obtain a bismuth alloy. (Author)

  7. Synthesis and characterization of bismuth alkaline titanate powders

    Energy Technology Data Exchange (ETDEWEB)

    Torres-Huerta, A.M., E-mail: [CICATA-Altamira, Instituto Politecnico Nacional, Km. 14.5 Carretera Tampico Puerto Industrial Altamira, Altamira, Tamps. 89600 (Mexico); Dominguez-Crespo, M.A. [CICATA-Altamira, Instituto Politecnico Nacional, Km. 14.5 Carretera Tampico Puerto Industrial Altamira, Altamira, Tamps. 89600 (Mexico); Hernandez-Perez, M.A. [ESIQIE, Metalurgia, Instituto Politecnico Nacional, Mexico, D. F (Mexico); Garcia-Zaleta, D.S. [CICATA-Altamira, Instituto Politecnico Nacional, Km. 14.5 Carretera Tampico Puerto Industrial Altamira, Altamira, Tamps. 89600 (Mexico); Brachetti-Sibaja, S.B. [CICATA-Altamira, Instituto Politecnico Nacional, Km. 14.5 Carretera Tampico Puerto Industrial Altamira, Altamira, Tamps. 89600 (Mexico); Instituto Tecnologico de Ciudad Madero, Av. 1o. de Mayo esq. Sor Juana Ines de la Cruz s/n Col. Los Mangos C.P.89440 Cd. Madero Tamaulipas (Mexico)


    In this work, samples of bismuth alkaline titanate, (K{sub 0.5}Na{sub 0.5}){sub (2-x/2)}Bi{sub (x/6)}TiO{sub 3}, (x = 0.05-0.75) have been prepared by conventional ceramic technique and molten salts. Metal oxides or carbonates powders were used as starting raw materials. The crystalline phase of the synthesized powders was identified by the X-ray diffraction (XRD) and particle morphology was characterized by scanning electron microscopy (SEM). Solid state reaction method was unsuccessful to obtain pellets. From XRD results, a rhombohedral structure was detected and the parameter lattice were estimated to be a = 5.5478 A and {alpha} = 59.48{sup o}. These parameters were used to refine the structure by Rietveld analysis. SEM results showed several morphologies. Apparently, bismuth is promoting the grain growth whose sizes vary from 30 nm to 180 nm It is expected that these materials can be utilized in practical applications as substitutes for lead zirconatetitanate (PZT)-based ceramics.

  8. Phase transition of solid bismuth under high pressure (United States)

    Chen, Hai-Yan; Xiang, Shi-Kai; Yan, Xiao-Zhen; Zheng, Li-Rong; Zhang, Yi; Liu, Sheng-Gang; Bi, Yan


    As a widely used pressure calibrator, the structural phase transitions of bismuth from phase I, to phase II, to phase III, and then to phase V with increasing pressure at 300 K have been widely confirmed. However, there are different structural versions for phase III, most of which are determined by x-ray diffraction (XRD) technology. Using x-ray absorption fine structure (XAFS) measurements combined with ab initio calculations, we show that the proposed incommensurate composite structure of bismuth of the three configurations is the best option. An abnormal continuous increase of the nearest-neighbor distance of phase III with elevated pressure is also observed. The electronic structure transformation from semimetal to metal is responsible for the complex behavior of structure transformation. Project supported by the National Natural Science Foundation of China (Grant Nos. 10904133, 11304294, 11274281, 11404006, and U1230201), the Development Foundation of China Academy of Engineering Physics (Grant Nos. 2015B0101004, 2013B0401062, and 2012A0101001), the Research Foundation of the Laboratory of Shock Wave and Detonation, China (Grant No. 9140C670201140C67282).

  9. Genotoxic effects of bismuth (III oxide nanoparticles by comet assay

    Directory of Open Access Journals (Sweden)

    Reecep Liman


    Full Text Available Bismuth oxide is one of the important transition metal oxides and it has been intensively studied due to their peculiar characteristics (semiconductor band gap, high refractive index, high dielectric permittivity, high oxygen conductivity, resistivity, photoconductivity and photoluminescence etc.. Therefore, it is used such as microelectronics, sensor technology, optical coatings, transparent ceramic glass manufacturing, nanoenergetic gas generator, biosensor for DNA hybridization, potential immobilizing platforms for glucose oxidase and polyphenol oxidase, fuel cells, a additive in paints, an astringent in a variety of medical creams and topical ointments, and for the determination of heavy metal ions in drinking water, mineral water and urine. In addition this, Bismuth (III oxide nanoparticles (BONPs are favorable for the biomolecules adsorption than regular sized particles because of their greater advantages and novel characteristics (much higher specific surface, greater surface free energy, and good electrochemical stability etc.. Genotoxic effects of BONPs were investigated on the root cells of Allium cepa by Comet assay. A. cepa roots were treated with the aqueous dispersions of BONPs at 5 different concentrations (12.5, 25, 50, 75, and 100 ppm for 4 h. A significant increase in DNA damage was also observed at all concentrations of BONPs except 12.5 ppm by Comet assay. The results were also analyzed statistically by using SPSS for Windows; Duncan’s multiple range test was performed. These result indicate that BONPs exhibit genotoxic activity in A. cepa root meristematic cells.

  10. Synthesis and characterization of bismuth alkaline titanate powders

    International Nuclear Information System (INIS)

    In this work, samples of bismuth alkaline titanate, (K0.5Na0.5)(2-x/2)Bi(x/6)TiO3, (x = 0.05-0.75) have been prepared by conventional ceramic technique and molten salts. Metal oxides or carbonates powders were used as starting raw materials. The crystalline phase of the synthesized powders was identified by the X-ray diffraction (XRD) and particle morphology was characterized by scanning electron microscopy (SEM). Solid state reaction method was unsuccessful to obtain pellets. From XRD results, a rhombohedral structure was detected and the parameter lattice were estimated to be a = 5.5478 A and α = 59.48o. These parameters were used to refine the structure by Rietveld analysis. SEM results showed several morphologies. Apparently, bismuth is promoting the grain growth whose sizes vary from 30 nm to 180 nm It is expected that these materials can be utilized in practical applications as substitutes for lead zirconatetitanate (PZT)-based ceramics.

  11. Superconductivity in Bismuth. A New Look at an Old Problem.

    Directory of Open Access Journals (Sweden)

    Zaahel Mata-Pinzón

    Full Text Available To investigate the relationship between atomic topology, vibrational and electronic properties and superconductivity of bismuth, a 216-atom amorphous structure (a-Bi216 was computer-generated using our undermelt-quench approach. Its pair distribution function compares well with experiment. The calculated electronic and vibrational densities of states (eDOS and vDOS, respectively show that the amorphous eDOS is about 4 times the crystalline at the Fermi energy, whereas for the vDOS the energy range of the amorphous is roughly the same as the crystalline but the shapes are quite different. A simple BCS estimate of the possible crystalline superconducting transition temperature gives an upper limit of 1.3 mK. The e-ph coupling is more preponderant in a-Bi than in crystalline bismuth (x-Bi as indicated by the λ obtained via McMillan's formula, λc = 0.24 and experiment λa = 2.46. Therefore with respect to x-Bi, superconductivity in a-Bi is enhanced by the higher values of λ and of eDOS at the Fermi energy.

  12. Is the ultra-fast transformation of bismuth non-thermal?

    CERN Document Server

    Gamaly, E G


    Transient state of femtosecond laser excited bismuth has been studied by various groups with time-resolved optical, x-ray, and electron probes at the deposited energy density from below through up to several times the equilibrium enthalpy of melting. However, the interpretations of the experimental results are controversial: the optical probes reveal the absence of transition to the melting phase while the authors of x-ray and electron diffraction experiments claim the observation of ultrafast non-thermal melting. The presented analysis, based on temperature dependence of bismuth optical properties, unequivocally shows a purely thermal nature of all the observed fs-laser induced transformations in bismuth.

  13. A model bismuth oxide intergranular thin film in a ZnO twist grain boundary

    Energy Technology Data Exchange (ETDEWEB)

    Domingos, H S [INESC, Microsistemas and Nanotecnologias, Rua Alves Redol 1-9, P-1000-029 Lisbon (Portugal)


    The electronic properties of a model bismuth oxide intergranular film in ZnO were investigated using density functional plane wave calculations. It was found that oxygen excess plays a fundamental role in the appearance of electrical activity. The introduction by oxygen interstitials or zinc vacancies results in depletion of the charge in deep gap states introduced by the bismuth impurities. This makes the boundary less metallic and promotes the formation of acceptor states localized to the boundary core, resulting in Schottky barrier enhancement. The results indicate that the origin of electrical activity in thin intergranular bismuth oxide films is probably not distinct from that in decorated ZnO boundaries.

  14. Bismuth Modified Carbon-Based Electrodes for the Determination of Selected Neonicotinoid Insecticides


    Marko Rodić; Olga Vajdle; Valéria Guzsvány; Jasmina Zbiljić; Zsigmond Papp


    Two types of bismuth modified electrodes, a bismuth-film modified glassy carbon (BiF-GCE) and a bismuth bulk modified carbon paste, were applied for the determination of selected nitroguanidine neonicotinoid insecticides. The method based on an ex situ prepared BiF-GCE operated in the differential pulse voltammetric (DPV) mode was applied to determine clothianidin in the concentration range from 2.5 to 23 μg cm−3 with a relative standard deviation (RSD) not exceeding 1.5%. The tricresyl phosp...

  15. Structural and optical characterization of thermally evaporated bismuth and antimony films for photovoltaic applications (United States)

    Srimathy, N.; Ruban Kumar, A.


    In this present study, the thin film of bismuth and antimony is coated by thermal evaporation system equipped with the inbuilt ultra high vacuum system. XRD analysis confirmed the rhombohedral structure of Bismuth and Antimony on the prepared film. The surface roughness and physical appearance is analyzed by Atomic force microscopy. The results of Raman Spectroscopy show the wave functions and the spectrum of electrons. The preparation technique and conditions strongly influence the crystalline structure and the phase composition of bismuth and antimony thin films. The electrical and optical properties for the prepared film are analyzed. The results show a great interest and promising applications in Photovoltaic devices.

  16. Exploiting Chemistry to Improve Performance of Screen-Printed, Bismuth Film Electrodes (SP-BiFE) (United States)

    Dossi, Carlo; Monticelli, Damiano; Pozzi, Andrea; Recchia, Sandro


    Mercury substitution is a big issue in electroanalysis, and the search for a suitable, and less toxic, replacement is still under development. Of all the proposed alternatives, bismuth films appear to be the most viable solution, although they are still suffering some drawbacks, particularly the influence of deposition conditions and linearity at low concentrations. In this paper, the most promising strategies for bismuth film deposition on screen-printed electrodes (surface modifications, polymeric film deposition, insoluble salt precursors) will be evaluated for trace metal analysis. Particular attention will be devoted to bismuth chemistry, aiming to rationalize their electroanalytic performance. PMID:27455338

  17. Exploiting Chemistry to Improve Performance of Screen-Printed, Bismuth Film Electrodes (SP-BiFE

    Directory of Open Access Journals (Sweden)

    Carlo Dossi


    Full Text Available Mercury substitution is a big issue in electroanalysis, and the search for a suitable, and less toxic, replacement is still under development. Of all the proposed alternatives, bismuth films appear to be the most viable solution, although they are still suffering some drawbacks, particularly the influence of deposition conditions and linearity at low concentrations. In this paper, the most promising strategies for bismuth film deposition on screen-printed electrodes (surface modifications, polymeric film deposition, insoluble salt precursors will be evaluated for trace metal analysis. Particular attention will be devoted to bismuth chemistry, aiming to rationalize their electroanalytic performance.

  18. 9 CFR 205.203 - Place of filing EFS. (United States)


    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Place of filing EFS. 205.203 Section 205.203 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE CLEAR TITLE-PROTECTION FOR PURCHASERS OF...

  19. 24 CFR 203.382 - Cancellation of hazard insurance. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Cancellation of hazard insurance. 203.382 Section 203.382 Housing and Urban Development Regulations Relating to Housing and Urban... Cancellation of hazard insurance. The mortgagee shall cancel any hazard insurance policy as of the date of...

  20. 48 CFR 203.570-3 - Contract clause. (United States)


    ..., DEPARTMENT OF DEFENSE GENERAL IMPROPER BUSINESS PRACTICES AND PERSONAL CONFLICTS OF INTEREST Other Improper Business Practices 203.570-3 Contract clause. Use the clause at 252.203-7001, Prohibition on Persons... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contract clause....

  1. 49 CFR 1540.203 - Security threat assessment. (United States)


    ... check conducted by TSA. (2) A security threat assessment conducted under 49 CFR part 1572 for the... 49 Transportation 9 2010-10-01 2010-10-01 false Security threat assessment. 1540.203 Section 1540... Security Threat Assessments § 1540.203 Security threat assessment. (a) Each operator subject to...

  2. 24 CFR 203.255 - Insurance of mortgage. (United States)


    ... obligations under § 203.10 concerning informed consumer choice for prospective FHA mortgagors); (4) Not... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance of mortgage. 203.255... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER...

  3. 24 CFR 203.316 - Termination by prepayment of mortgage. (United States)


    ... mortgage. 203.316 Section 203.316 Housing and Urban Development Regulations Relating to Housing and Urban... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Termination of Insurance...

  4. 48 CFR 1328.203-7 - Exclusion of individual sureties. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Exclusion of individual sureties. 1328.203-7 Section 1328.203-7 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE... Exclusion of individual sureties. The designee authorized to exclude an individual from acting as a...

  5. 48 CFR 1328.203 - Acceptability of individual sureties. (United States)


    ... individual sureties. 1328.203 Section 1328.203 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE... Acceptability of individual sureties. (a) Contracting officers shall obtain the opinion of the Procurement Counsel as to the adequacy of the documents pledging the assets of an individual surety prior to...

  6. 48 CFR 28.203 - Acceptability of individual sureties. (United States)


    ... individual sureties. 28.203 Section 28.203 Federal Acquisition Regulations System FEDERAL ACQUISITION... Acceptability of individual sureties. (a) An individual surety is acceptable for all types of bonds except position schedule bonds. The contracting officer shall determine the acceptability of individuals...

  7. 10 CFR 63.203 - Implementation of Subpart K. (United States)


    ... 10 Energy 2 2010-01-01 2010-01-01 false Implementation of Subpart K. 63.203 Section 63.203 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN A GEOLOGIC REPOSITORY AT YUCCA MOUNTAIN, NEVADA Preclosure Public Health and Environmental Standards §...

  8. 48 CFR 1326.203 - Transition of work. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Transition of work. 1326.203 Section 1326.203 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE SOCIOECONOMIC... work. The designee authorized to determine that transitioning response, relief, and/or...

  9. 48 CFR 26.203 - Transition of work. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Transition of work. 26.203... PROGRAMS OTHER SOCIOECONOMIC PROGRAMS Disaster or Emergency Assistance Activities 26.203 Transition of work... emergency response work to local firms (e.g., unnecessarily broad scopes of work or long periods...

  10. 24 CFR 203.554 - Enforcement of late charges. (United States)


    ... on the part of the mortgagor is the failure to pay a late charge or charges (§ 203.25), except as provided in § 203.556. (b) A late charge attributable to a particular installment payment due under the... mortgagor of his obligation to pay a late charge, such a charge may be deducted from any subsequent...

  11. 48 CFR 5416.203-4 - Contract clauses. (United States)


    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Contract clauses. 5416.203-4 Section 5416.203-4 Federal Acquisition Regulations System DEFENSE LOGISTICS AGENCY, DEPARTMENT OF... established price or cost index may be derived from sales prices in the marketplace, quotes, or assessments...

  12. 41 CFR 109-38.203 - Agency identification. (United States)


    ... Administrative Services, Logistics Management Division, Headquarters, using DOE Form 4250.2, “Requisition for... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Agency identification. 109-38.203 Section 109-38.203 Public Contracts and Property Management Federal Property...

  13. 24 CFR 570.203 - Special economic development activities. (United States)


    ... HOUSING AND URBAN DEVELOPMENT COMMUNITY FACILITIES COMMUNITY DEVELOPMENT BLOCK GRANTS Eligible Activities... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Special economic development activities. 570.203 Section 570.203 Housing and Urban Development Regulations Relating to Housing and...

  14. 33 CFR 203.51 - Levee owner's manual. (United States)


    ... Maintenance Manual specified by 33 CFR 208.10(a)(10) will fulfill the requirement of providing a levee owner's... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Levee owner's manual. 203.51... Program § 203.51 Levee owner's manual. (a) Authority. In accordance with section 202(f) of Public Law...

  15. 5 CFR 1201.203 - Proceedings for attorney fees. (United States)


    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Proceedings for attorney fees. 1201.203... PRACTICES AND PROCEDURES Attorney Fees (Plus Costs, Expert Witness Fees, and Litigation Expenses, Where Applicable), Consequential Damages, and Compensatory Damages § 1201.203 Proceedings for attorney fees....

  16. 41 CFR 105-54.203-2 - Active charters file. (United States)


    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Active charters file. 105-54.203-2 Section 105-54.203-2 Public Contracts and Property Management Federal Property Management... charters file. The GSA Committee Management Officer retains each original signed charter in a file...

  17. 48 CFR 236.203 - Government estimate of construction costs. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Government estimate of...-ENGINEER CONTRACTS Special Aspects of Contracting for Construction 236.203 Government estimate of construction costs. Follow the procedures at PGI 236.203 for handling the Government estimate of...

  18. 29 CFR 1952.203 - Compliance staffing benchmarks. (United States)


    ... 29 Labor 9 2010-07-01 2010-07-01 false Compliance staffing benchmarks. 1952.203 Section 1952.203... Compliance staffing benchmarks. Under the terms of the 1978 Court Order in AFL-CIO v. Marshall, compliance staffing levels (benchmarks) necessary for a “fully effective” enforcement program were required to...

  19. 24 CFR 203.400 - Method of payment. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Method of payment. 203.400 Section... FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Payment of Insurance Benefits § 203.400 Method of payment. If the application for insurance benefits is acceptable to the Commissioner payment...

  20. 42 CFR 447.203 - Documentation of payment rates. (United States)


    ... (CONTINUED) MEDICAL ASSISTANCE PROGRAMS PAYMENTS FOR SERVICES Payment Methods: General Provisions § 447.203 Documentation of payment rates. (a) The agency must maintain documentation of payment rates and make it... 42 Public Health 4 2010-10-01 2010-10-01 false Documentation of payment rates. 447.203 Section...

  1. 24 CFR 203.434 - Declaration of trust. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Declaration of trust. 203.434... Mortgage § 203.434 Declaration of trust. A sale of a beneficial interest in a group of insured mortgages... interest in a specific mortgage shall be made only pursuant to a declaration of trust, which has...

  2. Shielding property of bismuth glass based on MCNP 5 and WINXCOM simulated calculation

    International Nuclear Information System (INIS)

    Background: Currently, lead glass is widely used as observation window, while lead is toxic heavy metal. Purpose: Non-toxic materials and their shielding effects are researched in order to find a new material to replace lead containing material. Methods: The mass attenuation coefficients of bismuth silicate glass were investigated with gamma-ray's energy at 0.662 MeV, 1.17 MeV and 1.33 MeV, respectively, by MCNP 5 (Monte Carlo) and WINXCOM program, and compared with those of the lead glass. Results: With attenuation factor K, shielding and mechanical properties taken into consideration bismuth glass containing 50% bismuth oxide might be selected as the right material. Dose rate distributions of water phantom were calculated with 2-cm and 10-cm thick glass, respectively, irradiated by 137Cs and 60Co in turn. Conclusion: Results show that the bismuth glass may replace lead glass for radiation shielding with appropriate energy. (authors)

  3. In situ formation of bismuth nanoparticles through electron-beam irradiation in a transmission electron microscope (United States)

    Sepulveda-Guzman, S.; Elizondo-Villarreal, N.; Ferrer, D.; Torres-Castro, A.; Gao, X.; Zhou, J. P.; Jose-Yacaman, M.


    In this work, bismuth nanoparticles were synthesized when a precursor, sodium bismuthate, was exposed to an electron beam at room temperature in a transmission electron microscope (TEM). The irradiation effects were investigated in situ using selected-area electron diffraction, high-resolution transmission electron microscopy and x-ray energy dispersive spectroscopy. After the electron irradiation, bismuth nanoparticles with a rhombohedral structure and diameter of 6 nm were observed. The average particle size increased with the irradiation time. The electron-induced reduction is attributed to the desorption of oxygen ions. This method offers a one-step route to synthesize bismuth nanoparticles using electron irradiation, and the particle size can be controlled by the irradiation time.

  4. In situ formation of bismuth nanoparticles through electron-beam irradiation in a transmission electron microscope

    Energy Technology Data Exchange (ETDEWEB)

    Sepulveda-Guzman, S; Elizondo-Villarreal, N; Ferrer, D; Torres-Castro, A; Gao, X; Zhou, J P; Jose-Yacaman, M [Chemical Engineering Department and Texas Materials Institute, University of Texas at Austin, Austin, TX 78712 (United States)


    In this work, bismuth nanoparticles were synthesized when a precursor, sodium bismuthate, was exposed to an electron beam at room temperature in a transmission electron microscope (TEM). The irradiation effects were investigated in situ using selected-area electron diffraction, high-resolution transmission electron microscopy and x-ray energy dispersive spectroscopy. After the electron irradiation, bismuth nanoparticles with a rhombohedral structure and diameter of 6 nm were observed. The average particle size increased with the irradiation time. The electron-induced reduction is attributed to the desorption of oxygen ions. This method offers a one-step route to synthesize bismuth nanoparticles using electron irradiation, and the particle size can be controlled by the irradiation time.

  5. Surface tension of liquid dilute solutions of lead-cesium and bismuth-cesium systems

    International Nuclear Information System (INIS)

    Method of the maximal pressure in a drop was used to measure the surface tension of 15 liquid dilute solutions of lead-cesium system in 0-0.214 at% concentration range and of 12 diluted solutions of bismuth-cesium system in 0-0.160 at.% cesium range from solidification temperature up to 500 dec C. It was found that cesium was characterized as surfactant in lead and bismuth melts. It was established that the temperature coefficient of surface tension changes sufficiently in maximally diluted solutions of alkali metals in bismuth and lead melts. Effect of sodium, potassium, rubidum and cesium on the value of surface tension of lead and bismuth was systematized. Growth of activity in sodium, potassium, rubidium and cesium series was noted

  6. Three-component synthesis of amidoalkyl naphthols catalyzed by bismuth(Ⅲ) nitrate pentahydrate

    Institute of Scientific and Technical Information of China (English)

    Min Wang; Yan Liang; Ting Ting Zhang; Jing Jing Gao


    Bismuth(Ⅲ) nitrate pentahydrate catalyzed the three-component condensation of β-naphthol,aldehydes and amines/urea under solvent-free conditions to afford the corresponding amidoalkyl naphthols in excellent yields.

  7. Corrosion by liquid lead and lead-bismuth: experimental results review and analysis

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Jinsuo [Los Alamos National Laboratory


    Liquid metal technologies for liquid lead and lead-bismuth alloy are under wide investigation and development for advanced nuclear energy systems and waste transmutation systems. Material corrosion is one of the main issues studied a lot recently in the development of the liquid metal technology. This study reviews corrosion by liquid lead and lead bismuth, including the corrosion mechanisms, corrosion inhibitor and the formation of the protective oxide layer. The available experimental data are analyzed by using a corrosion model in which the oxidation and scale removal are coupled. Based on the model, long-term behaviors of steels in liquid lead and lead-bismuth are predictable. This report provides information for the selection of structural materials for typical nuclear reactor coolant systems when selecting liquid lead or lead bismuth as heat transfer media.

  8. Standard triple, bismuth pectin quadruple and sequential therapies for Helicobacter pylori eradication


    Gao, Xiao-Zhong; Qiao, Xiu-li; Song, Wen-chong; Wang, Xiao-Feng; Liu, Feng


    AIM: To compare the effectiveness of standard triple, bismuth pectin quadruple and sequential therapies for Helicobacter pylori (H. pylori) eradication in a randomized, double-blinded, comparative clinical trial in China.

  9. Vibrational spectra and structure of bismuth based quaternary glasses

    International Nuclear Information System (INIS)

    Quaternary bismuthate glasses containing Li2O, ZnO and B2O3 have been prepared by melt quench technique and studied by density, DSC, IR and Raman spectroscopy. Raman and infrared spectroscopy have been employed to investigate the (75 - x)Bi2O3-xLi2O-10ZnO-15B2O3 glasses in order to obtain information about the competitive role of Bi2O3 and B2O3 in the formation of glass network. The increase of Bi2O3 content causes a progressive conversion of three- to four-fold coordinated boron. IR and Raman spectra show that these glasses are made up of [BiO3] pyramidal and [BiO6] octahedral units. The formation of Zn in tetrahedral coordination was observed

  10. Structural investigation of Zn doped sodium bismuth borate glasses (United States)

    Bhatia, V.; Kumar, D.; Singh, D.; Singh, S. P.


    A series of Bismuth Borate Oxide Glass samples with composition x(ZnO):(15-x)Na2O:15Bi2O3:70B2O3 (variation in x is from 6 to 12 mole %) have been prepared by conventional melt quenching technique. All the chemicals used were of Analytical Grade. In order to verify the amorphous nature of the prepared samples the X-Ray Diffraction (XRD) was done. The physical and structural properties have been explored by using the techniques such as density, molar volume and FTIR in order to understand the effect of alkali and transition metal ions on the structure of these glasses. The results obtained by these techniques are in good agreement to one another and with literature as well. With the increase in the content of ZnO, the increase in density and some variations in structural coordination (ratio of BO3 & BO4 structural units) have been observed.

  11. High power and compact switchable bismuth based multiwavelength fiber laser

    International Nuclear Information System (INIS)

    A compact switchable multiwavelength fibre laser (SWFL) is proposed and demonstrated using a bismuth based erbium doped fibre amplifier (Bi-EDFA) and a Sagnac loop mirror (SLM) in a ring cavity. The proposed compact SWFL can generate up to 6 switchable wavelengths with an average peak power of 11 dBm and also shows good stability over time with a high side mode signal ratio (SMSR) of 40 dB that negates minor fluctuations in the laser output. The Bi-EDF based gain medium gives the SWFL a large usable bandwidth of up to 80 nm, and it is expected that this will allow the SWFL to be used as a tunable laser source for high power applications to meet increasing demand

  12. Terahertz radiation from bismuth surface induced by femtosecond laser pulses. (United States)

    Ilyakov, I E; Shishkin, B V; Fadeev, D A; Oladyshkin, I V; Chernov, V V; Okhapkin, A I; Yunin, P A; Mironov, V A; Akhmedzhanov, R A


    We report on the first experimental observation of terahertz (THz) wave generation from bismuth mono- and polycrystalline samples irradiated by femtosecond laser pulses. Dependencies of the THz signal on the crystal orientation, optical pulse energy, incidence angle, and polarization are presented and discussed together with features of the sample surfaces. The optical-to-THz conversion efficiency was up to two orders of magnitude higher than for metal at a moderate fluence of ∼1  mJ/cm2. We also found nonlinear effects not previously observed using other metal and semiconductor materials: (a) asymmetry of THz response with respect to a half-turn of a sample around its normal, (b) THz polarization control by orientation of the sample surface, and PMID:27628379

  13. Evaporation of mercury impurity from liquid lead–bismuth eutectic

    International Nuclear Information System (INIS)

    The equilibrium evaporation of mercury from dilute solutions in liquid lead–bismuth eutectic (LBE) was studied in argon atmosphere. Mercury present as impurity in LBE was evaporated and detected by atomic fluorescence spectroscopy. A method which could accurately simulate the experimental data was developed. Coefficients of the Henry constant temperature correlation for mercury dissolved in LBE were determined. Experiments with samples from several different batches of LBE revealed that mercury at mole fractions between 10−6 and 10−12 and temperatures between 150 and 350 °C evaporated from liquid LBE close to ideal behavior. Evaporation of mercury from solid LBE on the other hand was unexpectedly high. These results are important for safety evaluations of LBE based spallation targets and accelerator driven systems

  14. Enhanced multiferroic properties of Pr doped bismuth ferrite ceramics

    International Nuclear Information System (INIS)

    Pr modified Bi0.9-xLa0.1PrxFeO3 (BLPFO-x, x = 0, 0.1 and 0.2) ceramics were prepared by solid state reaction using oxide reagents and a detailed multiferroic properties is reported. X-ray analysis shows the formation of a bismuth ferrite rhombohedral phase. Pr doping significantly increases the resistivity and leads to a successful observation of electrical polarization hysteresis loops. All the samples have been found to possess a spontaneous magnetic moment at room temperature which increases further at low temperatures. The strong dependence of remnant polarization and dielectric constant on the strength of magnetic field is a direct evidence of magnetoelectric coupling in BLPFO ceramics. (author)

  15. Compatibility of structural materials with liquid bismuth, lead, and mercury

    Energy Technology Data Exchange (ETDEWEB)

    Weeks, J.R. [Brookhaven National Lab., Upton, NY (United States)


    During the 1950s and 1960s, a substantial program existed at Brookhaven National Laboratory as part of the Liquid Metal Fuel reactor program on the compatibility of bismuth, lead, and their alloys with structural materials. Subsequently, compatibility investigations of mercury with structural materials were performed in support of development of Rankine cycle mercury turbines for nuclear applications. The present talk will review present understanding of the corrosion/mass-transfer reactions of structural materials with these liquid metal coolants. Topics to be discussed include the basic solubility relationships of iron, chromium, nickel, and refractory metals in these liquid metals, the results of inhibition studies, the role of oxygen on the corrosion processes, and specialized topics such as cavitation-corrosion and liquid metal embrittlement. Emphasis will be placed on utilizing the understanding gained in this earlier work on the development of heavy liquid metal targets in spallation neutron sources.

  16. Bismuth Sodium Titanate Based Materials for Piezoelectric Actuators

    Directory of Open Access Journals (Sweden)

    Klaus Reichmann


    Full Text Available The ban of lead in many electronic products and the expectation that, sooner or later, this ban will include the currently exempt piezoelectric ceramics based on Lead-Zirconate-Titanate has motivated many research groups to look for lead-free substitutes. After a short overview on different classes of lead-free piezoelectric ceramics with large strain, this review will focus on Bismuth-Sodium-Titanate and its solid solutions. These compounds exhibit extraordinarily high strain, due to a field induced phase transition, which makes them attractive for actuator applications. The structural features of these materials and the origin of the field-induced strain will be revised. Technologies for texturing, which increases the useable strain, will be introduced. Finally, the features that are relevant for the application of these materials in a multilayer design will be summarized.

  17. Bismuth coatings deposited by the pulsed dc sputtering technique

    Energy Technology Data Exchange (ETDEWEB)

    Ortiz, M. F.; Olaya, J. J.; Alfonso, J. E., E-mail: [Universidad Nacional de Colombia, Departamento de Fisica, Grupo de Ciencia de Materiales y Superficies, Carrera 45 No. 26-85, Edif. Uriel Gutierrez, Bogota D. C. (Colombia)


    In this work we present the results obtained from the deposition of nano-structured bismuth coatings through Dc pulsed unbalanced magnetron sputtering. The coatings were grown on two substrates: silicon and AISI steel 316 L. The microstructure of the Bi coatings grown on silicon and the corrosion resistance of the Bi coatings grown on AISI steel were evaluated. The microstructure was evaluated by X-ray diffraction and the corrosion resistance was characterized by means of polarization potentiodynamic and electrochemical impedance spectroscopy. Finally the morphology of the coatings was evaluated through scanning electronic microscopy. The X-ray diffraction analysis indicates that the coatings are polycrystalline; the corrosion resistance tests indicate that the films with better corrosion resistance were deposited at 40 khz. Scanning electron microscopy micrographs show that the coatings are grown as granular form. (Author)

  18. Formic Acid Oxidation at Platinum-Bismuth Clusters

    DEFF Research Database (Denmark)

    Lovic, J. D.; Stevanovic, S. I.; Tripkovic, D. V.;


    . Catalysts prepared in this way exhibit about 10 times higher activity for formic acid oxidation in comparison to pure Pt, as revealed both by potentiodynamic and quasy-potentiostatic measurements. This high activity is the result of well-balanced ensemble effect induced by Bi-oxide species interrupting Pt......Formic acid oxidation was studied on platinum-bismuth deposits on glassy carbon (GC) substrate. The catalysts of equimolar ratio were prepared by potentiostatic deposition using chronocoulometry. Bimetallic structures obtained by two-step process, comprising deposition of Bi followed by deposition...... domains. Prolonged cycling and chronoamperometry tests disclosed exceptional stability of the catalyst during formic acid oxidation. The activity is compatible with the activity of previously studied Pt2Bi alloy but the stability is significantly better. (C) 2014 The Electrochemical Society. All rights...

  19. Ni-rich precipitates in a lead bismuth eutectic loop (United States)

    Kikuchi, K.; Saito, S.; Hamaguchi, D.; Tezuka, M.


    Solidified LBE was sampled from the specimens, electro-magnetic pump, filter, drain valve and oxygen sensor at the JAEA Lead Bismuth Loop-1 (JLBL-1) where the structural material was made of SS316. The concentration of Ni, Fe and Cr in LBE were analyzed by the Inductive Coupled Plasma atomic emission spectrometer. It was concluded that the solution of Ni into LBE was not saturated although the concentration of Fe and Cr almost achieved to the values in the literature. A needle-type structure appeared on the surface of solidified LBE inside the tube specimens. It was found to be Ni-rich precipitates by X-ray analyses (Field Emission Scanning Electron Microscope, FE-SEM). LBE samples collected from a circulating loop after discharging did not show the amount of impurities equivalent to the LBE bulk property.

  20. Evaporation of mercury impurity from liquid lead–bismuth eutectic

    Energy Technology Data Exchange (ETDEWEB)

    Aerts, A., E-mail: [SCK-CEN (Belgian Nuclear Research Centre), Boeretang 200, 2400 Mol (Belgium); Danaci, S. [SCK-CEN (Belgian Nuclear Research Centre), Boeretang 200, 2400 Mol (Belgium); Gonzalez Prieto, B. [SCK-CEN (Belgian Nuclear Research Centre), Boeretang 200, 2400 Mol (Belgium); Centre for Surface Chemistry and Catalysis, KU Leuven, Kasteelpark Arenberg 23, 3001 Heverlee (Belgium); Van den Bosch, J. [SCK-CEN (Belgian Nuclear Research Centre), Boeretang 200, 2400 Mol (Belgium); Neuhausen, J. [Laboratory for Radio- and Environmental Chemistry, Paul Scherrer Institute, CH-5232 Villigen PSI (Switzerland)


    The equilibrium evaporation of mercury from dilute solutions in liquid lead–bismuth eutectic (LBE) was studied in argon atmosphere. Mercury present as impurity in LBE was evaporated and detected by atomic fluorescence spectroscopy. A method which could accurately simulate the experimental data was developed. Coefficients of the Henry constant temperature correlation for mercury dissolved in LBE were determined. Experiments with samples from several different batches of LBE revealed that mercury at mole fractions between 10{sup −6} and 10{sup −12} and temperatures between 150 and 350 °C evaporated from liquid LBE close to ideal behavior. Evaporation of mercury from solid LBE on the other hand was unexpectedly high. These results are important for safety evaluations of LBE based spallation targets and accelerator driven systems.

  1. Toxicity of Volatile Methylated Species of Bismuth, Arsenic, Tin, and Mercury in Mammalian Cells In Vitro


    Rettenmeier, A W; Zimmermann, U.; Richard, J.; R. A. Diaz-Bone; Hippler, J; U. von Recklinghausen; Dopp, E.; Hirner, A. V.


    The biochemical transformation of mercury, tin, arsenic and bismuth through formation of volatile alkylated species performs a fundamental role in determining the environmental processing of these elements. While the toxicity of inorganic forms of most of these compounds are well documented (e.g., arsenic, mercury) and some of them are of relatively low toxicity (e.g., tin, bismuth), the more lipid-soluble organometals can be highly toxic. In the present study we investigated the cyto- and ge...

  2. Comparison of radiation shielding ratios of nano-sized bismuth trioxide and molybdenum (United States)

    Cho, J. H.; Kim, M. S.; Rhim, J. D.


    In this study, radiation shielding fibers using non-hazardous nano-sized bismuth trioxide and molybdenum instead of lead were developed and evaluated. Among the elements with high densities and atomic numbers, non-hazardous elements such as bismuth trioxide and molybdenum were chosen as a shielding element. Then, bismuth trioxide (Bi2O3) with average particle size 1-500 µm was ball milled for 10 min to produce a powdered form of nanoparticles with average particle size of 10-100 nm. Bismuth trioxide nanoparticles were dispersed to make a colloidal suspension, followed by spreading and hardening onto one or two sides of fabric, to create the radiation shielding fabric. The thicknesses of the shielding sheets using nano-sized bismuth and molybdenum were 0.4 and 0.7 mm. According to the lead equivalent test of X-ray shielding products suggested by KS, the equivalent dose was measured, followed by calculation of the shielding rate. The shielding rate of bismuth with 0.4 mm thickness and at 50 kVp was 90.5%, which is comparable to lead of 0.082 mm thickness. The shielding rate of molybdenum was 51.89%%, which is comparable to lead of 0.034 mm. At a thickness of 0.7 mm, the shielding rate of bismuth was 98.73%, equivalent to 0.101 mm Pb, whereas the shielding rate of molybdenum was 74.68%, equivalent to 0.045 mm Pb. In conclusion, the radiation shielding fibers using nano-sized bismuth developed in this study are capable of reducing radiation exposure by X-ray and its low-dose scatter ray.

  3. Study of bismuth minerals belonging to the mineralogical collection from the National Museum

    International Nuclear Information System (INIS)

    With the purpose of searching the presence of Tellurium minerals in the Ouro Preto-Mariana country, Minas Gerais State, and considering the existence of a great number of minerals in which this element come across allied with Bismuth, samples of the mineralogical collection of the Museu Nacional, proceeding that region and classified as Bismuth minerals were studied by X-ray fluorescence analysis and diffractometric analysis. In this report the results of this research are presented. (Author)

  4. Lead-bismuth eutectic corrosion behaviors of ferritic/martensitic steels in low oxygen concentration environment


    Liu, Jian; Shi, Quanqiang; Luan, He; Yan, Wei; Sha, Wei; Wang, Wei; Shan, Yiyin; Yang, Ke


    In order to investigate the compatibility of candidate structural materials with liquid metals, two kinds of ferritic/martensitic steels were chosen to contact with lead–bismuth eutectic in sealed quartz–glass tubes. The corrosion exposures were for 500 and 3000 h. Results showed that the oxidation layer and carbide dissolution layer on the two steels grew with contact time under oxygen unsaturated condition. Short-term corrosion behavior of a newly developed steel showed better lead–bismuth ...

  5. Intermetallic growth at the interface between copper and bismuth-tin solder


    Vollweiler, Fred O. P.


    Approved for public release; distribution is unlimited. Tin-bismuth alloys have been proposed as alternatives to lead containing solders for interconnection and packaging applications. Consequently, the interface between copper metallizations and bismuth-tin solders needs to be evaluated with respect to brittle intermetallic formation. In the binary Bi-Sn alloys both the Cu6Sn5 and Cu3Sn intermetallic phases were found at the Cu/ solder interface after exposure at 250 deg C, 300 deg C, and...

  6. Direct Electrochemical Synthesis of Bismuth(III) Phenoxides and their Coordination Compounds


    Harpreet Kaur; Baljit Singh


    Bismuth(III) phenoxides have been synthesized by electrochemical reactions of 1-naphthol, 2-naphthol, 4-aminophenol, 2-nitrophenol, 4-nitrophenol, 2-hydroxybenzoic acid, p-cresol, phenol, resorcinol, 2-tert-butylphenol and 2-tert-butyl-4-methoxyphenol at sacrificial bismuth anode and inert platinum cathode using tetrabutylammonium chloride as supporting electrolyte. The coordination compounds of these phenols with 1, 10-phenanthroline and 2, 2ʼ-bipyridyl have also been synthesized electrochem...

  7. Ferroelectric thin film bismuth titanate prepared from acetate precursors

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Yanxia; Hoelzer, D.T.; Schulze, W.A. [Alfred Univ., NY (United States); Tuttle, B.A.; Potter, B.G. [Sandia National Labs., Albuquerque, NM (United States)


    Bismuth titanate (Bi{sub 4}Ti{sub 3}O{sub 12}) thin films were fabricated by spin coat deposition followed by rapid thermal processing (RTP). Acetate derived solutions for deposition were synthesized by blending bismuth acetate in aqueous acetic acid and then adding titanium acetate. A series of electrically insulating, semiconducting and conducting substrates were evaluated for Bi{sub 4}Ti{sub 3}O{sub 12} film deposition. While X-ray diffraction and TEM analyses indicated that the initial perovskite crystallization temperature was 500{degrees}C or less for these Bi{sub 4}Ti{sub 3}O{sub 12} films, a 700{degrees}C crystallization treatment was used to obtain single phase perovskite films. Bi{sub 4}Ti{sub 3}O{sub 12} film crystallographic orientation was shown to depend on three factors: substrate surface morphology, the number of coating layers and thermal processing. While preferred c-direction orientation was observed for Bi{sub 4}Ti{sub 3}O{sub 12} films deposited on silver foil substrates, preferred a-direction orientation was obtained for films deposited on both Si and Pt coated Si wafers. The films were dense, smooth, crack free, and had grain sizes ranging from 20 nm to 100 nm. Film thickness and refractive index were determined using a combination of ellipsometry, waveguide refractometry and TEM measurements. Both low field dielectric and ferroelectric properties were measured for an 800 nm thick film deposited on a Pt coated MgO substrate. A remanent polarization of 38 {mu}C/cm{sup 2} and a coercive field of 98 kV/cm were measured for this film that was crystallized at 700{degrees}C.

  8. Polonium problem in lead-bismuth flow target

    Energy Technology Data Exchange (ETDEWEB)

    Pankratov, D.V.; Yefimov, E.I.; Bugreev, M.I. [State Scientific Centre of Russian Federation-Institute of Physics and Power Engineering, Obninsk (Russian Federation)


    Alpha-active polonium nuclides Po198 - Po210 are formed in a lead-bismuth target as results of reactions Bi{sup 209}(n,{gamma})Bi{sup 210} {yields} Po{sup 210}, Bi{sup 209}(p,xn)Po{sup 210} {yields} Po{sup 210 {minus} x} (x = 1-12), Pb{sup 208}({alpha},xn) {yields} Po{sup 210 {minus} x + 2} (x = 2-14). The most important nuclides are Po-210 (T{sub {1/2}}=138.4 day), Po-209 (T{sub {1/2}}=102 years) and Po-208 (T{sub {1/2}}=2.9 years). Polonium activity of the circuit for SINQ - conditions is about 15,000 Ci after 1-year operation. Polonium radiation hazard is connected with its output from the coolant and formation of aerosol and surface alpha-activity after the circuit break-down for repair works or in accidents. One of the important issues of polonium removal system creation is containing and storing polonium removed. Its storage in solidified alkaline is not expedient because of secondary neutron formation as a result of ({alpha},n) - reaction on oxygen and sodium nucleus. The estimations carried out demonstrated that by polonium concentration {approx} 100 Ci/l neutron current on the container surface can reach {approx} 10{sup 4}n/(cm{sup 2}s). Concentration and storage of polonium in solidified lead-bisumth seems the most convenient. The calculations demonstrated that in a 100 l container 50,000 Ci of polonium can be stored (as much as 3 times more than 1-year polonium product in SINQ-conditions) under temperature in the container less than melting point of lead bismuth (the wall temperature is about 100{degrees}C).

  9. Nano sized bismuth oxy chloride by metal organic chemical vapour deposition

    Energy Technology Data Exchange (ETDEWEB)

    Jagdale, Pravin, E-mail: [Department of Applied Science and Technology (DISAT), Politecnico di Torino, 10129 (Italy); Castellino, Micaela [Center for Space Human Robotics, Istituto Italiano di Tecnologia, Corso Trento 21, 10129 Torino (Italy); Marrec, Françoise [Laboratory of Condensed Matter Physics, University of Picardie Jules Verne (UPJV), Amiens 80039 (France); Rodil, Sandra E. [Instituto de Investigaciones en Materiales, Universidad Nacional Autonoma de Mexicom (UNAM), Mexico D.F. 04510 (Mexico); Tagliaferro, Alberto [Department of Applied Science and Technology (DISAT), Politecnico di Torino, 10129 (Italy)


    Metal organic chemical vapour deposition (MOCVD) method was used to prepare thin films of bismuth based nano particles starting from bismuth salts. Nano sized bismuth oxy chloride (BiOCl) crystals were synthesized from solution containing bismuth chloride (BiCl{sub 3}) in acetone (CH{sub 3}-CO-CH{sub 3}). Self-assembly of nano sized BiOCl crystals were observed on the surface of silicon, fused silica, copper, carbon nanotubes and aluminium substrates. Various synthesis parameters and their significant impact onto the formation of self-assembled nano-crystalline BiOCl were investigated. BiOCl nano particles were characterized by X-ray diffraction, X-ray photoelectron spectroscopy, field emission scanning electron microscopy, energy-dispersive X-ray spectroscopy and Micro-Raman spectroscopy. These analyses confirm that bismuth nanometer-sized crystal structures showing a single tetragonal phase were indeed bismuth oxy chloride (BiOCl) square platelets 18–250 nm thick and a few micrometres wide.

  10. Adverse events with bismuth salts for Helicobacter pylori eradication:Systematic review and meta-analysis

    Institute of Scientific and Technical Information of China (English)

    Alexander C Ford; Peter Malfertheiner; Monique Giguére; José Santana; Mostafizur Khan; Paul Moayyedi


    AIM:To assess the safety of bismuth used in Helicobacter pylori (H pylori) eradication therapy regimens.METHODS:We conducted a systematic review and meta-analysis.MEDLINE and EMBASE were searched (up to October 2007) to identify randomised controlled trials comparing bismuth with placebo or no treatment,or bismuth salts in combination with antibiotics as part of eradication therapy with the same dose and duration of antibiotics alone or,in combination,with acid suppression.Total numbers of adverse events were recorded.Data were pooled and expressed as relative risks with 95% confidence intervals (CI).RESULTS:We identified 35 randomised controlled trials containing 4763 patients.There were no serious adverse events occurring with bismuth therapy.There was no statistically significant difference detected in total adverse events with bismuth [relative risk (RR)=1.01;95% CI:0.87-1.16],specific individual adverse events,with the exception of dark stools (RR = 5.06;95% CI:1.59-16.12),or adverse events leading to withdrawal of therapy (RR = 0.86;95% CI:0.54-1.37).CONCLUSION:Bismuth for the treatment of H pylori is safe and well-tolerated.The only adverse event occurring significantly more commonly was dark stools.

  11. Exhaustive removal of chloride ions from water with the aid of a bismuth-based metallic sorbent

    Energy Technology Data Exchange (ETDEWEB)

    Moskvin, L.N.; Ushenko, V.G.


    The authors discuss the sorption properties of sorbents based on metallic bismuth, in relation to a solution of the problem of exhaustive removal of chloride ions from water. Metallic sorbents with bismuth contents of 10 mass % on polytetrafluoroethylene were used. The sorption properties of sorbents based on metallic bismuth and on Bi/sub 2/O/sub 3/ were studied under dynamic conditions. Their results show that bismuth-based metal sorbents and sorbents based on bismuth oxide can be used as inorganic anion-exchangers. In order to demonstrate the possibility of selective separation of chloride ions from solutions they determined the dynamic exchange capacity for chloride ions at various nitrate-ion concentrations. The use of the proposed sorbents based on metallic bismuth for exhaustive purification of water lowers the chloride-ion concentration in the water sharply in comparison with the level achieved by ion-exchange purification with the aid of organic anion-exchangers.

  12. Equilibrium and pre-equilibrium emissions in proton-induced reactions on 203,205Tl

    Indian Academy of Sciences (India)

    A Kaplan; A Aydin; E Tel; B Şarer


    In this study, the excitation functions for the reactions 203Tl(, )203Pb, 203Tl(, 3)203Pb, 203Tl(, 2)202Pb, 205Tl(, 4)202Pb, 203Tl(, 3)201Pb, 205Tl(, 5)201Pb, 203Tl(, 4)200Pb and 205Tl(, 6)200Pb have been calculated using pre-equilibrium and equilibrium reaction mechanisms. Calculated results based on hybrid model, geometry-dependent hybrid model and cascade-exciton model have been compared with the experimental data.

  13. New bismuth borophosphate Bi4BPO10: Synthesis, crystal structure, optical and band structure analysis

    International Nuclear Information System (INIS)

    New bismuth borophosphate Bi4BPO10 was obtained by spontaneous crystallization from the melt of correspondent composition at 804 °C. Crystal structure with orthorhombic lattice parameters: a = 22.5731(3) Å, b = 14.0523(2) Å, c = 5.5149(1) Å, V = 1749.34(4), Z = 8, SG Pcab was determined by X-ray powder diffraction technique. The [Bi2O2]2+ -layers, which are typical for bismuth oxide compounds, transform into cationic endless strips of 4 bismuth atoms width directed along the c-axis in Bi4BPO10. The strips combining stacks are separated by flat triangle [BO3]3− -anions within stacks. Neighboring stacks are separated by tetrahedral [PO4]3−-anions and shifted relatively to each other. Bismuth atoms are placed in 5–7 vertex oxygen irregular polyhedra. Bi4BPO10 is stable up to 812 °C, then melts according to the peritectic law. The absorption spectrum in the range 350–700 nm was obtained and the width of the forbidden band was estimated as 3.46 eV. The band electronic structure of Bi4BPO10 was modeled using DFT approach. The calculated band gap (3.56 eV) is in good agreement with the experimentally obtained data. - Graphical abstract: Display Omitted - Highlights: • New bismuth borophosphate with composition Bi4BPO10 was synthesized. • The crystal structure was determined by X-ray powder diffraction technique. • Bismuth-oxygen part [Bi4O3]6+ forms endless strips of 4 bismuth atoms width. • Electronic structure was modeled by DFT method. • The calculated band gap (3.56 eV) is very close to the experimental one (3.46 eV)

  14. Dextran coated bismuth-iron oxide nanohybrid contrast agents for computed tomography and magnetic resonance imaging. (United States)

    Naha, Pratap C; Zaki, Ajlan Al; Hecht, Elizabeth; Chorny, Michael; Chhour, Peter; Blankemeyer, Eric; Yates, Douglas M; Witschey, Walter R T; Litt, Harold I; Tsourkas, Andrew; Cormode, David P


    Bismuth nanoparticles have been proposed as a novel CT contrast agent, however few syntheses of biocompatible bismuth nanoparticles have been achieved. We herein report the synthesis of composite bismuth-iron oxide nanoparticles (BION) that are based on a clinically approved, dextran-coated iron oxide formulation; the particles have the advantage of acting as contrast agents for both CT and MRI. BION were synthesized and characterized using various analytical methods. BION CT phantom images revealed that the X-ray attenuation of the different formulations was dependent upon the amount of bismuth present in the nanoparticle, while T2-weighted MRI contrast decreased with increasing bismuth content. No cytotoxicity was observed in Hep G2 and BJ5ta cells after 24 hours incubation with BION. The above properties, as well as the yield of synthesis and bismuth inclusion efficiency, led us to select the Bi-30 formulation for in vivo experiments, performed in mice using a micro-CT and a 9.4 T MRI system. X-ray contrast was observed in the heart and blood vessels over a 2 hour period, indicating that Bi-30 has a prolonged circulation half-life. Considerable signal loss in T2-weighted MR images was observed in the liver compared to pre-injection scans. Evaluation of the biodistribution of Bi-30 revealed that bismuth is excreted via the urine, with significant concentrations found in the kidneys and urine. In vitro experiments confirmed the degradability of Bi-30. In summary, dextran coated BION are biocompatible, biodegradable, possess strong X-ray attenuation properties and also can be used as T2-weighted MR contrast agents.

  15. Bismuth oxide aqueous colloidal nanoparticles inhibit Candida albicans growth and biofilm formation

    Directory of Open Access Journals (Sweden)

    Hernandez-Delgadillo R


    Full Text Available Rene Hernandez-Delgadillo,1 Donaji Velasco-Arias,3 Juan Jose Martinez-Sanmiguel,2 David Diaz,3 Inti Zumeta-Dube,3 Katiushka Arevalo-Niño,1 Claudio Cabral-Romero2 1Facultad de Ciencias Biológicas, Instituto de Biotecnologia, Universidad Autonoma de Nuevo Leon, UANL, Monterrey, Mexico; 2Facultad de Odontología, Universidad Autonoma de Nuevo Leon, UANL, Monterrey, México; 3Facultad de Quimica, Universidad Nacional Autonoma de Mexico, UNAM, Distrito Federal, México Abstract: Multiresistance among microorganisms to common antimicrobials has become one of the most significant concerns in modern medicine. Nanomaterials are a new alternative to successfully treat the multiresistant microorganisms. Nanostructured materials are used in many fields, including biological sciences and medicine. Recently, it was demonstrated that the bactericidal activity of zero-valent bismuth colloidal nanoparticles inhibited the growth of Streptococcus mutans; however the antimycotic potential of bismuth nanostructured derivatives has not yet been studied. The main objective of this investigation was to analyze the fungicidal activity of bismuth oxide nanoparticles against Candida albicans, and their antibiofilm capabilities. Our results showed that aqueous colloidal bismuth oxide nanoparticles displayed antimicrobial activity against C. albicans growth (reducing colony size by 85% and a complete inhibition of biofilm formation. These results are better than those obtained with chlorhexidine, nystatin, and terbinafine, the most effective oral antiseptic and commercial antifungal agents. In this work, we also compared the antimycotic activities of bulk bismuth oxide and bismuth nitrate, the precursor metallic salt. These results suggest that bismuth oxide colloidal nanoparticles could be a very interesting candidate as a fungicidal agent to be incorporated into an oral antiseptic. Additionally, we determined the minimum inhibitory concentration for the synthesized

  16. Zerovalent bismuth nanoparticles inhibit Streptococcus mutans growth and formation of biofilm

    Directory of Open Access Journals (Sweden)

    Hernandez-Delgadillo R


    Full Text Available Rene Hernandez-Delgadillo1, Donaji Velasco-Arias2, David Diaz2, Katiushka Arevalo-Niño1, Marianela Garza-Enriquez1, Myriam A De la Garza-Ramos1, Claudio Cabral-Romero11Instituto de Biotecnologia, Centro de Investigacion y Desarrollo en Ciencias de la Salud, CIDICS, Facultad de Odontologia, Universidad Autonoma de Nuevo Leon, UANL, Monterrey, Nuevo Leon, 2Facultad de Quimica, Universidad Nacional Autonoma de Mexico, Distrito Federal, MexicoBackground and methods: Despite continuous efforts, the increasing prevalence of resistance among pathogenic bacteria to common antibiotics has become one of the most significant concerns in modern medicine. Nanostructured materials are used in many fields, including biological sciences and medicine. While some bismuth derivatives has been used in medicine to treat vomiting, nausea, diarrhea, and stomach pain, the biocidal activity of zerovalent bismuth nanoparticles has not yet been studied. The objective of this investigation was to analyze the antimicrobial activity of bismuth nanoparticles against oral bacteria and their antibiofilm capabilities.Results: Our results showed that stable colloidal bismuth nanoparticles had 69% antimicrobial activity against Streptococcus mutans growth and achieved complete inhibition of biofilm formation. These results are similar to those obtained with chlorhexidine, the most commonly used oral antiseptic agent. The minimal inhibitory concentration of bismuth nanoparticles that interfered with S. mutans growth was 0.5 mM.Conclusion: These results suggest that zerovalent bismuth nanoparticles could be an interesting antimicrobial agent to be incorporated into an oral antiseptic preparation.Keywords: zerovalent bismuth nanoparticles, antimicrobial agent, biofilm, Streptococcus mutans

  17. Electrical transport measurements of individual bismuth nanowires and carbon nanotubes (United States)

    Jang, Wan Young

    Nanostructures are defined by reducing dimensions. When the reduced size of materials is comparable to the Fermi wavelength, quantum size effect occurs. Dimensionality plays a critical role in determining the electronic properties of materials, because the density of states of materials is quite different. Nanowires have attracted much attention recently due to their fundamental interest and potential applications. A number of materials have been tried. Among them, bismuth has unique properties. Bismuth has the smallest effective mass as small as 0.001me. This small effective mass of Bi nanowires allows one to observe the quantum confinement effect easily. Also Bi nanowires are good candidates for a low-dimensional transport study due to long mean free path. Because of these remarkable properties of Bi nanowires, many efforts have been made to study Bi nanowires. However, because bismuth is extremely sensitive to the oxide, it is very difficult to make a reliable device. So far, array measurements of Bi nanowires have been reported. The study is focused on the synthesis and electric transport measurements of individual Bi nanowires. Bi nanowires are synthesized by electrodeposition using either anodic aluminum oxide (AAO) templates or commercially available track etched polycarbonate membranes (PCTE). The desired nanowire has a heterostructure of Au - Bi - Au. Au wires on both sides serve as contact electrodes with Bi. To extract nanowires from PCTE or AAO, several attempts have been made. Devices consisting of single Bi nanowires grown by hydrothermal method are fabricated and electrical measurements have been carried out after in-situ deposition of Pt electrodes. The temperature dependence of resistance of majority of nanowires increases with decreasing temperature, showing polycrystalline nature of nanowires. However, some nanowires show resistance peaks at low temperature, suggesting quantum size effect (QSE). Magnetoresistance (MR) has also been measured. We

  18. Spectroscopic Characterization of Extracellular Polymeric Substances from Escherichia coli and Serratia marcescens: Suppression using Sub-Inhibitory Concentrations of Bismuth Thiols

    Energy Technology Data Exchange (ETDEWEB)

    Badireddy, Appala R.; Korpol, Bhoom Reddy; Chellam, Shankararaman; Gassman, Paul L.; Engelhard, Mark H.; Lea, Alan S.; Rosso, Kevin M.


    Free and capsular EPS produced by Escherichia coli and Serratia marcescens were characterized in detail using Fourier transform infrared spectroscopy (FTIR), X-ray photoelectron spectroscopy (XPS), and Auger electron spectroscopy (AES). Total EPS production decreased upon treatment with sub-inhibitory concentrations of lipophilic bismuth thiols (bismuth dimercaptopropanol, BisBAL; bismuth ethanedithiol, BisEDT; and bismuth pyrithione, BisPYR), BisBAL being most effective. Bismuth thiols also influenced acetylation and carboxylation of polysaccharides in EPS from S. marcescens. Extensive homology between EPS samples in the presence and absence of bismuth was observed with proteins, polysaccharides, and nucleic acids varying predominantly only in the total amount expressed. Second derivative analysis of the amide I region of FTIR spectra revealed decreases in protein secondary structures in the presence of bismuth thiols. Hence, anti-fouling properties of bismuth thiols appear to originate in their ability to suppress O-acetylation and protein secondary structures in addition to total EPS secretion.

  19. 30 CFR 20.3 - Application procedures and requirements. (United States)


    ..., EVALUATION, AND APPROVAL OF MINING PRODUCTS ELECTRIC MINE LAMPS OTHER THAN STANDARD CAP LAMPS § 20.3... accrediting organization; (2) Complete technical explanation of how the product complies with each...

  20. 40 CFR 59.203 - Standards for consumer products. (United States)


    ... (CONTINUED) NATIONAL VOLATILE ORGANIC COMPOUND EMISSION STANDARDS FOR CONSUMER AND COMMERCIAL PRODUCTS National Volatile Organic Compound Emission Standards for Consumer Products § 59.203 Standards for consumer... those consumer products that are registered under the Federal Insecticide, Fungicide, and...

  1. 46 CFR 108.203 - Berths and lockers. (United States)


    ... EQUIPMENT Construction and Arrangement Accommodation Spaces § 108.203 Berths and lockers. (a) Each sleeping... pipe, ventilating duct, or other overhead installation. (i) Each berth must have a berth light....

  2. 18 CFR 701.203 - Schedule of fees. (United States)


    ... ORGANIZATION Availability of Information § 701.203 Schedule of fees. (a) The Public Information Officer will to... requester is advised promptly upon physical receipt of the request of the anticipated cost and agrees...

  3. 14 CFR 171.203 - Requests for IFR procedure. (United States)


    ...) NAVIGATIONAL FACILITIES NON-FEDERAL NAVIGATION FACILITIES VHF Marker Beacons § 171.203 Requests for IFR... beacon facility that he owns must submit the following information with that request: (1) A...

  4. Synthesis, Characterization and Molecular Structures of some Bismuth(III) Complexes with Thiosemicarbazones and Dithiocarbazonic Acid Methylester Derivatives with Activity against Helicobacter Pylori


    Diemer, Rolf; Dittes, Uwe; Nuber, Bernhard; Seifried, Volker; Opferkuch, Wolfgang; Keppler, Bernhard K.


    The reactions of bismuth(III) nitrate pentahydrate and bismuth(III) chloride with heterocyclic thiosemicarbazones and derivatives of dithiocarbazonic acid methylester were used to synthesize the respective bismuth(III) complexes, which could be divided into five groups D-H because of their stoichiometrical properties and their molecular structures. The molecular structure and the near coordination sphere of the bismuth(III) central atom of four representative compounds were determined by sing...

  5. Bismuth nanoparticles synthesized by laser ablation in lubricant oils for tribological tests

    Energy Technology Data Exchange (ETDEWEB)

    Flores-Castañeda, M., E-mail: [Universidad Autónoma del Estado de México, Av. Instituto Literario No. 100, Oriente Col. Centro, Toluca, Estado de México C.P. 50000, México (Mexico); Instituto Nacional de Investigaciones Nucleares, Carretera México-Toluca s/n, La Marquesa, Ocoyoacac, Edo. de México C.P. 52750, México (Mexico); Camps, E. [Instituto Nacional de Investigaciones Nucleares, Carretera México-Toluca s/n, La Marquesa, Ocoyoacac, Edo. de México C.P. 52750, México (Mexico); Camacho-López, M. [Universidad Autónoma del Estado de México, Av. Instituto Literario No. 100, Oriente Col. Centro, Toluca, Estado de México C.P. 50000, México (Mexico); Muhl, S. [Instituto de Investigación en Materiales (UNAM), Circuito Exterior, Ciudad Universitaria, Coyoacán, 04510 México, D.F., México (Mexico); and others


    Highlights: • Bismuth nanoparticles have been obtained by laser ablation of solids in liquids. • The technique allows controlling the size and concentration of the samples. • Bi np’s in base oils can improve the tribological characteristics of the lubricant. - Abstract: The improvement of the tribological properties of mineral base oils through the addition of bismuth nanoparticles as an additive, together with the idea of obtaining lubricants free of heavy metals, was evaluated. Bismuth nanoparticles were produced directly in the heavy and light viscosity mineral base oils (BS900 and BS6500) using the technique of laser ablation of solids immersed in liquids. Transmission electron microscopy measurements showed the presence of pure bismuth nanoparticles. Small Angle X-ray Scattering (SAXS) measurements showed that the average size of the nanoparticles was between 7 and 65 nm depending on the experimental conditions used. The tribological properties of the base oil with the bismuth nanoparticles additives were evaluated using a four-ball tester. Tests were performed using the base oil with and without Bi nanoparticles. It was observed that the coefficient of friction of the oil decrease with an increasing concentration of the nanoparticles. The results also showed that the wear rate was reduced when the Bi nanoparticle additives were used.

  6. Electrochemical study on determination of diffusivity, activity and solubility of oxygen in liquid bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Ganesan, Rajesh [Liquid Metals and Structural Chemistry Division, Chemistry Group, Indira Gandhi Centre for Atomic Research, Kalpakkam 603 102 (India); Gnanasekaran, T. [Liquid Metals and Structural Chemistry Division, Chemistry Group, Indira Gandhi Centre for Atomic Research, Kalpakkam 603 102 (India)]. E-mail:; Srinivasa, Raman S. [Department of Metallurgical Engineering and Materials Science, Indian Institute of Technology Bombay, Mumbai 400 076 (India)


    Diffusivity of oxygen in liquid bismuth was measured by potentiostatic method and is given bylg(D{sub O}{sup Bi}/cm{sup 2}.s{sup -1})(+/-0.042)=-3.706-1377/(TK{sup -1})(804bismuth was determined by coulometric titrations and using the measured data standard free energy of dissolution of oxygen in liquid bismuth was derived for the reaction:1/2O{sub 2}(g)=[O]{sub Bi}(at.%)and is given by{delta}G{sub O(Bi)}{sup o}/(J.g-atomO{sup -1})(+/-720)=-108784+20.356TK{sup -1}(753bismuth was derived as a function of temperature and is given by the following expressions:lg(S/at%O)(+/-0.05)=-4476/TK{sup -1}+4.05(753bismuth is compared with the literature data.

  7. Bismuth Modified Carbon-Based Electrodes for the Determination of Selected Neonicotinoid Insecticides

    Directory of Open Access Journals (Sweden)

    Marko Rodić


    Full Text Available Two types of bismuth modified electrodes, a bismuth-film modified glassy carbon (BiF-GCE and a bismuth bulk modified carbon paste, were applied for the determination of selected nitroguanidine neonicotinoid insecticides. The method based on an ex situ prepared BiF-GCE operated in the differential pulse voltammetric (DPV mode was applied to determine clothianidin in the concentration range from 2.5 to 23 μg cm−3 with a relative standard deviation (RSD not exceeding 1.5%. The tricresyl phosphate-based carbon paste electrodes (TCP-CPEs, bulk modified with 5 and 20 w/w% of bismuth, showed a different analytical performance in the determination of imidacloprid, regarding the peak shape, potential window, and noise level. The TCP-CPE with 5% Bi was advantageous, and the developed DPV method based on it allowed the determination in the concentration range from 1.7 to 60 μg cm−3 with an RSD of 2.4%. To get a deeper insight into the morphology of the bismuth-based sensor surfaces, scanning electron microscopic measurements were performed of both the surface film and the bulk modified electrodes.

  8. Role of bismuth in improving Helicobacter pylori eradication with triple therapy. (United States)

    Dore, Maria Pina; Lu, Hong; Graham, David Y


    In most regions of the world, antimicrobial resistance has increased to the point where empirical standard triple therapy forHelicobacter pylorieradication is no longer recommended. The treatment outcome in a population is calculated as the sum of the treatment success in the subpopulation with susceptible infections plus treatment success in the subpopulation with resistant infections. The addition of bismuth (ie, 14-day triple therapy plus bismuth) can improve cure rates despite a high prevalence of antimicrobial resistance. The major bismuth effect is to add an additional 30%-40% to the success with resistant infections. The overall result is therefore dependent on the prevalence of resistance and the treatment success in the subpopulation with resistant infections (eg, with proton-pump inhibitor-amoxicillin dual therapy). Here, we explore the contribution of each component and the mechanisms of how bismuth might enhance the effectiveness of triple therapy. We also discuss the limitations of this approach and provide suggestions how triple therapy plus bismuth might be further improved. PMID:26848181

  9. Synthesis and performance of bismuth trioxide nanoparticles for high energy gas generator use. (United States)

    Martirosyan, K S; Wang, L; Vicent, A; Luss, D


    Our experiments showed that the combustion of an Al-Bi2O3 nanoparticle mixture generated the highest pressure pulse among common nanothermite reactions and can potentially be used as a nanoenergetic gas generator. The combustion front propagation velocity and rate of energy release increased by up to three orders of magnitude when the particle size was reduced to a nanosize range for both the aluminum and the oxidizer. We developed a novel one-step (metal nitrate-glycine) combustion synthesis of nanostructured amorphous-like and highly crystalline bismuth trioxide nanoparticles. The combustion synthesis was conducted using a solution of molten bismuth nitrate as an oxidizer and glycine as a fuel. The glycine was completely combusted during the thermal decomposition of the bismuth nitrate pentahydrate and generated a temperature front that propagated through the sample. Increasing the fuel concentration increased the maximum combustion temperature from 280 to 1200 degrees C and the Bi2O3 particle size from 20 to 100 nm. The oxidizer/fuel ratio had a strong impact on the bismuth trioxide particle crystallinity. At low temperature (280 degrees C), amorphous-like bismuth trioxide nanoparticles formed, while at T > or =370 degrees C the structures were crystalline. A peak pressure of approximately 12 MPa and a thermal front propagating velocity of approximately 2500 m s(-1) were achieved during the combustion of an Al-Bi2O3 mixture containing 80 wt% of the synthesized Bi2O3 crystalline nanoparticles (size: 40-50 nm).

  10. Energy levels scheme simulation of divalent cobalt doped bismuth germanate

    Energy Technology Data Exchange (ETDEWEB)

    Andreici, Emiliana-Laura, E-mail: [Department of Physics, West University of Timisoara, Bd. V. Parvan 4,300223 Timisoara (Romania); Petkova, Petya [Shumen University “Konstantin Preslavsky”, 115 Universitetska street, 9712 Shumen (Bulgaria); Avram, Nicolae M. [Department of Physics, West University of Timisoara, Bd. V. Parvan 4,300223 Timisoara (Romania); Academy of Romanian Scientists, Independentei 54, 050094-Bucharest (Romania)


    The aim of this paper is to simulate the energy levels scheme for Bismuth Germanate (BGO) doped with divalent cobalt, in order to give a reliable explanation for spectral experimental data. In the semiempirical crystal field theory we first modeled the Crystal Field Parameters (CFPs) of BGO:Cr{sup 2+} system, in the frame of Exchange Charge Model (ECM), with actually site symmetry of the impurity ions after doping. The values of CFPs depend on the geometry of doped host matrix and by parameter G of ECM. First, we optimized the geometry of undoped BGO host matrix and afterwards, that of doped BGO with divalent cobalt. The charges effect of ligands and covalence bonding between cobalt cations and oxygen anions, in the cluster approach, also were taken into account. With the obtained values of the CFPs we simulate the energy levels scheme of cobalt ions, by diagonalizing the matrix of the doped crystal Hamiltonian. Obviously, energy levels and estimated Racah parameters B and C were compared with the experimental spectroscopic data and discussed. Comparison of obtained results with experimental data shows quite satisfactory, which justify the model and simulation schemes used for the title system.

  11. Aromatic amino acids in high selectivity bismuth(III) recognition. (United States)

    Ghatak, Sumanta Kumar; Dey, Debarati; Sen, Souvik; Sen, Kamalika


    The three aromatic amino acids, tyrosine, tryptophan and phenylalanine, play different physiological roles in life processes. Metal ions capable of binding these amino acids may aid in the reduction of effective concentration of these amino acids in any physiological system. Here we have studied the efficacy of some heavy metals for their complexation with these three amino acids. Bismuth has been found to bind selectively with these aromatic amino acids and this was confirmed using spectrofluorimetric, spectrophotometric and cyclic voltammetric studies. The series of heavy metals has been chosen because each of these metals remains associated with the others at very low concentration levels and Bi(III) is the least toxic amongst the other elements. So, selective recognition for Bi(III) would also mean no response for the other heavy elements if contaminants are present even at low concentration levels. The affinity towards these amino acids has been found to be in the order tryptophan phenylalanine amino acids have been calculated using Benesi-Hildebrand equations and the corresponding free energy change has also been calculated. The values of the association constants obtained from BH equations using absorbance values corroborate with the Stern-Volmer constants obtained from fluorimetric studies. The evidence for complexation is also supported by the results of cyclic voltammetry.

  12. Antibacterial effect of bismuth subsalicylate nanoparticles synthesized by laser ablation

    Energy Technology Data Exchange (ETDEWEB)

    Flores-Castañeda, Mariela [Instituto Nacional de Investigaciones Nucleares (Mexico); Vega-Jiménez, Alejandro L., E-mail:; Almaguer-Flores, Argelia [Universidad Nacional Autónoma de México, Facultad de Odontología, DEPeI, I (Mexico); Camps, Enrique; Pérez, Mario [Instituto Nacional de Investigaciones Nucleares (Mexico); Silva-Bermudez, Phaedra [Instituto Nacional de Rehabilitación, Unidad de Ingeniería de Tejidos, Terapia Celular y Medicina Regenerativa (Mexico); Berea, Edgardo [FarmaQuimia SA de CV. (Mexico); Rodil, Sandra E. [Universidad Nacional Autónoma de México, Instituto de Investigaciones en Materiales (Mexico)


    The antimicrobial properties of bismuth subsalicylate (BSS) nanoparticles against four opportunistic pathogens; E. coli, P. aeruginosa, S. aureus, and S. epidermidis were determined. BSS nanoparticles were synthesized by pulse laser ablation of a solid target in distilled water under different conditions. The nanoparticles were characterized using high-resolution transmission electron microscopy and absorption spectra and small angle X-ray scattering. The analysis shows that the colloids maintained the BSS structure and presented average particle size between 20 and 60 nm, while the concentration ranges from 95 to 195 mg/L. The antibacterial effect was reported as the inhibition ratio of the bacterial growth after 24 h and the cell viability was measured using the XTT assay. The results showed that the inhibition ratio of E. coli and S. epidermidis was dependant on the NPs size and/or concentration, meanwhile P. aeruginosa and S. aureus were more sensitive to the BSS nanoparticles independently of both the size and the concentration. In general, the BSS colloids with average particle size of 20 nm were the most effective, attaining inhibition ratios >80 %, similar or larger than those obtained with the antibiotic used as control. The results suggest that the BSS colloids could be used as effective antibacterial agents with potential applications in the medical area.

  13. Bismuth nanoparticles integration into heavy metal electrochemical stripping sensor. (United States)

    Cadevall, Miquel; Ros, Josep; Merkoçi, Arben


    Between their many applications bismuth nanoparticles (BiNPs) are showing interest as pre-concentrators in heavy metals detection while being applied as working electrode modifiers used in electrochemical stripping analysis. From the different reported methods to synthesize BiNPs we are focused on the typical polyol method, largely used in these types of metallic and semi-metallic nanoparticles. This study presents the strategy for an easy control of the shape and size of BiNPs including nanocubes, nanosferes and triangular nanostructures. To improve the BiNP size and shape, different reducing agents (ethylene glycol or sodium hypophosphite) and stabilizers (polyvinyl pyrrolidone, PVP, in different amounts) have been studied. The efficiency of BiNPs for heavy metals analysis in terms of detection sensitivity while being used as modifiers of screen-printed carbon electrodes including the applicability of the developed device in real sea water samples is shown. A parallel study between the obtained nanoparticles and their performance in heavy metal sensing has been described in this communication.

  14. Bismuth alloying properties in GaAs nanowires

    International Nuclear Information System (INIS)

    First-principles calculations have been performed to investigate the structural, electronic and optical properties of bismuth alloying in GaAs nanowires. A typical model of Ga31As31 nanowires is introduced for its reasonable band gap. The band gap of GaAs1−xBix shrinks clearly with the increasing Bi concentration and the band edge shifts when spin–orbit coupling (SOC) is considered. The insertion of Bi atom leads to hybridization of Ga/As/Bi p states which contributes a lot around Fermi level. Scissor effect is involved. The optical properties are presented, including dielectric function, optical absorption spectra and reflectivity, which are also varied with the increasing of Bi concentrations. - Graphical abstract: Top view of Bi-doped GaAs nanowires. Ga, As, and Bi atoms are denoted with grey, purple and red balls, respectively. Display Omitted - Highlights: • A typical model of Ga31As31 nanowires is introduced for its reasonable band gap. • The band gap of GaAs1−xBix shrinks clearly with the increasing Bi concentration. • The band edge shifts when spin–orbit coupling (SOC) is considered. • The insertion of Bi atom leads to hybridization of Ga/As/Bi p states

  15. Transport phenomena in nanowires based on bismuth alloys

    International Nuclear Information System (INIS)

    Full text: In this work, we study the conductivity and thermopower of quantum wires (QW) based on bismuth alloys. Calculations are carried out for nanowires with degenerate and nondegenerate gas of carriers at various crystalline orientations taking into account the real band structure of Bi. We find the energy eigenvalues of holes and taking into account the nonparabolicity of the band, the energy eigenvalues for electrons. The conductivity and thermopower determined with the use of the Kubo formulae in the case when the basic mechanism of carrier scattering is assumed to be elastic acoustic-phonon scattering and on a roughness surface of QW. Dependences of kinetic coefficients on temperature, nanowire diameter and crystalline orientation are investigated. The conductivity and thermopower of a QW contains the contributions of electrons and holes. Taking into account values of carrier effective masses and other band parameters of Bi, it is possible to conclude that the contribution of holes to the conductivity of nondegenerate carriers of QWs is more less than that of electrons, which is attributed to smaller effective mass of electrons. For a semiconducting Bi QW the conductivity depends exponentially on a temperature and wire diameter. The thermopower of a semiconducting and of a semimetallic Bi QW at low temperatures can be positive and change sign in more higher temperatures. The theoretical results are close to experiment for Bi wires with diameter of 50-100 nm. (author)

  16. One-dimensional Topological Edge States of Bismuth Bilayers (United States)

    Drozdov, Ilya; Alexandradinata, Aris; Jeon, Sangjun; Nadj-Perge, Stevan; Ji, Huiwen; Cava, Robert; Bernevig, B. Andrei; Yazdani, Ali


    The hallmark of a time-reversal symmetry protected topologically insulating state of matter in two-dimensions (2D) is the existence of chiral edge modes propagating along the perimeter of the sample. Bilayers of bismuth (Bi), an elemental system theoretically predicted to be a Quantum Spin Hall (QSH) insulator1, has been studied with Scanning Tunneling Microscopy (STM) and the electronic structure of its bulk and edge modes has been experimentally investigated. Spectroscopic mapping with STM reveals the presence of the state bound to the edges of the Bi-bilayer. By visualizing quantum interference of the edge state quasi-particles in confined geometries we characterize their dispersion and demonstrate that their properties are consistent with the absence of backscattering. Hybridization of the edge modes to the underlying substrate will be discussed. [1] Shuichi Murakami, Phys. Rev. Lett. 97, 236805 (2006). The work at Princeton and the Princeton Nanoscale Microscopy Laboratory was supported by ARO MURI program W911NF-12-1-0461, DARPA-SPWAR Meso program N6601-11-1-4110, NSF-DMR1104612, and NSF-MRSEC programs through the Princeton Center for Complex Materials (DMR-0819860)

  17. Investigation of solution-processed bismuth-niobium-oxide films

    International Nuclear Information System (INIS)

    The characteristics of bismuth-niobium-oxide (BNO) films prepared using a solution process were investigated. The BNO film annealed at 550 °C involving three phases: an amorphous phase, Bi3NbO7 fluorite microcrystals, and Nb-rich cubic pyrochlore microcrystals. The cubic pyrochlore structure, which was the main phase in this film, has not previously been reported in BNO films. The relative dielectric constant of the BNO film was approximately 140, which is much higher than that of a corresponding film prepared using a conventional vacuum sputtering process. Notably, the cubic pyrochlore microcrystals disappeared with increasing annealing temperature and were replaced with triclinic β-BiNbO4 crystals at 590 °C. The relative dielectric constant also decreased with increasing annealing temperature. Therefore, the high relative dielectric constant of the BNO film annealed at 550 °C is thought to result from the BNO cubic pyrochlore structure. In addition, the BNO films annealed at 500 °C contained approximately 6.5 atm. % carbon, which was lost at approximately 550 °C. This result suggests that the carbon in the BNO film played an important role in the formation of the cubic pyrochlore structure.

  18. Modular Lead-Bismuth Fast Reactors in Nuclear Power

    Directory of Open Access Journals (Sweden)

    Vladimir Petrochenko


    Full Text Available On the basis of the unique experience of operating reactors with heavy liquid metal coolant–eutectic lead-bismuth alloy in nuclear submarines, the concept of modular small fast reactors SVBR-100 for civilian nuclear power has been developed and validated. The features of this innovative technology are as follows: a monoblock (integral design of the reactor with fast neutron spectrum, which can operate using different types of fuel in various fuel cycles including MOX fuel in a self-providing mode. The reactor is distinct in that it has a high level of self-protection and passive safety, it is factory manufactured and the assembled reactor can be transported by railway. Multipurpose application of the reactor is presumed, primarily, it can be used for regional power to produce electricity, heat and for water desalination. The Project is being realized within the framework of state-private partnership with joint venture OJSC “AKME-Engineering” established on a parity basis by the State Atomic Energy Corporation “Rosatom” and the Limited Liability Company “EuroSibEnergo”.

  19. Bismuth alloying properties in GaAs nanowires

    Energy Technology Data Exchange (ETDEWEB)

    Ding, Lu [State Key Laboratory of Information Photonics and Optical Communications, Ministry of Education, Beijing University of Posts and Telecommunications, PO Box 72, Beijing 100876 (China); Lu, Pengfei, E-mail: [State Key Laboratory of Information Photonics and Optical Communications, Ministry of Education, Beijing University of Posts and Telecommunications, PO Box 72, Beijing 100876 (China); Cao, Huawei; Cai, Ningning; Yu, Zhongyuan [State Key Laboratory of Information Photonics and Optical Communications, Ministry of Education, Beijing University of Posts and Telecommunications, PO Box 72, Beijing 100876 (China); Gao, Tao [Institute of Atomic and Molecular Physics, Sichuan University, Chengdu 610065 (China); Wang, Shumin [State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Chinese Academy of Sciences, Shanghai 200050 (China); Photonics Laboratory, Department of Microtechnology and Nanoscience, Chalmers University of Technology, 41296 Gothenburg (Sweden)


    First-principles calculations have been performed to investigate the structural, electronic and optical properties of bismuth alloying in GaAs nanowires. A typical model of Ga{sub 31}As{sub 31} nanowires is introduced for its reasonable band gap. The band gap of GaAs{sub 1−x}Bi{sub x} shrinks clearly with the increasing Bi concentration and the band edge shifts when spin–orbit coupling (SOC) is considered. The insertion of Bi atom leads to hybridization of Ga/As/Bi p states which contributes a lot around Fermi level. Scissor effect is involved. The optical properties are presented, including dielectric function, optical absorption spectra and reflectivity, which are also varied with the increasing of Bi concentrations. - Graphical abstract: Top view of Bi-doped GaAs nanowires. Ga, As, and Bi atoms are denoted with grey, purple and red balls, respectively. Display Omitted - Highlights: • A typical model of Ga{sub 31}As{sub 31} nanowires is introduced for its reasonable band gap. • The band gap of GaAs{sub 1−x}Bi{sub x} shrinks clearly with the increasing Bi concentration. • The band edge shifts when spin–orbit coupling (SOC) is considered. • The insertion of Bi atom leads to hybridization of Ga/As/Bi p states.

  20. Bismuth nanoparticles integration into heavy metal electrochemical stripping sensor. (United States)

    Cadevall, Miquel; Ros, Josep; Merkoçi, Arben


    Between their many applications bismuth nanoparticles (BiNPs) are showing interest as pre-concentrators in heavy metals detection while being applied as working electrode modifiers used in electrochemical stripping analysis. From the different reported methods to synthesize BiNPs we are focused on the typical polyol method, largely used in these types of metallic and semi-metallic nanoparticles. This study presents the strategy for an easy control of the shape and size of BiNPs including nanocubes, nanosferes and triangular nanostructures. To improve the BiNP size and shape, different reducing agents (ethylene glycol or sodium hypophosphite) and stabilizers (polyvinyl pyrrolidone, PVP, in different amounts) have been studied. The efficiency of BiNPs for heavy metals analysis in terms of detection sensitivity while being used as modifiers of screen-printed carbon electrodes including the applicability of the developed device in real sea water samples is shown. A parallel study between the obtained nanoparticles and their performance in heavy metal sensing has been described in this communication. PMID:25994368

  1. Energy levels scheme simulation of divalent cobalt doped bismuth germanate (United States)

    Andreici, Emiliana-Laura; Petkova, Petya; Avram, Nicolae M.


    The aim of this paper is to simulate the energy levels scheme for Bismuth Germanate (BGO) doped with divalent cobalt, in order to give a reliable explanation for spectral experimental data. In the semiempirical crystal field theory we first modeled the Crystal Field Parameters (CFPs) of BGO:Cr2+ system, in the frame of Exchange Charge Model (ECM), with actually site symmetry of the impurity ions after doping. The values of CFPs depend on the geometry of doped host matrix and by parameter G of ECM. First, we optimized the geometry of undoped BGO host matrix and afterwards, that of doped BGO with divalent cobalt. The charges effect of ligands and covalence bonding between cobalt cations and oxygen anions, in the cluster approach, also were taken into account. With the obtained values of the CFPs we simulate the energy levels scheme of cobalt ions, by diagonalizing the matrix of the doped crystal Hamiltonian. Obviously, energy levels and estimated Racah parameters B and C were compared with the experimental spectroscopic data and discussed. Comparison of obtained results with experimental data shows quite satisfactory, which justify the model and simulation schemes used for the title system.

  2. Ferroelectric and photocatalytic behavior of bismuth ferrite nano wire (United States)

    William, R. V.; Marikani, A.; Madhavan, D.


    Multiferroic bismuth ferrite nanowires are prepared through polyol method with an average diameter of 35 nm with a narrow size distribution. The band gap was determined to be 2.10 eV, indicating their potential application as visible-light-response photo catalyst. The magnificent photocatalytic behaviors of BiFeO3 nanowires are understood from the methyl violet degradation under visible light irradiation. Moreover, the nano-wire takes only a lesser time for the diffusion of electron-hole pair from the surface of the sample. Further the BiFeO3 nano-wire was characterized using XRD, SEM, and U-V. The ferroelectric studies of BiFeO3 nano-wire show a frequency dependent property and maximum coercivity of 2.7 V/cm were achieved with a remanent polarization at 0.5 µC/cm2 at the frequency 4 kHz. The coercivity of BiFeO3 nano wire changes with variation of frequency from 1 kHz to 4 kHz.

  3. Synthesis and characterization of bismuth doped barium sulphide nanoparticles

    International Nuclear Information System (INIS)

    We have synthesized BaS:Bi nanocrystalline powder of average grain size 35 nm by solid-state diffusion method using sodium thiosulphate as a flux. During this work we have optimized the nature and amount of flux, amount of the dopant and temperature of firing for maximum yield of photoluminescence. The samples were characterized by X-ray powder diffraction (XRD) method, transmission electron microscopy (TEM), photoluminescence (PL) and UV-visible techniques. On excitation by 425 nm, these nanophosphors give one emission peak at 575 nm which corresponds to green color. In the excitation spectra of these particles there are two peaks at 350 nm and 425 nm. The effect of dopant concentration on the photoluminescence of BaS:Bi nanocrystallites has been studied which is in agreement with the principle of concentration quenching. The energy band gap of bismuth doped BaS nanopowder has been calculated to be 4.25 eV and is blue shifted in comparison to their bulk counterparts. The blue shift may be due to the quantum confinement in the particles.

  4. Synthesis and characterization of bismuth zinc niobate pyrochlore nanopowders

    Directory of Open Access Journals (Sweden)

    Sonia Maria Zanetti


    Full Text Available Bismuth zinc niobate pyrochlores Bi1.5ZnNb1.5O7 (alpha-BZN, and Bi2(Zn1/3Nb2/32O 7 (beta-BZN have been synthesized by chemical method based on the polymeric precursors. The pyrochlore phase was investigated by differential scanning calorimetry, infrared spectroscopy, and X ray diffraction. Powder and sintered pellets morphology was examined by scanning electron microscopy. The study of alpha-BZN phase formation reveals that, at 500 °C, the pyrochlore phase was already present while a single-phased nanopowder was obtained after calcination at 700 °C. The crystallization mechanism of the beta-BZN is quite different, occurring through the crystallization of alpha-BZN and BiNbO4 intermediary phases. Both compositions yielded soft agglomerated powders. alpha-BZN pellets, sintered at 800 °C for 2 hours, presented a relative density of 97.3% while those of beta-BZN, sintered at 900 °C for 2 hours, reached only 91.8%. Dielectric constant and dielectric loss, measured at 1 MHz, were 150 and 4 x/10-4 for a-BZN, and 97 and 8 x 10-4 for beta-BZN.

  5. Magnetic and Electrical Characteristics of Bismuth Ferrite, Depending on the Impurities, Method of Preparation and Size of the Nanoparticles

    Directory of Open Access Journals (Sweden)

    V.M. Sarnatsky


    Full Text Available The prospect of application of the multiferroics in devices and spintronics devices is shown. A comparative analysis of magnetic and dielectric properties of nanostructures based on bismuth ferrite which were synthesized by various ways was made. The results of studies of the structure and properties of the nanostructured bismuth ferrite powder, synthesized by combustion of nitrate - organic precursors, are presented.

  6. Insights into the growth of bismuth nanoparticles on 2D structured BiOCl photocatalysts: an in situ TEM investigation. (United States)

    Chang, Xiaofeng; Wang, Shuangbao; Qi, Qi; Gondal, Mohammed A; Rashid, Siddique G; Gao, Si; Yang, Deyuan; Shen, Kai; Xu, Qingyu; Wang, Peng


    The synthetic techniques for novel photocatalytic crystals had evolved by a trial-and-error process that spanned more than two decades, and an insight into the photocatalytic crystal growth process is a challenging area and prerequisite for achieving an excellent photoactivity. Bismuth nanoparticle based hybrids, such as Bi/BiOCl composites, have recently been investigated as highly efficient photocatalytic systems because of the localized surface plasmon resonance (LSPR) of nanostructured bismuth. In this work, the observation towards the formation and growth of bismuth nanoparticles onto 2D structured BiOCl photocatalysts has been performed using a transmission electron microscope (TEM) directly in real time. The growth of bismuth nanoparticles on BiOCl nanosheets can be emulated and speeded up driven by the electron beam (e(-) beam) in TEM. The crystallinity, growth and the elemental evolution during the formation of bismuth nanoparticles have also been probed in this work.

  7. Overview of the use of ATHENA for thermal-hydraulic analysis of systems with lead-bismuth coolant

    International Nuclear Information System (INIS)

    The INEEL and MIT are investigating the suitability of lead-bismuth cooled fast reactor for producing low-cost electricity as well as for actinide burning. This paper is concerned with the general area of thermal-hydraulics of lead-bismuth cooled reactors. The ATHENA code is being used in the thermal-hydraulic design and analysis of lead-bismuth cooled reactors. The ATHENA code was reviewed to determine its applicability for simulating lead-bismuth cooled reactors. Two modifications were made to the code as a result of this review. Specifically, a correlation to represent heat transfer from rod bundles to a liquid metal and a void correlation based on data taken in a mixture of lead-bismuth and steam were added the code. The paper also summarizes the analytical work that is being performed with the code and plans for future analytical work

  8. Assessment of the Eye Lens Dose Reduction by Bismuth Shields in Rando Phantom Undergoing CT of the Head

    International Nuclear Information System (INIS)

    The aim of this study is to assess the dose reduction of eye lens and availability of bismuth garments resulting from the use of radioprotective bismuth garments to shield the eyes of patients undergoing head CT. Rando phantom and TLDs were used to determine the amount of dose reduction by bismuth shielding of the eye in the following simulated CT scans : (a) scanning of the head including orbits, (b) scanning of the whole head, and (c) angled scanning of the head excluding orbits. The average dose reduction of eye lens was 43.2%, 36.0% and 1.4% for the three CT scans listed above. Significant reduction in the eye lens dose was achieved by using superficial orbital bismuth shielding during head CT scans. However, bismuth shields should not be used for the patients when their eyes are excluded from the primarily exposed region.

  9. Fluorescence Emission Centres and the Corresponding Infrared Fluorescence Saturation in a Bismuth-Doped Silica Fibre

    Institute of Scientific and Technical Information of China (English)

    QIU Yan-Qing; SHEN Yong-Hang


    We investigate the fluorescence characteristics of bismuth doped silica fibres with and without Al co-dopant which are fabricated by means of modified chemical vapour deposition (MCVD) technique, and find that the fluorescences in the red region (centred around 750nm) and in the infrared region (centred around 1100nm) may originate from different emission sites in the fibre. Strong upconversion phenomena are observed in both Al-codoped and non Al codoped bismuth fibres when the fibres are excited by an acoustic-optic Q-switched Nd: YVO4 laser. Both the aspects indicate that the upper energy level absorption reported in the work of the bismuth doped silica fibre lasers may result from the fluorescence emission sites that are not responsible for the infrared emission. It is thus expected that optimizing the compositions and the fabrication conditions of the fibre and then transferring more fluorescence emission centres are helpful for the infrared emission.

  10. Facile preparation of Bi nanoparticles by novel cathodic dispersion of bulk bismuth electrodes

    Energy Technology Data Exchange (ETDEWEB)

    Chen Xin [Zhejiang Key Laboratory for Reactive Chemistry on Solid Surfaces, Institute of Physical Chemistry, Zhejiang Normal University, Jinhua 321004 (China); Chen Shu; Huang Wei [Key Laboratory of Chemical Biology and Traditional Chinese Medicine Research (Ministry of Education of China), College of Chemistry and Chemical Engineering, Hunan Normal University, Lushan Road, Changsha 410081 (China); Zheng Jufang [Zhejiang Key Laboratory for Reactive Chemistry on Solid Surfaces, Institute of Physical Chemistry, Zhejiang Normal University, Jinhua 321004 (China); Li Zelin, E-mail: lizelin@zjnu.c [Key Laboratory of Chemical Biology and Traditional Chinese Medicine Research (Ministry of Education of China), College of Chemistry and Chemical Engineering, Hunan Normal University, Lushan Road, Changsha 410081 (China)


    A novel electrochemical approach has been developed to prepare clean bismuth nanoparticles (NPs) with a bulk Bi electrode in a 0.5 mol dm{sup -3} NaOH solution under highly cathodic polarization of -8 V versus a saturated mercurous sulfate electrode, requiring no any precursor ions and organic protective agents. The bulk Bi electrode can be facilely dispersed into Bi NPs at the condition of intensive hydrogen evolution. This cathodic dispersion of the bulk Bi electrode involves the formation and decomposition of unstable bismuth hydrides and the aggregation of atomic bismuth from the decomposition. Moreover, Bi{sub 2}O{sub 3} NPs have also been achieved by heating the precursor Bi NPs. Field-emission scanning electron microscopy, transmission electron microscope and X-ray diffraction were used to characterize these NPs. The as-prepared Bi NPs mainly existed in rhombohedral phase.

  11. Bismuth- and lithium-loaded plastic scintillators for gamma and neutron detection

    Energy Technology Data Exchange (ETDEWEB)

    Cherepy, Nerine J., E-mail: [Lawrence Livermore National Laboratory, Livermore, CA (United States); Sanner, Robert D.; Beck, Patrick R.; Swanberg, Erik L.; Tillotson, Thomas M.; Payne, Stephen A. [Lawrence Livermore National Laboratory, Livermore, CA (United States); Hurlbut, Charles R. [Eljen Technology, Sweetwater, TX (United States)


    Transparent plastic scintillators based on polyvinyltoluene (PVT) have been fabricated with high loading of bismuth carboxylates for gamma spectroscopy, and with lithium carboxylates for neutron detection. When activated with a combination of standard fluors, 2,5-diphenyloxazole (PPO) and tetraphenylbutadiene (TPB), gamma light yields with 15 wt% bismuth tripivalate of 5000 Ph/MeV are measured. A PVT plastic formulation including 30 wt% lithium pivalate and 30 wt% PPO offers both pulse shape discrimination, and a neutron capture peak at ~400 keVee. In another configuration, a bismuth-loaded PVT plastic is coated with ZnS({sup 6}Li) paint, permitting simultaneous gamma and neutron detection via pulse shape discrimination with a figure-of-merit of 3.8, while offering gamma spectroscopy with energy resolution of R(662 keV)=15%.

  12. Design of an Actinide Burning, Lead-Bismuth Cooled Reactor That Produces Low Cost Electricity

    Energy Technology Data Exchange (ETDEWEB)

    C. Davis; S. Herring; P. MacDonald; K. McCarthy; V. Shah; K. Weaver (INEEL); J. Buongiorno; R. Ballinger; K. Doyoung; M. Driscoll; P. Hejzler; M. Kazimi; N. Todreas (MIT)


    The purpose of this project is to investigate the suitability of lead-bismuth cooled fast reactors for producing low-cost electricity as well as for actinide burning. The goal is to identify and analyze the key technical issues in core neutronics, materials, thermal-hydraulics, fuels, and economics associated with the development of this reactor concept. The choice of lead-bismuth for the reactor coolant is an actinide burning fast reactor offers enhanced safety and reliability. The advantages of lead-bismuth over sodium as a coolant are related to the following material characteristics: chemical inertness with air and water; higher atomic number; lower vapor pressure at operating temperatures; and higher boiling temperature. Given the status of the field, it was agreed that the focus of this investigation in the first two years will be on the assessment of approaches to optimize core and plant arrangements in order to provide maximum safety and economic potential in this type of reactor.

  13. Poisoning effect of bismuth on modification behaviour of strontium in LM25 alloy

    Indian Academy of Sciences (India)

    S Farahany; A Ourdjini; M H Idris; L T Thai


    Nucleation and growth, temperature measurements andmicrostructure observations of silicon phase are presented for strontium modified Al–7%Si (LM25) cast alloy treated with bismuth. The results show that addition of bismuth in strontium modified alloys may have a poisoning effect resulting in lost modification of the silicon phase. With increasing Bi/Sr ratio, thermal analysis measurements showed that the eutectic growth temperature increased remarkably to 573°C and recalescence decreased to 0.2°C and the morphology of silicon displayed the same flakelike structure as in the unmodified alloys. Microstructural observation showed that a minimum Bi/Sr ratio of 1.2 which is equivalent to a Sr/Bi ratio of 0.43 is required for effective strontium modification and neutralization of the poisoning effect of bismuth.

  14. Bismuth subcarbonate as filler particle for an Epoxy-based root canal sealer

    Directory of Open Access Journals (Sweden)

    Eduardo Schwartzer


    Full Text Available Introduction: The aim of this study was to evaluate the addition of bismuth subcarbonate with different concentrations regarding the rheological properties of an experimental epoxy-based root canal sealer. Materials and Methods: Endodontic sealers were prepared with epoxy resin-based sealer with bismuth subcarbonate additions of 20%, 40%, 60%, 80%, 100%, and 120%. Flow, film thickness, working time, setting time, dimensional change, sorption, solubility, and cytotoxicity were studied according to the ISO standards. Data were statistically analyzed by one-way ANOVA, and Tukey multiple comparisons were used, with a significance level of 5%. Results: The flow, working time, water sorption, and solubility significantly decreased and the film thickness and dimensional change increased with higher filler particle addition. There were no statistically significant differences for setting time and cytotoxicity between the filler particle proportions. Conclusion: Experimental resin-based sealer with bismuth subcarbonate addition up to 40% can be an alternative for root canal sealer.

  15. Glass-like carbon, pyrolytic graphite or nanostructured carbon for electrochemical sensing of bismuth ion?

    Directory of Open Access Journals (Sweden)

    Jadranka Milikić


    Full Text Available Different carbon electrodes were explored for application in electroanalysis, namely for sensing of bismuth ion as model analyte. Carbon materials tested included glassy carbon, basal and edge plane pyrolytic graphite, as well as nanostructured carbonized polyaniline prepared in the presence of 3,5-dinitrosalicylic acid. Bismuth ion was chosen as model analyte as protocol for its detection and quantifications is still to be determined. Herein, anodic stripping voltammetry was used with study of effect of several parameters such as scan rate and deposition time. Electrode based on carbonized polyaniline showed the highest activity for bismuth ion sensing in terms of the highest current densities recorded both in a laboratory and in real sample, while basal plane pyrolytic graphite electrode gave the lowest limit of detection.

  16. Melting behaviour of lead and bismuth nano-particles in quasicrystalline matrix - The role of interfaces

    Indian Academy of Sciences (India)

    Alok Singh; A P Tsai


    Nanomaterials are playing an increasingly important role in modern technologies. Interfaces are crucial in nanotechnology. In this study, we have examined the stability of nanoparticles. Major emphasis is on understanding the effect of interfaces on melting. Melting behaviour of nanocrystalline interfaces, created by embedding lead and bismuth nanoparticles in quasicrystalline matrices, was studied. Sharply faceted and coherent interfaces can be related to sharper melting transitions, while irregularly shaped and incoherent interfaces can be directly correlated with lowering of melting temperatures. It is shown here that solid lead forms a high energy interface with phason strain-free quasicrystal (resulting in a lowering of the melting temperature) while bismuth forms a low energy interface with the quasicrystal (resulting in superheating, unusual for bismuth).

  17. Application of Thermodynamic Calculations to the Pyro-refining Process for Production of High Purity Bismuth (United States)

    Mezbahul-Islam, Mohammad; Belanger, Frederic; Chartrand, Patrice; Jung, In-Ho; Coursol, Pascal


    The present work has been performed with the aim to optimize the existing process for the production of high purity bismuth (99.999 pct). A thermo-chemical database including most of the probable impurities of bismuth (Bi-X, X = Ag, Au, Al, Ca, Cu, Fe, Mg, Mn, Na, Ni, Pb, S, Sb, Sn, Si, Te, Zn) has been constructed to perform different thermodynamic calculations required for the refining process. Thermodynamic description for eight of the selected binaries, Bi-Ca, Cu, Mn, Ni, Pb, S, Sb, and Sn, has been given in the current paper. Using the current database, different thermodynamic calculations have been performed to explain the steps involved in the bismuth refining process.

  18. Potentiation of the action of metronidazole on Helicobacter pylori by omeprazole and bismuth subcitrate

    DEFF Research Database (Denmark)

    Andersen, L P; Colding, H; Kristiansen, J E


    Treatment failures using triple therapy that include metronidazole, are common in patients infected with metronidazole-resistant Helicobacter pylori in the gastric mucosa. Higher eradication rates in such patients have been described when treatment regimens include bismuth salts compared...... to regimens that include proton pump inhibitors. In the present study, the synergistic effect of subinhibitory concentrations (0.25-0.5 MIC) of either bismuth subcitrate or omeprazole with metronidazole on the susceptibility of 42 H. pylori strains was investigated by agar dilution method and the Epsilometer...... test (Etest). With 0.5 MIC of either of the two drugs, the susceptibility of all H. pylori4 mg/l) reverted to being metronidazole sensitive. These results suggested that either bismuth salts or proton pump inhibitors may be effective in the treatment of some infections with metronidazole-resistant H...

  19. Radioactive Iodine (I-129) Gas Adsorption by Using Bismuth-Embedded SBA-15

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Jae Hwan; Cho, Yong-Jun; Park, Jang Jin; Ahn, Do-Hee [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Yim, Man-Sung [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of)


    The efficient capture of the long-lived I-129, released as off-gas from nuclear fuel reprocessing, have been of significant concern in the waste management field. In this study, bismuth-embedded SBA-15 mesoporous silica was firstly applied for iodine capture and storage. SBA-15 was functionalized with thiol (-SH) groups, followed by bismuth adsorption with Bi-S bonding, which was thermally treated to form Bi{sub 2}S{sub 3} within SBA-15. The bismuth-embedded SBA-15s demonstrated high iodine loading capacities with 540 mg-I/g-sorbent maximally, which benefitted from the high surface area and porosity of SBA-15 as well as the formation of thermodynamically stable BiI{sub 3} compound. Iodine physisorption could effectively be suppressed due to the large pores present in SBA-15, resulting in chemisorption as a main mechanism for iodine confinement.

  20. Growth morphology and structure of bismuth thin films on GaSb(110)

    DEFF Research Database (Denmark)

    Gemmeren, T. van; Lottermoser, L.; Falkenberg, G.;


    Photoelectron spectroscopy, low-energy electron diffraction, scanning tunneling microscopy and surface X-ray diffraction were used to investigate the growth of thin layers of bismuth on GaSb(110). At submonolayer coverages, growth of two-dimensional islands occurs. A uniform (1 x I)-reconstructio...... that the (1 x 1)-phases formed by antimony and bismuth adsorbates on (110) surfaces of other III-V compound semiconductors are also described by the epitaxial continued layer model. (C) 1998 Elsevier Science B.V. All rights reserved....

  1. Basic principles of lead and lead-bismuth eutectic application in blanket of fusion reactors

    International Nuclear Information System (INIS)

    Full text: One of the main requirements of advanced nuclear-power engineering is inherent safety of power installations. It initiates R and D of heavy liquid metals (lead, lead- bismuth eutectic) application in fission reactors as substitute of sodium. The same requirement makes advisable R and D of the lead and lead-bismuth eutectic application in blanket of fusion reactors as substitute of lithium. High magnetohydrodynamic pressure drop is an important issue for liquid metal blanket concepts. To decrease MHD-resistance authors propose to form electro-insulating coatings on internal surface of blanket ducts at any moment of fusion reactor exploitation. It may be achieved easily if lead or lead-bismuth eutectic is used and technology of oxidative potential handling is applied. A number of experiments carried out in NNSTU show the availability of the proposed technology. It bases on formation of the insulating coatings that consist of the oxides of components of the structural materials and of the coolant components. In-situ value of the electro-insulating coatings characteristics rd (r - specific resistance of coatings, d - thickness) is ∼ 10-5Ω·m2 for steels and 5, 0x10-6 - 5, 0x10-5Ω·m2 for vanadium alloys. Thermal cycling is possible during exploitation of a blanket. The experimental research of the insulating coatings properties during thermal cycling have shown that the coatings formed into the lead and lead-bismuth coolants save there electro-insulating properties. Experience of many years is an undoubted advantage of the lead-bismuth coolant and less of the lead coolant in comparison with lithium. Russian Federation possesses of experience of exploitation of the research and industrial facilities, of experience of creation of the pumps, steam generators and another equipment with heavy liquid metal coolants. The unique experience of designing, assembling and exploitation of the fission reactors with lead-bismuth coolant is also available. The problem

  2. Optical properties of thermally reduced bismuth-doped sodium aluminosilicate glasses

    DEFF Research Database (Denmark)

    Nielsen, K.H.; Smedskjær, Morten Mattrup; Yue, Yuanzheng;

    Heat-treatment of multivalent ion containing glasses in a hydrogen atmosphere may cause both reduction of the multivalent ions and ionic inward diffusion, resulting in improved glass properties. Bismuth-doped glasses are also interesting objects not only concerning the reduction induced diffusion......, but also concerning the metal particle formation, and the broadband near infrared luminescence. Both the inward diffusion and the infrared luminescence depend on the bismuth oxidation state. The latter can be varied by adjusting the parameters of the heat-treatment, e.g., time, temperature, and...

  3. Formic acid oxidation at platinum-bismuth catalysts

    Directory of Open Access Journals (Sweden)

    Popović Ksenija Đ.


    Full Text Available The field of heterogeneous catalysis, specifically catalysis on bimetallic surfaces, has seen many advances over the past few decades. Bimetallic catalysts, which often show electronic and chemical properties that are distinct from those of their parent metals, offer the opportunity to obtain new catalysts with enhanced selectivity, activity, and stability. The oxidation of formic acid is of permanent interest as a model reaction for the mechanistic understanding of the electrooxidation of small organic molecules and because of its technical relevance for fuel cell applications. Platinum is one of the most commonly used catalysts for this reaction, despite the fact that it shows a few significant disadvantages: high cost and extreme susceptibility to poisoning by CO. To solve this problem, several approaches have been used, but generally, they all consist in the modification of platinum with a second element. Especially, bismuth has received significant attention as Pt modifier. According to the results presented in this survey dealing with the effects influencing the formic acid oxidation it was found that two types of Pt-Bi bimetallic catalysts (bulk and low loading deposits on GC showed superior catalytic activity in terms of the lower onset potential and oxidation current density, as well as exceptional stability compared to Pt. The findings in this report are important for the understanding of mechanism of formic acid electrooxidation on a bulk alloy and decorated surface, for the development of advanced anode catalysts for direct formic acid fuel cells, as well as for the synthesis of novel low-loading bimetallic catalysts. The use of bimetallic compounds as the anode catalysts is an effective solution to overcoming the problems of the formic acid oxidation current stability for long term applications. In the future, the tolerance of both CO poisoning and electrochemical leaching should be considered as the key factors in the development

  4. Distribution of lead-203 in human peripheral blood in vitro

    International Nuclear Information System (INIS)

    In-vitro experiments using 203Pb were performed to identify the lead binding components in human peripheral blood. The distribution of lead in plasma, in the red cell membrane, and within the red cell was also investigated. Studies of the distribution of 203Pb in the whole blood showed that at a lead concentration of 2.45 μmol/l (50 μg/100 ml) about 94% of lead had been incorporated by the erythrocytes and 6% remained in the plasma. After extraction of lipid by a methanol/chloroform mixture, about 75% of the lead was found to be associated with the protein fraction. The lipid contained about 21% of the 203Pb, the remainder being in the aqueous plasma. SDS polyacrylamide gel electrophoresis of blood plasma showed that almost 90% of the 203Pb was present in the albumin fraction; the remainder was likely to be associated with high molecular weight globulins. Several binding sites were identified on the erythrocyte membrane. The high molecular weight component, about 130 000-230 000, was the most important 203Pb binding site. Chemical modification of membrane proteins suggested that the carboxyl groups are the major ligand responsible for most of the lead binding. SH groups of the membrane may have a minor role, but amino groups did not appear to affect the lead binding. The binding of lead to erythrocytes was not confined to membranes, over 80% of lead in blood penetrates into erythrocytes and binds to intracellular components. Gel chromatography of the haemolysate showed that over 90% of the 203Pb was attached to the haemoglobin molecule. (author)

  5. 75 FR 75693 - Rehabilitation Mortgage Insurance Underwriting Program Section 203(k); Notice of Proposed... (United States)


    ... URBAN DEVELOPMENT Rehabilitation Mortgage Insurance Underwriting Program Section 203(k); Notice of... information: Title of Proposal: Rehabilitation Mortgage Insurance Underwriting Program Section 203(k). OMB... Program Development, Department of Housing and Urban Development, 451 7th Street, SW., Washington,...

  6. Controlled growth of bismuth nanoparticles by electron beam irradiation in TEM

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Seon Ho [College of Environment and Applied Chemistry, Kyung Hee University, Yongin 449-701 (Korea, Republic of); Choi, Young-Suk [Center for Functional Nanomaterials, Brookhaven National Laboratory, Upton, NY 11973 (United States); Kang, Kyongha [Materials Science Department, Brookhaven National Laboratory, Upton, NY 11973 (United States)]. E-mail:; Yang, Sung Ik [College of Environment and Applied Chemistry, Kyung Hee University, Yongin 449-701 (Korea, Republic of)]. E-mail:


    In situ nanometer-sized bismuth particles were synthesized by irradiation of the electron beam in the TEM. The size of the crystalline Bi nanoparticles could be controlled by adjusting the irradiation time of the electron beam. Characterization of TEM reveals that the Bi nanoparticles exist in rhombic structure, same as to bulk Bi.

  7. Controlled oxidative synthesis of Bi nanoparticles and emission centers in bismuth glass nanocomposites for photonic application (United States)

    Singh, Shiv Prakash; Karmakar, Basudeb


    Here we demonstrate an oxidative process to control metallic bismuth (Bi 0) nanoparticles (NPs) creation in bismuth glass nanocomposites by using K 2S 2O 8 as oxidant and enhanced transparency of bismuth glasses. Formation of Bi 0 NPs has been monitored by their distinct surface plasmon resonance (SPR) band at 460 nm in the UV-visible absorption spectra. It is further confirmed by the transmission electron microscopy (TEM) images which disclose the formation of spherical Bi 0 NPs whereas the selected area electron diffraction (SAED) pattern reveals their crystalline rhombohedral phase. These glasses are found to exhibit visible and near infrared (NIR) luminescence bands at 630 and 843 nm respectively on excitation at 460 nm of the SPR band. It is realized that the luminescence center of bismuth species is an uncertain issue, however, it is reasonable to consider that the emission band at 630 nm is due to the combination of 2D 5/2 → 4S 3/2 of Bi 0 and 2P 3/2 (1) → 2P 1/2 of Bi 2+ transitions, and that of NIR emission band at 843 nm is attributed to the 2D 3/2 → 4S 3/2 of Bi 0 transition.

  8. The antimicrobial effects and metabolomic footprinting of carboxyl-capped bismuth nanoparticles against Helicobacter pylori. (United States)

    Nazari, P; Dowlatabadi-Bazaz, R; Mofid, M R; Pourmand, M R; Daryani, N E; Faramarzi, M A; Sepehrizadeh, Z; Shahverdi, A R


    Organic salts of bismuth are currently used as antimicrobial agents against Helicobacter pylori. This study evaluated the antibacterial effect of elemental bismuth nanoparticles (Bi NPs) using a serial agar dilution method for the first time against different clinical isolates and a standard strain of H. pylori. The Bi NPs were biologically prepared and purified by a recently described method and subjected to further characterization by infrared spectroscopy and anti-H. pylori evaluation. Infrared spectroscopy results showed the presence of carboxyl functional groups on the surface of biogenic Bi NPs. These biogenic nanoparticles showed good antibacterial activity against all tested H. pylori strains. The resulting MICs varied between 60 and 100 μg/ml for clinical isolates of H. pylori and H. pylori (ATCC 26695). The antibacterial effect of bismuth ions was also tested against all test strains. The antimicrobial effect of Bi ions was lower than antimicrobial effect of bismuth in the form of elemental NPs. The effect of Bi NPs on metabolomic footprinting of H. pylori was further evaluated by (1)H NMR spectroscopy. Exposure of H. pylori to an inhibitory concentration of Bi NPs (100 μg/ml) led to release of some metabolites such as acetate, formic acid, glutamate, valine, glycine, and uracil from bacteria into their supernatant. These findings confirm that these nanoparticles interfere with Krebs cycle, nucleotide, and amino acid metabolism and shows anti-H. pylori activity.

  9. A sensitive fluorescence quenching method for determination of bismuth with tiron

    Energy Technology Data Exchange (ETDEWEB)

    Taher, Mohammad Ali; Rahimi, Mina [Department of Chemistry, Shahid Bahonar University of Kerman, Kerman (Iran, Islamic Republic of); Fazelirad, Hamid, E-mail: [Department of Chemistry, Shahid Bahonar University of Kerman, Kerman (Iran, Islamic Republic of); Department of Chemistry, Science and Research Branch, Islamic Azad University, Yazd (Iran, Islamic Republic of); Young Researchers Society, Shahid Bahonar University of Kerman, P.O. Box 76175-133, Kerman (Iran, Islamic Republic of)


    We describe a fluorescence quenching method for determination of bismuth with tiron. The method is based on the reaction of tiron by bismuth(III) in acidic media. The influence of variables such as the pH, type of buffer, tiron concentration, reaction time and temperature were investigated. Under optimized conditions, the fluorescence quenching extent is proportional to the concentration of bismuth for Bi–tiron system at the range 0.13–2.09 μg mL{sup −1} and the detection limit is 0.05 μg mL{sup −1}. The proposed sensor presented good repeatability, evaluated in terms of relative standard deviation (R.S.D.=±0.498%) for 11 replicates. This sensitive, rapid and accurate method has been successfully applied to the determination of trace bismuth(III) in water and hair samples and certified reference materials. -- Highlights: • No previous paper report on use of fluorescence quenching for determination of Bi. • Fluorescence quenching of trion is a sensitive method for determination of Bi(III). • Under the optimum conditions the detection limit is very low (0.05 μg mL{sup −1}). • The procedure is simple and safe and has high tolerance limit to interferences.

  10. 75 FR 14491 - Listing of Color Additives Exempt From Certification; Bismuth Citrate (United States)


    ... level of bismuth citrate as a color additive in cosmetics intended for coloring hair on the scalp. This.... Ellison, Center for Food Safety and Applied Nutrition (HFS-265), Food and Drug Administration, 5100 Paint... notice published in the Federal Register of February 25, 2008 (73 FR 10035), FDA announced that a...

  11. 75 FR 34360 - Listing of Color Additives Exempt From Certification; Bismuth Citrate; Confirmation of Effective... (United States)


    ... level of bismuth citrate as a color additive in cosmetics intended for coloring hair on the scalp. DATES: The effective date for the final rule published in the Federal Register of March 26, 2010 (75 FR 14491... Safety and Applied Nutrition (HFS-265), Food and Drug Administration, 5100 Paint Branch Pkwy.,...

  12. Microwave and magneto-optic properties of bismuth-substituted yttrium iron garnet thin films (United States)

    Butler, J. C.; Kramer, J. J.; Esman, R. D.; Craig, A. E.; Lee, J. N.; Ryuo, T.


    Microwave and magneto-optic measurements have been made on bismuth-substituted yttrium iron garnet (BiYIG) films. Forward-volume (FV) magnetostatic-wave (MSW) attenuation has been measured from ferrimagnetic resonance and from pulse delay data. We report the indirect observation of FV MSW in BiYIG using two independent techniques: a pulse transmission technique and a passband measurement technique. Faraday rotation in the films was also recorded at a wavelength of 1.3 μm. The bismuth-substituted films are grown on carefully cleaned substrates and have yttrium:bismuth ratios of 1:1. The composition of the bismuth substituted films is Y1.5Bi1.5Fe5O12 deduced from lattice parameters and absolute Faraday rotation. These films show particular promise for use in waveguide-type high-speed MSW-optical devices where low MSW attenuation and high Faraday rotation are among the necessary criteria for successful operation.

  13. The antimicrobial effects and metabolomic footprinting of carboxyl-capped bismuth nanoparticles against Helicobacter pylori. (United States)

    Nazari, P; Dowlatabadi-Bazaz, R; Mofid, M R; Pourmand, M R; Daryani, N E; Faramarzi, M A; Sepehrizadeh, Z; Shahverdi, A R


    Organic salts of bismuth are currently used as antimicrobial agents against Helicobacter pylori. This study evaluated the antibacterial effect of elemental bismuth nanoparticles (Bi NPs) using a serial agar dilution method for the first time against different clinical isolates and a standard strain of H. pylori. The Bi NPs were biologically prepared and purified by a recently described method and subjected to further characterization by infrared spectroscopy and anti-H. pylori evaluation. Infrared spectroscopy results showed the presence of carboxyl functional groups on the surface of biogenic Bi NPs. These biogenic nanoparticles showed good antibacterial activity against all tested H. pylori strains. The resulting MICs varied between 60 and 100 μg/ml for clinical isolates of H. pylori and H. pylori (ATCC 26695). The antibacterial effect of bismuth ions was also tested against all test strains. The antimicrobial effect of Bi ions was lower than antimicrobial effect of bismuth in the form of elemental NPs. The effect of Bi NPs on metabolomic footprinting of H. pylori was further evaluated by (1)H NMR spectroscopy. Exposure of H. pylori to an inhibitory concentration of Bi NPs (100 μg/ml) led to release of some metabolites such as acetate, formic acid, glutamate, valine, glycine, and uracil from bacteria into their supernatant. These findings confirm that these nanoparticles interfere with Krebs cycle, nucleotide, and amino acid metabolism and shows anti-H. pylori activity. PMID:24104691

  14. Fridel-Crafts acylation using bismuth triflate in [BMI][PF6

    DEFF Research Database (Denmark)

    Tran, Phuong Hoang; Duus, Fritz; Le, Thach Ngoc


    Bismuth trifluoromethanesulfonate was found to be a good catalyst for the Friedel–Craftsacylation. Bismuthtriflate immobilized in an ionic liquid was the most efficient catalytic system. Bismuthtriflate in [BMI][PF6] catalyzes this reaction under microwave irradiation allowing the rapid synthesis...

  15. Structural Engineering of Vacancy Defected Bismuth Tellurides for Thermo-electric Applications (United States)

    Termentzidis, K.; Pokropivny, A.; Xiong, S.-Y.; Chumakov, Y.; Cortona, P.; Volz, S.


    Molecular Dynamics and ab-initio simulations are used to find the most stable stoichiometries of Bismuth Tellurides with vacancy defects. The interest is to decrease the thermal conductivity of these compounds a key point to achieve high figure of merits. A reduction of 70% of the thermal conductivity is observed with Te vacancies of only 5%.

  16. Examination of dielectric dispersion of complex oxides on the basis of bismuth-containing titanates

    International Nuclear Information System (INIS)

    In the present work the samples of complex oxide compounds on the basis of bismuth titanates with chalcolamprite structure type and layered perovskite doped with Cr, Fe and Co were studied at room temperature by the method of dielectric spectroscopy in the frequency range of 30 to 106 Hz

  17. Thermodynamics of neptunium in LiCl-KCl eutectic/liquid bismuth systems

    International Nuclear Information System (INIS)

    Thermodynamic properties of neptunium in LiCl-KCl eutectic/liquid bismuth systems in the temperature range 400--500 C have been studied using a galvanic cell method for the pyrometallurgical reprocessing of nuclear spent fuels. The standard potential of the Np/Np(III) couple vs. the Ag/AgCl (1 wt% AgCl) reference electrode in LiCl-KCl eutectic was measured and given by the equation ENp/Np(III)0 = minus2.0667 + 0.0007892 T (σ = 0.0009), where E is in volts, T is in kelvin, and σ is the standard deviation. The potential of neptunium-bismuth alloy, ENp-Bi, was measured as a function of neptunium concentration, XNpinBi. The curves for EBi-Np vs. log XNpinBi indicated the neptunium solubility in liquid bismuth to be 0.34 ± 0.02, 0.61 ± 0.08, and 1.06 ± 0.09 (±σ) atom % at 400, 450, and 500 C, respectively. The excess partial free energy of neptunium in liquid bismuth was represented by the equation, Δbar GNpxs (kcal/g atom) = minus32.5 (±0.7) + 0.0072 (±0.0010) T. The values of the solubility and excess partial free energy for neptunium were closer to those for plutonium rather than uranium

  18. Dynamic spatial structure of spontaneous beams in photorefractive bismuth sillicon oxide

    DEFF Research Database (Denmark)

    Buchhave, Preben; Lyuksyutov, S.; Vasnetsov, M.;


    We report the domain structure of spontaneously occurring beams (subharmonics) in photorefractive bismuth silicon oxide with an applied electric field from 1 to 6 kV/cm and a running grating. The subharmonic beams are generated in a pattern of domains that evolve dynamically as they move through ...

  19. Microwave-assisted facile and rapid Friedel-Crafts benzoylation of arenes catalysed by bismuth trifluoromethanesulfonate

    DEFF Research Database (Denmark)

    Tran, Phoung Hoang; Hansen, Poul Erik; Pham, Thuy Than;


    The catalytic activity of metal triflates was investigated in Friedel–Crafts benzoylation under microwave irradiation. Friedel–Crafts benzoylation with benzoyl chloride of a variety of arenes containing electron-rich and electron-poor rings using bismuth triflate under microwave irradiation is...

  20. Group III-nitride thin films grown using MBE and bismuth (United States)

    Kisielowski, Christian K.; Rubin, Michael


    The present invention comprises growing gallium nitride films in the presence of bismuth using MBE at temperatures of about 1000 K or less. The present invention further comprises the gallium nitride films fabricated using the inventive fabrication method. The inventive films may be doped with magnesium or other dopants. The gallium nitride films were grown on sapphire substrates using a hollow anode Constricted Glow Discharge nitrogen plasma source. When bismuth was used as a surfactant, two-dimensional gallium nitride crystal sizes ranging between 10 .mu.m and 20 .mu.m were observed. This is 20 to 40 times larger than crystal sizes observed when GaN films were grown under similar circumstances but without bismuth. It is thought that the observed increase in crystal size is due bismuth inducing an increased surface diffusion coefficient for gallium. The calculated value of 4.7.times.10.sup.-7 cm.sup.2 /sec. reveals a virtual substrate temperature of 1258 K which is 260 degrees higher than the actual one.

  1. Determination of (111) ordered domains on platinum electrodes by irreversible adsorption of bismuth. (United States)

    Rodríguez, Paramaconi; Solla-Gullón, José; Vidal-Iglesias, Francisco J; Herrero, Enrique; Aldaz, Antonio; Feliu, Juan M


    Irreversible adsorbed bismuth can be used to determine the fraction of (111) domains on a given platinum sample. On Pt(111) electrodes, the surface redox process of adsorbed bismuth takes place at 0.63 V in a well-defined peak. The behavior of this redox process on the Pt(111) vicinal surfaces indicates that the bismuth atoms involved in the redox process are only those deposited on the (111) terrace sites and that the charge under the peak at 0.63 V is directly proportional to the number of sites on (111) ordered domains (terraces). The good linear relationship obtained between the charge for the bismuth redox process and the number of (111) terrace sites on the vicinal surfaces allows construction of a calibration curve. This calibration curve has been used to directly estimate the amount of (111) ordered domain terrace sites on polycrystalline platinum samples with different surface ordered domains. The results agree with what we would expect from our knowledge of these surfaces. PMID:16097774

  2. Structural Engineering of Vacancy Defected Bismuth Tellurides for Thermo-electric Applications

    Directory of Open Access Journals (Sweden)

    Chumakov Y.


    Full Text Available Molecular Dynamics and ab-initio simulations are used to find the most stable stoichiometries of Bismuth Tellurides with vacancy defects. The interest is to decrease the thermal conductivity of these compounds a key point to achieve high figure of merits. A reduction of 70% of the thermal conductivity is observed with Te vacancies of only 5%.

  3. Electrodeposition of bismuth telluride thermoelectric films from a nonaqueous electrolyte using ethylene glycol

    NARCIS (Netherlands)

    Nguyen, H.P.; Wu, M.; Su, J.; Vullers, R.J.M.; Vereecken, P.M.; Fransaer, J.


    Ethylene glycol was studied as an electrolyte for the electrodeposition of thermoelectric bismuth telluride films by cyclic voltammetry, rotating ring disk electrode and electrochemical quartz crystal microbalance (EQCM). The reduction of both Bi3+ and Te4+ ions proceeds in one step without the form

  4. Improvements to a Flow Sensor for Liquid Bismuth-Fed Hall Thrusters (United States)

    Bonds, Kevin; Polzin, Kurt A.


    Recently, there has been significant interest in using bismuth metal as a propellant in Hall Thrusters [1, 2]. Bismuth offers some considerable cost, weight, and space savings over the traditional propellant--xenon. Quantifying the performance of liquid metal-fed Hall thrusters requires a very precise measure of the low propellant flow rates [1, 2]. The low flow rates (10 mg/sec) and the temperature at which free flowing liquid bismuth exists (above 300 C) preclude the use of off-the-shelf flow sensing equipment [3]. Therefore a new type of sensor is required. The hotspot bismuth flow sensor, described in Refs. [1-5] is designed to perform a flow rate measurement by measuring the velocity at which a thermal feature moves through a flow chamber. The mass flow rate can be determined from the time of flight of the thermal peak, [4, 5]. Previous research and testing has been concerned mainly with the generation of the thermal peak and it's subsequent detection. In this paper, we present design improvements to the sensor concept; and the results of testing conducted to verify the functionality of these improvements. A ceramic material is required for the sensor body (see Fig. 1), which must allow for active heating of the bismuth flow channel to keep the propellant in a liquid state. The material must be compatible with bismuth and must be bonded to conductive elements to allow for conduction of current into the liquid metal and measurement of the temperature in the flow. The new sensor requires fabrication techniques that will allow for a very small diameter flow chamber, which is required to produce useful measurements. Testing of various materials has revealed several that are potentially compatible with liquid bismuth. Of primary concern in the fabrication and testing of a robust, working prototype, is the compatibility of the selected materials with one another. Specifically, the thermal expansion rates of the materials relative to the ceramic body cannot expand so

  5. Hall Plateaus at magic angles in ultraquantum Bismuth (United States)

    Benoît, Fauqué.


    The behaviour of a three-dimensional electron gas in the presence of a magnetic field strong enough to put all carriers in the first Landau level (i.e. beyond the quantum limit) is a longstanding question of theoretical condensed matter physics [1]. This issue has been recently explored by two high-field experiments on elemental semi-metal Bismuth. In a first study of transport coefficients (which are dominated by hole-like carriers), the Nernst coefficient presented three unexpected maxima that are concomitant with quasi-plateaux in the Hall coefficient [2]. In a second series of experiments, torque magnetometry (which mainly probes the three Dirac valley electron pockets) detected a field-induced phase transition [3]. The full understanding of the electron and hole behaviours above the quantum limit of pure Bi is therefore still under debate. In this talk, we will present our measurement of the Hall resistivity and torque magnetometry with magnetic field up to 31 T and rotating in the trigonal-bisectrix plane [4]. The Hall response is dominated by the hole pockets according to its sign as well as the period and the angular dependence of its quantum oscillations. In the vicinity of the quantum limit, it presents additional anomalies which are the fingerprints of the electron pockets. We found that for particular orientations of the magnetic field (namely ``magic angles''), the Hall response becomes field-independent within the experimental resolution around 20T. This drastic dependence of the plateaux on the field orientation provides strong constraints for theoretical scenarios. [4pt] [1] Bertrand I. Halperin, Japanese Journal of Applied Physics, 26, Supplement 26-3 (1987).[0pt] [2] Kamran Behnia, Luis Balicas, Yakov Kopelevich, Science, 317, 1729 (2008).[0pt] [3] Lu Li, J. G. Checkelsky, Y. S. Hor, C. Uher, A. F. Hebard, R. J. Cava, and N. P. Ong , Science, 321, 5888 (2008).[0pt] [4] Benoît Fauqu'e, Luis Balicas, Ilya Sheikin, Jean Paul Issi and Kamran Behnia

  6. 48 CFR 627.203 - Patent indemnification of Government by contractor. (United States)


    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Patent indemnification of Government by contractor. 627.203 Section 627.203 Federal Acquisition Regulations System DEPARTMENT OF STATE GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Patents 627.203 Patent indemnification...

  7. 41 CFR 50-203.2 - Issuance of a formal complaint. (United States)


    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Issuance of a formal complaint. 50-203.2 Section 50-203.2 Public Contracts and Property Management Other Provisions Relating to... of the Walsh-Healey Public Contracts Act § 50-203.2 Issuance of a formal complaint. After a report...

  8. 32 CFR Appendix A to Part 203 - Technical Assistance for Public Participation Request Form (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Technical Assistance for Public Participation Request Form A Appendix A to Part 203 National Defense Department of Defense (Continued) OFFICE OF THE... DEFENSE ENVIRONMENTAL RESTORATION ACTIVITIES Pt. 203, App. A Appendix A to Part 203—Technical...

  9. 24 CFR 203.420 - Nature of Mutual Mortgage Insurance Fund. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Nature of Mutual Mortgage Insurance Fund. 203.420 Section 203.420 Housing and Urban Development Regulations Relating to Housing and Urban... and Distributive Shares § 203.420 Nature of Mutual Mortgage Insurance Fund. The Mutual...

  10. 14 CFR 1252.203 - Special benefits for children and the elderly. (United States)


    ... elderly. 1252.203 Section 1252.203 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION... Determining Age Discrimination § 1252.203 Special benefits for children and the elderly. If a recipient operating a program or activity provides special benefits to the elderly or to children, such use of...

  11. 48 CFR 1652.203-70 - Misleading, deceptive, or unfair advertising. (United States)


    ... unfair advertising. 1652.203-70 Section 1652.203-70 Federal Acquisition Regulations System OFFICE OF... CLAUSES Texts of FEHBP Clauses 1652.203-70 Misleading, deceptive, or unfair advertising. As prescribed in... Unfair Advertising (JAN 1991) (a) The Carrier agrees that any advertising material, including...

  12. 33 CFR 203.47 - Modifications to non-Federal flood control works. (United States)


    ... flood control works. 203.47 Section 203.47 Navigation and Navigable Waters CORPS OF ENGINEERS... DISASTER PROCEDURES Rehabilitation Assistance for Flood Control Works Damaged by Flood or Coastal Storm: The Corps Rehabilitation and Inspection Program § 203.47 Modifications to non-Federal flood...

  13. 33 CFR 203.44 - Rehabilitation of non-Federal flood control works. (United States)


    ... flood control works. 203.44 Section 203.44 Navigation and Navigable Waters CORPS OF ENGINEERS... DISASTER PROCEDURES Rehabilitation Assistance for Flood Control Works Damaged by Flood or Coastal Storm: The Corps Rehabilitation and Inspection Program § 203.44 Rehabilitation of non-Federal flood...

  14. 48 CFR 52.203-13 - Contractor Code of Business Ethics and Conduct. (United States)


    ... Business Ethics and Conduct. 52.203-13 Section 52.203-13 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.203-13 Contractor Code of Business Ethics and Conduct. As prescribed in 3.1004(a), insert the following clause: Contractor Code of Business Ethics and Conduct (APR 2010) (a)...

  15. 24 CFR 203.422 - Right and liability under Mutual Mortgage Insurance Fund. (United States)


    ... Mortgage Insurance Fund and Distributive Shares § 203.422 Right and liability under Mutual Mortgage... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Right and liability under Mutual Mortgage Insurance Fund. 203.422 Section 203.422 Housing and Urban Development Regulations Relating...

  16. 24 CFR 4001.203 - Calculation of upfront and annual mortgage insurance premiums for Program mortgages. (United States)


    ... mortgage insurance premiums for Program mortgages. 4001.203 Section 4001.203 Housing and Urban Development....203 Calculation of upfront and annual mortgage insurance premiums for Program mortgages. (a) Applicable premiums. Any mortgage presented for endorsement under section 257 on or after October 1,...

  17. 30 CFR 203.72 - Can my lease receive more than one suspension volume? (United States)


    ... volume? 203.72 Section 203.72 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR... receive more than one suspension volume? Yes. You may apply for royalty relief that involves more than one suspension volume under § 203.62 in two circumstances. (a) Each field that includes your lease may receive...

  18. 29 CFR 825.203 - Scheduling of intermittent or reduced schedule leave. (United States)


    ... 29 Labor 3 2010-07-01 2010-07-01 false Scheduling of intermittent or reduced schedule leave. 825.203 Section 825.203 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT... Family and Medical Leave Act § 825.203 Scheduling of intermittent or reduced schedule leave....

  19. 48 CFR 252.203-7002 - Requirement to Inform Employees of Whistleblower Rights. (United States)


    ... Employees of Whistleblower Rights. 252.203-7002 Section 252.203-7002 Federal Acquisition Regulations System... Whistleblower Rights. As prescribed in 203.970, use the following clause: Requirement To Inform Employees of Whistleblower Rights (JAN 2009) The Contractor shall inform its employees in writing of employee...

  20. 48 CFR 12.203 - Procedures for solicitation, evaluation, and award. (United States)


    ... solicitation, evaluation, and award. 12.203 Section 12.203 Federal Acquisition Regulations System FEDERAL... Acquisition of Commercial Items 12.203 Procedures for solicitation, evaluation, and award. Contracting... conjunction with the policies and procedures for solicitation, evaluation and award prescribed in part...

  1. 47 CFR 54.203 - Designation of eligible telecommunications carriers for unserved areas. (United States)


    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Designation of eligible telecommunications carriers for unserved areas. 54.203 Section 54.203 Telecommunication FEDERAL COMMUNICATIONS COMMISSION... Support § 54.203 Designation of eligible telecommunications carriers for unserved areas. (a) If no...

  2. 33 CFR 203.61 - Emergency water supplies due to contaminated water source. (United States)


    ... Water Act (see 40 CFR 141), is exceeded. (ii) The water supply has been identified as a source of... contaminated water source. 203.61 Section 203.61 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT... PROCEDURES Emergency Water Supplies: Contaminated Water Sources and Drought Assistance § 203.61...

  3. Synthesis of mercuric iodide and bismuth tri-iodide nanoparticles for heavy metal iodide films nucleation

    Energy Technology Data Exchange (ETDEWEB)

    Fornaro, L.; Pereira, H.Bentos [Compound Semiconductors Group, CURE, Universidad de la Republica, Rocha (Uruguay); Aguiar, I.; Perez Barthaburu, M. [Compound Semiconductors Group, Facultad de Quimica, Univ. de la Republica, Montevideo (Uruguay)


    We synthesized mercuric iodide and bismuth tri-iodide nanoparticles by suspension in octadecene, from Hg(NO{sub 3}){sub 2}.H{sub 2}O and I{sub 2}, and from Bi(NO{sub 3}){sub 3}.5H{sub 2}O and I{sub 2}, respectively. The best synthesis conditions were 2 h at 70-80 C, followed by 10 min at 110 C for mercuric iodide nanoparticles, and 4 h at 80-110 C, followed by 10 min at 180-210 C for bismuth tri-iodide ones. Nanoparticles were then washed and centrifuged with ether repeatedly. Compounds identity was confirmed by X-ray diffraction (XRD) and energy dispersive spectrometry (EDS). We found shifts of the X-ray diffraction maxima for nanoparticles of both compounds. We characterized the nanoparticles by transmission (TEM) and scanning (SEM) electron microscopy. We obtained disk-like and squared mercuric iodide nanostructures, 80-140 nm and 100-125 nm in size respectively. We also obtained rounded and rod-like bismuth tri-iodide nanoparticles, 30-500 nm in size. Acetonitrile and isopropanol suspensions of mercuric iodide nanoparticles, and acetonitrile suspension of bismuth tri-iodide nanoparticles exhibited peak maxima shifts in their UV-Vis spectra. We synthesized for the first time mercuric iodide and bismuth tri-iodide nanoparticles by the suspension method, although we have not yet obtained uniform shape and size distributions. They offer interesting perspectives for crystalline film nucleation and for improving current applications of these materials, as well as for opening new ones. (copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  4. 5 CFR 870.203 - Post-election BIA. (United States)


    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Post-election BIA. 870.203 Section 870...-election BIA. (a) The BIA of an individual who elects a Living Benefit under subpart K of this part is the amount of insurance left after the effective date of the Living Benefit election. This amount is...

  5. 5 CFR 847.203 - Elections of CSRS coverage. (United States)


    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Elections of CSRS coverage. 847.203... REGULATIONS (CONTINUED) ELECTIONS OF RETIREMENT COVERAGE BY CURRENT AND FORMER EMPLOYEES OF NONAPPROPRIATED FUND INSTRUMENTALITIES Elections To Continue Retirement Coverage After a Qualifying Move §...

  6. 5 CFR 950.203 - Public accountability standards. (United States)


    ... Section 950.203 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE... insure organizations wishing to solicit donations from Federal employees in the workplace are portraying... organization is directed by an active and responsible governing body whose members have no material conflict...

  7. 46 CFR 16.203 - Employer, MRO, and SAP responsibilities. (United States)


    ... meet the training requirements and follow the procedures in 49 CFR Part 40. (2) MROs may report... and follow the procedures in 49 CFR Part 40. ... 46 Shipping 1 2010-10-01 2010-10-01 false Employer, MRO, and SAP responsibilities. 16.203...

  8. 27 CFR 555.203 - Types of magazines. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Types of magazines. 555... EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Storage § 555.203 Types of magazines. For purposes of this part, there are five types of magazines. These types, together with the classes...

  9. 10 CFR 830.203 - Unreviewed safety question process. (United States)


    ... 10 Energy 4 2010-01-01 2010-01-01 false Unreviewed safety question process. 830.203 Section 830... Unreviewed safety question process. (a) The contractor responsible for a hazard category 1, 2, or 3 DOE... a procedure for its USQ process on a schedule that allows DOE approval in a safety evaluation...

  10. 48 CFR 43.203 - Change order accounting procedures. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Change order accounting... CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 43.203 Change order accounting procedures. (a) Contractors' accounting systems are seldom designed to segregate the costs of performing changed...

  11. 24 CFR 203.350 - Assignment of mortgage. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Assignment of mortgage. 203.350... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Assignment of Mortgage §...

  12. 20 CFR 416.203 - Initial determinations of SSI eligibility. (United States)


    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Initial determinations of SSI eligibility... INCOME FOR THE AGED, BLIND, AND DISABLED Eligibility General § 416.203 Initial determinations of SSI eligibility. (a) What happens when you apply for SSI benefits. When you apply for SSI benefits we will ask...

  13. 24 CFR 203.270 - Open-end insurance charges. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Open-end insurance charges. 203.270... (Continued) OFFICE OF ASSISTANT SECRETARY FOR HOUSING-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF HOUSING AND... SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Open-End Insurance Charges-All...

  14. 48 CFR 828.203-7 - Exclusion of individual sureties. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Exclusion of individual... Exclusion of individual sureties. The DSPE may make the determinations referenced in FAR 28.203-7: (a) To exclude individuals from acting as surety on bonds; and (b) To accept bonds from individuals named on...

  15. 24 CFR 203.361 - Acceptance of property by Commissioner. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Acceptance of property by... AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Claim Procedure § 203.361 Acceptance of property by Commissioner. Upon receipt of notice of property transfer the Commissioner...

  16. 40 CFR 61.203 - Radon monitoring and compliance procedures. (United States)


    ... disposal of phosphogypsum or for water management, the stack ceases to be in inactive status and the owner... stack for disposal of phosphogypsum or water management, the stack will once again become inactive and... for Radon Emissions From Phosphogypsum Stacks § 61.203 Radon monitoring and compliance procedures....

  17. 48 CFR 1631.203-70 - Allocation techniques. (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Allocation techniques. 1631... PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 1631.203-70 Allocation techniques. (a... preferred allocation technique is one that shows the consumption of resources in performance of...

  18. 48 CFR 23.203 - Energy-efficient products. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Energy-efficient products... SOCIOECONOMIC PROGRAMS ENVIRONMENT, ENERGY AND WATER EFFICIENCY, RENEWABLE ENERGY TECHNOLOGIES, OCCUPATIONAL SAFETY, AND DRUG-FREE WORKPLACE Energy and Water Efficiency and Renewable Energy 23.203...

  19. 31 CFR 539.203 - Evasions; attempts; conspiracies. (United States)


    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Evasions; attempts; conspiracies. 539... REGULATIONS Prohibitions § 539.203 Evasions; attempts; conspiracies. Any transaction by any United States... prohibited. Any conspiracy formed for the purpose of engaging in a transaction prohibited by this part...

  20. 48 CFR 836.203 - Government estimate of construction costs. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Government estimate of... Contracting for Construction 836.203 Government estimate of construction costs. The overall amount of the Government estimate must not be disclosed until after award of the contract. After award, the...

  1. 48 CFR 436.203 - Government estimate of construction costs. (United States)


    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Government estimate of... Contracting for Construction 436.203 Government estimate of construction costs. For acquisitions using sealed bid procedures, the contracting officer may disclose the overall amount of the Government's...

  2. 27 CFR 31.203 - Possession of used liquor bottles. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Possession of used liquor... BUREAU, DEPARTMENT OF THE TREASURY LIQUORS ALCOHOL BEVERAGE DEALERS Reuse and Possession of Used Liquor Bottles § 31.203 Possession of used liquor bottles. The possession of used liquor bottles by any...

  3. 20 CFR 633.203 - Review of funding request. (United States)


    ... 633.203 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR MIGRANT AND.... The SGA will identify all review standards including: (a) An understanding of the problems of migrant... capability to administer effectively a diversified employability development program for migrant and...

  4. 24 CFR 203.493 - Declaration of trust. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Declaration of trust. 203.493... Declaration of trust. A sale of a beneficial interest in a group of insured loans, where the interest to be... be made only pursuant to a declaration of trust, which has been approved by the Commissioner prior...

  5. 24 CFR 203.604 - Contact with the mortgagor. (United States)


    ... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Servicing Responsibilities Mortgagee Action and Forbearance § 203.604... the mortgage are unpaid. If default occurs in a repayment plan arranged other than during a...

  6. 24 CFR 1003.203 - Special economic development activities. (United States)


    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Special economic development... Eligible Activities § 1003.203 Special economic development activities. A grantee may use ICDBG funds for special economic development activities in addition to other activities authorized in this subpart...

  7. 33 CFR 203.72 - Eligibility criteria and procedures. (United States)


    ..., DEPARTMENT OF DEFENSE EMERGENCY EMPLOYMENT OF ARMY AND OTHER RESOURCES, NATURAL DISASTER PROCEDURES Advance Measures § 203.72 Eligibility criteria and procedures. (a) Threat of flooding. An imminent threat of... readily apparent that damages will be incurred if preventive action is not taken immediately. (b)...

  8. 24 CFR 203.288 - Discontinuance of adjusted premium charge. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Discontinuance of adjusted premium... Premium § 203.288 Discontinuance of adjusted premium charge. Notwithstanding any provision in the mortgage instrument, there shall be no adjusted mortgage insurance premium due the Commissioner on account of...

  9. 203Hg binding in the liver and kidney of the frog, Rana tigrina

    International Nuclear Information System (INIS)

    Following a single i.p. dose of the radioisotope, 203Hg was found to accumulate in both the high and low molecular weight (MW) fractions of the kidney and liver of the frog. The course of 203Hg appearance in the 2 fractions varied in the liver; 203Hg was exclusively associated with the higher MW fractions at 2 days whereas the radiotracer appeared in both low and high MW fractions at 4 and 7 days after administration. In the kidneys, however, 203Hg was associated with high and low MW fractions at all the intervals studied. Low MW 203Hg binding fraction appeared to be a metallothionein-like substance. (Auth.)

  10. Electrodes modified with bismuth, antimony and tin precursor compounds for electrochemical stripping analysis of trace metals (a short review)


    Lezi, Nikolitsa; Economou, Anastasios; Barek, Jiří


    Over the last decade, intensive research is being carried out towards the development of “green” electrochemical sensors. Bismuth, antimony and tin electrodes have been proposed as potential substitutes of mercury electrodes in electrochemical stripping analysis of trace metals. The main advantage of these metals as electrode materials is their lower toxicity compared to mercury. Among the different configuration of bismuth, antimony and tin electrodes, one of the most attractive inv...

  11. ELECTRA: A European Lead-bismuth Cooled Training Reactor

    International Nuclear Information System (INIS)

    The lack of low power liquid metal cooled reactors has meant that few engineers within the nuclear power industry and research community are familiar with operational procedures of this family of coolants, expected to be used for Generation IV fast neutron systems. The reasons for this lack may include safety issues related to use of Mercury, NaK or sodium as applied in early low power reactors. Especially in western Europe, no low power liquid metal cooled reactor was ever in operation. Here, we present the design of a 2 MWth lead-bismuth cooled reactor with (Pu,Zr)N fuel, relying on natural convection for full power operation. The combination of low power density with natural convection for heat removal makes the reactor ideal for training purposes. The large thermal expansion of heavy liquid metals makes is possible to design low power fast neutron reactors relying on natural convection. Since at present, there exists no suitable material for pumps operating at high velocity in lead alloy environments, the only possible short term solution for constructing such a reactor is anyway to design for 100% natural circulation of the coolant. For this purpose, a small core height, a large difference between coolant inlet and outlet temperatures and a low coolant velocity is desired. By application of (Pu,Zr)N fuel, criticality can be achieved with a fissile inventory of 100 kg LWR grade plutonium. Monte Carlo simulations show that 19 hexagonal fuel assemblies, each with 91 fuel pins having an outer diameter of 1.1 cm, and an active height of 15 cm is sufficient to obtain a critical core. Including end pellets, gas plenum and end caps, the total core height is limited to 30 cm. Adopting P/D = 1.25 and a heat exchanger elevation of 4 m, it is found that 2 MW of thermal power may be removed by a natural circulation velocity of 0.4 m/s. This corresponds to a linear rating of 8 kW/m and a temperature increase of the coolant equal to 240 degrees. Limiting the clad temperature

  12. Bismuth-ceramic nanocomposites through ball milling and liquid crystal synthetic methods (United States)

    Dellinger, Timothy Michael

    Three methods were developed for the synthesis of bismuth-ceramic nanocomposites, which are of interest due to possible use as thermoelectric materials. In the first synthetic method, high energy ball milling of bismuth metal with either MgO or SiO2 was found to produce nanostructured bismuth dispersed on a ceramic material. The morphology of the resulting bismuth depended on its wetting behavior with respect to the ceramic: the metal wet the MgO, but did not wet on the SiO2. Differential Scanning Calorimetry measurements on these composites revealed unusual thermal stability, with nanostructure retained after multiple cycles of heating and cooling through the metal's melting point. The second synthesis methodology was based on the use of lyotropic liquid crystals. These mixtures of water and amphiphilic molecules self-assemble to form periodic structures with nanometer-scale hydrophilic and hydrophobic domains. A novel shear mixing methodology was developed for bringing together reactants which were added to the liquid crystals as dissolved salts. The liquid crystals served to mediate synthesis by acting as nanoreactors to confine chemical reactions within the nanoscale domains of the mesophase, and resulted in the production of nanoparticles. By synthesizing lead sulfide (PbS) and bismuth (Bi) particles as proof-of-concept, it was shown that nanoparticle size could be controlled by controlling the dimensionality of the nanoreactors through control of the liquid crystalline phase. Particle size was shown to decrease upon going from three-dimensionally percolating nanoreactors, to two dimensional sheet-like nanoreactors, to one dimensional rod-like nanoreactors. Additionally, particle size could be controlled by varying the precursor salt concentration. Since the nanoparticles did not agglomerate in the liquid crystal immediately after synthesis, bismuth-ceramic nanocomposites could be prepared by synthesizing Bi nanoparticles and mixing in SiO2 particles which

  13. Syntheses, crystal structures and characterizations of two new bismuth(III) arsenites

    Energy Technology Data Exchange (ETDEWEB)

    Liu Junhui [State Key Laboratory of Structural Chemistry, Fujian Institute of Research on the Structure of Matter, Chinese Academy of Sciences, Fuzhou 350002 (China); Graduate School of the Chinese Academy of Sciences, Beijing 100039 (China); Kong Fang [State Key Laboratory of Structural Chemistry, Fujian Institute of Research on the Structure of Matter, Chinese Academy of Sciences, Fuzhou 350002 (China); Gai Yanli [State Key Laboratory of Structural Chemistry, Fujian Institute of Research on the Structure of Matter, Chinese Academy of Sciences, Fuzhou 350002 (China); Graduate School of the Chinese Academy of Sciences, Beijing 100039 (China); Mao Jianggao, E-mail: [State Key Laboratory of Structural Chemistry, Fujian Institute of Research on the Structure of Matter, Chinese Academy of Sciences, Fuzhou 350002 (China)


    Two new bismuth arsenites with two different structural types, namely, Bi{sub 2}O(AsO{sub 3})Cl (1), Bi{sub 8}O{sub 6}(AsO{sub 3}){sub 2}(AsO{sub 4}){sub 2} (2), have been synthesized by the solid-state reactions. Compound 1 exhibits novel 2D bismuth arsenite layers with Bi{sub 4}O{sub 4} rings capped by oxide anions, which are further interconnected by Bi-Cl-Bi bridges into a 3D network. Compound 2 contains both arsenite and arsenate anions, its 3D structures are based on 1D bismuth arsenite and 1D bismuth arsenate chains both along b-axis, which are interconnected by oxide anions via Bi-O-Bi bridges, forming 1D tunnels of Bi{sub 4}As{sub 4} 8-membered rings (MRs) along b-axis, the lone pairs of the arsenite groups are orientated toward the centers of the above tunnels. Thermogravimetric analysis indicated that both compounds display high thermal stability. Optical property measurements revealed that they are wide band-gap semiconductors. Both compounds display broad green-light emission bands centered at 506 nm under excitation at 380 and 388 nm. - Graphical abstract: Solid state reactions of Bi{sub 2}O{sub 3} (BiCl{sub 3}) and As{sub 2}O{sub 3} yielded two new compounds with two different structural types, namely, Bi{sub 2}O(AsO{sub 3})Cl (1), Bi{sub 8}O{sub 6}(AsO{sub 3}){sub 2}(AsO{sub 4}){sub 2} (2). They represent the first examples of bismuth arsenates. Highlights: Black-Right-Pointing-Pointer Solid state reactions of Bi{sub 2}O{sub 3} (BiCl{sub 3}) and As{sub 2}O{sub 3} yielded two new phases. Black-Right-Pointing-Pointer They represent the first examples of bismuth arsenites. Black-Right-Pointing-Pointer The two compounds exhibit two different structural types.

  14. Pharmacokinetics and bioequivalence of ranitidine and bismuth derived from two compound preparations

    Institute of Scientific and Technical Information of China (English)

    Quan Zhou; Zou-Rong Ruan; Hong Yuan; Bo Jiang; Dong-Hang Xu


    AIM: To evaluate the bioequivalence of ranitidine and bismuth derived from two compound preparations.METHODS: The bioavailability was measured in 20healthy male Chinese volunteers following a single oral dose (equivalent to 200 mg of ranitidine and 220 mg of bismuth) of the test or reference products in the fasting state. Then blood samples were collected for 24 h.Plasma concentrations of ranitidine and bismuth were analyzed by high-performance liquid chromatography and inductively coupled plasma-mass spectrometry (ICPMS), respectively. The non-compartmental method was used for pharmacokinetic analysis. Log-transformed Cmax,AUC(0-t) and AUC(0-∞) were tested for bioequivalence using ANOVA and Schuirmann two-one sided t-test. Tmax was analyzed by Wilcoxon's test.RESULTS: Various pharmacokinetic parameters of ranitidine derived from the two compound preparations,including Cmax, AUC(0-t), AUC(0-∞), Tmax and T1/2, were nearly consistent with previous observations. These parameters derived from test and reference drug were as follows: Cmax(0.67 ± 0.21 vs 0.68 ± 0.22mg/L), AUC(0-t)(3.1 ± 0.6 vs 3.0 ± 0.7 mg/L per hour),AUC(0-∞)(3.3 ± 0.6 vs 3.2 ± 0.8 mg/L per hour),Tmax (2.3 ± 0.9 vs 2.1 ± 0.9 h) and T1/2 (2.8 ± 0.3 vs 3.1± 0.4 h). In addition, double-peak absorption profiles of ranitidine were found in some Chinese volunteers.For bismuth, those parameters derived from test and reference drug were as follows: Cmax (11.80 ± 7.36 vs 11.40 ± 6.55 μg/L),AUC(0-t) (46.65 ± 16.97 vs 47.03 ±21.49 μg/L per hour), Tmax (0.50 ± 0.20 vs 0.50 ± 0.20 h)and T1/2 (10.2 ± 2.3 vs 13.0 ± 6.9 h). Ninety percent of confidence intervals for the test/reference ratio of Cmax,AUC(0-t) and AUC(0-∞) derived from both ranitidine and bismuth were found within the bioequivalence acceptable range of 80%-125%. No significant difference was found in Tmax derived from both ranitidine and bismuth.CONCLUSION: The two compound preparations are bioequivalent and may be prescribed

  15. 30 CFR 203.68 - What pre-application costs will MMS consider in determining economic viability? (United States)


    ... determining economic viability? 203.68 Section 203.68 Mineral Resources MINERALS MANAGEMENT SERVICE... § 203.68 What pre-application costs will MMS consider in determining economic viability? (a) We will not consider ineligible costs as set forth in § 203.89(h) in determining economic viability for purposes...

  16. Characterization, Leaching, and Filtration Testing for Bismuth Phosphate Sludge (Group 1) and Bismuth Phosphate Saltcake (Group 2) Actual Waste Sample Composites

    Energy Technology Data Exchange (ETDEWEB)

    Lumetta, Gregg J.; Buck, Edgar C.; Daniel, Richard C.; Draper, Kathryn; Edwards, Matthew K.; Fiskum, Sandra K.; Hallen, Richard T.; Jagoda, Lynette K.; Jenson, Evan D.; Kozelisky, Anne E.; MacFarlan, Paul J.; Peterson, Reid A.; Shimskey, Rick W.; Sinkov, Sergey I.; Snow, Lanee A.


    A testing program evaluating actual tank waste was developed in response to Task 4 from the M-12 External Flowsheet Review Team (EFRT) issue response plan.() The test program was subdivided into logical increments. The bulk water-insoluble solid wastes that are anticipated to be delivered to the Waste Treatment and Immobilization Plant (WTP) were identified according to type such that the actual waste testing could be targeted to the relevant categories. Eight broad waste groupings were defined. Samples available from the 222S archive were identified and obtained for testing. The actual waste-testing program included homogenizing the samples by group, characterizing the solids and aqueous phases, and performing parametric leaching tests. Two of the eight defined groups—bismuth phosphate sludge (Group 1) and bismuth phosphate saltcake (Group 2)—are the subjects of this report. The Group 1 waste was anticipated to be high in phosphorus and was implicitly assumed to be present as BiPO4 (however, results presented here indicate that the phosphate in Group 1 is actually present as amorphous iron(III) phosphate). The Group 2 waste was also anticipated to be high in phosphorus, but because of the relatively low bismuth content and higher aluminum content, it was anticipated that the Group 2 waste would contain a mixture of gibbsite, sodium phosphate, and aluminum phosphate. Thus, the focus of the Group 1 testing was on determining the behavior of P removal during caustic leaching, and the focus of the Group 2 testing was on the removal of both P and Al. The waste-type definition, archived sample conditions, homogenization activities, characterization (physical, chemical, radioisotope, and crystal habit), and caustic leaching behavior as functions of time, temperature, and hydroxide concentration are discussed in this report. Testing was conducted according to TP-RPP-WTP-467.

  17. Graphite felt modified with bismuth nanoparticles as negative electrode in a vanadium redox flow battery. (United States)

    Suárez, David J; González, Zoraida; Blanco, Clara; Granda, Marcos; Menéndez, Rosa; Santamaría, Ricardo


    A graphite felt decorated with bismuth nanoparticles was studied as negative electrode in a vanadium redox flow battery (VRFB). The results confirm the excellent electrochemical performance of the bismuth modified electrode in terms of the reversibility of the V(3+) /V(2+) redox reactions and its long-term cycling performance. Moreover a mechanism that explains the role that Bi nanoparticles play in the redox reactions in this negative half-cell is proposed. Bi nanoparticles favor the formation of BiHx , an intermediate that reduces V(3+) to V(2+) and, therefore, inhibits the competitive irreversible reaction of hydrogen formation (responsible for the commonly observed loss of Coulombic efficiency of VRFBs). Thus, the total charge consumed during the cathodic sweep in this electrode is used to reduce V(3+) to V(2+) , resulting in a highly reversible and efficient process.

  18. In situ transmission electron microscopy of solid-liquid phase transition of silica encapsulated bismuth nanoparticles (United States)

    Hu, Jianjun; Hong, Yan; Muratore, Chris; Su, Ming; Voevodin, Andrey A.


    The solid-liquid phase transition of silica encapsulated bismuth nanoparticles was studied by in situ transmission electron microscopy (TEM). The nanoparticles were prepared by a two-step chemical synthesis process involving thermal decomposition of organometallic precursors for nucleating bismuth and a sol-gel process for growing silica. The microstructural and chemical analyses of the nanoparticles were performed using high-resolution TEM, Z-contrast imaging, focused ion beam milling, and X-ray energy dispersive spectroscopy. Solid-liquid-solid phase transitions of the nanoparticles were directly recorded by electron diffractions and TEM images. The silica encapsulation of the nanoparticles prevented agglomeration and allowed particles to preserve their original volume upon melting, which is desirable for applications of phase change nanoparticles with consistently repeatable thermal properties.

  19. Zero-dimensional nanostructured material with metallic bismuth nanoparticles: a new route for thermoelectrics (United States)

    Benoit, Roland; Treguer, Mona; Saboungi, Marie-Louise


    The thermoelectric figure of merit ZT has so far not exceeded the value ZT=3 need to compete with mechanical energy conversion systems. However, theoretical work has shown that it is possible to reach values of ZT higher than this. One of the most promising routes is nanostructured materials, which offer the opportunity to tailor physical properties such as electrical and heat transport, due to the effects of electron filtering and phonon confinement. Dresselhaus et al. (ref.?) were among the first to show that 2D and 1D structures are capable of reaching ZT values higher than 2. The thermoelectric materials of current interest are in the form of nanotubes, nanodots and, more generally, superlattices composed of a matrix and nanoparticles. In our work we synthesize a periodic network of bismuth nanoparticles in a matrix of mesoporous Si O2 . We find that in this form bismuth transforms from a rhombohedral to a cubic structure, with improved filtering of electrons and phonons.

  20. Ab initio lattice dynamics and thermochemistry of layered bismuth telluride (Bi2Te3) (United States)

    Zurhelle, Alexander F.; Deringer, Volker L.; Stoffel, Ralf P.; Dronskowski, Richard


    We present density-functional theory calculations of the lattice dynamics of bismuth telluride, yielding force constants, mean-square displacements and partial densities of phonon states which corroborate and complement previous nuclear inelastic scattering experiments. From these data, we derive an element- and energy-resolved view of the vibrational anharmonicity, quantified by the macroscopic Grüneisen parameter γ which results in 1.56. Finally, we calculate thermochemical properties in the quasiharmonic approximation, especially the heat capacity at constant pressure and the enthalpy of formation for bismuth telluride; the latter arrives at ▵H f (Bi2Te3)  =  -102 kJ mol-1 at 298 K.

  1. Recovery of IR luminescence in photobleached bismuth-doped fibers by thermal annealing (United States)

    Firstov, S. V.; Firstova, E. G.; Alyshev, S. V.; Khopin, V. F.; Riumkin, K. E.; Melkumov, M. A.; Guryanov, A. N.; Dianov, E. M.


    The effect of annealing temperature on the luminescent properties of bismuth-doped fibers bleached by 532 nm laser radiation was investigated. The photoluminescence (PL) measurements were performed in pristine and photobleached samples which were thermally annealed at various temperatures ranging from 100 to 900 °C and slowly cooled. We observed that the intensity of the PL band at 1700 nm in the photobleached fibers recovered its pre-bleached level. Moreover, it was shown that a significant increase of the PL level could be achieved using the special annealing regime. Thereby, we obtained the experimental evidence of a thermally activated recovery process of the PL intensity showing that photoinduced changes of PL in bismuth-doped fibers are completely reversible. The mechanism of the thermal recovery of the PL is discussed.

  2. Synthesis of Bismuth Ferrite Nanoparticles via a Wet Chemical Route at Low Temperature

    Directory of Open Access Journals (Sweden)

    Yongming Hu


    Full Text Available Nanoparticles (NPs of multiferroic bismuth ferrite (BiFeO3 with narrow size distributions were synthesized via a wet chemical route using bismuth nitrate and iron nitrate as starting materials and excess tartaric acid and citric acid as chelating agent, respectively, followed by thermal treatment. It was found that BiFeO3 NPs crystallized at ∼350∘C when using citric acid as chelating agent. Such crystallization temperature is much lower than that of conventional chemical process in which other types of chelating agent are used. BiFeO3 NPs with different sizes distributions show obvious ferromagnetic properties, and the magnetization is increased with reducing the particle size.

  3. Quantum transport, anomalous dephasing, and spin-orbit coupling in an open ballistic bismuth nanocavity (United States)

    Hackens, B.; Minet, J. P.; Faniel, S.; Farhi, G.; Gustin, C.; Issi, J. P.; Heremans, J. P.; Bayot, V.


    The phase coherence time τφ and spin-orbit coupling time τso are measured in a bismuth quasiballistic nanocavity and in bismuth thin films using weak antilocalization and universal conductance fluctuations. The cavity is found to be zero dimensional for phase-coherent processes at low temperature. Weak antilocalization seems weakly affected by this drastic reduction of dimensionality. The temperature dependence of τφ is similar in both types of samples, qualitatively consistent with low-energy transfer two-dimensional electron-electron interaction effects as the dominant dephasing mechanism. Strikingly, τφ in the dot is found to be an order-of-magnitude smaller than in the film, and orders-of-magnitude smaller than the theoretical prediction.

  4. Synthesis and Electrochemical Sensing Toward Heavy Metals of Bunch-like Bismuth Nanostructures

    Directory of Open Access Journals (Sweden)

    Zhang Zhi


    Full Text Available Abstract Large-scale bunch-like bismuth (Bi nanostructures were the first time to be synthesized via two-step electrochemical deposition. The growth mechanism of the nanostructures was discussed. Such a designed bunch-like Bi electrode has high sensitivity to detect the heavy metal ions due to its unique three-dimensional structures and strong ability of adsorbing the heavy metal ions. The bunch-like Bi electrode’s detection of heavy metals was statically performed using anodic stripping voltammetry (ASV. The detection in the Pb(II concentration range of 2.5–50 μg/l was also performed. Based on the experimental results, this bunch-like Bi electrode can be considered as an interesting alternative to common mercury electrodes and bismuth film electrodes for possible use in electrochemical studies and electroanalytical applications.

  5. Intercalation of pyridine and its derivatives into crystalline bismuth molybdenum hydrous oxide

    International Nuclear Information System (INIS)

    Bismuth molybdenum hydrous oxide was prepared by water-thermally direct precipitation in relatively concentrated solutions. The composition of the resulting product was Bi2Mo3O12 x 3.86 H2O determined by thermal analysis and ICP. The X-ray powder diffraction patterns of the crystal synthesized was identical with that of Bi2Mo3O12 x 4.75 H2O. Pyridine, 2,5-dimethylpyridine and 4-benzylpiridine were intercalated into inorganic crystal, significantly expanding interlayer distance along b axis in the monoclinic cell unit of bismuth molybdenum hydrous oxide. The organic molecules were intercalated by solvent exchange mechanism which mainly devoted to the expansion of interlayer spacing. (author)

  6. Equilibrium evaporation of trace polonium from liquid lead–bismuth eutectic at high temperature

    International Nuclear Information System (INIS)

    Highlights: •We studied evaporation of trace polonium from liquid lead–bismuth eutectic. •Our methods for Po are validated through analysis of LBE evaporation. •At low concentration Po evaporates from LBE according to Henry’s law. •New Henry constant-temperature correlations for Po in LBE are presented. -- Abstract: The evaporation of Po from its dilute solution in liquid lead–bismuth eutectic (LBE) was determined between 700 and 1000 °C in Ar/5%H2 by the transpiration method. Concurrent measurements of the evaporation of LBE could be well reproduced by calculations using literature data, confirming conditions of equilibrium and convective vapor transport in our transpiration method experiments. This allowed to model the Po evaporation data and extract accurate temperature correlations for the Henry constant for Po dissolved in LBE at two different Po concentrations. Extrapolations of the new correlations were in excellent agreement with existing data at lower temperature

  7. Gamma-ray shielding and structural properties of barium-bismuth-borosilicate glasses (United States)

    Bootjomchai, Cherdsak; Laopaiboon, Jintana; Yenchai, Chadet; Laopaiboon, Raewat


    The attenuation coefficients of barium-bismuth-borosilicate glasses have been measured for gamma-ray photon energies of 662, 1173 and 1332 keV using a narrow beam transmission geometry. These coefficients were then used to obtain the values of mass attenuation coefficients, effective atomic number, effective electron density and mean free path. Good agreement has been observed between experimental and theoretical values of these parameters. From the obtained results it is reported here that from the barium-bismuth-borosilicate glasses are better shields to gamma-radiations in comparison to the standard radiation shielding concretes from the shielding point of view. The molar volume, FTIR and acoustic investigations have been used to study the structural properties of the prepared glass system. The obtained results reveal that the formation of non-bridging oxygens occurs at higher concentration of Bi2O3.

  8. Mixed-layered bismuth--oxygen--iodine materials for capture and waste disposal of radioactive iodine

    Energy Technology Data Exchange (ETDEWEB)

    Krumhansl, James L; Nenoff, Tina M


    Materials and methods of synthesizing mixed-layered bismuth oxy-iodine materials, which can be synthesized in the presence of aqueous radioactive iodine species found in caustic solutions (e.g. NaOH or KOH). This technology provides a one-step process for both iodine sequestration and storage from nuclear fuel cycles. It results in materials that will be durable for repository conditions much like those found in Waste Isolation Pilot Plant (WIPP) and estimated for Yucca Mountain (YMP). By controlled reactant concentrations, optimized compositions of these mixed-layered bismuth oxy-iodine inorganic materials are produced that have both a high iodine weight percentage and a low solubility in groundwater environments.

  9. Synthesis and Electrochemical Sensing Toward Heavy Metals of Bunch-like Bismuth Nanostructures (United States)

    Zhang, Zhi; Yu, Ke; Bai, Dan; Zhu, Ziqiang


    Large-scale bunch-like bismuth (Bi) nanostructures were the first time to be synthesized via two-step electrochemical deposition. The growth mechanism of the nanostructures was discussed. Such a designed bunch-like Bi electrode has high sensitivity to detect the heavy metal ions due to its unique three-dimensional structures and strong ability of adsorbing the heavy metal ions. The bunch-like Bi electrode’s detection of heavy metals was statically performed using anodic stripping voltammetry (ASV). The detection in the Pb(II) concentration range of 2.5-50 μg/l was also performed. Based on the experimental results, this bunch-like Bi electrode can be considered as an interesting alternative to common mercury electrodes and bismuth film electrodes for possible use in electrochemical studies and electroanalytical applications.

  10. Evaluation of bismuth shielding effectiveness in reducing breast absorbed dose during thoracic CT scan

    International Nuclear Information System (INIS)

    Computed Tomography (CT) is an essential method for tracking neoplasia and efficiently diagnosing a wide variety of thoracic diseases. CT is generally considered the most accurate choice for lung examination. Due to the growing use of CT, breast and other superficial and radiosensitive organs are unnecessarily irradiated during radiological procedures, thus requiring the development of strategies appropriate to optimize and, if possible, to reduce the radiation dose. The use of bismuth shielding to reduce radiation dose absorbed by breast during thoracic CT examinations has been the subject of many studies recently published by Brazilian and foreign authors of various fields. The purpose of this paper is both to accurately determine the glandular dose when breast is exposed to radiation and to assess the reduction in absorbed dose during thoracic CT examinations, using a set of Thermoluminescent Dosimeters, an anthropomorphic phantom and bismuth shielding. (Author)

  11. Evaluation of bismuth shielding effectiveness in reducing breast absorbed dose during thoracic CT scan

    Energy Technology Data Exchange (ETDEWEB)

    Alonso, T. C.; Mourao, A. P.; Santana, P. C.; Silva, T. A. [Federal University of Minas Gerais, Program of Nuclear Science and Techniques, Av. Pte. Antonio Carlos 6627, 31270-901 Belo Horizonte, Minas Gerais (Brazil)


    Computed Tomography (CT) is an essential method for tracking neoplasia and efficiently diagnosing a wide variety of thoracic diseases. CT is generally considered the most accurate choice for lung examination. Due to the growing use of CT, breast and other superficial and radiosensitive organs are unnecessarily irradiated during radiological procedures, thus requiring the development of strategies appropriate to optimize and, if possible, to reduce the radiation dose. The use of bismuth shielding to reduce radiation dose absorbed by breast during thoracic CT examinations has been the subject of many studies recently published by Brazilian and foreign authors of various fields. The purpose of this paper is both to accurately determine the glandular dose when breast is exposed to radiation and to assess the reduction in absorbed dose during thoracic CT examinations, using a set of Thermoluminescent Dosimeters, an anthropomorphic phantom and bismuth shielding. (Author)

  12. Structural, optical and glass transition studies on Nd3+-doped lead bismuth borate glasses

    International Nuclear Information System (INIS)

    Nd3+-doped lead bismuth borate (PbO-Bi2O3-B2O3) glasses were prepared with different concentrations of Nd3+. The structural studies were done through FTIR spectral analysis. The glass transition studies were done through differential scanning calorimetry. The optical analysis was done by using Judd-Ofelt theory. The structural study reveals that the glass has [BiO3], BO4, BO3 and PbO4 units as the local structures

  13. Electroless deposition of bismuth on Si(111) wafer from hydrogen fluoride solutions

    Energy Technology Data Exchange (ETDEWEB)

    Romann, T., E-mail: tavo.romann@ut.e [Institute of Chemistry, University of Tartu, 2 Jakobi Street, 51014 Tartu (Estonia); Anderson, E.; Kallip, S. [Institute of Chemistry, University of Tartu, 2 Jakobi Street, 51014 Tartu (Estonia); Maendar, H.; Matisen, L. [Institute of Physics, University of Tartu, 142 Riia Street, 51014 Tartu (Estonia); Lust, E. [Institute of Chemistry, University of Tartu, 2 Jakobi Street, 51014 Tartu (Estonia)


    Thin Bi layers were deposited by simple immersion of silicon chip into diluted HF aqueous solution, containing bismuth(III) ions. Bi nanoparticles or continuous up to 300 nm thick Bi film can be grown on silicon by the variation of the temperature and deposition time. Prepared surfaces have been characterized by atomic force microscopy, X-ray diffraction, X-ray photoelectron spectroscopy, Raman scattering, photoluminescence and resistivity measurement methods. It was found that thinner Bi layers have a yellowish colour.

  14. Quantum Interference of Surface States in Bismuth Nanowires in Transverse Magnetic Fields (United States)

    Konopko, L. A.; Huber, T. E.; Nikolaeva, A. A.; Burceacov, L. A.


    We report the results of studies of the magnetoresistance (MR) and electric field effect (EFE) of single-crystal Bi nanowires with diameter dMurakami, bismuth bilayers can exhibit the quantum spin Hall effect. A Bi crystal can be viewed as a stacking of bilayers with a honeycomblike lattice structure along the [111] direction. An interpretation of transverse MR oscillations with using this theory is presented.

  15. Equilibrium distribution of samarium and europium between fluoride salt melts and liquid bismuth (United States)

    Zagnit'ko, A. V.; Ignat'ev, V. V.


    The extraction of samarium and europium from a melt of a molar composition 73LiF-27BeF2 into liquid bismuth with additions of lithium as a reducing agent at a temperature of 600-610°C was studied. The equilibrium distribution coefficients of samarium and europium were measured. In the metal fluoride salt melt under study, the valence of samarium and europium was shown to be equal to two.

  16. Analysis of the color alteration and radiopacity promoted by bismuth oxide in calcium silicate cement

    Directory of Open Access Journals (Sweden)

    Marina Angelica Marciano


    Full Text Available The aim of the study was to determine if the increase in radiopacity provided by bismuth oxide is related to the color alteration of calcium silicate-based cement. Calcium silicate cement (CSC was mixed with 0%, 15%, 20%, 30% and 50% of bismuth oxide (BO, determined by weight. Mineral trioxide aggregate (MTA was the control group. The radiopacity test was performed according to ISO 6876/2001. The color was evaluated using the CIE system. The assessments were performed after 24 hours, 7 and 30 days of setting time, using a spectrophotometer to obtain the ΔE, Δa, Δb and ΔL values. The statistical analyses were performed using the Kruskal-Wallis/Dunn and ANOVA/Tukey tests (p 3 mm equivalent of Al. The MTA group was statistically similar to the CSC / 30% BO group (p > 0.05. In regard to color, the increase of bismuth oxide resulted in a decrease in the ΔE value of the calcium silicate cement. The CSC group presented statistically higher ΔE values than the CSC / 50% BO group (p < 0.05. The comparison between 24 hours and 7 days showed higher ΔE for the MTA group, with statistical differences for the CSC / 15% BO and CSC / 50% BO groups (p < 0.05. After 30 days, CSC showed statistically higher ΔE values than CSC / 30% BO and CSC / 50% BO (p < 0.05. In conclusion, the increase in radiopacity provided by bismuth oxide has no relation to the color alteration of calcium silicate-based cements.

  17. Report - Melter Testing of New High Bismuth HLW Formulations VSL-13R2770-1

    Energy Technology Data Exchange (ETDEWEB)

    Kruger, Albert A.; Pegg, I. L.; Kot, W. K.; Gan, H.; Matlack, K. S.


    The primary objective of the work described was to test two glasses formulated for a high bismuth waste stream on the DM100 melter system. Testing was designed to determine processing characteristics and production rates, assess the tendency for foaming, and confirm glass properties. The glass compositions tested were previously developed to maintain high waste loadings and processing rates while suppressing the foaming observed in previous tests

  18. The expression and function of microRNA-203 in lung cancer. (United States)

    Jin, Jianhua; Deng, Jianzhong; Wang, Fang; Xia, Xiyi; Qiu, Tiefeng; Lu, Wenbin; Li, Xianwen; Zhang, Hua; Gu, Xiaoyan; Liu, Yungang; Cao, Weiguo; Shao, Wenlong


    We aimed to determine the expression of microRNA-203 (miR-203) in human lung cancer cell lines and to evaluate the effects of miR-203 by targeting survivin, on the lung cancer cell line 95-D to provide potential new strategies for treating lung cancer. The expression of miR-203 was detected using quantitative real-time PCR (qRT-PCR) in the in vitro cultured lung cancer cells A549, HCC827, NCI-H1299, and 95-D as well as in normal human bronchial epithelial cells. Following a 72-h transfection with the miR-203 precursor in 95-D lung cancer cells, the change in miR-203 expression was detected using qRT-PCR and the resulting effect on survivin protein expression was ascertained by Western blot analysis. The influence of miR-203 on the viability of 95-D lung cancer cells was evaluated using 3-(4,5-dimethylthiazol-2-yl)-2, 5-diphenyltetrazolium bromide (MTT) assay. The effect of miR-203 on 95-D cell proliferation was analyzed using flow cytometry. The consequences of miR-203 expression on 95-D cell apoptosis were analyzed by Annexin V/propidium iodide double staining coupled with flow cytometry. The role of miR-203 in the invasive potential of 95-D cells was studied using a transwell chamber assay. A luciferase reporter gene system was used to verify that survivin is a target gene for miR-203. By qRT-PCR, the expression of miR-203 was lower in lung cancer cells than in normal bronchial epithelial cells (p transfection with the miR-203 precursor (p transfection with the miR-203 precursor, survivin protein levels in 95-D cells were significantly decreased (p transfection with the miR-203 precursor (p < 0.05). The expression of miR-203 is downregulated in lung cancer cells. miR-203 negatively regulates survivin protein expression and inhibits the proliferation and invasion of lung cancer cells. Therapeutic strategies that enhance miR-203 expression or silence survivin could potentially benefit lung cancer patients. PMID:23073851

  19. Opto-electronic properties of bismuth oxide films presenting different crystallographic phases

    Energy Technology Data Exchange (ETDEWEB)

    Gomez, Celia L. [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico); Posgrado en Ciencia e Ingeniería de Materiales, UNAM, Unidad de Posgrado, Edificio C, Piso 1, Zona Cultural de CU, México, D.F. 04510 (Mexico); Depablos-Rivera, Osmary, E-mail: [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico); Posgrado en Ciencia e Ingeniería de Materiales, UNAM, Unidad de Posgrado, Edificio C, Piso 1, Zona Cultural de CU, México, D.F. 04510 (Mexico); Silva-Bermudez, Phaedra [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico); Instituto Nacional de Rehabilitación, Calz. México Xochimilco No. 289 Col. Arenal de Guadalupe, C.P.14389, Ciudad de México, D.F. (Mexico); Muhl, Stephen [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico); Zeinert, Andreas; Lejeune, Michael; Charvet, Stephane; Barroy, Pierre [Laboratoire de Physique de la Matière Condensée, Université de Picardie Jules Verne, 33 rue Saint Leu, 80039 Amiens Cedex 1 (France); Camps, Enrique [Instituto Nacional de Investigaciones Nucleares, Carretera México-Toluca S/N, kilómetro 36.5. La Marquesa, Municipio de Ocoyoacac, CP 52750, Estado de México (Mexico); Rodil, Sandra E. [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico)


    The optical, electrical and structural properties of bismuth oxide thin films deposited by radio frequency reactive magnetron sputtering were studied. The Bi{sub 2}O{sub 3} thin films were grown on Si and glass substrates under different power and substrate temperatures in an oxygen-enriched plasma leading to films with different crystalline phase as evidenced by X-ray diffraction and Raman spectroscopy. The optical properties of the films were measured using ellipsometric spectroscopy and optical transmission spectra. In order to parameterize the optical dispersion functions (n, k) of the films, the Tauc–Lorentz dispersion model was used. The optical bandgap was then assessed by different methods and the results are compared to the thermal variations of the electrical resistivity of the films. It was found that the refractive index, extinction coefficient and optical gap strongly depend on the deposition conditions and the crystalline phase; the fluorite defect cubic δ-Bi{sub 2}O{sub 3} phase showed the lowest optical gap and lower resistivity. - Highlights: • Different bismuth oxide phases were obtained by sputtering. • The power and substrate temperature were the two key parameters. • Room temperature delta-Bi{sub 2}O{sub 3} thin films were obtained. • The optical bandgap was around 1.5 and 2.2 eV, depending on the phase. • The bismuth oxide films presented activation energies around 1 eV.

  20. Fabrication and modeling of bismuth titanate-PZT ceramic transducers for high temperature applications (United States)

    Reinhardt, B.; Searfass, C.; Cyphers, R.; Sinding, K.; Pheil, C.; Tittmann, B.


    Utilization of a spray-on deposition technique of ferroelectric bismuth titanate (Bi4Ti3O12) composites has a competitive advantage to standard ultrasonic transducers. These can conform to curved surfaces, can operate at high temperature (Curie-Weiss temperature 685 °C) and are mechanically well-coupled to a substrate. However, an issue with many high temperature transducers such as bismuth titanate ceramics is that they have relatively low transduction efficiency, i.e. d33 is about 12-14 pC/F in Bi4Ti3O12 versus 650 pC/F in PZT-5H. It is a common conception that high-temperature capability comes at the cost of electro-mechanical coupling. It will be shown that the high temperature capability of bismuth-titanate-PZT composite transducers using the spray-on deposition technique previously developed, improves the electro-mechanical coupling while maintaining the high temperature performance and mechanical coupling. This material could provide advantages in harsh environments where high signal-to-noise ratios are needed.

  1. Dirac fermions at high-index surfaces of bismuth chalcogenide topological insulator nanostructures (United States)

    Virk, Naunidh; Yazyev, Oleg V.


    Binary bismuth chalcogenides Bi2Se3, Bi2Te3, and related materials are currently being extensively investigated as the reference topological insulators (TIs) due to their simple surface-state band dispersion (single Dirac cone) and relatively large bulk band gaps. Nanostructures of TIs are of particular interest as an increased surface-to-volume ratio enhances the contribution of surfaces states, meaning they are promising candidates for potential device applications. So far, the vast majority of research efforts have focused on the low-energy (0001) surfaces, which correspond to natural cleavage planes in these layered materials. However, the surfaces of low-dimensional nanostructures (nanoplatelets, nanowires, nanoribbons) inevitably involve higher-index facets. We perform a systematic ab initio investigation of the surfaces of bismuth chalcogenide TI nanostructures characterized by different crystallographic orientations, atomic structures and stoichiometric compositions. We find several stable terminations of high-index surfaces, which can be realized at different values of the chemical potential of one of the constituent elements. For the uniquely defined stoichiometric termination, the topological Dirac fermion states are shown to be strongly anisotropic with a clear dependence of Fermi velocities and spin polarization on the surface orientation. Self-doping effects and the presence of topologically trivial mid-gap states are found to characterize the non-stoichiometric surfaces. The results of our study pave the way towards experimental control of topologically protected surface states in bismuth chalcogenide nanostructures.

  2. Facile production of thermoelectric bismuth telluride thick films in the presence of polyvinyl alcohol. (United States)

    Lei, C; Burton, M R; Nandhakumar, I S


    Bismuth telluride is currently the best performing thermoelectric material for room temperature operations in commercial thermoelectric devices. We report the reproducible and facile production of 600 micron thick bismuth telluride (Bi2Te3) layers by low cost and room temperature pulsed and potentiostatic electrodeposition from a solution containing bismuth and tellurium dioxide in 2 M nitric acid onto nickel in the presence of polyvinyl alcohol (PVA). This was added to the electrolyte to promote thick layer formation and its effect on the structure, morphology and composition of the electrodeposits was investigated by SEM and EDX. Well adherent, uniform, compact and stoichiometric n-type Bi2Te3 films with a high Seebeck coefficient of up to -200 μV K(-1) and a high electrical conductivity of up to 400 S cm(-1) resulting in a power factor of 1.6 × 10(-3) W m(-1) K(-2) at film growth rates of 100 μm h(-1) for potentiostatic electrodeposition were obtained. The films also exhibited a well defined hexagonal structure as determined by XRD.

  3. Bismuth Modified Porous Silica Preparation, Characterization and Photocatalytic Activity Evaluation for Degradation of Isoproturon

    Institute of Scientific and Technical Information of China (English)

    Anil Kumar Reddy Police; Srinivas Basavaraju; Durga Kumari Valluri; Subrahmanyam Machiraju


    Porous silica prepared by using an acrylic emulsion has been impregnated with bismuth ion resulting in Bi2Sio5 species containing surface.The as-prepared materials have been characterized by X-ray diffraction spectroscopy (XRD),X-ray photoelectron spectroscopy (XPS),UV-Vis diffuse reflectance spectroscopy (UV-Vis DRS),scanning electron microscopy (SEM),energy dispersive analysis of X-ray (EDAX),transmission electron microscopy (TEM),Fourier transform infrared spectroscopy (FTIR) and N2 adsorption/desorption techniques.EDAX analysis confirms the penetration of bismuth ions into the framework of silica to form Bi2Sio5,which is substantiated by XRD.The UV-Vis DRS shows that the catalysts are optically active and XPS confirms the inclusion of bismuth into the framework of silica.FTIR spectra illustrate the formation of Bi-O-Si linkages in the porous silica framework.SEM and TEM show the spherical morphology,whereas N2 adsorption/desorption study confirms the porosity of the prepared materials.The photocatalytic activity of the material is evaluated for the degradation of isoproturon herbicide and it is found that the material is active as compared to the commercial P-25 Degussa Tio2.

  4. Performance comparison of metallic, actinide burning fuel in lead-bismuth and sodium cooled fast reactors

    Energy Technology Data Exchange (ETDEWEB)

    Weaver, K.D.; Herring, J.S.; Macdonald, P.E. [Idaho National Engineering and Environment Lab., Advanced Nuclear Energy, Idaho (United States)


    Various methods have been proposed to ''incinerate'' or ''transmute'' the current inventory of transuranic waste (TRU) that exits in spent light-water-reactor (LWR) fuel, and weapons plutonium. These methods include both critical (e.g., fast reactors) and non-critical (e.g., accelerator transmutation) systems. The work discussed here is part of a larger effort at the Idaho National Engineering and Environmental Laboratory (INEEL) and at the Massachusetts Institute of Technology (MIT) to investigate the suitability of lead and lead-alloy cooled fast reactors for producing low-cost electricity as well as for actinide burning. The neutronics of non fertile fuel loaded with 20 or 30-wt% light water reactor (LWR) plutonium plus minor actinides for use in a lead-bismuth cooled fast reactor are discussed in this paper, with an emphasis on the fuel cycle life and isotopic content. Calculations show that the average actinide burn rate is similar for both the sodium and lead-bismuth cooled cases ranging from -1.02 to -1.16 g/MWd, compared to a typical LWR actinide generation rate of 0.303 g/MWd. However, when using the same parameters, the sodium-cooled case went subcritical after 0.2 to 0.8 effective full power years, and the lead-bismuth cooled case ranged from 1.5 to 4.5 effective full power years. (author)

  5. Performance Comparison of Metallic, Actinide Burning Fuel in Lead-Bismuth and Sodium Cooled Fast Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Weaver, Kevan Dean; Herring, James Stephen; Mac Donald, Philip Elsworth


    Various methods have been proposed to “incinerate” or “transmutate” the current inventory of trans-uranic waste (TRU) that exits in spent light-water-reactor (LWR) fuel, and weapons plutonium. These methods include both critical (e.g., fast reactors) and non-critical (e.g., accelerator transmutation) systems. The work discussed here is part of a larger effort at the Idaho National Engineering and Environmental Laboratory (INEEL) and at the Massachusetts Institute of Technology (MIT) to investigate the suitability of lead and lead-alloy cooled fast reactors for producing low-cost electricity as well as for actinide burning. The neutronics of non-fertile fuel loaded with 20 or 30-wt% light water reactor (LWR) plutonium plus minor actinides for use in a lead-bismuth cooled fast reactor are discussed in this paper, with an emphasis on the fuel cycle life and isotopic content. Calculations show that the average actinide burn rate is similar for both the sodium and lead-bismuth cooled cases ranging from -1.02 to -1.16 g/MWd, compared to a typical LWR actinide generation rate of 0.303 g/MWd. However, when using the same parameters, the sodium-cooled case went subcritical after 0.2 to 0.8 effective full power years, and the lead-bismuth cooled case ranged from 1.5 to 4.5 effective full power years.

  6. Efficient gas sensitivity in mixed bismuth ferrite micro (cubes) and nano (plates) structures

    Energy Technology Data Exchange (ETDEWEB)

    Waghmare, Shivaji D.; Jadhav, Vijaykumar V.; Gore, Shaym K. [Center for Nanomaterials and Energy Devices, School of Physical Sciences, Swami Ramanand Teerth Marathwada University, Nanded 431606, Maharashtra (India); Yoon, Seog-Joon; Ambade, Swapnil B. [Inorganic Nanomaterials Laboratory, Department of Chemistry, Hanyang University, Seoul 133-1791 (Korea, Republic of); Lokhande, B.J. [Department of Physics, Solapur University, Solapur (India); Mane, Rajaram S., E-mail: [Center for Nanomaterials and Energy Devices, School of Physical Sciences, Swami Ramanand Teerth Marathwada University, Nanded 431606, Maharashtra (India); Han, Sung-Hwan, E-mail: [Inorganic Nanomaterials Laboratory, Department of Chemistry, Hanyang University, Seoul 133-1791 (Korea, Republic of)


    Graphical abstract: Display Omitted Highlights: ► Micro (cubes) structure embedded in nano (plates) of bismuth ferrite was prepared by a chemical method. ► These structures were characterized by XRD and SEM. ► LPG, CO{sub 2} and NH{sub 4} gases were exposed. ► Properties related to gas sensors were measured and reported. -- Abstract: Mixed micro (cubes) and nano (plates) structures of bismuth ferrite (BFO) have been synthesized by a simple and cost-effective wet-chemical method. Structural, morphological and phase confirmation characteristics are measured using X-ray diffraction, field-emission scanning electron microscopy (FE-SEM) and energy dispersive X-ray analysis techniques. The digital FE-SEM photo-images of BFO sample confirmed an incubation of discrete micro-cubes into thin and regularly placed large number of nano-plates. The bismuth ferrite, with mixed structures, films show considerable performance when used in liquefied petroleum (LPG), carbon dioxide (CO{sub 2}) and ammonium (NH{sub 3}) gas sensors application. Different chemical entities in LPG have made it more efficient with higher sensitivity, recovery and response times compared to CO{sub 2} and NH{sub 3} gases. Furthermore, effect of palladium surface treatment on the gas sensitivity and the charge transfer resistances of BFO mixed structures is investigated and reported.

  7. Growth of GaAsBi alloy under alternated bismuth flows by metalorganic vapor phase epitaxy (United States)

    Chine, Z.; Fitouri, H.; Zaied, I.; Rebey, A.; El Jani, B.


    A successful method to epitaxy GaAsBi layer on (0 0 1) GaAs substrate is proposed. During growth, alternated trimethyl bismuth (TMBi) flows were used. These TMBi flashes were switched on for a short time. The growth was monitored in situ by laser reflectometry using a 632.8 nm beam. The reflectance signal is found to change significantly during both bismuth flashes and GaAs growth stages. High-resolution X-ray diffraction (HRXRD), secondary ion mass spectroscopy (SIMS) and photoreflectance spectroscopy (PR) have been used to characterize the obtained GaAsBi layer. HRXRD curve shows a diffraction peak that can be attributed to a GaAsBi epilayer. SIMS measurements of GaAsBi layer suggest that bismuth diffuses faster near the interface. The PR spectrum indicates the band-to-band transition in GaAsBi layer. The band gap energy was determined by adjusting the PR spectrum with a multilayer model.

  8. Efficient gas sensitivity in mixed bismuth ferrite micro (cubes) and nano (plates) structures

    International Nuclear Information System (INIS)

    Graphical abstract: Display Omitted Highlights: ► Micro (cubes) structure embedded in nano (plates) of bismuth ferrite was prepared by a chemical method. ► These structures were characterized by XRD and SEM. ► LPG, CO2 and NH4 gases were exposed. ► Properties related to gas sensors were measured and reported. -- Abstract: Mixed micro (cubes) and nano (plates) structures of bismuth ferrite (BFO) have been synthesized by a simple and cost-effective wet-chemical method. Structural, morphological and phase confirmation characteristics are measured using X-ray diffraction, field-emission scanning electron microscopy (FE-SEM) and energy dispersive X-ray analysis techniques. The digital FE-SEM photo-images of BFO sample confirmed an incubation of discrete micro-cubes into thin and regularly placed large number of nano-plates. The bismuth ferrite, with mixed structures, films show considerable performance when used in liquefied petroleum (LPG), carbon dioxide (CO2) and ammonium (NH3) gas sensors application. Different chemical entities in LPG have made it more efficient with higher sensitivity, recovery and response times compared to CO2 and NH3 gases. Furthermore, effect of palladium surface treatment on the gas sensitivity and the charge transfer resistances of BFO mixed structures is investigated and reported.

  9. Effect of ferromagnetic dopants on laser induced optical parameters of bismuth doped CaS phosphors (United States)

    Kumar, Sunil; Jeon, H. C.; Kang, T. W.; Devraj; Sekhon, Jaskanwal; Verma, N. K.; Bhatti, H. S.; Choubey, Ravi Kant


    The effect of ferromagnetic impurities (Fe, Co, and Ni) on the laser induced optical parameters of CaS:Bi phosphors has been studied. The studies were done for the Bismuth concentration of 0.4% in CaS phosphors due to the highest value of oscillator strength as reported earlier. The studies were conducted using nitrogen laser as a excitation source in a pulse excitation mode at room temperature. Appreciable changes in the optical properties have been detected after the addition of ferromagnetic impurities in the CaS phosphor doped with bismuth. The nature of the multiple exponential decays remains the same even after the addition of ferromagnetic impurities in the present case of bismuth-doped phosphors which is in agreement with the earlier work reported on other dopants in sulfide type phosphors. As ferromagnetic impurities enhanced the optical parameters of CaS phosphors appreciably, these studies shows that they can be used to control the transition probability and the corresponding optical parameters.

  10. Iron modified structural and optical spectral properties of bismuth silicate glasses

    International Nuclear Information System (INIS)

    Iron bismuth silicate glasses have been successfully synthesized by melt quenching technique. The amorphous nature of the glass samples is ascertained by the XRD patterns. The values of density, molar volume and crystalline volume have been measured and are found to decrease with increase in iron content. The glass transition temperature measured using Differential Scanning Calorimetry (DSC) also varies with increase in Fe2O3 content. The Raman and FTIR spectra of the studied glass system taken at room temperature suggests that Fe2O3 modifies the structure of bismuth silicate glasses and it acts as both network modifier as well as network former. Bismuth also plays the role of both network modifier (BiO6 octahedra) as well as network former (BiO3 pyramids) and SiO2 exists in SiO4 tetrahedral structural units with two non-bridging oxygens. The Hydrogenic excitonic model is found to be applicable to the studied glass compositions. The variation in Urbach energy value observed for the studied glass samples suggests the possibility of increase in the number of glass defects. The metallization criterion for the synthesized glass samples is determined and found to be in the range 0.30–0.38

  11. Topological nature and the multiple Dirac cones hidden in Bismuth high-Tc superconductors. (United States)

    Li, Gang; Yan, Binghai; Thomale, Ronny; Hanke, Werner


    Recent theoretical studies employing density-functional theory have predicted BaBiO3 (when doped with electrons) and YBiO3 to become a topological insulator (TI) with a large topological gap (~0.7 eV). This, together with the natural stability against surface oxidation, makes the Bismuth-Oxide family of special interest for possible applications in quantum information and spintronics. The central question, we study here, is whether the hole-doped Bismuth Oxides, i.e. Ba(1-x)K(x)BiO3 and BaPb(1-x)Bi(x)O3, which are "high-Tc" bulk superconducting near 30 K, additionally display in the further vicinity of their Fermi energy EF a topological gap with a Dirac-type of topological surface state. Our electronic structure calculations predict the K-doped family to emerge as a TI, with a topological gap above EF. Thus, these compounds can become superconductors with hole-doping and potential TIs with additional electron doping. Furthermore, we predict the Bismuth-Oxide family to contain an additional Dirac cone below EF for further hole doping, which manifests these systems to be candidates for both electron- and hole-doped topological insulators. PMID:26014056

  12. Underpotential Deposition Study and Determination of Bismuth on Gold Electrode by Using Voltammetry

    Institute of Scientific and Technical Information of China (English)

    DU,Yong-Ling(杜永令); WANG,Chun-Ming(王春明)


    The cyclic voltammetry (CV) and the semidifferential anodic stripping voltanmetry (SdASV) were used for investigation of bismuth(Ⅲ) underpotential deposition (UPD) on gold electrode. Based on the excellent electrochemical properties of Au/Bi UPD system, a new method for determining bismuth (Ⅲ)was established. A solution of 0.1 mol/L HNO3 was selected as the supporting electrolyte. Factors affecting the Bi(Ⅲ) UPD and stripping steps were investigated and an opthmized analytical procedure was developed. The calibration plots for Bi(Ⅲ) concentration in the range 1.25 × 10-8-1.0 × 10-7 mol/L were obtained. The detection limit, calculated as three times the standard deviation of the analytical signal of 8.3×10-8 mol/L for a 90 s electrodeposition at 0.00 V (while the solution magnetically stirred at a speed of 300 rpm), was 7.5× 10-9 mol/ L. For8 successive determinations of 1.25 × 10-7 mol/L Bi(Ⅲ), the obtained RSD (relative standard deviation) was 0.4%. The developed method was applied to bismuth determining in medicine and urine samples. The analytical results were compared with that of atomic emission spectrometry (AES) method.

  13. Bismuth labeling for the CT assessment of local administration of magnetic nanoparticles (United States)

    Veintemillas-Verdaguer, S.; Luengo, Y.; Serna, C. J.; Andrés-Vergés, M.; Varela, M.; Calero, Macarena; Lazaro-Carrillo, Ana; Villanueva, Angeles; Sisniega, A.; Montesinos, P.; Morales, M. P.


    Many therapeutic applications of magnetic nanoparticles involve the local administration of nanometric iron oxide based materials as seeds for magnetothermia or drug carriers. A simple and widespread way of controlling the process using x-ray computed tomography (CT) scanners is desirable. The combination of iron and bismuth in one entity will increase the atenuation of x-rays, offering such a possibility. In order to check this possibility core-shell nanocrystals of iron oxide@bismuth oxide have been synthesized by an aqueous route and stabilized in water by polyethylene glycol (PEG), and we have evaluated their ability to generate contrast by CT and magnetic resonance imaging (MRI) to measure the radiopacity and proton relaxivities using phantoms. High-resolution scanning transmission electron microscopy (STEM) revealed that the material consists of a highly crystalline 8 nm core of maghemite and a 1 nm shell of bismuth atoms either isolated or clustered on the nanocrystal’s surface. The comparison of μCT and MRI images of mice acquired in the presence of the contrast shows that when local accumulations of the magnetic nanoparticles take place, CT images are more superior in the localization of the magnetic nanoparticles than MRI images, which results in magnetic field inhomogeneity artifacts.

  14. The Growth of Bismuth Sulfide Nanorods from Spherical-Shaped Amorphous Precursor Particles under Hydrothermal Condition

    Directory of Open Access Journals (Sweden)

    Pravas Kumar Panigrahi


    Full Text Available A surfactant/solid-template-free hydrothermal process has been developed for the synthesis of single-crystalline nanorods of bismuth sulfide (Bi2S3 using triethanolamine as a complexing agent for the Bi3+ ions and elemental sulfur, solubilized in monoethanolamine, as the sulfur source. X-ray diffraction and morphological studies of a series of samples synthesized at different reaction conditions suggest that the growth of nanorods occurred at the expense of the low-crystalline spherical precursor particles of aminium compounds of bismuth sulfide or bismuth sulfate formed at room temperature. In the process, the reaction condition is optimized for obtaining crystalline nanorods of pure Bi2S3 with high aspect ratio. From the XRD, XPS, and HRTEM analysis of the samples, the growth of nanorods was assessed to be due to the cooperative effects of solid-solution-solid transformation and controlled oriented attachment. The hydrothermal process parameters and the presence of water in the reaction system have been found to play a crucial role in the formation of high aspect ratio nanorods. The optical band gap of the synthesized sample at optimized conditions is found to be 1.46 eV as calculated from its diffused reflectance spectrum at room temperature.

  15. Research work for utilizing technology of the lead-bismuth eutectic. 2nd report: Research on corrosion resistance of ODS-Al steels in high temperature lead-bismuth eutectic under oxygen concentration control (Joint research)

    International Nuclear Information System (INIS)

    In 2002, the Japan Atomic Energy Agency (past organization name: Japan Nuclear Cycle Development Institute) was made a contract with the Central Research Institute of Electric Power Industry on the research work for utilizing technology of the lead bismuth eutectic. In the contract, research on corrosion of FBR materials in high temperature lead bismuth eutectic was performed. This work was composed of two stages. In the first stage, corrosion test of high chromium martensitic steel, which was one candidate material for structures of advanced fast reactor, was performed in oxygen controlled lead bismuth eutectic at 650degC. Effect of chromium on corrosion in the lead bismuth eutectic was estimated. In this second research, corrosion test of oxide dispersion strengthened ferritic steels whose chemical compositions of chromium and aluminum were differed has been performed in the lead bismuth eutectic for up to 4,000 hours. As the results, although chromium effect on corrosion has not been observed, good corrosion resistance by aluminum oxide formation on the surface has been obtained. (author)

  16. MiR-203 controls proliferation, migration and invasive potential of prostate cancer cell lines

    DEFF Research Database (Denmark)

    Viticchiè, Giuditta; Lena, Anna Maria; Latina, Alessia;


    transition and invasion of healthy tissues (usually bones). MicroRNA-203 (miR-203) is a tumor suppressor microRNA often silenced in different malignancies. Here, we show that miR-203 is downregulated in clinical primary prostatic tumors compared to normal prostate tissue, and in metastatic prostate cancer...... cell lines compared to normal epithelial prostatic cells. Overexpression of miR-203 in brain or bone metastatic prostate cell lines (DU145 and PC3) is sufficient to induce a mesenchymal to epithelial transition with inhibition of cell proliferation, migration and invasiveness. We have identified CKAP2......, LASP1, BIRC5, WASF1, ASAP1 and RUNX2 as new miR-203 direct target mRNAs involved in these events. Therefore, miR-203 could be a potentially new prognostic marker and therapeutic target in metastatic prostate cancer....

  17. 21 CFR 74.203 - FD&C Green No. 3. (United States)


    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false FD&C Green No. 3. 74.203 Section 74.203 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL LISTING OF COLOR ADDITIVES SUBJECT TO CERTIFICATION Foods § 74.203 FD&C Green No. 3. (a) Identity. (1) The color additive FD&C Green No. 3 is principally the...

  18. Some health physics aspects of working with 203Hg in university research. (United States)

    Belanger, M; Westin, A; Barfuss, D W


    The radioisotope 203Hg is used in university toxicology research experiments. When our commercial vendor ceased the production of the high specific activity 203Hg we required, an alternative source was sought. Other commercial sources were investigated without success leaving the synthesis of this radioisotope to us. This paper outlines the method we used to synthesize 203Hg and provides a summary of our results to date and a discussion of our experiences.

  19. Tank 241-B-203 Push Mode Core Sampling and Analysis Plan

    Energy Technology Data Exchange (ETDEWEB)

    Jo, J. [Westinghouse Hanford Co., Richland, WA (United States)


    This Sampling and Analysis Plan (SAP) will identify characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements in accordance with the Tank Safety Screening Data Quality Objective (Babad and Redus 1994). This Data Quality Objective (DQO) is described in the Tank Characterization Plan (Jo, 1995) for tank 241-B-203 (B-203). This SAP will also identify procedures and requirements for collecting and characterizing samples from tank B-203 by the core sampling method.

  20. Li3PO4 Matrix Enables a Long Cycle Life and High Energy Efficiency Bismuth-Based Battery. (United States)

    Sun, Chuan-Fu; Hu, Junkai; Wang, Peng; Cheng, Xi-Yuan; Lee, Sang Bok; Wang, YuHuang


    Bismuth is a lithium-ion battery anode material that can operate at an equilibrium potential higher than graphite and provide a capacity twice as high as that of Li4Ti5O12, making it intrinsically free from lithium plating that may cause catastrophic battery failure. However, the potential of bismuth is hampered by its inferior cyclability (limited to tens of cycles). Here, we propose an "ion conductive solid-state matrix" approach to address this issue. By homogeneously confining bismuth nanoparticles in a solid-state γ-Li3PO4 matrix that is electrochemically formed in situ, the resulting composite anode exhibits a reversible capacity of 280 mA hours per gram (mA h/g) at a rate of 100 mA/g and a record cyclability among bismuth-based anodes up to 500 cycles with a capacity decay rate of merely 0.071% per cycle. We further show that full-cell batteries fabricated from this composite anode and commercial LiFePO4 cathode deliver a stable cell voltage of ∼2.5 V and remarkable energy efficiency up to 86.3%, on par with practical batteries (80-90%). This work paves a way for harnessing bismuth-based battery chemistry for the design of high capacity, safer lithium-ion batteries to meet demanding applications such as electric vehicles.

  1. Photovoltaic enhancement based on improvement of ferroelectric property and band gap in Ti-doped bismuth ferrite thin films

    International Nuclear Information System (INIS)

    Highlights: • The leakage current is effectively reduced by adding a certain amount of titanium. • Addition of titanium increases the remnant polarization and decreases the band gap. • The power conversion efficiency increases as titanium content increases. - Abstract: Ti-doped bismuth ferrite thin films were prepared via sol–gel spin-coating method. The effects of titanium on the microstructure, optical, leakage, ferroelectric and photovoltaic characteristics have been investigated systematically. The result shows that bismuth ferrite thin films doped with 0–8 at.% Ti are rhombohedral distortion perovskite structure. The addition of titanium inhibits the grain growth and enhances the thickness uniformity and can decrease the band gap of bismuth ferrite thin films. The leakage current of bismuth ferrite thin films is effectively reduced by adding a certain amount of titanium and the leakage mechanism has been investigated. Addition of titanium increases the remnant polarization of the films. As titanium content increases, the short circuit photocurrent density decrease first and then increase, while the open circuit photovoltage increase first and then decrease. The power conversion efficiency of Ti-doped bismuth ferrite thin films increases as titanium content increases, which can be explained as a result of the increased remnant polarization and decreased band gap

  2. Li3PO4 Matrix Enables a Long Cycle Life and High Energy Efficiency Bismuth-Based Battery. (United States)

    Sun, Chuan-Fu; Hu, Junkai; Wang, Peng; Cheng, Xi-Yuan; Lee, Sang Bok; Wang, YuHuang


    Bismuth is a lithium-ion battery anode material that can operate at an equilibrium potential higher than graphite and provide a capacity twice as high as that of Li4Ti5O12, making it intrinsically free from lithium plating that may cause catastrophic battery failure. However, the potential of bismuth is hampered by its inferior cyclability (limited to tens of cycles). Here, we propose an "ion conductive solid-state matrix" approach to address this issue. By homogeneously confining bismuth nanoparticles in a solid-state γ-Li3PO4 matrix that is electrochemically formed in situ, the resulting composite anode exhibits a reversible capacity of 280 mA hours per gram (mA h/g) at a rate of 100 mA/g and a record cyclability among bismuth-based anodes up to 500 cycles with a capacity decay rate of merely 0.071% per cycle. We further show that full-cell batteries fabricated from this composite anode and commercial LiFePO4 cathode deliver a stable cell voltage of ∼2.5 V and remarkable energy efficiency up to 86.3%, on par with practical batteries (80-90%). This work paves a way for harnessing bismuth-based battery chemistry for the design of high capacity, safer lithium-ion batteries to meet demanding applications such as electric vehicles. PMID:27518908

  3. Dual-modality, fluorescent, PLGA encapsulated bismuth nanoparticles for molecular and cellular fluorescence imaging and computed tomography (United States)

    Swy, Eric R.; Schwartz-Duval, Aaron S.; Shuboni, Dorela D.; Latourette, Matthew T.; Mallet, Christiane L.; Parys, Maciej; Cormode, David P.; Shapiro, Erik M.


    Reports of molecular and cellular imaging using computed tomography (CT) are rapidly increasing. Many of these reports use gold nanoparticles. Bismuth has similar CT contrast properties to gold while being approximately 1000-fold less expensive. Herein we report the design, fabrication, characterization, and CT and fluorescence imaging properties of a novel, dual modality, fluorescent, polymer encapsulated bismuth nanoparticle construct for computed tomography and fluorescence imaging. We also report on cellular internalization and preliminary in vitro and in vivo toxicity effects of these constructs. 40 nm bismuth(0) nanocrystals were synthesized and encapsulated within 120 nm Poly(dl-lactic-co-glycolic acid) (PLGA) nanoparticles by oil-in-water emulsion methodologies. Coumarin-6 was co-encapsulated to impart fluorescence. High encapsulation efficiency was achieved ~70% bismuth w/w. Particles were shown to internalize within cells following incubation in culture. Bismuth nanocrystals and PLGA encapsulated bismuth nanoparticles exhibited >90% and >70% degradation, respectively, within 24 hours in acidic, lysosomal environment mimicking media and both remained nearly 100% stable in cytosolic/extracellular fluid mimicking media. μCT and clinical CT imaging was performed at multiple X-ray tube voltages to measure concentration dependent attenuation rates as well as to establish the ability to detect the nanoparticles in an ex vivo biological sample. Dual fluorescence and CT imaging is demonstrated as well. In vivo toxicity studies in rats revealed neither clinically apparent side effects nor major alterations in serum chemistry and hematology parameters. Calculations on minimal detection requirements for in vivo targeted imaging using these nanoparticles are presented. Indeed, our results indicate that these nanoparticles may serve as a platform for sensitive and specific targeted molecular CT and fluorescence imaging.Reports of molecular and cellular imaging using

  4. Structural studies of bismuth nanocrystals embedded in SiO2 or GeO2 matrices

    International Nuclear Information System (INIS)

    The layer of bismuth nanoclusters embedded in glass matrices and the surface layer of bismuth grains have been obtained by thermal treatment in hydrogen atmosphere of Bi0.33Ge0.67O1.84 and Bi0.57Si0.43O1.72 glass. The thickness and structure of such layers strongly depend on temperature and time of reduction. The structural studies of bismuth nanocrystals embedded in SiO2 or GeO2 matrices were performed with optical microscopy and atomic force microscopy. By the use of a slow-positron beam we monitored the structural changes undergoing in near-to-surface layers after the first steps of isothermal annealing. A simple two-layer model of reduced glasses explains the evolution of the surface layer and electrical properties of the material during the reduction process

  5. NIR photoluminescence of bismuth-doped CsCdBr{sub 3} – The first ternary bromide phase with a univalent bismuth impurity center

    Energy Technology Data Exchange (ETDEWEB)

    Romanov, Alexey N., E-mail: [N.N. Semenov Institute of Chemical Physics, Russian Academy of Sciences, 4 Kosygina Street, 119991 (Russian Federation); Veber, Alexander A. [Universität Erlangen-Nürnberg, Lehrstuhl für Glas und Keramik, Martensstraße 5, 91058 Erlangen (Germany); Vtyurina, Daria N. [N.N. Semenov Institute of Chemical Physics, Russian Academy of Sciences, 4 Kosygina Street, 119991 (Russian Federation); Kouznetsov, Mikhail S.; Zaramenskikh, Ksenia S.; Lisitsky, Igor S. [State Scientific-Research and Design Institute of Rare-Metal Industry “Giredmet” JSC, 5-1 B.Tolmachevsky Lane, 119017 Moscow (Russian Federation); Fattakhova, Zukhra T.; Haula, Elena V. [N.N. Semenov Institute of Chemical Physics, Russian Academy of Sciences, 4 Kosygina Street, 119991 (Russian Federation); Loiko, Pavel A.; Yumashev, Konstantin V. [Center for Optical Materials and Technologies, Belarusian National Technical University, 65/17 Nezavisimosti Avenue, 220013 Minsk (Belarus); Korchak, Vladimir N. [N.N. Semenov Institute of Chemical Physics, Russian Academy of Sciences, 4 Kosygina Street, 119991 (Russian Federation)


    Single crystals of ternary bromide phase CsCdBr{sub 3} doped with univalent bismuth cations are prepared for the first time by the Bridgman method. Bi{sup +} impurity center emits a broadband long-lived near-infrared photoluminescence with a maximum at ~1053 nm. The characteristics of this photoluminescence and its relations with the energy spectrum of Bi{sup +} impurity center are discussed. A comparison of Bi{sup +} photoluminescence in CsCdBr{sub 3} and ternary chlorides (studied previously) is performed. - Highlights: • Single crystals of Bi{sup +}-doped ternary bromide CsCdBr{sub 3} were prepared. • Broadband NIR photoluminescence was observed from Bi{sup +}-doped CsCdBr{sub 3}. • Single optical center is responsible for NIR emission in Bi{sup +}-doped CsCdBr{sub 3}.

  6. Feasibility of preparing patterned molybdenum coatings on bismuth telluride thermoelectric modules.

    Energy Technology Data Exchange (ETDEWEB)

    Sarobol, Pylin; Hall, Aaron Christopher; Miller, Stephen Samuel; Knight, Marlene E.; LePage, William S.; Sobczak, Catherine Elizabeth.; Wesolowski, Daniel Edward


    Molybdenum electrical interconnects for thermoelectric modules were produced by air plasma spraying a 30%CE%BCm size molybdenum powder through a laser-cut Kapton tape mask. Initial feasibility demonstrations showed that the molybdenum coating exhibited excellent feature and spacing retention (~170%CE%BCm), adhered to bismuth-telluride, and exhibited electrical conductivity appropriate for use as a thermoelectric module interconnect. A design of experiments approach was used to optimize air plasma spray process conditions to produce a molybdenum coating with low electrical resistivity. Finally, a molybdenum coating was successfully produced on a fullscale thermoelectric module. After the addition of a final titanium/gold layer deposited on top of the molybdenum coating, the full scale module exhibited an electrical resistivity of 128%CE%A9, approaching the theoretical resistivity value for the 6mm module leg of 112%CE%A9. Importantly, air plasma sprayed molybdenum did not show significant chemical reaction with bismuth-telluride substrate at the coating/substrate interface. The molybdenum coating microstructure consisted of lamellar splats containing columnar grains. Air plasma sprayed molybdenum embedded deeply (several microns) into the bismuth-telluride substrate, leading to good adhesion between the coating and the substrate. Clusters of round pores (and cracks radiating from the pores) were found immediately beneath the molybdenum coating. These pores are believed to result from tellurium vaporization during the spray process where the molten molybdenum droplets (2623%C2%B0C) transferred their heat of solidification to the substrate at the moment of impact. Substrate cooling during the molybdenum deposition process was recommended to mitigate tellurium vaporization in future studies.

  7. Origin of broad NIR photoluminescence in bismuthate glass and Bi-doped glasses at room temperature

    Energy Technology Data Exchange (ETDEWEB)

    Peng, Mingying; Zollfrank, Cordt; Wondraczek, Lothar [Lehrstuhl fuer Glas und Keramik, WW3, Friedrich Alexander Universitaet Erlangen-Nuernberg, Martensstrasse 5, D-91058 Erlangen (Germany)], E-mail:, E-mail:


    Bi-doped glasses with broadband photoluminescence in the near-infrared (NIR) spectral range are presently receiving significant consideration for potential applications in telecommunications, widely tunable fiber lasers and spectral converters. However, the origin of NIR emission remains disputed. Here, we report on NIR absorption and emission properties of bismuthate glass and their dependence on the melting temperature. Results clarify that NIR emission occurs from the same centers as it does in Bi-doped glasses. The dependence of absorption and NIR emission of bismuthate glasses on the melting temperature is interpreted as thermal dissociation of Bi{sub 2}O{sub 3} into elementary Bi. Darkening of bismuthate glass melted at 1300 deg. C is due to the agglomeration of Bi atoms. The presence of Bi nanoparticles is confirmed by transmission electron microscopy, high-resolution energy dispersive x-ray spectroscopy and element distribution mapping. By adding antimony oxide as an oxidation agent to the glass, NIR emission centers can be eliminated and Bi{sup 3+} is formed. By comparing with atomic spectral data, absorption bands at {approx}320 , {approx}500 , 700 , 800 and 1000 nm observed in Bi-doped glasses are assigned to Bi{sup 0} transitions {sup 4}S{sub 3/2}{yields}{sup 2}P{sub 3/2}, {sup 4}S{sub 3/2}{yields}{sup 2}P{sub 1/2}, {sup 4}S{sub 3/2}{yields}{sup 2}D{sub 5/2}, {sup 4}S{sub 3/2}{yields}{sup 2}D{sub 3/2}(2) and {sup 4}S{sub 3/2}{yields}{sup 2}D{sub 3/2}(1), respectively, and broadband NIR emission is assigned to the transition {sup 2}D{sub 3/2}(1){yields}{sup 4}S{sub 3/2}.

  8. Origin of broad NIR photoluminescence in bismuthate glass and Bi-doped glasses at room temperature (United States)

    Peng, Mingying; Zollfrank, Cordt; Wondraczek, Lothar


    Bi-doped glasses with broadband photoluminescence in the near-infrared (NIR) spectral range are presently receiving significant consideration for potential applications in telecommunications, widely tunable fiber lasers and spectral converters. However, the origin of NIR emission remains disputed. Here, we report on NIR absorption and emission properties of bismuthate glass and their dependence on the melting temperature. Results clarify that NIR emission occurs from the same centers as it does in Bi-doped glasses. The dependence of absorption and NIR emission of bismuthate glasses on the melting temperature is interpreted as thermal dissociation of Bi2O3 into elementary Bi. Darkening of bismuthate glass melted at 1300 °C is due to the agglomeration of Bi atoms. The presence of Bi nanoparticles is confirmed by transmission electron microscopy, high-resolution energy dispersive x-ray spectroscopy and element distribution mapping. By adding antimony oxide as an oxidation agent to the glass, NIR emission centers can be eliminated and Bi3+ is formed. By comparing with atomic spectral data, absorption bands at ~320 , ~500 , 700 , 800 and 1000 nm observed in Bi-doped glasses are assigned to Bi0 transitions {}^{4}\\mathrm {S_{3/2}} \\to {}^{2}\\mathrm {P_{3/2}} , {}^{4}\\mathrm {S_{3/2}}\\to {}^{2}\\mathrm {P_{1/2}} , {}^{4}\\mathrm {S_{3/2}}\\to {}^{2}\\mathrm {D_{5/2}} , {}^{4}\\mathrm {S_{3/2}}\\to {}^{2}\\mathrm {D_{3/2}}(2) and {}^{4}\\mathrm {S_{3/2}}\\to {}^{2}\\mathrm {D_{3/2 }}(1) , respectively, and broadband NIR emission is assigned to the transition {}^{2}\\mathrm {D_{3/2}(1)}\\to {}^{4}\\mathrm {S_{3/2}} .

  9. Optical property tuning of bismuth chalcogenides using chemical intercalation (Presentation Recording) (United States)

    Yao, Jie


    Two-dimensional (2D) materials with natural layer structures have been proven to provide extraordinary physical and chemical properties. Bismuth chalcogenides are examples of such two-dimensional materials. They are strongly bonded within layers and weak van der Waals interaction ties those layers together. Such naturally layered structure allows chemical intercalation of foreign atoms into the van der Waals gaps. Here, we show that by adding large number of copper atoms into van der Waals gaps of bismuth chalcogenides, we observed counter-intuitive enhancement of optical transparency together with improved electrical conductivity, which is on the contrary to most bulk materials in which doping reduces the light transmission. This surprising behavior is caused by substantial tuning of material optical property and nanophotonic anti-reflection effect unique to ultra-thin nanoplates. With the intercalation of copper atoms, large number of electrons have been added into the semiconducting material system and effectively lift the Fermi level of the resulting material to its conduction band, as proved by our densityfunctional- theory computations. Occupied lower states in the conduction band do not allow the optical excitation of electrons in the valence band to the bottom of the conduction band, leading to an effective widening of optical band gap. Optical transmission is further enhanced by constructive interference of reflected beams as bismuth chalcogenides have large permittivity than the environment. The synergy of these two effects in two-dimensional nanostructures can be exploited for various optoelectronic applications including transparent electrode. The reversible intercalation process allows potential dynamic tuning capability.

  10. Evaluation of Radiation Dose Reduction during CT Scans Using Oxide Bismuth and Nano-Barium Sulfate Shields


    Seoung, Youl-Hun


    The purpose of the present study was to evaluate radiation dose reduction and image quality during CT scanning by using a new dose reduction fiber sheet (DRFS) with commercially available bismuth shields. These DRFS were composed of nano-barium sulfate (BaSO4), filling the gaps left by the large oxide bismuth (Bi2O3) particle sizes. The radiation dose was measured five times at directionss of 12 o'clock from the center of the polymethyl methacrylate (PMMA) head phantom to calculate an average...

  11. On the evaluation of the pressure losses in a lead-bismuth-eutectics cooled fuel assembly with TRACE and SUSA

    International Nuclear Information System (INIS)

    The prediction of the pressure drop in a pool-type reactor operated with lead-bismuth-eutectics is of crucial importance. A pressure drop of e.g. 1 bar is equivalent to a lead-bismuth-eutectics column of about 1 m, which has a big influence on the financial aspects of the design proposal. The paper presents results on the hydraulic evaluation of a fuel assembly with the emphasis on uncertainties and variations of relevant parameters like the mass flow rate, form, and friction loss coefficients. With the subsequent uncertainty and sensitivity study, in connection with thermal hydraulic investigations, the influence of these uncertain parameters was evaluated. (author)

  12. Variation of the electronic densities of states as a function of impurity concentration in amorphous bismuth alloys (United States)

    Mata-Pinzon, Zaahel; Valladares, Ariel Alberto; Valladares, Alexander; Valladares, Renela Maria


    The properties of materials are strongly related to their atomic topology, especially when we compare properties related to the ordered and disordered phases. Using Density Functional Theory methods on 64-atom supercells we obtain the structure and calculate the electronic density of states (eDOS) as a function of the concentration of lead, thallium or antimony in an amorphous bismuth supercell. This is done to investigate how the eDOS affects the superconducting transition temperature (Tc), taking into account the measurements made by Shier and Ginsberg[2] on contaminated amorphous bismuth thin films. Supported by CONACYT and DGAPA (UNAM).

  13. Study of iron structure stability in high temperature molten lead-bismuth eutectic with oxygen injection using molecular dynamics simulation

    Energy Technology Data Exchange (ETDEWEB)

    Arkundato, Artoto [Physics Department, Faculty of Mathematical and Natural Sciences, Jember University, Jl. Kalimantan 37 Jember (Indonesia); Su' ud, Zaki [Physics Department, Faculty of Mathematical and Natural Sciences, Bandung Institute of Technology, Jl. Ganesha 10, Bandung (Indonesia); Sudarko [Chemistry Department, Faculty of Mathematical and Natural Sciences, Jember University, Jl. Kalimantan 37 Jember (Indonesia); Shafii, Mohammad Ali [Physics Department, Faculty of Mathematical and Natural Sciences, Andalas University, Padang (Indonesia); Celino, Massimo [ENEA, CR Casaccia, Via Anguillarese 301, Rome (Italy)


    Corrosion of structural materials in high temperature molten lead-bismuth eutectic is a major problem for design of PbBi cooled reactor. One technique to inhibit corrosion process is to inject oxygen into coolant. In this paper we study and focus on a way of inhibiting the corrosion of iron using molecular dynamics method. For the simulation results we concluded that effective corrosion inhibition of iron may be achieved by injection 0.0532 wt% to 0.1156 wt% oxygen into liquid lead-bismuth. At this oxygen concentration the structure of iron material will be maintained at about 70% in bcc crystal structure during interaction with liquid metal.

  14. Effects of temperature and strain rate on the tensile behaviors of SIMP steel in static lead bismuth eutectic (United States)

    Liu, Jian; Yan, Wei; Sha, Wei; Wang, Wei; Shan, Yiyin; Yang, Ke


    In order to assess the susceptibility of candidate structural materials to liquid metal embrittlement, this work investigated the tensile behaviors of ferritic-martensitic steel in static lead bismuth eutectic (LBE). The tensile tests were carried out in static lead bismuth eutectic under different temperatures and strain rates. Pronounced liquid metal embrittlement phenomenon is observed between 200 °C and 450 °C. Total elongation is reduced greatly due to the liquid metal embrittlement in LBE environment. The range of ductility trough is larger under slow strain rate tensile (SSRT) test.

  15. Electrical characteristics of bismuth titanate glass-ceramics containing SiO2 and Nd2O3


    Stanislav S. Slavov; Milena Z. Krapchanska; Elena P. Kashchieva; Yanko B. Dimitriev


    Bismuth-titanate ceramics containing SiO2 and Nd2O3 as additives are synthesized at two different ways of cooling of the melts. The introduction of SiO2 and Nd2O3 leads to more complex crystallization with participation of several phases including Bi4Ti3O12. It is proved that the applied methods of synthesis are suitable for generation of different microstructures in the bulk doped bismuth titanate ceramics, which is promising basis for modification of their electrical properties. The increas...

  16. Dielectric and Piezoelectric Properties of Sodium Bismuth Titanate Ceramics with KCe Substitution

    Institute of Scientific and Technical Information of China (English)

    XU Jian-Xiu; ZHAO Liang; ZHANG Cheng-Ju


    @@ The piezoelectric properties of the (KCe)-substituted sodium bismuth titanate (Na0.5Bi4.5 Ti4O15, NBT) piezo-electric ceramics are investigated. The piezoelectric properties of NBT ceramics are significantly enhanced by (KCe) substitution. The Curie temperature Tc, and piezoelectric coefficient d33 for the (KCe)-substituted NBT are found to be 663°C, and 27pC/N, respectively. Dielectric and annealing spectroscopy present that the (KCe) co-substituted NBT piezoelectric ceramics possess stable piezoelectric properties.

  17. Effect of oxygen on fouling behavior in lead bismuth coolant systems (United States)

    Niu, Fenglei; Candalino, Robert; Li, Ning


    This experimental research investigates the effects of the oxygen in lead-bismuth eutectic on fouling. The analysis was carried out by performing three tests with different oxygen concentration on the recuperator where the heat transfer rate is susceptible to fouling, and introducing a correlation for the fouling factor. The comparison of fouling factors obtained with each oxygen level is presented, the relationship between fouling factors and oxygen concentrations is correlated, and the effects of oxidation on heat transfer are demonstrated qualitatively by wetting conditions of the samples.

  18. Effect of Bismuth Oxide on the Microstructure and Electrical Conductivity of Yttria Stabilized Zirconia

    Directory of Open Access Journals (Sweden)

    Liwei Liu


    Full Text Available Bismuth oxide (Bi2O3-doped yttria-stabilized zirconia (YSZ were prepared via the solid state reaction method. X-ray diffraction and electron diffraction spectroscopy results indicate that doping with 2 mol% Bi2O3 and adding 10 mol% yttria result in a stable zirconia cubic phase. Adding Bi2O3 as a dopant increases the density of zirconia to above 96%, while reducing its normal sintering temperature by approximately 250 °C. Moreover, electrical impedance analyses show that adding Bi2O3 enhances the conductivity of zirconia, improving its capability as a solid electrolyte for intermediate or even lower temperatures.

  19. Optical properties of Dy3+ doped bismuth zinc borate glass and glass ceramics (United States)

    Shanmugavelu, B.; Kanth Kumar, V. V. Ravi


    Dy3+ doped bismuth zinc borate transparent glasses were prepared by melt quenching technique and these glasses were used precursor to obtain transparent glass ceramics by heat treatment method. XRD pattern of the glass ceramic shows the formation of the β-BiB3O6 and Bi2ZnOB2O6 phases. The visible emission intensity of the glass ceramics is stronger than the glass. This can be due to the formation of nano nonlinear optical crystallites in glass matrix.

  20. Observation of dimension dependent magnetic ordering in bismuth ferrite particulate and fiber nanostructures

    Energy Technology Data Exchange (ETDEWEB)

    Sakar, M.; Bharathkumar, S.; Balakumar, S., E-mail: [National Centre for Nanoscience and Nanotechnology, University of Madras, Chennai 600 025 (India); Saravanan, P. [Defence Metallurgical Research Laboratory, Hyderabad 500058 (India)


    Nanoparticles and nanofibers of bismuth ferrite were fabricated by sol-gel and electrospinning methods respectively. The structural and morphological analysis was carried out by XRD and FESEM techniques respectively. The magnetic measurements were carried out by SQUID magnetometer. The BFO nanofibers showed an enhanced magnetic property compared to nanoparticles. The observed magnetic properties were found to be associated with their magnetic ordering in the system where the antiferromagnetic/ferromagnetic core/shell like nature and ‘canted’ spin structure ordering was found to be the magnetic origin in the particulate and fiber nanostructures respectively.

  1. Effect of Bismuth Oxide on the Microstructure and Electrical Conductivity of Yttria Stabilized Zirconia. (United States)

    Liu, Liwei; Zhou, Zheng; Tian, He; Li, Jixue


    Bismuth oxide (Bi2O3)-doped yttria-stabilized zirconia (YSZ) were prepared via the solid state reaction method. X-ray diffraction and electron diffraction spectroscopy results indicate that doping with 2 mol% Bi2O3 and adding 10 mol% yttria result in a stable zirconia cubic phase. Adding Bi2O3 as a dopant increases the density of zirconia to above 96%, while reducing its normal sintering temperature by approximately 250°C. Moreover, electrical impedance analyses show that adding Bi2O3 enhances the conductivity of zirconia, improving its capability as a solid electrolyte for intermediate or even lower temperatures.

  2. Ultrafast optical control of magnetization dynamics in polycrystalline bismuth doped iron garnet thin films

    Energy Technology Data Exchange (ETDEWEB)

    Deb, Marwan, E-mail:; Vomir, Mircea; Rehspringer, Jean-Luc; Bigot, Jean-Yves [Institut de Physique et Chimie des Matériaux de Strasbourg, UMR 7504, CNRS, Université de Strasbourg, BP 43, 23 rue du Loess, 67034 Strasbourg Cedex 02 (France)


    Controlling the magnetization dynamics on the femtosecond timescale is of fundamental importance for integrated opto-spintronic devices. For industrial perspectives, it requires to develop simple growth techniques for obtaining large area magneto-optical materials having a high amplitude ultrafast Faraday or Kerr response. Here we report on optical pump probe studies of light induced spin dynamics in high quality bismuth doped iron garnet polycrystalline film prepared by the spin coating method. We demonstrate an ultrafast non-thermal optical control of the spin dynamics using both circularly and linearly polarized pulses.

  3. RBEC lead-bismuth cooled fast reactor: review of conceptual decisions

    Energy Technology Data Exchange (ETDEWEB)

    Alekseev, P.; Fomichenko, P.; Mikityuk, K.; Nevinitsa, V.; Shchepetina, T.; Subbotin, S.; Vasiliev, A. [Russian Research Centre Kurchatov Inst., Moscow (Russian Federation)


    A concept of the RBEC lead-bismuth fast reactor-breeder is a synthesis, on one hand, of more than 40-year experience in development and operation of fast sodium power reactors and reactors with Pb-Bi coolant for nuclear submarines, and, on the other hand, of large R and D activities on development of the core concept for modified fast sodium reactor. The report briefly presents main parameters of the RBEC reactor, as a candidate for commercial exploitation in structure of the future nuclear power. (author)

  4. Additive-free controllable fabrication of bismuth vanadates and their photocatalytic activity toward dye degradation

    International Nuclear Information System (INIS)

    Bismuth vanadates (BiVO4) with various crystal structures (tetragonal scheelite, monoclinic scheelite, and tetragonal zircon) and morphologies (sphere-, nanosheet-, dendrite-, and flower-like) were controllably fabricated by using a mild additive-free hydrothermal treatment process under the different preparation conditions. The crystal structures, morphologies, and photophysical properties of the products were well-characterized. Subsequently, their UV- as well as visible-light photocatalytic performance was evaluated via dyes rhodamine B (RB) and methylene blue (MB) degradation. Special attention was paid to evaluate the correlation of the reactivity with crystal structure, morphology, and electronic structure of as-prepared BiVO4 samples.

  5. Interaction study between MOX fuel and Eutectic Lead-Bismuth coolant




    In the frame of the MYRRHA reactor project, the interaction between fuel pellets and the reactor coolant is essential for safety evaluations, e.g. in case of a pin breach. Therefore, interaction tests between uranium-plutonium mixed oxide (MOX) pellets and molten lead bismuth eutectic (LBE) have been performed and three parameters were studied, namely the interaction temperature (500 °C and 800 °C), the oxygen content in LBE and the stoichiometry of the MOX (U0.7Pu0.3O2-x and U0.7Pu0.3O2.00)....

  6. Corrosion behavior of cold-worked austenitic stainless steels in liquid lead–bismuth eutectic

    Energy Technology Data Exchange (ETDEWEB)

    Kurata, Yuji, E-mail:


    Highlights: • Austenitic stainless steels cold-worked up to 50% were exposed to lead–bismuth. • Lead–bismuth with the low oxygen concentration caused deep ferritization at 550 °C. • Ferritization also occurred at 550 °C during 3000 h under the high oxygen condition. • Cold working accelerated ferritization and Pb–Bi penetration without a protective film. • Attention should be also focused on the cold-working effect on corrosion behavior. - Abstract: The effect of cold working on the corrosion behavior of austenitic stainless steels in liquid lead–bismuth eutectic (LBE) was studied to develop accelerator-driven systems for the transmutation of long-lived radioactive wastes and lead–bismuth cooled fast reactors. Corrosion tests on solution-treated, 20% cold-worked and 50% cold-worked 316SS and JPCA (15Cr–15Ni–Ti) were conducted in oxygen-controlled LBE. Slight ferritization caused by Ni dissolution and Pb–Bi penetration were observed for all specimens in the corrosion test conducted at 500 °C for 1000 h in liquid LBE with an intermediate oxygen concentration (1.4 × 10{sup −7} wt.%). In the corrosion test performed at 550 °C for 1000 h in liquid LBE with a low oxygen concentration (4.2 × 10{sup −9} wt.%), the depth of the ferritization of 316SS and JPCA increased with the extent of cold working. Only oxidation was observed in the corrosion test that was performed at 550 °C for 1000 h in liquid LBE with a high oxygen concentration (approximately 10{sup −5} wt.%). Cold working accelerated the formation of the double layer oxide and increased the thickness of the oxide layer slightly. In contrast, the ferritization accompanied by Pb–Bi penetration was widely observed with oxidation for all specimens corrosion tested at 550 °C for 3000 h under the high-oxygen condition. Cold working increased the depth of the ferritization of 316SS and JPCA. It is considered that cold working accelerated the ferritization and Pb–Bi penetration

  7. Laboratory-Scale Bismuth Phosphate Extraction Process Simulation To Track Fate of Fission Products

    Energy Technology Data Exchange (ETDEWEB)

    Serne, R. JEFFREY; Lindberg, Michael J.; Jones, Thomas E.; Schaef, Herbert T.; Krupka, Kenneth M.


    Recent field investigation that collected and characterized vadose zone sediments from beneath inactive liquid disposal facilities at the Hanford 200 Areas show lower than expected concentrations of a long-term risk driver, Tc-99. Therefore laboratory studies were performed to re-create one of the three processes that were used to separate the plutonium from spent fuel and that created most of the wastes disposed or currently stored in tanks at Hanford. The laboratory simulations were used to compare with current estimates based mainly on flow sheet estimates and spotty historical data. Three simulations of the bismuth phosphate precipitation process show that less that 1% of the Tc-99, Cs-135/137, Sr-90, I-129 carry down with the Pu product and thus these isotopes should have remained within the metals waste streams that after neutralization were sent to single shell tanks. Conversely, these isotopes should not be expected to be found in the first and subsequent cycle waste streams that went to cribs. Measurable quantities (~20 to 30%) of the lanthanides, yttrium, and trivalent actinides (Am and Cm) do precipitate with the Pu product, which is higher than the 10% estimate made for current inventory projections. Surprisingly, Se (added as selenate form) also shows about 10% association with the Pu/bismuth phosphate solids. We speculate that the incorporation of some Se into the bismuth phosphate precipitate is caused by selenate substitution into crystal lattice sites for the phosphate. The bulk of the U daughter product Th-234 and Np-237 daughter product Pa-233 also associate with the solids. We suspect that the Pa daughter products of U (Pa-234 and Pa-231) would also co-precipitate with the bismuth phosphate induced solids. No more than 1 % of the Sr-90 and Sb-125 should carry down with the Pu product that ultimately was purified. Thus the current scheme used to estimate where fission products end up being disposed overestimates by one order of magnitude the

  8. New Bismuth Germanate Oxide Nanoparticle Material for Biolabel Applications in Medicine


    M. J. Oviedo; Contreras, O. E.; Y. Rosenstein; Vazquez-Duhalt, R.; Z. S. Macedo; Carbajal-Arizaga, G. G.; G. A. Hirata


    Bismuth germanate (Bi4Ge3O12, BGO) has been the focus of several studies due to its scintillation properties. It has been employed as detector in scientific research and medicine, and herein we studied its possible biomedical applications. The photoluminescence properties of the uncoated and protein-coated nanoparticles were analyzed in different body fluids, at different pH. The nanoparticles yielded blueish-white luminescence with a maximum emission peak at 485 nm corresponding to the 3P1→1...

  9. 21 CFR 203.50 - Requirements for wholesale distribution of prescription drugs. (United States)


    ... sale, purchase, or trade of such drug. This identifying statement shall include: (1) The proprietary... prescription drugs. 203.50 Section 203.50 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL PRESCRIPTION DRUG MARKETING Wholesale Distribution §...

  10. 5 CFR 2638.203 - Duties of the designated agency ethics official. (United States)


    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Duties of the designated agency ethics official. 2638.203 Section 2638.203 Administrative Personnel OFFICE OF GOVERNMENT ETHICS GOVERNMENT ETHICS OFFICE OF GOVERNMENT ETHICS AND EXECUTIVE AGENCY ETHICS PROGRAM RESPONSIBILITIES Designated Agency...

  11. 48 CFR 2152.203-70 - Misleading, deceptive, or unfair advertising. (United States)


    ... unfair advertising. 2152.203-70 Section 2152.203-70 Federal Acquisition Regulations System OFFICE OF..., deceptive, or unfair advertising. As prescribed in 2103.571, insert the following clause: Misleading, Deceptive, or Unfair Advertising (OCT 2005) The Contractor agrees that any advertising material...

  12. 24 CFR 203.52 - Acceptance of individual residential water purification equipment. (United States)


    ... National Primary Drinking Water requirements, 40 CFR parts 141 and 142.) (4) There exists a Plan providing... residential water purification equipment. 203.52 Section 203.52 Housing and Urban Development Regulations... water purification equipment. If a property otherwise eligible for insurance under this part does...

  13. 33 CFR 203.48 - Inspection guidelines for non-Federal flood control works. (United States)


    ...-Federal flood control works. 203.48 Section 203.48 Navigation and Navigable Waters CORPS OF ENGINEERS... DISASTER PROCEDURES Rehabilitation Assistance for Flood Control Works Damaged by Flood or Coastal Storm..., construction, and maintenance of non-Federal flood control works. The guidelines are not intended to...

  14. 5 CFR 451.203 - Responsibilities of the Office of Personnel Management. (United States)


    ... Personnel Management. 451.203 Section 451.203 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL... Management. (a) The Office of Personnel Management, in accordance with Executive Order 10717, as amended... and recommend to the President which career employees should receive this award. (b) Under...

  15. 9 CFR 93.203 - Ports designated for the importation of poultry. (United States)



  16. 47 CFR 101.203 - Communications concerning safety of life and property. (United States)


    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Communications concerning safety of life and property. 101.203 Section 101.203 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY... concerning safety of life and property. (a) Handling and transmission of messages concerning the safety...

  17. 10 CFR 490.203 - Light Duty Alternative Fueled Vehicle Plan. (United States)


    ... Section 490.203 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION ALTERNATIVE FUEL TRANSPORTATION PROGRAM Mandatory State Fleet Program § 490.203 Light Duty Alternative Fueled Vehicle Plan. (a) General Provisions... fleets, a State may follow a Light Duty Alternative Fueled Vehicle Plan that has been approved by...

  18. 24 CFR 203.256 - Insurance of open-end advance. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance of open-end advance. 203... Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR HOUSING-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF... Insurance § 203.256 Insurance of open-end advance. Insurance on an open-end advance will be evidenced...

  19. 21 CFR 20.3 - Certification and authentication of Food and Drug Administration records. (United States)


    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Certification and authentication of Food and Drug Administration records. 20.3 Section 20.3 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND... authentication of Food and Drug Administration records. (a) Upon request, the Food and Drug Administration...

  20. 5 CFR 330.203 - Eligibility due to reduction in force. (United States)


    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Eligibility due to reduction in force. 330.203 Section 330.203 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE... Eligibility due to reduction in force. (a) To apply for the RPL, an employee must meet all the...

  1. 9 CFR 203.15 - Trust benefits under sections 206 and 207 of the Act. (United States)


    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Trust benefits under sections 206 and 207 of the Act. 203.15 Section 203.15 Animals and Animal Products GRAIN INSPECTION, PACKERS AND..., live poultry seller or grower, to preserve his interest in the statutory trust, must give...

  2. 48 CFR 1836.203 - Government estimate of construction costs.(NASA supplements paragraph (c)) (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Government estimate of construction costs.(NASA supplements paragraph (c)) 1836.203 Section 1836.203 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND SPACE ADMINISTRATION SPECIAL CATEGORIES OF CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS...

  3. 38 CFR 1.203 - Information to be reported to VA Police. (United States)


    ... reported to VA Police. 1.203 Section 1.203 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS... be reported to VA Police. Information about actual or possible violations of criminal laws related to... occurs on VA premises, will be reported by VA management officials to the VA police component...

  4. 7 CFR 760.203 - Eligible losses, adverse weather, and other loss conditions. (United States)


    ... to, flood, freeze, hurricane, hail, tidal surge, volcanic eruption, and wildfire on non-Federal land... 7 Agriculture 7 2010-01-01 2010-01-01 false Eligible losses, adverse weather, and other loss conditions. 760.203 Section 760.203 Agriculture Regulations of the Department of Agriculture (Continued)...

  5. 50 CFR 226.203 - Critical habitat for northern right whales. (United States)


    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Critical habitat for northern right whales. 226.203 Section 226.203 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND... Critical habitat for northern right whales. (a) Great South Channel. The area bounded by 41°40′ N/69°45′...

  6. 17 CFR 275.203(b)(3)-1 - Definition of “client” of an investment adviser. (United States)


    ... generally to the public as an investment adviser, within the meaning of section 203(b)(3) of the Act (15 U.S... than the United States, and is regulated as a public investment company under the laws of the country... investment adviser. 275.203(b)(3)-1 Section 275.203(b)(3)-1 Commodity and Securities Exchanges SECURITIES...

  7. 24 CFR 203.439a - Mortgages on property in Allegany Reservation of Seneca Nation of Indians authorized by section... (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgages on property in Allegany Reservation of Seneca Nation of Indians authorized by section 203(q) of the National Housing Act. 203.439a... Reservation of Seneca Indians § 203.439a Mortgages on property in Allegany Reservation of Seneca Nation...

  8. 24 CFR 203.666 - Processing defaulted mortgages on property in Allegany Reservation of Seneca Nation of Indians. (United States)


    ... property in Allegany Reservation of Seneca Nation of Indians. 203.666 Section 203.666 Housing and Urban... INSURANCE Servicing Responsibilities Assignment and Forbearance-Property in Allegany Reservation of Seneca Indians § 203.666 Processing defaulted mortgages on property in Allegany Reservation of Seneca Nation...

  9. 30 CFR 203.44 - What administrative steps must I take to use the royalty suspension volume? (United States)


    ... 30 CFR part 250, subpart L. (d) You must provide the information in paragraph (b) of this section by... the royalty suspension volume? 203.44 Section 203.44 Mineral Resources MINERALS MANAGEMENT SERVICE... Relief § 203.44 What administrative steps must I take to use the royalty suspension volume? (a) You...

  10. 14 CFR 203.4 - Montreal Agreement as part of airline-passenger contract and conditions of carriage. (United States)


    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Montreal Agreement as part of airline-passenger contract and conditions of carriage. 203.4 Section 203.4 Aeronautics and Space OFFICE OF THE... CONVENTION LIABILITY LIMITS AND DEFENSES § 203.4 Montreal Agreement as part of airline-passenger contract...

  11. 36 CFR 223.203 - Indirect substitution exception for National Forest System timber from within Washington State. (United States)


    ... 36 CFR 223.203, the prohibition contained in section 490(b) of the Act (16 U.S.C. 620b) applies to me... from the prohibition against indirect substitution in section 490(b) of the Act, a person must have... exception for National Forest System timber from within Washington State. 223.203 Section 223.203...

  12. Adaptive statistical iterative reconstruction and bismuth shielding for evaluation of dose reduction to the eye and image quality during head CT

    International Nuclear Information System (INIS)

    There is a concern regarding the adverse effects of increasing radiation doses due to repeated computed tomography (CT) scans, especially in radiosensitive organs and portions thereof, such as the lenses of the eyes. Bismuth shielding with an adaptive statistical iterative reconstruction (ASIR) algorithm was recently introduced in our clinic as a method to reduce the absorbed radiation dose. This technique was applied to the lens of the eye during CT scans. The purpose of this study was to evaluate the reduction in the absorbed radiation dose and to determine the noise level when using bismuth shielding and the ASIR algorithm with the GE DC 750 HD 64-channel CT scanner for CT of the head of a humanoid phantom. With the use of bismuth shielding, the noise level was higher in the beam-hardening artifact areas than in the revealed artifact areas. However, with the use of ASIR, the noise level was lower than that with the use of bismuth alone; it was also lower in the artifact areas. The reduction in the radiation dose with the use of bismuth was greatest at the surface of the phantom to a limited depth. In conclusion, it is possible to reduce the radiation level and slightly decrease the bismuth-induced noise level by using a combination of ASIR as an algorithm process and bismuth as an in-plane hardware-type shielding method.

  13. Low-Temperature Synthesis of Bismuth Chalcohalides: Candidate Photovoltaic Materials with Easily, Continuously Controllable Band gap (United States)

    Kunioku, Hironobu; Higashi, Masanobu; Abe, Ryu


    Although bismuth chalcohalides, such as BiSI and BiSeI, have been recently attracting considerable attention as photovoltaic materials, the methods available to synthesize them are quite limited thus far. In this study, a novel, facile method to synthesize these chalcohalides, including BiSBr1-xIx solid solutions, at low temperatures was developed via the substitution of anions from O2- to S2- (or Se2-) using bismuth oxyhalide precursors. Complete phase transition was readily observed upon treatment of BiOI particles with H2S or H2Se at surprisingly low temperatures of less than 150 °C and short reaction times of less than 1 h, producing BiSI and BiSeI particles, respectively. This method was also applied for synthesizing BiSBr1-xIx, where continuous changes in their band gaps were observed depending on the ratio between iodine and bromine. The composition of all elements (except oxygen) in the chalcohalides thus produced was almost identical to that of the oxyhalide precursors, attributed to the suppressed volatilization of halogens at such low temperatures. All chalcohalides loaded on FTO clearly exhibited an anodic photocurrent in an acetonitrile solution containing I-, attributed to their n-type nature, e.g., the BiSI electrode exhibited high IPCE (64% at 700 nm, +0.2 V vs. Ag/AgCl).

  14. Carbon nanotubes paste sensor modified with bismuth film for determination of metallic ions in ethanol fuel

    Directory of Open Access Journals (Sweden)

    Felipe Augusto Gorla


    Full Text Available In the present study an anodic stripping voltammetric method using a bismuth film modified carbon nanotubes paste electrode for simultaneous determination of metals Zn2+, Cd2+and Pb2+in ethanol fuel is described. The metallic ions were preconcentrated on the bismuth film in the time and deposition potential of 500 s and -1.2 V and the stripping step was carried out by square wave voltammetry (frequency of 15 Hz, pulse amplitude of 25 mV and potential step of 5 mV. Acetate buffer at 0.1 mol L-1concentration and pH 4.5 was used as support electrolyte. The method showed linearity including the analytical blank up to 48.39 ?g L-1 for the metals and the obtained limits of detection were 3.36, 0.32 and 0.47 ?g L-1for Zn2+, Cd2+and Pb2+, respectively. The proposed method was applied in ethanol fuel samples.

  15. Low-Temperature Synthesis of Bismuth Chalcohalides: Candidate Photovoltaic Materials with Easily, Continuously Controllable Band gap (United States)

    Kunioku, Hironobu; Higashi, Masanobu; Abe, Ryu


    Although bismuth chalcohalides, such as BiSI and BiSeI, have been recently attracting considerable attention as photovoltaic materials, the methods available to synthesize them are quite limited thus far. In this study, a novel, facile method to synthesize these chalcohalides, including BiSBr1‑xIx solid solutions, at low temperatures was developed via the substitution of anions from O2‑ to S2‑ (or Se2‑) using bismuth oxyhalide precursors. Complete phase transition was readily observed upon treatment of BiOI particles with H2S or H2Se at surprisingly low temperatures of less than 150 °C and short reaction times of less than 1 h, producing BiSI and BiSeI particles, respectively. This method was also applied for synthesizing BiSBr1‑xIx, where continuous changes in their band gaps were observed depending on the ratio between iodine and bromine. The composition of all elements (except oxygen) in the chalcohalides thus produced was almost identical to that of the oxyhalide precursors, attributed to the suppressed volatilization of halogens at such low temperatures. All chalcohalides loaded on FTO clearly exhibited an anodic photocurrent in an acetonitrile solution containing I‑, attributed to their n-type nature, e.g., the BiSI electrode exhibited high IPCE (64% at 700 nm, +0.2 V vs. Ag/AgCl).

  16. Size control of semimetal bismuth nanoparticles and the UV-visible and IR absorption spectra. (United States)

    Wang, Y W; Hong, Byung Hee; Kim, Kwang S


    We introduced a simple chemical method to synthesize semimetal bismuth nanoparticles in N,N-dimethylformamide (DMF) by reducing Bi(3+) with sodium borohydride (NaBH(4)) in the presence of poly(vinylpyrroldone) (PVP) at room temperature. The size and dispersibility of Bi nanoparticles can be easily controlled by changing the synthetic conditions such as the molar ratio of PVP to BiCl(3) and the concentration of BiCl(3). The UV-visible absorption spectra of Bi nanoparticles of different diameters are systematically studied. The surface plasmon peaks broaden with the increasing molar ratio of PVP to BiCl(3) as the size of bismuth nanoparticles decreases. Infrared (IR) spectra of the complexes with different molar ratios of PVP/BiCl(3) show a strong interaction between the carboxyl oxygen (C=O) of PVP and Bi(3+) ion and a weak interaction between the carboxyl oxygen (C=O) of PVP and the Bi atom in nanoparticles. This indicates that PVP serves as an effective capping ligand, which prevents the nanoparticles from aggregation.

  17. Solar photocatalytic degradation of RB5 by ferrite bismuth nanoparticles synthesized via ultrasound. (United States)

    Soltani, T; Entezari, M H


    In this paper, the photocatalytic degradation of Reactive Black 5 (RB5) was investigated with ferrite bismuth synthesized via ultrasound under direct sunlight irradiation. The intensity of absorption peaks of RB5 gradually decreased by increasing the irradiation time and finally vanished in 50 min in acidic medium. The formation of new intermediate was observed in basic medium. The relative concentration of RB5 in solution and on the surface of ferrite bismuth (BiFeO3) nanoparticles was considered during the experiment in acidic and basic media. The effects of various parameters such as amount of catalyst, concentration of dye, and pH of the solution have been studied on the dye degradation. The adsorption isotherm and the kinetic of photocatalytic degradation of RB5 were investigated. The adsorption constants in the dark and in the presence of sunlight irradiation were compared. The photocatalytic degradation mechanism of RB5 has been evaluated through the addition of some scavengers to the solution. In addition, the stability and reusability of the catalyst were examined in this work.

  18. Thermoelectric properties and micro-structure characteristics of annealed N-type bismuth telluride thin film

    International Nuclear Information System (INIS)

    N-type bismuth telluride (Bi2Te3) thermoelectric thin films were deposited by co-sputtering simple substance Te and Bi targets. The deposited films were annealed under various temperatures. The composition ratio, micro-structure and thermoelectric properties of the prepared films were systematically investigated by energy dispersive spectrometer, X-ray diffraction, four-probe method and Seebeck coefficient measurement system. When the annealing temperature is 400 °C, the stoichiometric N-type Bi2Te3 film is achieved, which has a maximum thermoelectric power factor of 0.821 × 10−3 W m−1 K−2. Furthermore, the dependence of Seebeck coefficient, electrical conductivity and power factor of the stoichiometric N-type Bi2Te3 film annealed at film 400 °C on the applied temperature ranging from 25 °C to 315 °C was investigated. The results show that a highest power factor of 3.288 × 10−3 W m−1 K−2 is obtained at the applied temperature of 275 °C. The structural and thermoelectric properties of the deposited bismuth telluride thin films are greatly improved by annealing and the Seebeck coefficient, electrical conductivity and power factor increase with the applied temperature rising, which are helpful and could be guidance for preparing the high-performance thin film thermoelectric materials for thermoelectric application.

  19. Study of structural, ferromagnetic and ferroelectric properties of nanostructured barium doped Bismuth Ferrite

    International Nuclear Information System (INIS)

    Nanostructured multiferroic Bi(1−x)BaxFeO3x=0.0, 0.1, 0.2 were prepared by hydrothermal technique. All samples belonged to the rhombohedrally distorted perovskite structure. The morphology of the particles changed with the doping of barium. Effect of barium doping on the dielectric constant was studied over a wide frequency range of 1000 Hz–1 MHz. The activation energy due to relaxation and due to conduction was measured from the Cole Cole plot and the AC conductivity versus frequency plot respectively. The activation energy estimated from both the studies was close to each other. The activation energy also enhanced with the increase in the barium content. The magnetization at the highest available field (∼1.6 T) increased from 0.05 emu/g for the sample with x=0.0–12 emu/g for the sample with x=0.2. The magnetic measurements show a significant increase in magnetization around 400 °C. Remnant polarization for x=0.0 was negligible and it increased to 0.06 µC/cm2 for x=0.2. - Highlights: • Bismuth Ferrite nanostructures were synthesized by the hydrothermal technique. • Barium was doped in Bismuth site. • Morphology changed with doping. • Ferromagnetic, Ferroelectric and Dielectric properties enhanced with doping. • An unreported magnetic transition due to spin canting was observed near 550 °C

  20. Growth of epitaxial sodium-bismuth-titanate films by metal-organic chemical vapor phase deposition

    Energy Technology Data Exchange (ETDEWEB)

    Schwarzkopf, J., E-mail: [Leibniz Institute for Crystal Growth, Max-Born-Strasse 2, 12489 Berlin (Germany); Schmidbauer, M.; Duk, A.; Kwasniewski, A. [Leibniz Institute for Crystal Growth, Max-Born-Strasse 2, 12489 Berlin (Germany); Anooz, S. Bin [Leibniz Institute for Crystal Growth, Max-Born-Strasse 2, 12489 Berlin (Germany); Physics Department, Faculty of Science, Hadhramout University of Science and Technology, Mukalla 50511, Republic of Yemen (Yemen); Wagner, G. [Leibniz Institute for Crystal Growth, Max-Born-Strasse 2, 12489 Berlin (Germany); Devi, A. [Inorganic Materials Chemistry, Ruhr-University Bochum, Universitaetsstr. 150, 44801 Bochum (Germany); Fornari, R. [Leibniz Institute for Crystal Growth, Max-Born-Strasse 2, 12489 Berlin (Germany)


    The liquid-delivery spin metal-organic chemical vapor phase deposition method was used to grow epitaxial sodium-bismuth-titanate films of the system Bi{sub 4}Ti{sub 3}O{sub 12} + xNa{sub 0.5}Bi{sub 0.5}TiO{sub 3} on SrTiO{sub 3}(001) substrates. Na(thd), Ti(O{sup i}Pr){sub 2}(thd){sub 2} and Bi(thd){sub 3}, solved in toluene, were applied as source materials. Depending on the substrate temperature and the Na/Bi ratio in the gas phase several structural phases of sodium-bismuth-titanate were detected. With increasing temperature and/or Na/Bi ratio, phase transitions from an Aurivillius phase with m = 3 to m = 4 via an interleaved state with m = 3.5, and, finally, to Na{sub 0.5}Bi{sub 0.5}TiO{sub 3} with perovskite structure (m = {infinity}) were established. These phase transitions proceed at remarkably lower temperatures than in ceramics or bulk crystals for which they had been exclusively observed so far.