
Sample records for bismuth 201

  1. Valley polarization in bismuth (United States)

    Fauque, Benoit


    The electronic structure of certain crystal lattices can contain multiple degenerate valleys for their charge carriers to occupy. The principal challenge in the development of valleytronics is to lift the valley degeneracy of charge carriers in a controlled way. In bulk semi-metallic bismuth, the Fermi surface includes three cigar-shaped electron valleys lying almost perpendicular to the high symmetry axis known as the trigonal axis. The in-plane mass anisotropy of each valley exceeds 200 as a consequence of Dirac dispersion, which drastically reduces the effective mass along two out of the three orientations. According to our recent study of angle-dependent magnetoresistance in bismuth, a flow of Dirac electrons along the trigonal axis is extremely sensitive to the orientation of in-plane magnetic field. Thus, a rotatable magnetic field can be used as a valley valve to tune the contribution of each valley to the total conductivity. As a consequence of a unique combination of high mobility and extreme mass anisotropy in bismuth, the effect is visible even at room temperature in a magnetic field of 1 T. Thus, a modest magnetic field can be used as a valley valve in bismuth. The results of our recent investigation of angle-dependent magnetoresistance in other semi-metals and doped semiconductors suggest that a rotating magnetic field can behave as a valley valve in a multi-valley system with sizeable mass anisotropy.

  2. Bismuth toxicity in patients treated with bismuth iodoform paraffin packs. (United States)

    Atwal, A; Cousin, G C S


    Bismuth is a heavy metal used in bismuth iodoform paraffin paste (BIPP) antiseptic dressings and in a number of other medical preparations. It can be absorbed systemically and cause toxicity. We report 2 cases of such neurotoxicity after it was used in operations on the jaws. Copyright © 2015. Published by Elsevier Ltd.

  3. Laser Spectroscopy of Neutron Rich Bismuth Isotopes

    CERN Multimedia


    %IS344 :\\\\ \\\\ The aim of the experiment is to measure the optical isotope shifts and hyperfine structures of bismuth isotopes across the N=126 shell closure in order to extract the change in mean square charge radii ($\\delta\\langle r^{2}\\rangle$) and static moments. These include the first isotones of lead to be measured directly above the shell closure and will provide new information on the systematics of the kink ($\\delta\\langle r^{2}\\rangle)$ seen in the lead isotopic chain. After two very successful runs the programme has been extended to include the neutron deficient isotopes below $^{201}$Bi to study the systematics across the $i_{13/2}$ neutron sub-shell closure at N=118.\\\\ \\\\ During the initial 2 runs (9 shifts) the isotope shifts and hyperfine structures of three new isotopes, $ ^{210,212,213}$Bi and the 9$^{-}$ isomer of $^{210}$Bi have been measured. The accuracy of the previous measurements of $^{205,206,208}$Bi have been greatly improved. The samples of $ ^{208,210,210^{m}}$Bi were prepared by c...

  4. Iodine Gas Trapping using Granular Porous Bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Jae Hwan; Shin, Jin Myeong; Park, Jang Jin; Park, Geun Il [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Yim, Mansung [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of)


    {sup 129}I is a radionuclide with a very long half-life of 1.57 Χ 10{sup 7} years and has negative health effects to the human body. Therefore, the emission of {sup 129}I into the air is closely regulated by the Environmental Protection Agency (EPA). Many methods for trapping gaseous {sup 129}I have been developed thus far, including wet scrubbing and adsorption using silver loaded zeolites. Although wet scrubbing can effectively remove iodine, it suffers from corrosion of the vessel due to high concentration of the scrubbing solution. Silver loaded zeolites also show effectiveness in capturing {sup 129}I gas, yet weak thermal stability of physisorbed iodine remains a challenge. We studied a novel and facile method to trap iodine gas using bismuth. Granular bismuth having many pores was synthesized using bismuth nitrate and polyvinyl alcohol as a bismuth precursor and pore forming agent, respectively. Reaction of iodine and our samples resulted in an iodine capturing capacity of more than 2 times that of the commercial grade silver exchanged zeolite (AgX). Granular porous bismuths synthesized using bismuth nitrate and PVA show a promising performance in capturing iodine gas. The use of bismuth in trapping {sup 129}I gas can reduce the process cost as bismuth is cheap. Further study is going on to improve the mechanical property of granular porous bismuths for their easy handling.

  5. Iodine Gas Trapping using Granular Porous Bismuth

    International Nuclear Information System (INIS)

    Yang, Jae Hwan; Shin, Jin Myeong; Park, Jang Jin; Park, Geun Il; Yim, Mansung


    129 I is a radionuclide with a very long half-life of 1.57 Χ 10 7 years and has negative health effects to the human body. Therefore, the emission of 129 I into the air is closely regulated by the Environmental Protection Agency (EPA). Many methods for trapping gaseous 129 I have been developed thus far, including wet scrubbing and adsorption using silver loaded zeolites. Although wet scrubbing can effectively remove iodine, it suffers from corrosion of the vessel due to high concentration of the scrubbing solution. Silver loaded zeolites also show effectiveness in capturing 129 I gas, yet weak thermal stability of physisorbed iodine remains a challenge. We studied a novel and facile method to trap iodine gas using bismuth. Granular bismuth having many pores was synthesized using bismuth nitrate and polyvinyl alcohol as a bismuth precursor and pore forming agent, respectively. Reaction of iodine and our samples resulted in an iodine capturing capacity of more than 2 times that of the commercial grade silver exchanged zeolite (AgX). Granular porous bismuths synthesized using bismuth nitrate and PVA show a promising performance in capturing iodine gas. The use of bismuth in trapping 129 I gas can reduce the process cost as bismuth is cheap. Further study is going on to improve the mechanical property of granular porous bismuths for their easy handling

  6. Oxygen depletion of bismuth molybdates

    Energy Technology Data Exchange (ETDEWEB)

    Yong, L.K.; Howe, R.F.; Keulks, G.W.; Hall, W.K.


    Pure ..cap alpha..-phase bismuth molybdate (Bi/sub 2/Mo/sub 3/O/sub 12/), which is known to be weakly active for selective oxidation, and pure ..gamma..-phase bismuth molybdate (Bi/sub 2/MoO/sub 6/), which has good activity, were subjected to oxidation-reduction cycles with known amounts of hydrogen and oxygen, at 300/sup 0/-570/sup 0/C and with evacuation steps between treatments. The volume of oxygen consumed during reoxidation was equal to half the hydrogen consumed during the reduction on the ..cap alpha..-phase, which indicated that no hydrogen was retained during reduction. For the ..gamma..-phase, the oxygen consumption was greater than half of the hydrogen consumption and it increased with extent of reduction. The excess oxygen was apparently consumed by filling anion vacancies formed during outgassing subsequent to the reduction step. ESR spectroscopy and temperature-programed oxidation-reduction indicated that lattice oxide ions which bridge between bismuth and molybdenum layers of the koechlinite structure become more labile when the catalyst is in a partially reduced state, and that this effect is greater in the ..gamma..- than the ..cap alpha..-phase. Table and 15 references.

  7. Bismuth absorption from sup 205 Bi-labelled pharmaceutical bismuth compounds used in the treatment of peptic ulcer disease

    Energy Technology Data Exchange (ETDEWEB)

    Dresow, B.; Fischer, R.; Gabbe, E.E.; Wendel, J.; Heinrich, H.C. (Eppendorf University Hospital, Hamburg (Germany))


    The absorption of bismuth from five {sup 205}Bi-labelled pharmaceutically used bismuth compounds was studied in man. From single oral doses of all compounds under investigation only <0.1% bismuth was absorbed and excreted with the urine. A significantly higher absorption was observed from the colloidal bismuth subcitrate and the basic bismuth gallate than from the basic bismuth salicylate, nitrate and aluminate. No retention of bismuth in the whole body was found from the single dose experiment. The biologic fast-term half-lives of absorbed bismuth were calculated to be 0.12 and 1.5 days. 14 refs., 2 figs., 1 tab.

  8. Bismuth ions are metabolized into autometallographic traceable bismuth-sulphur quantum dots

    Directory of Open Access Journals (Sweden)

    M Stoltenberg


    Full Text Available Bismuth – sulphur quantum dots can be silver enhanced by autometallography (AMG. In the present study, autometallographic silver enhanced bismuth-sulphur nanocrystals were isolated from unfixed cryo-sections of kidneys and livers of rats exposed to bismuth (Bi207 subnitrate. After being subjected to AMG all the organic material was removed by sonication and enzymatic digestion and the silver enhanced Bi- S quantum dots spun down by an ultracentrifuge and analyzed by scintillation. The analysis showed that the autometallographic technique traces approximately 94% of the total bismuth. This implies that the injected bismuth is ultimately captured in bismuthsulphur quantum dots, i.e., that Bi-S nanocrystals are the end product of bismuth metabolism

  9. Gravimetric Analysis of Bismuth in Bismuth Subsalicylate Tablets: A Versatile Quantitative Experiment for Undergraduate Laboratories (United States)

    Davis, Eric; Cheung, Ken; Pauls, Steve; Dick, Jonathan; Roth, Elijah; Zalewski, Nicole; Veldhuizen, Christopher; Coeler, Joel


    In this laboratory experiment, lower- and upper-division students dissolved bismuth subsalicylate tablets in acid and precipitated the resultant Bi[superscript 3+] in solution with sodium phosphate for a gravimetric determination of bismuth subsalicylate in the tablets. With a labeled concentration of 262 mg/tablet, the combined data from three…

  10. Short report: evaluation of Helicobacter pylori eradication with bismuth sucralfate

    NARCIS (Netherlands)

    Reijers, M. H.; Noach, L. A.; Tytgat, G. N.


    In a pilot study we have evaluated the clinical efficacy of bismuth sucralfate to eradicate H. pylori. Ten consecutive patients with chronic dyspepsia and H. pylori associated gastritis were treated with bismuth sucralfate (220 mg bismuth per tablet, 4 tablets per day for 4 weeks). If a 14C urea

  11. Bismuth titanate nanorods and their visible light photocatalytic properties

    International Nuclear Information System (INIS)

    Pei, L.Z.; Liu, H.D.; Lin, N.; Yu, H.Y.


    Highlights: • Bismuth titanate nanorods have been synthesized by a simple hydrothermal process. • The size of bismuth titanate nanorods can be controlled by growth conditions. • Bismuth titanate nanorods show good photocatalytic activities of methylene blue and Rhodamine B. - Abstract: Bismuth titanate nanorods have been prepared using a facile hydrothermal process without additives. The bismuth titanate products were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), high-resolution TEM (HRTEM) and UV-vis diffusion reflectance spectrum. XRD pattern shows that the bismuth titanate nanorods are composed of cubic Bi 2 Ti 2 O 7 phase. Electron microscopy images show that the length and diameter of the bismuth titanate nanorods are 50-200 nm and 2 μm, respectively. Hydrothermal temperature and reaction time play important roles on the formation and size of the bismuth titanate nanorods. UV-vis diffusion reflectance spectrum indicates that bismuth titanate nanorods have a band gap of 2.58 eV. The bismuth titanate nanorods exhibit good photocatalytic activities in the photocatalytic degradation of methylene blue (MB) and Rhodamine B (RB) under visible light irradiation. The bismuth titanate nanorods with cubic Bi 2 Ti 2 O 7 phase are a promising candidate as a visible light photocatalyst

  12. Bismuth Subgallate Toxicity in the Age of Online Supplement Use. (United States)

    Sampognaro, Paul; Vo, Kathy T; Richie, Megan; Blanc, Paul D; Keenan, Kevin


    Bismuth salts have been used to treat gastroenterological disorders and are readily available over-the-counter and via the internet. Even though generally considered safe, bismuth compounds can cause a syndrome of subacute, progressive encephalopathy when taken in large quantities. We present the case of woman who developed progressive encephalopathy, aphasia, myoclonus, and gait instability after chronically ingesting large amounts of bismuth subgallate purchased from a major online marketing website to control symptoms of irritable bowel syndrome. After extensive neurological work-up, elevated bismuth levels in her blood, urine, and cerebrospinal fluid confirmed the diagnosis of bismuth-related neurotoxicity. She improved slowly following cessation of exposure. This case highlights bismuth subgallate as a neurotoxic bismuth formulation and reminds providers of the potential for safety misconceptions of positively reviewed online supplements.

  13. Radio-sensitization of animals by bismuth; Radio sensibilisation de l'animal par le bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Pierotti, T; Verain, A [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires


    Digestive absorption of bismuth by animals leads to radio-sensitization. This effect is very marked when the X-rays used are centered on the absorption line of bismuth. This work has involved the use of more than 2000 C3H/JAX mice, and has shown that a maximum lethal effect, with respect to the standard, occurs for bismuth sub-nitrate doses of the order of 3 g/kg and for exposures of 700 R. For stronger or weaker doses, the sensitization effect is less marked. (authors) [French] L'absorption digestive de bismuth provoque une radiosensibilisation de l'animal. Celle-ci est nette quand le rayonnement X utilise est centre sur la raie d'absorption du bismuth. L'etude portant sur plus de 2000 souris C3H/JAX a montre une lethalite maximale par rapport aux temoins pour des doses de sous-nitrate de bismuth de l'ordre de 3 g/kg et pour des expositions de 700 R. Pour des doses plus fortes ou plus faibles, l'effet de sensibilisation est moins net. (auteurs)

  14. 21 CFR 73.2110 - Bismuth citrate. (United States)


    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Bismuth citrate. 73.2110 Section 73.2110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL LISTING OF COLOR... paragraph (c)(1), effective April 27, 2010. For the convenience of the user, the revised text is set forth...

  15. Magnetoreflection studies of ion implanted bismuth

    International Nuclear Information System (INIS)

    Nicolini, C.; Chieu, T.C.; Dresselhaus, M.S.; Massachusetts Inst. of Tech., Cambridge; Dresselhaus, G.


    The effect of the implantation of Sb ions on the electronic structure of the semimetal bismuth is studied by the magnetoreflection technique. The results show long electronic mean free paths and large implantation-induced increases in the band overlap and L-point band gap. These effects are opposite to those observed for Bi chemically doped with Sb. (author)

  16. Thallium-201 myocardial imaging

    International Nuclear Information System (INIS)

    Wackers, F.J.Th.


    Three views are routinely obtained for 201 Tl scintigraphy: 0 0 anterior, 45 0 left-anterior-oblique, both views with the patient supine and a left-lateral view, with the patient lying on his right side. Following intravenous injection of 201 Tl, the scintiscans of a normal subject only demonstrate the left ventricle. In patients with normal myocardial perfusion, the left ventricle appears horseshoe or ovoid in shape. The central area of decreased activity represents the left ventricular cavity and is normal. The accumulation of 201 Tl in the normal left ventricle is usually homogeneous. However, some areas with apparent diminished uptake may occur in the normal subject. These variations of the normal image are discussed. The right ventricle, because of its smaller myocardial mass and relatively less 201 Tl accumulation per gram of tissue, is usually on a resting study not, or only faintly, visualized. However, following exercise, the right ventricle is clearly visualized. (Auth.)

  17. Bismuth( Ⅲ ) Salts: Green Catalysts for Organic Transformations

    Institute of Scientific and Technical Information of China (English)

    C. Le Roux


    @@ 1Introduction Bismuth, the heaviest stable element in the periodic table, stands out from other heavy elements (such as mercury, thallium and lead) due to its relatively non-toxic character which confers on bismuth the enviable status of being an eco-friendly element. Therefore, bismuth and its compounds hold considerable promise as useful catalysts for green chemistry. The research presented in this communication is devoted to the applications of bismuth( Ⅲ ) salts as catalysts for organic transformations.After some general comments about bismuth and a short presentation of the various applications of bismuth( Ⅲ ) salts in organic synthesis, this communication will focus on the works done in our research group during the last several years which deals mainly with electrophilic substitutions. When appropriate, some mechanistic details will be given.

  18. Thermal decomposition synthesis of nanorods bismuth sulphide from bismuth N-ethyl cyclohexyl dithiocarbamate complex

    International Nuclear Information System (INIS)

    Abdullah, Nurul Hidayah; Zainal, Zulkarnain; Silong, Sidik; Tahir, Mohamed Ibrahim Mohamed; Tan, Kar-Ban; Chang, Sook-Keng


    Highlights: • Bismuth N-ethyl cyclohexyl dithiocarbamate was used as single source precursor. • No surfactant was used in the preparation of Bi_2S_3 nanorods. • Pure phase orthorhombic Bi_2S_3 is obtained. • Bismuth sulphide with an average atomic ratio of Bi:S close to 2:3 is obtained. - Abstract: Nanorods of bismuth sulphide were prepared by thermal decomposition of bismuth N-ethyl cyclohexyl dithiocarbamate at different calcination duration. X-ray diffraction (XRD) analysis shows that at 400 °C, the precursor was fully decomposed to orthorhombic bismuth sulphide after 2 h of calcination. Besides, calcination duration does not affect the existence of Bi_2S_3 phase. Field emission scanning electron microscopy (FESEM) and transmission electron microscopy (TEM) analyses reveal that Bi_2S_3 nanorods with an average width ranging from 29–36 nm were obtained. Energy dispersive X-ray (EDX) analysis confirmed the atomic ratio of Bi and S close to 2:3, giving a possible composition of Bi_2S_3. Direct band gap energy of Bi_2S_3 decreases from 1.83 eV to 1.54 eV as calcination time increases.

  19. "Chemical contraction" in rubidium-bismuth melts (United States)

    Khairulin, R. A.; Abdullaev, R. N.; Stankus, S. V.


    The density and thermal expansion of liquid rubidium and rubidium-bismuth alloy containing 25.0 at % Bi were measured by the gamma-ray attenuation technique at temperatures from liquidus to 1000 K. The results of this study were compared with the data obtained by other authors. The molar volume of the Rb75Bi25 melt strongly deviates from the additivity rule for ideal solutions.

  20. Electrocatalytic activity of bismuth doped silver electrodes

    CERN Document Server

    Amjad, M


    Investigation of redox reactions on silver, and bismuth doped silver electrodes in aqueous KOH solutions, by using potentiostatic steady-state polarization technique, has been carried out. The redox wave potential and current displacements along with multiplicity of the latter have been examined. These electrodes were employed for the oxidation of organic molecules such as ethylamine in alkaline media. Subsequently, these electrodes were ranked with respect to their activity for the redox reactions. (author)

  1. Flame spray synthesis under a non-oxidizing atmosphere: Preparation of metallic bismuth nanoparticles and nanocrystalline bulk bismuth metal

    Energy Technology Data Exchange (ETDEWEB)

    Grass, Robert N.; Stark, Wendelin J. [Institute for Chemical and Bioengineering, ETH Zuerich (Switzerland)], E-mail:


    Metallic bismuth nanoparticles of over 98% purity were prepared by a modified flame spray synthesis method in an inert atmosphere by oxygen-deficient combustion of a bismuth-carboxylate based precursor. The samples were characterized by X-ray diffraction, thermal analysis and scanning electron microscopy confirming the formation of pure, crystalline metallic bismuth nanoparticles. Compression of the as-prepared powder resulted in highly dense, nanocrystalline pills with strong electrical conductivity and bright metallic gloss.

  2. Doping of germanium telluride with bismuth tellurides

    International Nuclear Information System (INIS)

    Abrikosov, N.Kh.; Karpinskij, O.G.; Makalatiya, T.Sh.; Shelimova, L.E.


    Effect of germanium telluride doping with bismuth fellurides (Bi 2 Te 3 ; BiTe; Bi 2 Te) on phase transition temperature, lattice parameters and electrophysical properties of alloys is studied. It is shown that in alloys of GeTe-Bi 2 Te 3 (BiTe)(Bi 2 Te) cross sections solid solution of GeTe with Bi 2 Te 3 , characterized by deviation from stoichiometry, and germanium in the second phase the quantity of which increases during the transition from GeTe-Bi 2 Te 3 cross section to GeTe-Bi 2 Te are in equilibrium. Lower values of holes concentration and of electric conductivity and higher values of thermo e.m.f. coefficient in comparison with alloys of GeTe-Bi 2 Te 3 cross section with the same bismuth content are characterized for GeTe-Bi 2 Te cross section alloys. It is shown that in the range of GeTe-base solid solution the α→γ phase transformation which runs trough the two-phase region (α→γ) is observed with tellurium content increase. Extension of α-phase existence region widens with the bismuth content increase. Peculiarities of interatomic interaction in GeTe-base solid solutions with isovalent and heterovalent cation substitution are considered [ru

  3. Effect of excess bismuth on the dielectric and piezoelectric properties of strontium bismuth niobate ceramics

    International Nuclear Information System (INIS)

    Verma, Maya; Tanwar, Amit; Sreenivas, K.


    Excess Bismuth Strontium Bismuth Niobate (Sr 2 Bi 2 Nb 2 O 9 + x wt% Bi 2 O 3 ) ceramics were prepared using conventional solid state reaction method by varying x in the range (x=0%wt - 20%wt). X-ray diffraction studies reveal no significant shift in the peak positions as the Bi content increases from 0.0 to 5%wt. However, at a higher content of Bi beyond x = 5wt% secondary phases relating to Bi 2 O 3 are identified. The c-axis orientation is found to be minimum for SBN ceramic prepared with 5% excess bismuth whereas with further increase in excess Bi 2 O 3 addition during processing, SBN ceramics show a much stronger c-axis orientation. Room temperature dielectric constant measured at 100 KHz is found to increase from 117 to 130 with increase in Bi content from x = 0 to 10wt% suggesting Bi addition has make up for the bismuth losses at higher sintering temperature (1200℃), however with further increase in Bi content (x > 10wt%), the dielectric constant decreases, and could be due to the increased probability of segregation of Bi on the grains of SBN ceramics. The improvement in ferroelectric properties were obtained when the bismuth excess is increased from 0% to 5%. It may be observed that on increasing the excess bismuth to 5%, the transition temperature increases from 424 to 450℃, while further increasing to 10%, transition becomes slightly diffused and phase transition temperature gets decreased to 398℃, which may be due to the formation of secondary phase. 5% excess Bi is found to enhance the dielectric and ferroelectricity properties, and any further increase of Bi in excess (>10%) during processing is found to degrade the electrical and functional properties of SBN. (author)

  4. Effectiveness of ranitidine bismuth citrate and proton pump inhibitor ...

    African Journals Online (AJOL)

    Effectiveness of ranitidine bismuth citrate and proton pump inhibitor based triple therapies of Helicobacter pylori in Turkey. ... Results: When we look at the eradication rates of the treatment groups, only two groups (ranitidine bismuth citrate and rabeprazole groups) had eradication rates greater than 80%, both at intention to ...

  5. Bismuth-silver mineralization in the Sergozerskoe gold occurrence

    Directory of Open Access Journals (Sweden)

    Kalinin A. A.


    Full Text Available Bismuth-silver mineralization attendant to gold mineralization in the Sergozerskoe gold occurrence has been studied in detail. Bi-Ag mineralization is connected with diorite porphyry dykes, which cut volcanic-sedimentary Lopian complexes of the Strel'ninsky greenstone belt – hornblendite and actinolite-chlorite amphibolites, biotite and bi-micaceous gneisses. Distribution of Bi-Ag mineralization similar to gold mineralization is controlled by 80 m thick zone of silicification. Bi minerals are found in brecciated diorite porphyry. Bismuth-silver mineralization includes native metals (bismuth, electrum, silver, tellurides (hedleyite, hessite, selenides (ikunolite, sulfides and sulfosalts of Bi and Ag (matildite, lillianite, eckerite, jalpaite, prustite, acanthite, a few undiagnosed minerals. All Bi and Ag minerals associate with galena. Composition of mineralization evolved from early to late stages of development, depending on intensity of rock alteration. The earliest Bi-Ag minerals were native bismuth and hedleyite formed dissemination in galena, and electrum with 30-45 mass.% Au. Later native bismuth was partly substituted by silver and bismuth sulfosalts and bismuth sulfides. The latest minerals were low-temperature silver sulfides eckerite, jalpaite, and acanthite, which were noted only in the most intensively altered rocks. As soon as the process of formation of Bi-Ag mineralization is the same as formation of gold, findings of bismuth-silver mineralization can serve as a positive exploration sign for gold in the region.

  6. Heat capacity, enthalpy and entropy of bismuth niobate and bismuth tantalate

    Czech Academy of Sciences Publication Activity Database

    Hampl, M.; Strejc, A.; Sedmidubský, D.; Růžička, K.; Hejtmánek, Jiří; Leitner, J.


    Roč. 179, - (2006), s. 77-80 ISSN 0022-4596 Institutional research plan: CEZ:AV0Z10100521 Keywords : heat capacity * heat of formation * heat content * bismuth perovskite Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.107, year: 2006

  7. Heat-Pipe Bismuth Laser; Examination of Laser Action at 4722A in Bismuth Vapor (United States)


    11, 15(1975). of Type 6p 3 -6p 2 7s in the Bismuth Atomic Spectrum in Intermediate Coupling," Acta Physica Polonica A47, 231(1975). 19. A.N. Nesmeyanov...Calculated Transit n Probabilities and Lifetimes for the First Excited Configuration np (n+l)s in the Neutral As, Sb and Bi Atoms, " Physica Scripta

  8. Bismuth X-ray absorber studies for TES microcalorimeters

    International Nuclear Information System (INIS)

    Sadleir, J.E.; Bandler, S.R.; Brekosky, R.P.; Chervenak, J.; Figueroa-Feliciano, E.; Finkbeiner, F.; Iyomoto, N.; Kelley, R.L.; Kilbourne, C.A.; King, J.M.; Porter, F.S.; Robinson, I.K.; Saab, T.; Talley, D.J.


    Bismuth's large atomic number and low carrier density makes it an attractive X-ray absorber material for microcalorimeters. Bismuth's long Fermi wavelength and long mean free paths have motivated much interest in the fabrication of high quality bismuth films to study quantum size effects. Despite such incentives, fabrication of high quality bismuth films has proven difficult, and measured properties of such films are highly variable in the literature. Implementing a bismuth deposition process for TES (superconducting Transition Edge Sensor) device fabrication presents additional challenges particularly at interfaces due to the inherent granularity and surface roughness of its films, its low melting point, and its tendency to diffuse and form undesired intermetallic phases. We report observations of Bi-Cu and Bi-Au diffusion in our devices correlating with large shifts in T c (superconducting transition temperature). Using SEM and in situ R vs T annealing experiments we have been able to study these diffusion processes and identify their activation temperatures

  9. Thallium 201 Scintigraphy (United States)

    McKillop, James H.


    The radioactive isotope thallium 201 behaves physiologically as a potassium analog, and when injected intravenously accumulates rapidly within the cells of many organs. Uptake of the isotope reflects both regional perfusion and sodium-potassium pump activity. The radionuclide emits 80 keV x-rays which are suitable for scintillation camera imaging. The main clinical application of 201TI scintigraphy has been in myocardial imaging. Abnormal uptake of the isotope results in a cold spot on the myocardial image. In patients with coronary artery disease, the differentiation of ischemic and infarcted myocardium is made by comparing images obtained after injecting the radionuclide at the peak of a maximal exercise test with those obtained after injection at rest. Abnormalities due to ischemia usually are seen only on the stress image whereas fixed defects in both rest and stress studies usually indicate areas of infarction or scarring. Some investigators believe that redistribution images obtained four to six hours after stress injection (without administering further 201TI) give the same information as a separate rest study. The sensitivity of stress imaging for detecting significant coronary disease is of the order of 80 percent to 95 percent, though computer processing of the images may be necessary to achieve the higher figure. The prediction of the extent of coronary disease from 201TI images is less reliable. An abnormal 201TI image is not entirely specific for coronary artery disease and the likelihood of an abnormal image being due to this diagnosis varies according to the clinical circumstances. The main clinical value of 201TI myocardial imaging is likely to be in the noninvasive screening of patients with atypical chest pain or with ambiguous findings on stress electrocardiographic tests. It has also proved useful in studying patients with variant angina or following a coronary bypass operation. It is doubtful whether the technique is clinically helpful in most

  10. Bismuth-Based Quadruple Therapy with Bismuth Subcitrate, Metronidazole, Tetracycline and Omeprazole in the Eradication of Helicobacter pylori

    Directory of Open Access Journals (Sweden)

    Raymond Lahaie


    Full Text Available BACKGROUND: A previous study showed that 14 days of qid bismuth-based triple therapy with tetracycline 500 mg, metronidazole 250 mg and colloidal bismuth subcitrate 120 mg resulted in excellent Helicobacter pylori eradication rates (89.5%. The present study looked at a shorter treatment period by adding omeprazole and by reducing the dose of tetracycline.

  11. Quantum oscillations of conductivity in bismuth wires

    International Nuclear Information System (INIS)

    Condrea, Elena


    Measurements of the resistance of bismuth nanowires with several diameters and different quality reveal oscillations on the dependence of resistance under uniaxial strain at T = 4.2 K. Amplitude of oscillations is significant (38 %) at helium temperature and becomes smearing at T = 77 K. Observed oscillations originate from quantum size effect. A simple evaluation of period of oscillations allows us to identify the groups of carriers involved in transport. Calculated periods of 42.2 and 25.9 nm satisfy approximately the ratio 2:1 for two experimentally observed sets of oscillations from light and heavy electrons.

  12. An evaluated neutronic data file for bismuth

    International Nuclear Information System (INIS)

    Guenther, P.T.; Lawson, R.D.; Meadows, J.W.; Smith, A.B.; Smith, D.L.; Sugimoto, M.; Howerton, R.J.


    A comprehensive evaluated neutronic data file for bismuth, extending from 10 -5 eV to 20.0 MeV, is described. The experimental database, the application of the theoretical models, and the evaluation rationale are outlined. Attention is given to uncertainty specification, and comparisons are made with the prior ENDF/B-V evaluation. The corresponding numerical file, in ENDF/B-VI format, has been transmitted to the National Nuclear Data Center, Brookhaven National Laboratory. 106 refs., 10 figs., 6 tabs

  13. Optical Properties of Bismuth Tellurite Based Glass

    Directory of Open Access Journals (Sweden)

    Hooi Ming Oo


    Full Text Available A series of binary tellurite based glasses (Bi2O3x (TeO2100−x was prepared by melt quenching method. The density, molar volume and refractive index increase when bismuth ions Bi3+ increase, this is due to the increased polarization of the ions Bi3+ and the enhanced formation of non-bridging oxygen (NBO. The Fourier transform infrared spectroscopy (FTIR results show the bonding of the glass sample and the optical band gap, Eopt decreases while the refractive index increases when the ion Bi3+ content increases.

  14. Optical Properties of Bismuth Tellurite Based Glass (United States)

    Oo, Hooi Ming; Mohamed-Kamari, Halimah; Wan-Yusoff, Wan Mohd Daud


    A series of binary tellurite based glasses (Bi2O3)x (TeO2)100−x was prepared by melt quenching method. The density, molar volume and refractive index increase when bismuth ions Bi3+ increase, this is due to the increased polarization of the ions Bi3+ and the enhanced formation of non-bridging oxygen (NBO). The Fourier transform infrared spectroscopy (FTIR) results show the bonding of the glass sample and the optical band gap, Eopt decreases while the refractive index increases when the ion Bi3+ content increases. PMID:22605999

  15. Coating compositions comprising bismuth-alloyed zinc

    DEFF Research Database (Denmark)


    The present application discloses (i) a coating composition comprising a particulate zinc-based alloyed material, said material comprising 0.05-0.7% by weight of bismuth (Bi), the D50 of the particulate material being in the range of 2.5-30 µm; (ii) a coated structure comprising a metal structure...... having a first coating of the zinc-containing coating composition applied onto at least a part of the metal structure in a dry film thickness of 5-100 µm; and an outer coating applied onto said zinc-containing coating in a dry film thickness of 30-200 µm; (iii) a particulate zinc-based alloyed material......, wherein the material comprises 0.05-0.7%(w/w) of bismuth (Bi), and wherein the D50 of the particulate material is in the range of 2.5-30 µm; (iv) a composite powder consisting of at least 25%(w/w) of the particulate zinc-based alloyed material, the rest being a particulate material consisting of zinc...

  16. Liquid Lead-Bismuth Materials Test Loop

    International Nuclear Information System (INIS)

    Tcharnotskaia, Valentina; Ammerman, Curtt; Darling, Timothy; King, Joe; Li, Ning; Shaw, Don; Snodgrass, Leon; Woloshun, Keith


    We designed and built the Liquid Lead-Bismuth Materials Test Loop (MTL) to study the materials behavior in a flow of molten lead-bismuth eutectic (LBE). In this paper we present a description of the loop with main components and their functions. Stress distribution in the piping due to sustained, occasional and expansion loads is shown. The loop is designed so that a difference of 100 deg. C can be attained between the coldest and the hottest parts at a nominal flow rate of 8.84 GPM. Liquid LBE flow can be activated by a mechanical sump pump or by natural convection. In order to maintain a self-healing protective film on the surface of the stainless steel pipe, a certain concentration of oxygen has to be maintained in the liquid metal. We developed oxygen sensors and an oxygen control system to be implemented in the loop. The loop is outfitted with a variety of instruments that are controlled from a computer based data acquisition system. Initial experiments include preconditioning the loop, filling it up with LBE, running at uniform temperature and tuning the oxygen control system. We will present some preliminary results and discuss plans for the future tests. (authors)

  17. What is the structure of liquid Bismuth?

    International Nuclear Information System (INIS)

    Caspi, El'ad N; Greenberg, Yaron; Yahel, Eyal; Beuneu, Brigitte; Makov, Guy


    The structure of liquid Bismuth is probably the best-studied among elemental liquid metals because of a combination of the interesting physical properties of Bismuth and its excellent neutron scattering properties. Over the last six decades there have been more than 10 independent studies of the structure of liquid Bi, near the melting temperature. This remarkable number of measurements provides an opportunity to compare these results and to analyze the different sources of error contributing to the calculated pair distribution function. In the present contribution we analyze possible sources of error by varying the analysis procedure for a given measurement. By repeating a previous measurement in a new experimental configuration we demonstrate that an invariant (i.e. up to an absolute error) structure factor can be obtained. Transforming the structure factor into the radial distribution introduces new sources of error which causes the scatter to be greater than that required to resolve issues such as the existence of liquid-liquid phase transitions in Bi and to obtain correlation between thermo-physical properties and structure. We consider the contribution of different parameters when transforming the structure factor to the radial distribution function.

  18. Study of point defects in bismuth

    International Nuclear Information System (INIS)

    Bois, P.


    Single crystalline samples of bismuth, pure and n or p - doped by adding tellurium or tin, were electron irradiated at low temperature (4.2 K and 20 K). In the energy range 0.7 - 2.5 MeV, a displacement threshold energy of 13 eV and an athermal recombination volume of 150 atomic volumes were determined. Joint measurements of resistivity, magnetotransport and positron annihilation enabled to precised the nature of the annealing stages: 40-50 K, free migration of interstitials; 90-120 K long range migration of vacancy. Point defects have according to their nature a different effect on the electronic properties of bismuth: isolated Frenkel pairs are globally donnors with a charge of + 0.16 e- and the vacancy is donnor, which seems to attribute to it a negative formation volume. A simple model with non-deformating bands is no longer sufficient to explain the behaviour under irradiation: one has to take into account an acceptor level with a charge of - 0,27 e-, linked to the cascade-type defects and resonating with the valence band. It's position in the band overlap and it's width (8 meV) could be precised. In first approximation this coupling with less mobile carriers does not affect the simple additive rule which exists for relaxation times. Some yet obscure magnetic properties seem to be linked to this defect level [fr

  19. Development of lead-bismuth coolant technology for nuclear device

    International Nuclear Information System (INIS)

    Kamata, Kin-ya; Kitano, Teruaki; Ono, Mikinori


    Liquid lead-bismuth is a promising material as a future fast reactor coolant or an intensive neutron source material for accelerator driven transmutation system (ADS). To develop nuclear plants and their installations using lead-bismuth coolant for practical use, both coolant technologies, inhabitation process of steels and quality control of coolant, and total operation system for liquid lead-bismuth plants are required. Based on the experience of liquid metal coolant, Mitsui Engineering and Shipbuilding Co., Ltd. (MES) has completed the liquid lead-bismuth forced circulation loop and has acquired various engineering data on main components including economizer. As a result of tis operation, MES has developed key technologies of lead-bismuth coolant such as controlling of oxygen content in lead-bismuth and a purification of lead-bismuth coolant. MES participated in the national project, ''The Development of Accelerator Driven Transmutation System'', together with JAERI (Japan Atomic Energy Research Institute) and started corrosion test for beam window of ADS. (author)

  20. 201Tl heart studies

    International Nuclear Information System (INIS)

    Bell, R.L.


    At the annual meeting of the Society of Nuclear Medicine there was a preponderance of papers dealing with the heart. The most impressive papers detailed the use of monovalent cation 201 Tl in the evaluation of coronary artery disease. Thallium-201 behaves like potassium in that it enters heart muscle quickly and persists in that organ for several hours. It is unlike most radioactive potassium analogues used for heart studies in that: (1) its gamma energy peaks (69 keV and 80 keV) are more easily collimated with resultant image improvement, (2) its physical half life of 72 hours is sufficiently short to attain high counting rates without too much radiation and is sufficiently long so that storage is not prohibitive, (3) its short half life and lack of Beta radiation results in lower radiation to the patient, and (4) its uptake in heart is greater and uptake in liver and stomach less than other potassium analogues

  1. Properties of Nanostructure Bismuth Telluride Thin Films Using Thermal Evaporation

    Directory of Open Access Journals (Sweden)

    Swati Arora


    Full Text Available Bismuth telluride has high thermoelectric performance at room temperature; in present work, various nanostructure thin films of bismuth telluride were fabricated on silicon substrates at room temperature using thermal evaporation method. Tellurium (Te and bismuth (Bi were deposited on silicon substrate in different ratio of thickness. These films were annealed at 50°C and 100°C. After heat treatment, the thin films attained the semiconductor nature. Samples were studied by X-ray diffraction (XRD and scanning electron microscopy (SEM to show granular growth.

  2. Process for producing thallium-201

    International Nuclear Information System (INIS)

    Ageev, V.A.; Kljucnikov, A.A.; Linev, A.F.; Chalkin, V.A.; Zajceva, N.G.


    A storage plate of pure Pb-206 enriched up to 95% is irradiated with a 50 to 70 MeV proton beam. The plate is then dissolved in acid, and the Th-201 contained in the solution is oxydated and precipitated from the Pb solution. Traces of Pb retained in the solution are separated from the Th-201 by cation exchange, and the Th-201 is eluated using hydrochloric acid. (orig./PW) [de

  3. Ultrasonic investigations of some bismuth borate glasses doped with ...

    Indian Academy of Sciences (India)

    Keywords. Bismuth borate glasses; elastic moduli; Makishima–Mackenzie model. 1. Introduction ... former because of the small field strength of Bi3+ ion. Bi2O3 ..... Typically, when the material undergoes a phase change, the value of the.

  4. Studies on bismuth carboxylates—synthesis and characterization of ...

    Indian Academy of Sciences (India)

    crystalline modification (4 ) of the previously reported coordination polymer, bismuth tris(picolinate), [Bi(2– .... no significant change in the IR spectrum or the melting behaviour between 4 .... lens et al.7 There are moderate differences in the.

  5. Synthesis and characterization of superconducting bismuthates

    International Nuclear Information System (INIS)

    Tang, Horngyi.


    A new electrosynthetic technique for low-temperature crystal growth of superconducting bismuthates was developed, and its utility demonstrated by growing various high-quality BiO 3 crystals. The crystals of Ba 1-x K x BiO 3 and Ba 1-x Rb x BiO 3 display their T c onset at 31.8k and 28k, respectively, using SQUID magnetometry. The structure of a KBiO 3 x H 2 O single crystal determined by single crystal x-ray diffraction confirms previous results from powder samples that it is isostructural with KSbO 3 . The crystals of Ba 1-x Cs x BiO 3 do not show superconductivity to 4k. Chemical vapor-transport experiments leading to the fabrication of MoS 2 /WSe 2 junctions were also performed and are described in detail

  6. Flotation atomic absorption determination of bismuth in nonferrous metal alloys

    International Nuclear Information System (INIS)

    Ososkov, V.K.; Plintus, A.M.; Kornelli, M.Eh.; Zakhariya, A.N.; Lozanova, E.V.


    Technique of flotation concentration and atomic absorption determination of bismuth microquantities in alloys on the basis of copper and zinc has been developed. Fine-dispersed EhDEh-10P anionite was used as a carrier in flotation concentration. State standard samples (SSS) of brasses and German silver were used as analysed objects. Effect of macrocomponents on the results of bismuth content determination has been studied. Satisfactory coincidence of the results obtained and SSS certificates is shown

  7. Platinum-Bismuth Bimetallic Catalysts: Synthesis, Characterization and Applications


    Saucedo, Jose A, Jr; Xiao, Yang; Varma, Arvind


    Bimetallic catalysts have been explored and shown to exhibit unique characteristics which are not present in monometallic catalysts. Platinum is well known as an effective catalyst for oxidation and reduction reactions, and it can be made more effective when bismuth is introduced as a promotor. Thus, the effectiveness of the Pt-Bi catalyst was demonstrated in prior work. What is not clear, however, is the mechanism behind the catalyst function; why addition of bismuth to platinum decreases de...

  8. In situ electron beam irradiated rapid growth of bismuth nanoparticles in bismuth-based glass dielectrics at room temperature

    International Nuclear Information System (INIS)

    Singh, Shiv Prakash; Karmakar, Basudeb


    In this study, in situ control growth of bismuth nanoparticles (Bi 0 NPs) was demonstrated in bismuth-based glass dielectrics under an electron beam (EB) irradiation at room temperature. The effects of EB irradiation were investigated in situ using transmission electron microscopy (TEM), selected-area electron diffraction and high-resolution transmission electron microscopy. The EB irradiation for 2–8 min enhanced the construction of bismuth nanoparticles with a rhombohedral structure and diameter of 4–9 nm. The average particle size was found to increase with the irradiation time. Bismuth metal has a melting point of 271 °C and this low melting temperature makes easy the progress of energy induced structural changes during in situ TEM observations. This is a very useful technique in nano-patterning for integrated optics and other applications.

  9. Main: PPD201 [AT Atlas

    Lifescience Database Archive (English)

    Full Text Available PPD201 PPD2 Overexpression of mammal origin membrane protein by high-density cultur...roaki Kato Graduate School of Pharmaceutical Sciences, Kyoto University Nat Protoc (2006)|Protein Expr. Purif. (2009)|Biotechnol. Prog. (1996) 17406338|8845106|18984054 PPD201.csml ...

  10. Thallium-201 infusion imaging

    International Nuclear Information System (INIS)

    Alazraki, N.; Kralios, A.; Wooten, W.W.


    To test the accuracy of Thallium-201 coronary artery infusion imaging of the earth during rapid changes in blood flow through a major coronary artery, the author performed a study in dogs correlating electromagnetic flow probe recordings with 201 Tl scintillation camera acquisitions. Hyperemic vascular response was produced experimentally in a major coronary artery by occlusion and release interventions which altered flow from baseline to zero during occlusion (20 seconds), followed by rapid flow increases approaching three times baseline immediately upon release of the occlusion. Flow returned to the baseline level within 60 seconds following release. Flow was also altered in a controlled fashion by other interventions. Recordings of Thallium uptake in the myocardium were displayed as a time histogram (counts per second squared vs time) which correlated very closely with electromagnetic flow probe recordings of flow (R=o.82-0.97). These experiments demonstrate a high degree of accuracy in Thallium infusion imaging to detect rapid changes in flow through a major coronary artery

  11. Bismuth ferrite as low-loss switchable material for plasmonic waveguide modulator

    DEFF Research Database (Denmark)

    Babicheva, Viktoriia; Zhukovsky, Sergei; Lavrinenko, Andrei


    We propose new designs of plasmonic modulators, which can beused for dynamic signal switching in photonic integrated circuits. We studyperformance of a plasmonic waveguide modulator with bismuth ferrite as atunable material. The bismuth ferrite core is sandwiched between metalplates (metal...

  12. 7 CFR 201.42 - Small containers. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Small containers. 201.42 Section 201.42 Agriculture... REGULATIONS Sampling in the Administration of the Act § 201.42 Small containers. In sampling seed in small containers that it is not practical to sample as required in § 201.41, a portion of one unopened container or...

  13. 43 CFR 20.201 - Ethics officials. (United States)


    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Ethics officials. 20.201 Section 20.201... Department Ethics Program § 20.201 Ethics officials. (a) Designated Agency Ethics Official refers to the official designated under 5 CFR 2638.201 to coordinate and manage the Department's ethics program. (b) The...

  14. Controlled synthesis of bismuth oxyiodide toward optimization of photocatalytic performance

    Energy Technology Data Exchange (ETDEWEB)

    Liao, Chenxing; Ma, Zhijun [State Key Laboratory of Luminescent Materials and Devices, School of Materials Science and Engineering, South China University of Technology, Wushan Road 381, Guangzhou 510641 (China); Chen, Xiaofeng, E-mail: [Biomaterials Research Institute, School of Materials Science and Engineering, South China University of Technology, Wushan Road 381, Guangzhou 510641 (China); He, Xin [School of Applied Physics and Materials, Wuyi University, Jiangmen 529020 (China); Qiu, Jianrong, E-mail: [State Key Laboratory of Luminescent Materials and Devices, School of Materials Science and Engineering, South China University of Technology, Wushan Road 381, Guangzhou 510641 (China)


    Highlights: • Different bismuth oxyiodide was synthesized. • The hollow Bi{sub 4}O{sub 5}I{sub 2} microspheres was obtained. • Formation mechanism of the hollow structure was discussed in detail. - Abstract: A new investigation on the variation rule of the structure, morphology, chemical composition and photocatalytic performance of bismuth oxyiodide synthesized by solvothermal method as a function of reaction conditions was performed here. The composition and morphology of the product could be determined by X-ray diffraction, thermogravimetric analysis and scanning electron microscopy. The results revealed that the particle size together with content of iodide in bismuth oxyiodide decrease with the increase of the concentration of reaction precursors. Hollow Bi{sub 4}O{sub 5}I{sub 2} microsphere with specific surface area as high as 120.88 m{sup 2} g{sup −1} can be easily synthesized when the concentration of the reaction precursors finally increased to 62.5 mM. Photocatalytic water purification performance of the as-prepared samples was evaluated by using Rhodamine B (RhB) as a model contaminant. The results revealed that the hollow Bi{sub 4}O{sub 5}I{sub 2} exhibited the best performance among all the bismuth oxyodide synthesized here for the degradation of RhB under visible light irradiation. Meanwhile, the formation mechanism of the hierarchical hollow structure of bismuth oxyiodide was investigated by the dissolution-recrystallization mechanism.

  15. Lead- or Lead-bismuth-cooled fast reactors

    International Nuclear Information System (INIS)

    Bouchter, J.C.; Courouau, J.L.; Dufour, P.; Guidez, J.; Latge, C.; Martinelli, L.; Renault, C.; Rimpault, G.


    Lead-cooled fast reactors are one of the 6 concepts retained for the 4. generation of nuclear reactors. So far no lead-cooled reactors have existed in the world except lead-bismuth-cooled reactors in soviet submarines. Some problems linked to the use of the lead-bismuth eutectic appeared but were satisfactorily solved by a more rigorous monitoring of the chemistry of the lead-bismuth coolant. Lead presents various advantages as a coolant: no reactivity with water and the air,a high boiling temperature and low contamination when irradiated. The main asset of the lead-bismuth alloy is the drop of the fusion temperature from 327 C degrees to 125 C degrees. The main drawback of using lead (or lead-bismuth) is its high corrosiveness with metals like iron, chromium and nickel. The high corrosiveness of the coolant implies low flow velocities which means a bigger core and consequently a bigger reactor containment. Different research programs in the world (in Europe, Russia and the USA) are reviewed in the article but it appears that the development of this type of reactor requires technological breakthroughs concerning materials and the resistance to corrosion. Furthermore the concept of lead-cooled reactors seems to be associated to a range of low output power because of the compromise between the size of the reactor and its resistance to earthquakes. (A.C.)

  16. Oxygen holes and hybridization in the bismuthates (United States)

    Khazraie, Arash; Foyevtsova, Kateryna; Elfimov, Ilya; Sawatzky, George A.


    Motivated by the recently renewed interest in the superconducting bismuth perovskites, we investigate the electronic structure of the parent compounds A BiO3 (A = Sr, Ba) using ab initio methods and tight-binding (TB) modeling. We use the density functional theory (DFT) in the local density approximation (LDA) to understand the role of various interactions in shaping the A BiO3 band structure near the Fermi level. It is established that interatomic hybridization involving Bi-6 s and O-2 p orbitals plays the most important role. Based on our DFT calculations, we derive a minimal TB model and demonstrate that it can describe the properties of the band structure as a function of lattice distortions, such as the opening of a charge gap with the onset of the breathing distortion and the associated condensation of holes onto a1 g-symmetric molecular orbitals formed by the O-2 pσ orbitals on collapsed octahedra. We also derive a single band model involving the hopping of an extended molecular orbital involving both Bi-6 s and a linear combination of six O-2 p orbitals which provides a very good description of the dispersion and band gaps of the low energy scale bands straddling the chemical potential.

  17. Tunneling in cuprate and bismuthate superconductors

    International Nuclear Information System (INIS)

    Zasadzinski, J.F.; Huang, Qiang; Tralshawala, N.


    Tunneling measurements using a point-contact technique are reported for the following high temperature superconducting oxides: Ba 1-x K x BiO 3 (BKBO), Nd 2-x Ce x CuO 4 (NCCO), Bi 2 Sr 2 CaCu 2 O 7 (BSCCO) and Tl 2 Ba 2 CaCu 2 O x (TBCCO). For the bismuthate, BKBO, ideal, S-I-N tunneling characteristics are observed using a Au tip. The normalized conductance is fitted to a BCS density of states and thermal smearing only proving there is no fundamental limitation in BKBO for device applications. For the cuprates, the normalized conductance displays BCS-like characteristics, but with a broadening larger than from thermal smearing. Energy gap values are presented for each material. For BKBO and NCCO the Eliashberg functions, α 2 F(ω), obtained from the tunneling are shown to be in good agreement with neutron scattering results. Proximity effect tunneling studies are reported for Au/BSCCO bilayers and show that the energy gap of BSCCO can be observed through Au layers up to 600 Angstrom thick

  18. Use of Russian technology of ship reactors with lead-bismuth coolant in nuclear power

    International Nuclear Information System (INIS)

    Zrodnikov, A.V.; Chitaykin, V.I.; Gromov, B.F.; Grigoryv, O.G.; Dedoul, A.V.; Toshinsky, G.I.; Dragunov, Yu.G.; Stepanov, V.S.


    The experience of using lead-bismuth coolant in Russian nuclear submarine reactors has been presented. The fundamental statements of the concept of using the reactors cooled by lead-bismuth alloy in nuclear power have been substantiated. The results of developments for using lead bismuth coolant in nuclear power have been presented. (author)

  19. Prognostic Value of Bismuth Typing and Modified T-stage in Hilar Cholangiocarcinoma

    Directory of Open Access Journals (Sweden)

    Shengen Yi


    Conclusion: The majority of our patients with HCC were characterized as Subtype IV in Bismuth typing and Stage T3 in modified T-stage. Both Bismuth typing and modified T-stage showed prognostic value in HCC. Compared with Bismuth typing, modified T-stage is a better indicator of the resectability of HCC.

  20. Microstructure and electrical properties of bismuth and bismuth oxide deposited by magnetron sputtering UBM

    International Nuclear Information System (INIS)

    Otalora B, D. M.; Dussan, A.; Olaya F, J. J.


    In this work, bismuth (Bi) and bismuth oxide (Bi 2 O 3 ) thin films were prepared, at room temperature, by Sputtering Unbalanced Magnetron (UBM - Unbalance Magnetron) technique under glass substrates. Microstructural and electrical properties of the samples were studied by X-ray diffraction (XRD) and System for Measuring Physical Properties - PPMS (Physical Property Measurement System). Dark resistivity of the material was measured for a temperature range between 100 and 400 K. From the XRD measurements it was observed a polycrystalline character of the Bi associated to the presence of phases above the main peak, 2θ = 26.42 grades and a growth governed by a rhombohedral structure. Crystal parameters were obtained for both compounds, Bi and Bi 2 O 3 . From the analysis of the spectra of the conductivity as a function of temperature, it was established that the transport mechanism that governs the region of high temperature (T>300 K) is thermally activated carriers. From conductivity measurements the activation energies were obtained of 0.0094 eV and 0.015 eV for Bi 2 O 3 and Bi, respectively. (Author)

  1. Bismuth iron oxide thin films using atomic layer deposition of alternating bismuth oxide and iron oxide layers

    Energy Technology Data Exchange (ETDEWEB)

    Puttaswamy, Manjunath; Vehkamäki, Marko [University of Helsinki, Department of Chemistry, P.O. Box 55, FI-00014 Helsinki (Finland); Kukli, Kaupo, E-mail: [University of Helsinki, Department of Chemistry, P.O. Box 55, FI-00014 Helsinki (Finland); University of Tartu, Institute of Physics, W. Ostwald 1, EE-50411 Tartu (Estonia); Dimri, Mukesh Chandra [National Institute of Chemical Physics and Biophysics, Akadeemia tee 23, EE-12618 Tallinn (Estonia); Kemell, Marianna; Hatanpää, Timo; Heikkilä, Mikko J. [University of Helsinki, Department of Chemistry, P.O. Box 55, FI-00014 Helsinki (Finland); Mizohata, Kenichiro [University of Helsinki, Department of Physics, P.O. Box 64, FI-00014 Helsinki (Finland); Stern, Raivo [National Institute of Chemical Physics and Biophysics, Akadeemia tee 23, EE-12618 Tallinn (Estonia); Ritala, Mikko; Leskelä, Markku [University of Helsinki, Department of Chemistry, P.O. Box 55, FI-00014 Helsinki (Finland)


    Bismuth iron oxide films with varying contributions from Fe{sub 2}O{sub 3} or Bi{sub 2}O{sub 3} were prepared using atomic layer deposition. Bismuth (III) 2,3-dimethyl-2-butoxide, was used as the bismuth source, iron(III) tert-butoxide as the iron source and water vapor as the oxygen source. The films were deposited as stacks of alternate Bi{sub 2}O{sub 3} and Fe{sub 2}O{sub 3} layers. Films grown at 140 °C to the thickness of 200–220 nm were amorphous, but crystallized upon post-deposition annealing at 500 °C in nitrogen. Annealing of films with intermittent bismuth and iron oxide layers grown to different thicknesses influenced their surface morphology, crystal structure, composition, electrical and magnetic properties. Implications of multiferroic performance were recognized in the films with the remanent charge polarization varying from 1 to 5 μC/cm{sup 2} and magnetic coercivity varying from a few up to 8000 A/m. - Highlights: • Bismuth iron oxide thin films were grown by atomic layer deposition at 140 °C. • The major phase formed in the films upon annealing at 500 °C was BiFeO{sub 3}. • BiFeO{sub 3} films and films containing excess Bi favored electrical charge polarization. • Slight excess of iron oxide enhanced saturative magnetization behavior.

  2. Characterization of bismuth nanospheres deposited by plasma focus device

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, M., E-mail: [IBA Laboratory, Chemistry Department, Atomic Energy Commission of Syria, P.O. Box 6091, Damascus (Syrian Arab Republic); Al-Hawat, Sh.; Akel, M. [Physics Department, Atomic Energy Commission of Syria, P.O. Box 6091, Damascus (Syrian Arab Republic); Mrad, O. [Chemistry Department, Atomic Energy Commission of Syria, P.O. Box 6091, Damascus (Syrian Arab Republic)


    A new method for producing thin layer of bismuth nanospheres based on the use of low energy plasma focus device is demonstrated. Various techniques such as scanning electron microscopy, Rutherford backscattering spectroscopy, X-ray diffraction, X-ray photoelectron spectroscopy, and Raman spectroscopy have been used to characterize the morphology and the composition of the nanospheres. Experimental parameters may be adjusted to favour the formation of bismuth nanospheres instead of microspheres. Therefore, the formation of large surface of homogeneous layer of bismuth nanospheres with sizes of below 100 nm can be obtained. The natural snowball phenomenon is observed to be reproduced in nanoscale where spheres roll over the small nanospheres and grow up to bigger sizes that can reach micro dimensions. The comet-like structure, a reverse phenomenon to snowball is also observed.

  3. Inexpensive laser-induced surface modification in bismuth thin films

    Energy Technology Data Exchange (ETDEWEB)

    Contreras, A. Reyes [Facultad de Ciencias, Universidad Autónoma del Estado de México, Carretera Toluca, Ixtlahuaca Kilómetro 15.5, C.P. 50200 Edo. de México (Mexico); Hautefeuille, M., E-mail: [Facultad de Ciencias, Universidad Nacional Autónoma de México, Avenida Universidad 3000, Circuito Exterior S/N, Coyoacán, Ciudad Universitaria, C.P. 04510 D.F. Mexico (Mexico); García, A. Esparza [Fotofísica y Películas Delgadas, Departamento de Tecnociencias, CCADET-UNAM, Circuito exterior s/n C.P. 04510 Cd. Universitaria, D.F. Mexico (Mexico); Mejia, O. Olea [Centro Conjunto de Investigación en Química Sustentable UAEM-UNAM, Carretera Toluca-Atlacomulco, Km 14.5, Unidad El Rosedal, 50200 San Cayetano, Estado de México (Mexico); López, M.A. Camacho [Facultad de Química, Universidad Autónoma del Estado de México, Tollocan s/n, esq. Paseo Colón, Toluca, Estado de México 50110 (Mexico)


    Highlights: • Laser-induced microbumps were formed on bismuth films using a simple, low-cost, laser setup. • The patterns, similar to those typically obtained with high-power lasers, were characterized. • Control of laser ablation conditions is critical in the fabrication of surface microbumps. - Abstract: In this work, we present results on texturing a 500 nm thick bismuth film, deposited by sputtering onto a glass slide using a low-cost homemade, near-infrared pulsed laser platform. A 785 nm laser diode of a CD–DVD pickup head was precisely focused on the sample mounted on a motorized two-axis translation stage to generate localized surface microbumps on the bismuth films. This simple method successfully transferred desired micropatterns on the films in a computer-numerical control fashion. Irradiated zones were characterized by atomic force microscopy and scanning electron microscopy. It was observed that final results are strongly dependent on irradiation parameters.

  4. Characterization of bismuth nanospheres deposited by plasma focus device

    International Nuclear Information System (INIS)

    Ahmad, M.; Al-Hawat, Sh.; Akel, M.; Mrad, O.


    A new method for producing thin layer of bismuth nanospheres based on the use of low energy plasma focus device is demonstrated. Various techniques such as scanning electron microscopy, Rutherford backscattering spectroscopy, X-ray diffraction, X-ray photoelectron spectroscopy, and Raman spectroscopy have been used to characterize the morphology and the composition of the nanospheres. Experimental parameters may be adjusted to favour the formation of bismuth nanospheres instead of microspheres. Therefore, the formation of large surface of homogeneous layer of bismuth nanospheres with sizes of below 100 nm can be obtained. The natural snowball phenomenon is observed to be reproduced in nanoscale where spheres roll over the small nanospheres and grow up to bigger sizes that can reach micro dimensions. The comet-like structure, a reverse phenomenon to snowball is also observed

  5. MES lead bismuth forced circulation loop and test results

    International Nuclear Information System (INIS)

    Ono, Mikinori; Mine, Tatsuya; Kitano, Teruaki; Kamata, Kin-ya


    Liquid lead-bismuth is a promising material as future reactor coolant or intensive neutron source material for accelerator driven system (ADS). Mitsui Engineering and Shipbuilding Co., Ltd. (MES) completed lead-bismuth coolant (LBC) forced circulation loop in May 2001 and acquired engineering data on economizer, electro magnetic pump, electro magnetic flow meter and so on. For quality control of LBC, oxygen sensor and filtering element are developing using some hydrogen and moisture mixed gases. Structural materials corrosion test for accelerator driver system (ADS) will start soon. And thermal hydraulic test for ADS will start in tree years. (author)

  6. Hydrolysis studies on bismuth nitrate: synthesis and crystallization of four novel polynuclear basic bismuth nitrates. (United States)

    Miersch, L; Rüffer, T; Schlesinger, M; Lang, H; Mehring, M


    Hydrolysis of Bi(NO(3))(3) in aqueous solution gave crystals of the novel compounds [Bi(6)O(4)(OH)(4)(NO(3))(5)(H(2)O)](NO(3)) (1) and [Bi(6)O(4)(OH)(4)(NO(3))(6)(H(2)O)(2)]·H(2)O (2) among the series of hexanuclear bismuth oxido nitrates. Compounds 1 and 2 both crystallize in the monoclinic space group P2(1)/n but show significant differences in their lattice parameters: 1, a = 9.2516(6) Å, b = 13.4298(9) Å, c = 17.8471(14) Å, β = 94.531(6)°, V = 2210.5(3) Å(3); 2, a = 9.0149(3) Å, b = 16.9298(4) Å, c = 15.6864(4) Å, β = 90.129(3)°, V = 2394.06(12) Å(3). Variation of the conditions for partial hydrolysis of Bi(NO(3))(3) gave bismuth oxido nitrates of even higher nuclearity, [{Bi(38)O(45)(NO(3))(24)(DMSO)(26)}·4DMSO][{Bi(38)O(45)(NO(3))(24)(DMSO)(24)}·4DMSO] (3) and [{Bi(38)O(45)(NO(3))(24)(DMSO)(26)}·2DMSO][{Bi(38)O(45)(NO(3))(24)(DMSO)(24)}·0.5DMSO] (5), upon crystallization from DMSO. Bismuth oxido clusters 3 and 5 crystallize in the triclinic space group P1 both with two crystallographically independent molecules in the asymmetric unit. The following lattice parameters are observed: 3, a = 20.3804(10) Å, b = 20.3871(9) Å, c = 34.9715(15) Å, α = 76.657(4)°, β = 73.479(4)°, γ = 60.228(5)°, V = 12021.7(9) Å(3); 5, a = 20.0329(4) Å, b = 20.0601(4) Å, c = 34.3532(6) Å, α = 90.196(1)°, β = 91.344(2)°, γ = 119.370(2)°, V = 12025.8(4) Å(3). Differences in the number of DMSO molecules (coordinated and noncoordinated) and ligand (nitrate, DMSO) coordination modes are observed.

  7. Bismuth oxyfluoride @ CMK-3 nanocomposite as cathode for lithium ion batteries (United States)

    Ni, Dan; Sun, Wang; Xie, Liqiang; Fan, Qinghua; Wang, Zhenhua; Sun, Kening


    Bismuth oxyfluoride impregnated CMK-3 nanocomposite is synthesized by a facile nanocasting approach. Mesoporous carbon CMK-3 can suppress the aggregation and growth of bismuth oxyfluoride particles and offer rapid electron and Li ion passageways. Bismuth oxyfluoride nanoparticles are embedded in the mesoporous channels with particle size less than 20 nm. The bismuth oxyfluoride@CMK-3 nanocomposite maintains 148 mA h g-1 after 40 cycles with the capacity from both the bismuth oxyfluoride and the functional groups on the mesoporous carbon. The hybrid with confined bismuth oxyfluoride nanoparticles, conductive carbon network, and oxygen functional groups on the carbon matrix exhibits higher capacity and cycling stability than bulk bismuth oxyfluoride particles when used as lithium ion batteries cathode.

  8. Temperature gradient compatibility tests of some refractory metals and alloys in bismuth and bismuth--lithium solutions

    International Nuclear Information System (INIS)

    DiStefano, J.R.; Cavin, O.B.


    Quartz, T-111, and Mo thermal-convection loop tests were conducted at temperatures up to 700 0 C (100 0 C ΔT) to determine the compatibility of several refractory metals/alloys with bismuth and bismuth-lithium solutions for molten salt breeder reactor applications. Methods of evaluation included weight change measurements, metallographic examination, chemical and electron microprobe analysis, and mechanical properties tests. Molybdenum, T-111, and TA--10 percent W appear to be the most promising containment materials, while niobium and iron-based alloys are unacceptable

  9. 24 CFR 100.201 - Definitions. (United States)


    ... at § 100.201a), ICC/ANSI A117.1-1998 (incorporated by reference at § 100.201a), CABO/ANSI A117.1-1992... (incorporated by reference at § 100.201a), ICC/ANSI A117.1-1998 (incorporated by reference at § 100.201a), CABO... (incorporated by reference at § 100.201a), CABO/ANSI A117.1-1992 (incorporated by reference at § 100.201a), ANSI...

  10. Myocardial scintigraphy with thallium-201

    International Nuclear Information System (INIS)

    Schwaiger, M.; Silber, S.; Klein, U.; Rudolph, W.


    Thallium-201 myocardial scintigraphy is an important non-invasive method for assessment of coronary artery disease. Other applications of the method such as delineation of the right ventricular free wall in right ventricular overload, or the detection of hypertrophic cardiomyopathies or myocardial infiltrations are of subordinate importance. In heart disease such as congestive cardiomyopathy and mitral valve prolapse thallium-201 uptake defects have been described, the clinical implications of these findings, however, cannot be adequately interpreted at this time. Myocardial uptake of thallium-201 is an active process, dependent on and proportional to perfusion. Differentiation between myocardial ischemia and myocardial scar is based on the presence or absence of thallium-201 'redistribution'. That is, in the presence of acute reversible ischemia there is increased thallium-201 uptake in the post-ischemic phase in previously hypoperfused myocardium and, subsequently, equilibrium of the initially registered activity differences. 'Redistribution' has also been described in the resting scintigram of patients with severe coronary artery disease and chronic hypoperfusion. (orig.) [de

  11. Measured and evaluated neutron cross sections of elemental bismuth

    International Nuclear Information System (INIS)

    Smith, A.; Guenther, P.; Smith, D.; Whalen, J.; Howerton, R.


    Neutron total cross sections of elemental bismuth are measured with broad resolution from 1.2 to 4.5 MeV to accuracies of approx. = 1%. Neutron-differential-elastic-scattering cross sections of bismuth are measured from 1.5 to 4.0 MeV at incident neutron energy intervals of approx.< 0.2 MeV over the scattered-neutron angular range approx. = 20 to 160 deg. Differential neutron cross sections for the excitation of observed states in bismuth at 895 +- 12, 1606 +- 14, 2590 +- 15, 2762 +- 29, 3022 +- 21, and 3144 +- 15 keV are determined at incident neutron energies up to 4.0 MeV. An optical-statistical model is deduced from the measured values. This model, the present experimental results, and information available elsewhere in the literature are used to construct a comprehensive evaluated nuclear data file for elemental bismuth in the ENDF format. The evaluated file is particularly suited to the neutronic needs of the fusion-fission hybrid designer. 87 references, 10 figures, 6 tables

  12. The reduction of background signal in bismuth germanate scintillators

    International Nuclear Information System (INIS)

    Lewis, T.A.


    Bismuth germanate (BGO) is one of several new scintillator materials developed in recent years. It has similar energy resolution (6-8%) to sodium iodide (NaI) but it is non-hygroscopic, has a much better Peak-to-Compton ratio and a stopping power about 2.3 times greater than NaI. For counting activated foils it represents an improvement on NaI for high efficiency counting where the resolution of a germanium spectrometer is not required. Two scintillators bought for this purpose were found to have a higher than expected background signal between 500 keV and 2 MeV which was traced to Bi207, an active isotope of bismuth with a 38 year half-life and not listed as occurring naturally. Reference to the manufacturer showed all crystals to be similarly contaminated. It is speculated that this active isotope arises from cosmic proton activation of associated lead in the ore from which the bismuth is extracted. Although not confirmed rigorously it has been shown that bismuth extracted from ore with a low lead content does not contain Bi207. Scintillators have been manufactured from uncontaminated material and reductions in the background signal of more than an order of magnitude have been achieved. This reduction will be of immediate benefit for monitoring nickel foils (fast flux monitors) activated in zero-energy reactors and should also permit the exploitation of other low probability reactions previously not thought to be feasible. (author)

  13. Short-term static corrosion tests in lead-bismuth (United States)

    Soler Crespo, L.; Martín Muñoz, F. J.; Gómez Briceño, D.


    Martensitic steels have been proposed to be used as structural materials and as spallation target window in hybrid systems devoted to the transmutation of radioactive waste of long life and high activity. However, their compatibility with lead-bismuth in the operating conditions of these systems depends on the existence of a protective layer such as an oxide film. The feasibility of forming and maintaining an oxide layer or maintaining a pre-oxidised one has been studied. Martensitic steel F82Hmod. (8% Cr) has been tested in lead-bismuth under static and isothermal conditions at 400°C and 600°C. In order to study the first stages of the interaction between the steel and the eutectic, short-term tests (100 and 665 h) have been carried out. Pre-oxidised and as-received samples have been tested in atmospheres with different oxidant potential. For low oxygen concentration in lead-bismuth due to unexpected oxygen consumption in the experimental device, dissolution of as-received F82Hmod. occurs and pre-oxidation does not prevent the material dissolution. For high oxygen concentration, the pre-oxidation layer seems to improve the feasibility of protecting stainless steels controlling the oxygen potential of lead-bismuth with a gas phase.

  14. Short-term static corrosion tests in lead-bismuth

    International Nuclear Information System (INIS)

    Soler Crespo, L.; Martin Munoz, F.J.; Gomez Briceno, D.


    Martensitic steels have been proposed to be used as structural materials and as spallation target window in hybrid systems devoted to the transmutation of radioactive waste of long life and high activity. However, their compatibility with lead-bismuth in the operating conditions of these systems depends on the existence of a protective layer such as an oxide film. The feasibility of forming and maintaining an oxide layer or maintaining a pre-oxidised one has been studied. Martensitic steel F82Hmod. (8% Cr) has been tested in lead-bismuth under static and isothermal conditions at 400 o C and 600 o C. In order to study the first stages of the interaction between the steel and the eutectic, short-term tests (100 and 665 h) have been carried out. Pre-oxidised and as-received samples have been tested in atmospheres with different oxidant potential. For low oxygen concentration in lead-bismuth due to unexpected oxygen consumption in the experimental device, dissolution of as-received F82Hmod. occurs and pre-oxidation does not prevent the material dissolution. For high oxygen concentration, the pre-oxidation layer seems to improve the feasibility of protecting stainless steels controlling the oxygen potential of lead-bismuth with a gas phase

  15. Pairing from dynamically screened Coulomb repulsion in bismuth (United States)

    Ruhman, Jonathan; Lee, Patrick A.


    Recently, Prakash et al. have discovered bulk superconductivity in single crystals of bismuth, which is a semimetal with extremely low carrier density. At such low density, we argue that conventional electron-phonon coupling is too weak to be responsible for the binding of electrons into Cooper pairs. We study a dynamically screened Coulomb interaction with effective attraction generated on the scale of the collective plasma modes. We model the electronic states in bismuth to include three Dirac pockets with high velocity and one hole pocket with a significantly smaller velocity. We find a weak-coupling instability, which is greatly enhanced by the presence of the hole pocket. Therefore we argue that bismuth is the first material to exhibit superconductivity driven by retardation effects of Coulomb repulsion alone. By using realistic parameters for bismuth we find that the acoustic plasma mode does not play the central role in pairing. We also discuss a matrix element effect, resulting from the Dirac nature of the conduction band, which may affect Tc in the s -wave channel without breaking time-reversal symmetry.

  16. Synthesis and structural characterization of Ce-doped bismuth titanate

    International Nuclear Information System (INIS)

    Pavlovic, Nikolina; Srdic, Vladimir V.


    Ce-modified bismuth titanate nanopowders Bi 4-x Ce x Ti 3 O 12 (x ≤ 1) have been synthesized using a coprecipitation method. DTA/TG, FTIR, XRD, SEM/EDS and BET methods were used in order to investigate the effect of Ce-substitution on the structure, morphology and sinterability of the obtained powders. The phase structure investigation revealed that after calcinations at 600 deg. C powder without Ce addition exhibited pure bismuth titanate phase; however, powders with Ce (x = 0.25, 0.5 and 0.75) had bismuth titanate pyrochlore phase as the second phase. The strongest effect of Ce addition on the structure was noted for the powder with the highest amount of Ce (x = 1) having a cubic pyrochlore structure. The presence of pure pyrochlore phase was explained by its stabilization due to the incorporation of cerium ions in titanate structure. Ce-modified bismuth titanate ceramic had a density over 95% of theoretical density and the fracture in transgranular manner most probably due to preferable distribution of Ce in boundary region

  17. Void worths in subcritical cores cooled by lead-bismuth

    International Nuclear Information System (INIS)

    Wallenius, Janne; Tucek, Kamil; Gudowski, Waclaw


    The introduction lead-bismuth coolant in accelerator driven transmutation systems (ADS) was: good neutron economy (higher source efficiency); natural circulation possible (decay heat removal); synergy with spallation target (simplified coolant management); high temperature of boiling (larger overpower margin); smaller void worths (operation at higher k-values). This paper deals with different aspects of the void worths in JAERI ADS

  18. Preparation of Ferroelectric Thin Films of Bismuth Layer Structured Compounds (United States)

    Watanabe, Hitoshi; Mihara, Takashi; Yoshimori, Hiroyuki; Araujo, Carlos


    Ferroelectric thin films of bismuth layer structured compounds, SrBi2Ta2O9, SrBi2Nb2O9, SrBi4Ti4O15 and their solid solutions, were formed onto a sputtered platinum layer on a silicon substrate using spin-on technique and metal-organic decomposition (MOD) method. X-ray diffraction (XRD) analysis and some electrical measurements were performed on the prepared thin films. XRD results of SrBi2(Ta1- x, Nb x)2O9 films (0≤x≤1) showed that niobium ions substitute for tantalum ions in an arbitrary ratio without any change of the layer structure and lattice constants. Furthermore, XRD results of SrBi2 xTa2O9 films (0≤x≤1.5) indicated that the formation of the bismuth layer structure does not always require an accurate bismuth content. The layer structure was formed above 50% of the stoichiometric bismuth content in the general formula. SrBi2(Ta1- x, Nb x)2O9 films with various Ta/Nb ratios have large enough remanent polarization for nonvolatile memory application and have shown high fatigue resistance against 1011 cycles of full switching of the remanent polarization. Mixture films of the three compounds were also investigated.

  19. Ultrafast electron diffraction studies of optically excited thin bismuth films

    International Nuclear Information System (INIS)

    Rajkovic, Ivan


    This thesis contains work on the design and the realization of an experimental setup capable of providing sub-picosecond electron pulses for ultrafast electron diffraction experiments, and performing the study of ultrafast dynamics in bismuth after optical excitation using this setup. (orig.)

  20. Bismuth Ferrite for Active Control of Surface Plasmon Polariton Modes

    DEFF Research Database (Denmark)

    Babicheva, Viktoriia; Zhukovsky, Sergei; Lavrinenko, Andrei


    We propose and investigate several layouts of m etal-insulator-metal waveguide with active core which can be utilized for dynamic switching in photonic integrated circuits. The active material, bismuth ferrite (BiFeO3), is sandwiched between metal plates and changes i ts refractive index through...

  1. Ultrafast electron diffraction studies of optically excited thin bismuth films

    Energy Technology Data Exchange (ETDEWEB)

    Rajkovic, Ivan


    This thesis contains work on the design and the realization of an experimental setup capable of providing sub-picosecond electron pulses for ultrafast electron diffraction experiments, and performing the study of ultrafast dynamics in bismuth after optical excitation using this setup. (orig.)

  2. Phase transition of bismuth telluride thin films grown by MBE

    DEFF Research Database (Denmark)

    Fülöp, Attila; Song, Yuxin; Charpentier, Sophie


    A previously unreported phase transition between Bi2Te3 and Bi4Te3 in bismuth telluride grown by molecular beam epitaxy is recorded via XRD, AFM, and SIMS observations. This transition is found to be related to the Te/Bi beam equivalent pressure (BEP) ratio. BEP ratios below 17 favor the formation...

  3. AB initio energetics of lanthanum substitution in ferroelectric bismuth titanate

    International Nuclear Information System (INIS)

    Shah, S.H.


    Density functional theory based electronic structure calculations play a vital role in understanding, controlling and optimizing physical properties of materials at microscopic level. In present study system of interest is bismuth titanate (Bi/sub 4/Ti/sub 3/O/sub 12/)/(BIT) which has wide range of applications such as a high temperature piezoelectric and one of the best material for memory devices. However, it also suffers from serious issues such as oxygen vacancies which degrade its performance as a memory element and piezoelectric material. In this context, the bulk and defect properties of orthorhombic bismuth titanate (Bi/sub 4/Ti/sub 3/O/sub 12/) and bismuth lanthanum titanate (Bi/sub 3.25/La/sub 0.75/Ti/sub 3/O/sub 12/)/(BLT, x=0.75) were investigated by using first principles calculations and atomistic thermodynamics. Heats of formation, valid chemical conditions for synthesis, lanthanum substitution energies and oxygen and bismuth vacancy formation energies were computed. The study improves understanding of how native point defects and substitutional impurities influence the ferroelectric properties of these layered perovskite materials. It was found that lanthanum incorporation could occur on either of the two distinct bismuth sites in the structure and that the effect of substitution is to increase the formation energy of nearby native oxygen vacancies. The results provide direct atomistic evidence over a range of chemical conditions for the suggestion that lanthanum incorporation reduces the oxygen vacancy concentration. Oxygen vacancies contribute to ferroelectric fatigue by interacting strongly with domain walls and therefore a decrease in their concentration is beneficial. (orig./A.B.)

  4. Efficient enhancement of bismuth NIR luminescence by aluminum and its mechanism in bismuth doped germanate laser glass

    DEFF Research Database (Denmark)

    Wang, L.P.; Tan, L.L.; Yue, Yuanzheng


    As a new member of laser glass family, bismuth-doped glasses have received rising interests due to the application of fiber amplifiers and laser sources in the new spectral range for the next-generation optical communication system. For practical application of the glasses, it must be considered ...

  5. Formation of gas-phase π-allyl radicals from propylene over bismuth oxide and γ-bismuth molybdate catalysts

    International Nuclear Information System (INIS)

    Martir, W.; Lunsford, J.H.


    Gas-phase π-allyl radicals were produced when propylene reacted over Bi 2 O 3 and γ-bismuth molybdate catalysts at 723 K. The pressure in the catalyst zone was varied between 5 x 10 -3 and 1 torr. The radicals were detected by EPR spectroscopy together with a matrix isolation technique in which argon was used as the diluent. The matrix was formed on a sapphire rod at 12 K which was located 33-cm downstream from the catalyst. Bismuth oxide was more effective in the production of gas-phase allyl radicals than γ-bismuth molybdate. By contrast α-bismuth molybdate was ineffective in forming allyl radicals and MoO 3 acted as a sink for radicals which were produced elsewhere in the system. Comparison of the π-allyl radical and the stable product concentrations over Bi 2 O 3 revealed that gas-phase radical recombination reactions served as a major pathway for the formation of 1,5-hexadiene. Addition of small amounts of gas-phase oxygen increased the concentration of allyl radicals, and at greater oxygen levels allyl peroxy radicals were detected. Because of the effect of temperature on the equilibrium between allyl and allyl peroxy radicals, the latter product must be formed in the cooler part of the system

  6. 42 CFR 50.201 - Applicability. (United States)


    ... 42 Public Health 1 2010-10-01 2010-10-01 false Applicability. 50.201 Section 50.201 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS POLICIES OF GENERAL APPLICABILITY... Public Health Service. ...

  7. 7 CFR 201.63 - Germination. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination. 201.63 Section 201.63 Agriculture... REGULATIONS Tolerances § 201.63 Germination. The following tolerances are applicable to the percentage of germination and also to the sum of the germination plus the hard seed when 400 or more seeds are tested. Mean...

  8. 7 CFR 201.20 - Germination. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination. 201.20 Section 201.20 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.20 Germination. The label shall show the percentage of germination each kind, or kind and variety, or kind and type, or kind and hybrid of agricultural seed present...

  9. 40 CFR 243.201 - Safety. (United States)


    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 243.201 Section 243.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE STORAGE... Procedures § 243.201 Safety. ...

  10. 43 CFR 17.201 - Application. (United States)


    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Application. 17.201 Section 17.201 Public Lands: Interior Office of the Secretary of the Interior NONDISCRIMINATION IN FEDERALLY ASSISTED PROGRAMS OF THE DEPARTMENT OF THE INTERIOR Nondiscrimination on the Basis of Handicap § 17.201 Application...

  11. 46 CFR 16.201 - Application. (United States)


    ... 46 Shipping 1 2010-10-01 2010-10-01 false Application. 16.201 Section 16.201 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MERCHANT MARINE OFFICERS AND SEAMEN CHEMICAL TESTING Required Chemical Testing § 16.201 Application. (a) Chemical testing of personnel must be conducted as required by this...

  12. 17 CFR 201.58 - Judicial review. (United States)


    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Judicial review. 201.58 Section 201.58 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Regulations Pertaining to the Equal Access to Justice Act § 201.58 Judicial review. Judicial review of final...

  13. 7 CFR 1435.201 - Civil penalties. (United States)


    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Civil penalties. 1435.201 Section 1435.201... Recordkeeping Requirements § 1435.201 Civil penalties. (a) Any processor, refiner, or importer of sugar, syrup... false data required under § 1435.200(a) through (e), is subject to a civil penalty of no more than $10...

  14. 17 CFR 201.54 - Settlement. (United States)


    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Settlement. 201.54 Section 201... Regulations Pertaining to the Equal Access to Justice Act § 201.54 Settlement. The applicant and counsel for the Office or Division of the Commission may agree on a proposed settlement of the award before final...

  15. 21 CFR 201.105 - Veterinary drugs. (United States)


    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Veterinary drugs. 201.105 Section 201.105 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING Exemptions From Adequate Directions for Use § 201.105 Veterinary drugs. A drug subject to the...

  16. 48 CFR 1318.201 - Contingency operation. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contingency operation. 1318.201 Section 1318.201 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Emergency Acquisition Flexibilities 1318.201 Contingency...

  17. 21 CFR 201.70 - Calcium labeling. (United States)


    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Calcium labeling. 201.70 Section 201.70 Food and... LABELING Labeling Requirements for Over-the-Counter Drugs § 201.70 Calcium labeling. (a) The labeling of over-the-counter (OTC) drug products intended for oral ingestion shall contain the calcium content per...

  18. 5 CFR 2601.201 - Delegation. (United States)


    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Delegation. 2601.201 Section 2601.201... § 2601.201 Delegation. (a) The authority to solicit, accept, and utilize gifts in accordance with this... in accordance with paragraph (b) of this section may be redelegated only through a written delegation...

  19. 48 CFR 201.403 - Individual deviations. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Individual deviations. 201.403 Section 201.403 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... Individual deviations. (1) Individual deviations, except those described in 201.402(1) and paragraph (2) of...

  20. 31 CFR 800.201 - Business day. (United States)


    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Business day. 800.201 Section 800.201 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT... FOREIGN PERSONS Definitions § 800.201 Business day. The term business day means Monday through Friday...

  1. 17 CFR 201.104 - Business hours. (United States)


    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Business hours. 201.104 Section 201.104 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Rules of Practice General Rules § 201.104 Business hours. The Headquarters office of the Commission, at...

  2. 48 CFR 24.201 - Authority. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Authority. 24.201 Section 24.201 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SOCIOECONOMIC PROGRAMS PROTECTION OF PRIVACY AND FREEDOM OF INFORMATION Freedom of Information Act 24.201 Authority. The Freedom of...

  3. 32 CFR 724.201 - Authority. (United States)


    ... 32 National Defense 5 2010-07-01 2010-07-01 false Authority. 724.201 Section 724.201 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY PERSONNEL NAVAL DISCHARGE REVIEW BOARD Authority/Policy for Departmental Discharge Review § 724.201 Authority. The Naval Discharge Review Board...

  4. 28 CFR 31.201 - Audit. (United States)


    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Audit. 31.201 Section 31.201 Judicial Administration DEPARTMENT OF JUSTICE OJJDP GRANT PROGRAMS Formula Grants General Requirements § 31.201 Audit. The State must assure that it adheres to the audit requirements enumerated in the “Financial and...

  5. 4 CFR 201.13 - Business information. (United States)


    ... 4 Accounts 1 2010-01-01 2010-01-01 false Business information. 201.13 Section 201.13 Accounts RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD PUBLIC INFORMATION AND REQUESTS § 201.13 Business information. (a) In general. Business information obtained by the Board from a submitter shall be disclosed...

  6. 49 CFR 393.201 - Frames. (United States)


    ... 49 Transportation 5 2010-10-01 2010-10-01 false Frames. 393.201 Section 393.201 Transportation... SAFE OPERATION Frames, Cab and Body Components, Wheels, Steering, and Suspension Systems § 393.201 Frames. (a) The frame or chassis of each commercial motor vehicle shall not be cracked, loose, sagging or...

  7. 18 CFR 706.201 - Proscribed actions. (United States)


    ... economy; (d) Losing complete independence or impartiality; (e) Making a Government decision outside....201 Section 706.201 Conservation of Power and Water Resources WATER RESOURCES COUNCIL EMPLOYEE RESPONSIBILITIES AND CONDUCT Conduct and Responsibilities of Employees § 706.201 Proscribed actions. An employee...

  8. 19 CFR 201.140 - Employment. (United States)


    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Employment. 201.140 Section 201.140 Customs Duties... Commission § 201.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...

  9. 24 CFR 201.41 - Loan servicing. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Loan servicing. 201.41 Section 201... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Loan Administration § 201.41 Loan servicing. (a) Generally...

  10. 24 CFR 201.10 - Loan amounts. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Loan amounts. 201.10 Section 201.10... MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Loan and Note Provisions § 201.10 Loan amounts. (a) Property...

  11. 7 CFR 201.15 - Weed seeds. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Weed seeds. 201.15 Section 201.15 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.15 Weed seeds. The percentage of weed seeds shall include seeds of plants considered weeds in the State into which the seed is offered for transportation or...

  12. 5 CFR 532.201 - Definitions. (United States)


    ... establishments in the private sector by personal visit of data collectors. Host activity is the local Federal... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Definitions. 532.201 Section 532.201... Prevailing Rate Determinations § 532.201 Definitions. For the purposes of this part: Full-scale survey means...

  13. Myocardial scintigraphy with thallium-201

    Energy Technology Data Exchange (ETDEWEB)

    Lichte, H [Zentralkrankenhaus Gauting (Germany, F.R.). Nuklearmedizinische Abt.


    Myocardial scintigraphy with /sup 201/thallium is a non-invasive method for detection of myocardial infarction and coronary heart disease. Redistribution-analysis as a sequential-scintigraphy of an exercise-scan permits to distinguish between myocardial scars and coronary vessel disease.

  14. Measurements and FLUKA Simulations of Bismuth, Aluminium and Indium Activation at the upgraded CERN Shielding Benchmark Facility (CSBF) (United States)

    Iliopoulou, E.; Bamidis, P.; Brugger, M.; Froeschl, R.; Infantino, A.; Kajimoto, T.; Nakao, N.; Roesler, S.; Sanami, T.; Siountas, A.; Yashima, H.


    The CERN High energy AcceleRator Mixed field (CHARM) facility is situated in the CERN Proton Synchrotron (PS) East Experimental Area. The facility receives a pulsed proton beam from the CERN PS with a beam momentum of 24 GeV/c with 5·1011 protons per pulse with a pulse length of 350 ms and with a maximum average beam intensity of 6.7·1010 protons per second. The extracted proton beam impacts on a cylindrical copper target. The shielding of the CHARM facility includes the CERN Shielding Benchmark Facility (CSBF) situated laterally above the target that allows deep shielding penetration benchmark studies of various shielding materials. This facility has been significantly upgraded during the extended technical stop at the beginning of 2016. It consists now of 40 cm of cast iron shielding, a 200 cm long removable sample holder concrete block with 3 inserts for activation samples, a material test location that is used for the measurement of the attenuation length for different shielding materials as well as for sample activation at different thicknesses of the shielding materials. Activation samples of bismuth, aluminium and indium were placed in the CSBF in September 2016 to characterize the upgraded version of the CSBF. Monte Carlo simulations with the FLUKA code have been performed to estimate the specific production yields of bismuth isotopes (206 Bi, 205 Bi, 204 Bi, 203 Bi, 202 Bi, 201 Bi) from 209 Bi, 24 Na from 27 Al and 115 m I from 115 I for these samples. The production yields estimated by FLUKA Monte Carlo simulations are compared to the production yields obtained from γ-spectroscopy measurements of the samples taking the beam intensity profile into account. The agreement between FLUKA predictions and γ-spectroscopy measurements for the production yields is at a level of a factor of 2.

  15. Equilibrium evaporation test of lead-bismuth eutectic and of tellurium in lead-bismuth

    International Nuclear Information System (INIS)

    Ohno, Shuji; Nishimura, Masahiro; Hamada, Hirotsugu; Miyahara, Shinya; Sasa, Toshinobu; Kurata, Yuji


    A series of equilibrium evaporation experiment was performed to acquire the essential and the fundamental knowledge about the transfer behavior of lead-bismuth eutectic (LBE) and impurity tellurium in LBE from liquid to gas phase. The experiments were conducted using the transpiration method in which saturated vapor in an isothermal evaporation pot was transported by inert carrier gas and collected outside of the pot. The size of the used evaporation pot is 8 cm inner diameter and 15 cm length. The weight of the LBE pool in the pot is about 500 g. The investigated temperature range was 450degC to 750degC. From this experiment and discussion using the data in literature, we have obtained several instructive and useful data on the LBE evaporation behavior such as saturated vapor pressure of LBE, vapor concentration of Pb, Bi and Bi 2 in LBE saturated gas phase, and activity coefficient of Pb in the LBE. The LBE vapor pressure equation is represented as the sum of Pb, Bi and Bi 2 vapor in the temperature range between 550degC and 750degC as logP[Pa]=10.2-10100/T[k]. The gas-liquid equilibrium partition coefficient of tellurium in LBE is in the range of 10 to 100, with no remarkable temperature dependency between 450degC and 750degC. This research was founded by the Ministry of Education, Culture, Sports, Science and Technology (MEXT). (author)

  16. Rapid semi-quantitative determination of bismuth in minerals using ascending paper chromatography (1961)

    International Nuclear Information System (INIS)

    Agrinier, H.


    The bismuth is separated by a solvent made up of acetone, water, and hydrofluoric and hydrochloric acids. The bismuth is developed with dimercapto-2.5 thio-diazole-1.3.4 and ammonium sulphide. The use of this method for the detection of bismuth in minerals makes it possible to determine the metal at a concentration of 5 x 10 -6 . (author) [fr

  17. Influence of bismuth on structural, elastic and spectroscopic properties of Nd{sup 3+} doped Zinc–Boro-Bismuthate glasses

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, Gaurav; Sontakke, Atul D.; Karmakar, P.; Biswas, K.; Balaji, S.; Saha, R.; Sen, R.; Annapurna, K., E-mail:


    The present investigation reports, influence of bismuth addition on structural, elastic and spectral properties of [(99.5−x) {4ZnO−3B_2O_3}−0.5Nd{sub 2}O{sub 3}−x Bi{sub 2}O{sub 3} where x=0, 5, 10, 20, 30, 40, 50 and 60] glasses. The measured FTIR reflectance spectra facilitated a thorough insight of methodical modifications that are arising in the glass structure from borate (build by BO{sub 3} and BO{sub 4} units) to bismuthate (BiO{sub 3} and BiO{sub 6} units) network due to the increase of bismuth content ensuing with a steady decrease in host phonon energy (ν{sub ph}). The elastic properties estimated from measured longitudinal and shear ultrasonic velocities (U{sub L} and U{sub s}) demonstrated the reduction in network rigidity of glasses on Bi{sub 2}O{sub 3} inclusion. The three phenomenological Judd–Ofelt intensity parameters (Ω{sub 2,4,6}) were obtained from recorded absorption spectra of Nd{sup 3+} ions in these glasses and have been used to predict radiative properties as a function of variation in bismuth content. The reduced host phonon energy and high optical basicity effect due to Bi{sub 2}O{sub 3} incorporation remarkably improved the Nd{sup 3+} luminescence properties such as emission intensity, quantum yield and emission cross-section. The quantum yield showed a strong increase from mere 16% in Zinc–Borate glass to almost 73% in 60 mol% Bi{sub 2}O{sub 3} containing glass. Similarly, the emission cross-section for Nd{sup 3+4}F{sub 3/2}→{sup 4}I{sub 11/2} laser transition raised from 2.43×10{sup −20} cm{sup 2} to 3.95×10{sup −20} cm{sup 2} in studied concentration suggesting a strong improvement in Nd{sup 3+} laser spectroscopic properties in Zinc–Boro-Bismuthate glass. These materials may be promising for compact solid state infrared lasers. - Highlights: • Continuous structural changes associated with reduction in host phonon energy by Bi{sub 2}O{sub 3} inclusion. • Ultrasonic velocity study revealed reduced Debye

  18. Phase transition of solid bismuth under high pressure

    International Nuclear Information System (INIS)

    Chen Hai-Yan; Xiang Shi-Kai; Yan Xiao-Zhen; Zhang Yi; Liu Sheng-Gang; Bi Yan; Zheng Li-Rong


    As a widely used pressure calibrator, the structural phase transitions of bismuth from phase I, to phase II, to phase III, and then to phase V with increasing pressure at 300 K have been widely confirmed. However, there are different structural versions for phase III, most of which are determined by x-ray diffraction (XRD) technology. Using x-ray absorption fine structure (XAFS) measurements combined with ab initio calculations, we show that the proposed incommensurate composite structure of bismuth of the three configurations is the best option. An abnormal continuous increase of the nearest-neighbor distance of phase III with elevated pressure is also observed. The electronic structure transformation from semimetal to metal is responsible for the complex behavior of structure transformation. (paper)

  19. Ac irreversibility line of bismuth-based high temperature superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)


    We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}

  20. Ac irreversibility line of bismuth-based high temperature superconductors

    International Nuclear Information System (INIS)

    Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.


    We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society

  1. Quantum nernst effect in a bismuth single crystal

    International Nuclear Information System (INIS)

    Matsuo, M.; Endo, A.; Hatano, N.; Nakamura, H.; Shirasaki, R.; Sugihara, K.


    We calculate the phonon-drag contribution to the transverse (Nernst) thermoelectric power S yx in a bismuth single crystal subjected to a quantizing magnetic field. The calculated heights of the Nernst peaks originating from the hole Landau levels and their temperature dependence reproduce the right order of magnitude for those of the pronounced magneto-oscillations recently reported by Behnia et al. A striking experimental finding that S yx is much larger than the longitudinal (Seebeck) thermoelectric power S xx can be naturally explained as the effect of the phonon drag, combined with the well-known relation between the longitudinal and the Hall resistivity ρ xx >> |ρ yx | in a semi-metal bismuth. The calculation that includes the contribution of both holes and electrons suggests that some of the hitherto unexplained minor peaks located roughly at the fractional filling of the hole Landau levels are attributable to the electron Landau levels. (author)

  2. Nanophotonic Modulator with Bismuth Ferrite as Low-loss Switchable Material

    DEFF Research Database (Denmark)

    Babicheva, Viktoriia; Zhukovsky, Sergei; Lavrinenko, Andrei


    We propose a nanophotonic waveguide modulator with bismuth ferrite as a tunable material. Due to near-zero losses in bismuth ferrite, modulation with up to 20 dB/μm extinction ratio and 12 μm propagation length is achieved.......We propose a nanophotonic waveguide modulator with bismuth ferrite as a tunable material. Due to near-zero losses in bismuth ferrite, modulation with up to 20 dB/μm extinction ratio and 12 μm propagation length is achieved....

  3. Dose reduction using Bismuth protectors in chest computed tomography

    International Nuclear Information System (INIS)

    Anaya, R.


    This monography is about the Dose reduction using Bismuth protectors in chest CT. The radiation protection of specific areas is necessary when the tissues or radiosensitive organs are near the path of light beam. The correct use of protection represents a challenge for the radiologist because of the time and materials required. The method used was a prospective investigatio in CHPR (TC service) and the doses was measured with TLD dosimeters. It is important to use these protectors in children hospitals.

  4. Spectroscopic and kinetic study of bismuth dimers (United States)

    Franklin, Robert Eugene


    The spectroscopy of high rotational levels in Bi2 X(0g+) and A(0u+) was investigated for 2/le v/prime'/le5 and 0/le v/sp/prime/le4 by observing total fluorescence from laser excitation with a scanning, continuous wave, narrow linewidth ring laser. Rotational levels with J/le211 were accessed. Dunham coefficients were derived that fit all observed rotational lines to within 0.01 cm-1. From these coefficients, Franck-Condon factors were calculated that accurately reflect a set of experimentally determined Franck-Condon factors originating from the initially populated levels 0/le v/sp/prime/le5. Vibrational energy transfer in the low-lying vibrational levels (v/sp/prime/le4) of the A(0u+) state of Bi2 was investigated using spectrally resolved, continuous wave laser induced fluorescence. Spectrally resolved emissions from collisionally populated Bi2(A) vibrational levels were observed for rare gas collision partners. Vibrational transfer promoted rapid thermalization of the excited A state molecules. Landau- Teller scaling of vibrational transfer rates was found to be an acceptable model for the scaling of transfer rates with vibrational quantum number. Fundamental transfer rate coefficients ranged from kv(1,0)=5.29/pm0.73×10-12/ [ cm]3/molec-sec for helium to kv(1,0)=2.38/pm0.36×10-12/ [ cm]3/molec-sec for krypton. Electronic quenching and multi-quantum transfer rates were found to be approximately an order of magnitude slower than the corresponding single quantum transfer rates. Rotational energy transfer in high rotational levels of the A state of Bi2 was also investigated by spectrally resolved, continuous wave laser induced fluorescence. Spectrally resolved emissions from collisionally populated Bi2(A) rotational levels were observed for collisions with helium, neon and argon after laser excitation of J/sp/prime=171,201,231. Rotational energy transfer was the most efficient kinetic process in Bi2(A) and is adequately modeled by the energy based statistical

  5. Oxide layer stability in lead-bismuth at high temperature (United States)

    Martín, F. J.; Soler, L.; Hernández, F.; Gómez-Briceño, D.


    Materials protection by 'in situ' oxidation has been studied in stagnant lead-bismuth, with different oxygen levels (H 2/H 2O ratios of 0.3 and 0.03), at temperatures from 535 °C to 600 °C and times from 100 to 3000 h. The materials tested were the martensitic steels F82Hmod, EM10 and T91 and the austenitic stainless steels, AISI 316L and AISI 304L. The results obtained point to the existence of an apparent threshold temperature above which corrosion occurs and the formation of a protective and stable oxide layer is not possible. This threshold temperature depends on material composition, oxygen concentration in the liquid lead-bismuth and time. The threshold temperature is higher for the austenitic steels, especially for the AISI 304L, and it increases with the oxygen concentration in the lead-bismuth. The oxide layer formed disappear with time and, after 3000 h all the materials, except AISI 304L, suffer corrosion, more severe for the martensitic steels and at the highest temperature tested.

  6. Theoretical study of bismuth-doped cadmium telluride (United States)

    Menendez-Proupin, E.; Rios-Gonzalez, J. A.; Pena, J. L.

    Cadmium telluride heavily doped with bismuth has been proposed as an absorber with an intermediate band for solar cells. Increase in the photocurrent has been shown recently, although the overall cell efficiency has not improved. In this work, we study the electronic structure and the formation energies of the defects associated to bismuth impurities. We have performed electronic structure calculations within generalized density functional theory, using the exchange-correlation functional HSE(w) , where the range-separation parameter w has been tuned to reproduce the CdTe bandgap. Improving upon previous reports, we have included the spin-orbit interaction, which modifies the structure of the valence band and the energy levels of bismuth. We have found that interstitial Bi (Bii) tends to occupy Cd vacancies, cadmium substitution (BiCd) creates single donor level, while tellurium substitution (BiTe) is a shallow single acceptor. We investigate the interaction between these point defects and how can they be combined to create a partially filled intermediate band. Supported by FONDECYT Grant 1130437, CONACYT-SENER SUSTENTABILIDAD ENERGETICA/project CeMIE-Sol PY-207450/25 and PY-207450/26. JARG acknowledges CONACYT fellowship for research visit. Powered@NLHPC (ECM-02).

  7. Study of barium bismuth titanate prepared by mechanochemical synthesis

    Directory of Open Access Journals (Sweden)

    Lazarević Z.Ž.


    Full Text Available Barium-bismuth titanate, BaBi4Ti4O15 (BBT, a member of Aurivillius bismuth-based layer-structure perovskites, was prepared from stoichiometric amounts of barium titanate and bismuth titanate obtained via mechanochemical synthesis. Mechanochemical synthesis was performed in air atmosphere in a planetary ball mill. The reaction mechanism of BaBi4Ti4O15 and the preparation and characteristics of BBT ceramic powders were studied using XRD, Raman spectroscopy, particle analysis and SEM. The Bi-layered perovskite structure of BaBi4Ti4O15 ceramic forms at 1100 °C for 4 h without a pre-calcination step. The microstructure of BaBi4Ti4O15 exhibits plate-like grains typical for the Bi-layered structured material and spherical and polygonal grains. The Ba2+ addition leads to changes in the microstructure development, particularly in the change of the average grain size.

  8. Aerosol deposition of (Cu,Ti) substituted bismuth vanadate films

    Energy Technology Data Exchange (ETDEWEB)

    Exner, Jörg, E-mail: [University of Bayreuth, Department of Functional Materials, Universitätsstraße 30, 95440 Bayreuth (Germany); Fuierer, Paul [Materials and Metallurgical Engineering Department, New Mexico Institute of Mining and Technology, Socorro, NM 87801 (United States); Moos, Ralf [University of Bayreuth, Department of Functional Materials, Universitätsstraße 30, 95440 Bayreuth (Germany)


    Bismuth vanadate, Bi{sub 4}V{sub 2}O{sub 11}, and related compounds with various metal (Me) substitutions, Bi{sub 4}(Me{sub x}V{sub 1−x}){sub 2}O{sub 11−δ}, show some of the highest ionic conductivities among the known solid oxide electrolytes. Films of Cu and Ti substituted bismuth vanadate were prepared by an aerosol deposition method, a spray coating process also described as room temperature impact consolidation. Resultant films, several microns in thickness, were dense with good adhesion to the substrate. Scanning electron microscopy and high temperature X-ray diffraction were used to monitor the effects of temperature on the structure and microstructure of the film. The particle size remained nano-scale while microstrain decreased rapidly up to 500 °C, above which coarsening and texturing increased rapidly. Impedance measurements of films deposited on inter-digital electrodes revealed an annealing effect on the ionic conductivity, with the conductivity exceeding that of a screen printed film, and approaching that of bulk ceramic. - Highlights: • Cu and Ti doped bismuth vanadate films were prepared by aerosol deposition (AD). • Dense 3–5 μm thick films were deposited on alumina, silicon and gold electrodes. • Annealing of the AD-layer increases the conductivity by 1.5 orders of magnitude. • Effect of temperature on structure and microstructure was investigated.

  9. Soluble Lead and Bismuth Chalcogenidometallates: Versatile Solders for Thermoelectric Materials

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Hao [Department; Son, Jae Sung [Department; School; Dolzhnikov, Dmitriy S. [Department; Filatov, Alexander S. [Department; Hazarika, Abhijit [Department; Wang, Yuanyuan [Department; Hudson, Margaret H. [Department; Sun, Cheng-Jun [Advanced; Chattopadhyay, Soma [Physical; Talapin, Dmitri V. [Department; Center


    Here we report the syntheses of largely unexplored lead and bismuth chalcogenidometallates in the solution phase. Using N2H4 as the solvent, new compounds such as K6Pb3Te6·7N2H4 were obtained. These soluble molecular compounds underwent cation exchange processes using resin chemistry, replacing Na+ or K+ by decomposable N2H5+ or tetraethylammonium cations. They also transformed into stoichiometric lead and bismuth chalcogenide nanomaterials with the addition of metal salts. Such a versatile chemistry led to a variety of composition-matched solders to join lead and bismuth chalcogenides and tune their charge transport properties at the grain boundaries. Solution-processed thin films composed of Bi0.5Sb1.5Te3 microparticles soldered by (N2H5)6Bi0.5Sb1.5Te6 exhibited thermoelectric power factors (~28 μW/cm K2) comparable to those in vacuum-deposited Bi0.5Sb1.5Te3 films. The soldering effect can also be integrated with attractive fabrication techniques for thermoelectric modules, such as screen printing, suggesting the potential of these solders in the rational design of printable and moldable thermoelectrics.

  10. Shape-controlled solvothermal synthesis of bismuth subcarbonate nanomaterials

    International Nuclear Information System (INIS)

    Cheng Gang; Yang Hanmin; Rong Kaifeng; Lu Zhong; Yu Xianglin; Chen Rong


    Much effort has been devoted to the synthesis of novel nanostructured materials because of their unique properties and potential applications. Bismuth subcarbonate ((BiO) 2 CO 3 ) is one of commonly used antibacterial agents against Helicobacter pylori (H. pylori). Different (BiO) 2 CO 3 nanostructures such as cube-like nanoparticles, nanobars and nanoplates, were fabricated from bismuth nitrate via a simple solvothermal method. The nanostructures were characterized by powder X-ray diffraction (XRD), scanning electron microscope (SEM), transmission electron microscopy (TEM) and high-resolution transmission electron microscopy (HRTEM). It was found that the solvents and precursors have an influence on the morphologies of (BiO) 2 CO 3 nanostructures. The possible formation mechanism of different (BiO) 2 CO 3 nanostructures fabricated under different conditions was also discussed. - Graphical abstract: Different bismuth subcarbonate ((BiO) 2 CO 3 ) nanostructures were successfully synthesized by a simple solvothermal method. It was found that the solvents and precursors have an influence on the morphologies of (BiO) 2 CO 3 nanostructures.

  11. Bismuth Oxysulfide and Its Polymer Nanocomposites for Efficient Purification

    Directory of Open Access Journals (Sweden)

    Yidong Luo


    Full Text Available The danger of toxic organic pollutants in both aquatic and air environments calls for high-efficiency purification material. Herein, layered bismuth copper oxychalcogenides, BiCuSO, nanosheets of high photocatalytic activity were introduced to the PVDF (Polyvinylidene Fluoride. The fibrous membranes provide an easy, efficient, and recyclable way to purify organic pollutant. The physical and photophysical properties of the BiCuSO and its polymer composite were characterized by scanning electron microscopy (SEM, X-ray diffraction (XRD, ultraviolet-visible diffuse reflection spectroscopy (DRS, X-ray photoelectron spectroscopy (XPS, electron spin resonance (EPR. Photocatalysis of Congo Red reveals that the BiCuSO/PVDF shows a superior photocatalytic activity of a 55% degradation rate in 70 min at visible light. The high photocatalytic activity is attributed to the exposed active {101} facets and the triple vacant associates V B i ‴ V O • • V B i ‴ . By engineering the intrinsic defects on the surface of bismuth oxysulfide, high solar-driven photocatalytic activity can be approached. The successful fabrication of the bismuth oxysulfide and its polymer nanocomposites provides an easy and general approach for high-performance purification materials for various applications.

  12. Study on corrosion test techniques in lead bismuth eutectic flow. Joint research report in JFY2002

    International Nuclear Information System (INIS)

    Takahashi, Minoru; Sekimoto, Hiroshi


    The evaluation of corrosion behaviors of core and structural materials in lead bismuth eutectic is one of the key issues for the utilization of lead bismuth eutectic as a coolant of the primary loops of lead bismuth cooled fast breeder reactors (FBRs) and the intermediate heat transport media of new-type steam generators of the sodium cooled FBRs. The purpose of the present study is to establish corrosion test techniques in lead bismuth eutectic flow. The techniques of steel corrosion test and oxygen control in flowing lead bismuth eutectic, and the technologies of a lead bismuth flow test at high temperature and high velocity were developed through corrosion test using a lead bismuth flow test loop of the Tokyo Institute of Technology in JFY2002. The major results are summarized as follows: (1) Techniques of fabrication, mount and rinse of corrosion specimens, measurement method of weight loss, and SEM/EDX analysis method have been established through lead bismuth corrosion test. (2) Weight losses were measured, corrosion and lead bismuth-adhered layers and eroded parts were observed in two 1000 hr-corrosion tests, and the results were compared with each other for twelve existing steels including ODS, F82H and SUH-3. (3) An oxygen sensor made of zirconia electrolyte structurally resistant to thermal stress and thermal shock was developed and tested in the lead bismuth flow loop. Good performance has been obtained. (4) An oxygen control method by injecting argon and hydrogen mixture gas containing steam into lead bismuth was applied to the lead bismuth flow loop, and technical issues for the development of the oxygen control method were extracted. (5) Technical measures for freezing and leakage of lead bismuth in the flow loop were accumulated. (6) Technical measures for flow rate decrease/blockage due to precipitation of oxide and corrosion products in a low temperature section of the lead bismuth flow loop were accumulated. (7) Electromagnetic flow meters with MI

  13. Dicty_cDB: SLH201 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH201 (Link to dictyBase) - - - Contig-U14690-1 SLH201F (Link to Original site) SLH2...01F 395 - - - - - - Show SLH201 Library SL (Link to library) Clone ID SLH201 (Link Representative seq. ID SLH20...1F (Link to Original site) Representative DNA sequence >SLH201 (SLH201Q) /CSM/SL/SLH2-A/SLH201Q.Seq.d/ CACCA...M/SL/SLH4-C/SLH463Q.Seq.d/ 718 0.0 SLH201 (SLH201Q) /CSM/SL/SLH2-A/SLH201Q.Seq.d/ 718 0.0 SSF514 (SSF514Q) /

  14. A single drug for Helicobacter pylori infection: first results with a new bismuth triple monocapsule

    NARCIS (Netherlands)

    de Boer, W. A.; van Etten, R. J.; Schneeberger, P. M.; Tytgat, G. N.


    In this pilot study we investigated the efficacy and tolerability of a new monocapsule that contains a bismuth compound, tetracycline, and metronidazole. If proven to be effective, this monotherapy would turn the well-accepted multidrug regimen of standard bismuth-based triple therapy into an easy

  15. Method of Creating Micro-scale Silver Telluride Grains Covered with Bismuth Nanoparticles (United States)

    Kim, Hyun-Jung (Inventor); Choi, Sang Hyouk (Inventor); King, Glen C. (Inventor); Park, Yeonjoon (Inventor); Lee, Kunik (Inventor)


    Provided is a method of enhancing thermoelectric performance by surrounding crystalline semiconductors with nanoparticles by contacting a bismuth telluride material with a silver salt under a substantially inert atmosphere and a temperature approximately near the silver salt decomposition temperature; and recovering a metallic bismuth decorated material comprising silver telluride crystal grains.

  16. Build-up enhancement of photoluminescence from phenylazomethine bismuth dendrimer using Bi(OTf)3 (United States)

    Kambe, Tetsuya; Imaoka, Shotaro; Imaoka, Takane; Yamamoto, Kimihisa


    Metal assembly to a dendrimer can provide various functionalities based on the branched structure. Here, we researched assembly phenomena of bismuth salts in the phenylazomethine dendrimer and achieved enhancement of emission intensity per metal unit by using Bi(OTf)3. This enhancement suggested increasing of Bi-N coordination bonds derived from the bismuth units in the dendrimer.

  17. Selective oxidation of propylene to acrolein by silica-supported bismuth molybdate catalysts

    DEFF Research Database (Denmark)

    Duc, Duc Truong; Ha, Hanh Nguyen; Fehrmann, Rasmus


    Silica-supported bismuth molybdate catalysts have been prepared by impregnation, structurally characterized and examined as improved catalysts for the selective oxidation of propylene to acrolein. Catalysts with a wide range of loadings (from 10 to 90 wt%) of beta bismuth molybdate (β-Bi2Mo2O9) w...

  18. 32 CFR 48.201 - Options. (United States)


    ... 32 National Defense 1 2010-07-01 2010-07-01 false Options. 48.201 Section 48.201 National Defense...'S FAMILY PROTECTION PLAN Election of Options § 48.201 Options. As provided in § 48.203, a member may... amount equal to such 121/2 per centum. (a) Option 1 is an annuity payable to or on behalf of his widow...

  19. 7 CFR 201.11a - Hybrid. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Hybrid. 201.11a Section 201.11a Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.11a Hybrid. If any one kind or kind and variety of seed present in excess of 5 percent is “hybrid” seed, it shall be designated “hybrid” on the label. The percentage...

  20. 7 CFR 201.41 - Bags. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Bags. 201.41 Section 201.41 Agriculture Regulations of... Sampling in the Administration of the Act § 201.41 Bags. (a) For lots of six bags or less, each bag shall be sampled. A total of at least five trierfuls shall be taken. (b) For lots of more than six bags...

  1. Localization and Related Phenomena in Multiply Connected Nanostructured Inverse Opal Bismuth (United States)

    Bleiweiss, Michael; Saygi, Salih; Amirzadeh, Jafar; Datta, Timir; Lungu, Anca; Yin, Ming; Palm, Eric; Brandt, Bruce; Iqbal, Zafar


    The nanostructures were fabricated by pressure infiltration of bismuth into porous artificial opal and were characterized using SEM, EDX and XRD. These structures form a regular three-dimensional network in which the bismuth regions percolate in all directions between the close packed spheres of SiO_2. The sizes of the conducting regions are of the order of tens of nanometers. The static magnetic properties of both bismuth inverse opal and bulk bismuth were studied using a SQUID magnetometer. Transport measurements, including Hall, were done using standard ac four and six probe techniques in fields up to 17 T* and temperatures between 4.2 and 150 K. The results of these measurements, including the observation of localization phenomena, will be discussed. Comparisons will be made with published results on bismuth nanowires. *Performed at the National High Magnetic Field Lab (NHMFL) FSU, Tallahassee, FL. Partially supported by a grant from NASA.

  2. Thermodynamics Calculation and Experimental Study on Separation of Bismuth from a Bismuth Glance Concentrate Through a Low-Temperature Molten Salt Smelting Process (United States)

    Yang, Jian-Guang; He, De-Wen; Tang, Chao-Bo; Chen, Yong-Ming; Sun, Ya-Hui; Tang, Mo-Tang


    The main purpose of this study is to characterize and separate bismuth from a bismuth glance concentrate through a low-temperature, sulfur-fixing smelting process. This article reports on a study conducted on the optimization of process parameters, such as Na2CO3 and zinc oxide wt pct in charging, smelting temperature, smelting duration on the bismuth yield, resultant crude bismuth grade, and sulfur-fixing rate. A maximum bismuth recovery of 97.31 pct, crude bismuth grade of 96.93 pct, and 98.23 pct sulfur-fixing rate are obtained when a charge (containing 63.50 wt pct of Na2CO3 and 22.50 wt pct of bismuth glance, as well as 5 pct in excess of the stoichiometric requirement of zinc oxide dosage) is smelted at 1000 K (727 °C) for 150 minutes. This smelting operation is free from atmospheric pollution because zinc oxide is used as the sulfur-fixing agent, which can capture sulfur from bismuth sulfide and form the more thermodynamic-stable compound, zinc sulfide. The solid residue is subjected to a mineral dressing operation to obtain suspension, which is filtered to produce a cake, representing the solid particles of zinc sulfide. Based on the results of the chemical content analysis of the as-resultant zinc sulfide, more than 93 pct zinc sulfide can be recovered, and the recovered zinc sulfide grade can reach 60.20 pct. This material can be sold as zinc sulfide concentrate or roasted to be regenerated as zinc oxide.

  3. Bioavailability and chronic toxicity of bismuth citrate to earthworm Eisenia andrei exposed to natural sandy soil. (United States)

    Omouri, Zohra; Hawari, Jalal; Fournier, Michel; Robidoux, Pierre Yves


    The present study describes bioavailability and chronic effects of bismuth to earthworms Eisenia andrei using OECD reproduction test. Adult earthworms were exposed to natural sandy soil contaminated artificially by bismuth citrate. Average total concentrations of bismuth in soil recovered by HNO 3 digestion ranged from 75 to 289mg/kg. Results indicate that bismuth decreased significantly all reproduction parameters of Eisenia andrei at concentrations ≥ 116mg/kg. However, number of hatched cocoons and number of juveniles seem to be more sensitive than total number of cocoons, as determined by IC 50 ; i.e., 182, 123 and > 289mg/kg, respectively. Bismuth did not affect Eisenia andrei growth and survival, and had little effect on phagocytic efficiency of coelomocytes. The low immunotoxicity effect might be explained by the involvement of other mechanisms i.e. bismuth sequestered by metal-binding compounds. After 28 days of exposure bismuth concentrations in earthworms tissue increased with increasing bismuth concentrations in soil reaching a stationary state of 21.37mg/kg dry tissue for 243mg Bi/kg dry soil total content. Data indicate also that after 56 days of incubation the average fractions of bismuth available extracted by KNO 3 aqueous solution in soil without earthworms varied from 0.0051 to 0.0229mg/kg, while in soil with earthworms bismuth concentration ranged between 0.310-1.347mg/kg dry soil. We presume that mucus and chelating agents produced by earthworms and by soil or/and earthworm gut microorganisms could explain this enhancement, as well as the role of dermal and ingestion routes of earthworms uptake to soil contaminant. Copyright © 2017 Elsevier Inc. All rights reserved.

  4. Bismuth oxide nanotubes-graphene fiber-based flexible supercapacitors (United States)

    Gopalsamy, Karthikeyan; Xu, Zhen; Zheng, Bingna; Huang, Tieqi; Kou, Liang; Zhao, Xiaoli; Gao, Chao


    Graphene-bismuth oxide nanotube fiber as electrode material for constituting flexible supercapacitors using a PVA/H3PO4 gel electrolyte is reported with a high specific capacitance (Ca) of 69.3 mF cm-2 (for a single electrode) and 17.3 mF cm-2 (for the whole device) at 0.1 mA cm-2, respectively. Our approach opens the door to metal oxide-graphene hybrid fibers and high-performance flexible electronics.Graphene-bismuth oxide nanotube fiber as electrode material for constituting flexible supercapacitors using a PVA/H3PO4 gel electrolyte is reported with a high specific capacitance (Ca) of 69.3 mF cm-2 (for a single electrode) and 17.3 mF cm-2 (for the whole device) at 0.1 mA cm-2, respectively. Our approach opens the door to metal oxide-graphene hybrid fibers and high-performance flexible electronics. Electronic supplementary information (ESI) available: Equations and characterization. SEM images of GGO, XRD and XPS of Bi2O3 NTs, HRTEM images and EDX Spectra of Bi2O3 NT5-GF, CV curves of Bi2O3NT5-GF, Bi2O3 NTs and bismuth nitrate in three-electrode system (vs. Ag/AgCl). CV and GCD curves of Bi2O3 NT1-GF and Bi2O3 NT3-GF. See DOI: 10.1039/c4nr02615b

  5. Conduction mechanism in bismuth silicate glasses containing titanium

    International Nuclear Information System (INIS)

    Dult, Meenakshi; Kundu, R.S.; Murugavel, S.; Punia, R.; Kishore, N.


    Bismuth silicate glasses mixed with different concentrations of titanium dioxide having compositions xTiO 2 –(60−x)Bi 2 O 3 –40SiO 2 with x=0, 5, 10, 15 and 20 were prepared by the normal melt quench technique. The frequency dependence of the ac electrical conductivity of different compositions of titanium bismuth silicate glasses has been studied in the frequency range 10 −1 Hz to 10 MHz and in the temperature range 623–703 K. The temperature and frequency dependent conductivity is found to obey Jonscher's universal power law for all the compositions of titanium bismuth silicate glass system. The dc conductivity (σ dc ), so called crossover frequency (ω H ), and frequency exponent (s) have been estimated from the fitting of experimental data of ac conductivity with Jonscher's universal power law. Enthalpy to dissociate the cation from its original site next to a charge compensating center (H f ) and enthalpy of migration (H m ) have also been estimated. The conductivity data have been analyzed in terms of different theoretical models to determine the possible conduction mechanism. Analysis of the conductivity data and the frequency exponent shows that the correlated barrier hopping of electrons between Ti 3+ and Ti 4+ ions in the glasses is the most favorable mechanism for ac conduction. The temperature dependent dc conductivity has been analyzed in the framework of theoretical variable range hopping model (VRH) proposed by Mott which describe the hopping conduction in disordered semiconducting systems. The various polaron hopping parameters have also been deduced. Mott's VRH model is found to be in good agreement with experimental data and the values of inverse localization length of s-like wave function (α) obtained by this model with modifications suggested by Punia et al. are close to the ones reported for a number of oxide glasses

  6. Yttrium bismuth titanate pyrochlore mixed oxides for photocatalytic hydrogen production

    Energy Technology Data Exchange (ETDEWEB)

    Merka, Oliver


    In this work, the sol-gel synthesis of new non-stoichiometric pyrochlore titanates and their application in photocatalytic hydrogen production is reported. Visible light response is achieved by introducing bismuth on the A site or by doping the B site by transition metal cations featuring partially filled d orbitals. This work clearly focusses on atomic scale structural changes induced by the systematical introduction of non-stoichiometry in pyrochlore mixed oxides and the resulting influence on the activity in photocatalytic hydrogen production. The materials were characterized in detail regarding their optical properties and their atomic structure. The pyrochlore structure tolerates tremendous stoichiometry variations. The non-stoichiometry in A{sub 2}O{sub 3} rich compositions is compensated by distortions in the cationic sub-lattice for the smaller Y{sup 3+} cation and by evolution of a secondary phase for the larger Bi{sup 3+} cation on the A site. For TiO{sub 2} rich compositions, the non-stoichiometry leads to a special vacancy formation in the A and optionally O' sites. It is shown that pyrochlore mixed oxides in the yttrium bismuth titanate system represent very active and promising materials for photocatalytic hydrogen production, if precisely and carefully tuned. Whereas Y{sub 2}Ti{sub 2}O{sub 7} yields stable hydrogen production rates over time, the bismuth richer compounds of YBiTi{sub 2}O{sub 7} and Bi{sub 2}Ti{sub 2}O{sub 7} are found to be not stable under irradiation. This drawback is overcome by applying a special co-catalyst system consisting of a precious metal core and a Cr{sub 2}O{sub 3} shell on the photocatalysts.

  7. Solution combustion synthesis and characterization of nanosized bismuth ferrite (United States)

    Sai Kumar, V. Sesha; Rao, K. Venkateswara; Krishnaveni, T.; Kishore Goud, A. Shiva; Reddy, P. Ranjith


    The present paper describes a simple method of nanosized BiFeO3 by the solution combustion synthesis using bismuth and iron nitrates as oxidizers and the combination fuel of citric acid and ammonium hydroxide, with fuel to oxidizer ratio (Ψ = 1) one. The X-ray Diffraction results indicated rhombohedral phase (R3m) with JCPDS data card no: 72-2035. The ferroelectric transition of the sample at 8310C was detected by differential thermal analysis. Thermal analysis was done by Thermal gravimetric-Differential thermal analyzer and obtained results were presented in this paper.

  8. 14 CFR 201.1 - Formal requirements. (United States)


    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Formal requirements. 201.1 Section 201.1 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC... papers. (b) Any person desiring to provide air transportation as a commuter air carrier must comply with...

  9. 17 CFR 201.57 - Commission review. (United States)


    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Commission review. 201.57... Regulations Pertaining to the Equal Access to Justice Act § 201.57 Commission review. In accordance with the... Division of the Commission may seek review of the initial decision on the fee application, or the...

  10. 17 CFR 201.240 - Settlement. (United States)


    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Settlement. 201.240 Section... of Practice Initiation of Proceedings and Prehearing Rules § 201.240 Settlement. (a) Availability... party to a proceeding already instituted, may, at any time, propose in writing an offer of settlement...

  11. 15 CFR 280.201 - Violations. (United States)


    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Violations. 280.201 Section 280.201 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade NATIONAL INSTITUTE OF... otherwise, fasteners that are required by the applicable consensus standard or standards to bear an insignia...

  12. Commercial production of thallium-201 chloride

    International Nuclear Information System (INIS)

    Sokolov, S.V.; Volkova, N.M.; Skokov, V.S.


    Thallium-201 chloride pharmaceuticals production practice at the Medradiopreparat factory under USSR Ministry of Public Health is described. The factory is carried out series-produced supplies of the compound prepared according to a new practice from September, 1985. Thallium-201 extraction from cyclotron targets irradiated is carried out by the extraction method

  13. 7 CFR 1430.201 - Administration. (United States)


    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1430.201 Section 1430.201 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF... Administration. (a) This program is administered under the general supervision of the Executive Vice President...

  14. 24 CFR 201.16 - Default provision. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Default provision. 201.16 Section... PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Loan and Note Provisions § 201.16 Default provision. The... default by the borrower. ...

  15. 48 CFR 218.201 - Contingency operation. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contingency operation. 218... Flexibilities 218.201 Contingency operation. (1) Selection, appointment, and termination of appointment... in a contingency contracting force. See 201.603-2(2). (2) Policy for unique item identification...

  16. 40 CFR 266.201 - Definitions. (United States)



  17. 48 CFR 33.201 - Definitions. (United States)


    .... Alternative dispute resolution (ADR) means any type of procedure or combination of procedures voluntarily used... REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 33.201 Definitions. As used in this subpart... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Definitions. 33.201...

  18. 24 CFR 3285.201 - Soil conditions. (United States)


    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Soil conditions. 3285.201 Section 3285.201 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR HOUSING-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT MODEL MANUFACTURED HOME...

  19. 46 CFR 199.201 - Survival craft. (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft. 199.201 Section 199.201 Shipping COAST... craft. (a) Each survival craft must be approved and equipped as follows: (1) Each lifeboat must be... addition to the survival craft required in paragraph (b)(1) of this section, additional liferafts must be...

  20. 31 CFR 0.201 - Political activity. (United States)


    ... EMPLOYEE RULES OF CONDUCT Rules of Conduct § 0.201 Political activity. (a) Employees may: (1) Take an active part in political management or in political campaigns to the extent permitted by law (5 U.S.C... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Political activity. 0.201 Section 0...

  1. 17 CFR 242.201 - Price test. (United States)


    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Price test. 242.201 Section...-Regulation of Short Sales § 242.201 Price test. Link to an amendment published at 75 FR 11323, Mar. 10, 2010. (a) No short sale price test, including any short sale price test of any self-regulatory organization...

  2. 48 CFR 50.201 - Definitions. (United States)


    ... EXTRAORDINARY CONTRACTUAL ACTIONS AND THE SAFETY ACT Support Anti-terrorism by Fostering Effective Technologies Act of 2002 50.201 Definitions. Act of terrorism means any act determined to have met the following... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Definitions. 50.201...

  3. 9 CFR 201.3 - Authority. (United States)


    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Authority. 201.3 Section 201.3 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS....3 Authority. The Administrator shall perform such duties as the Secretary may require in enforcing...

  4. 48 CFR 419.201-73 - Reports. (United States)


    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Reports. 419.201-73... SMALL BUSINESS PROGRAMS Policies 419.201-73 Reports. The Director, OSDBU, shall be responsible for submitting reports concerning USDA's progress and achievements in the procurement preference program. ...

  5. 19 CFR 201.205 - Salary adjustments. (United States)


    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Salary adjustments. 201.205 Section 201.205 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION Debt... of coverage, or a change in coverage, under a Federal benefits program requiring periodic deductions...

  6. 33 CFR 135.201 - Applicability. (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Applicability. 135.201 Section 135.201 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OFFSHORE OIL POLLUTION COMPENSATION FUND...

  7. Production of Thallium 201 for medical applications

    International Nuclear Information System (INIS)

    Braghirolli, A.M.S.


    With the purpose of producing high purity carrier-free 201 Tl, for medical use, a production and separation method was developed using the CV-28 Cyclotron of the Nuclear Engineering Institute in Rio de Janeiro, Brazil. 201 Pb was produced by 24 MeV proton bombardment of natural Tl and allowed to decay to 201 Tl. In the separation process the target is dissolved in HNO 3 , the 201 Pb produced is separated by Fe(OH) 3 coprecipitation, and the Fe is latter separated by anion exchange. The 201 Pb is permited to decay during 32 hrs. 201 Tl is then separated from remaining Pb by anion exchange. The chemical separation is done in a remote processing cell using manipulators, tongs, electric and pneumatic systems. The thick target yield of 201 Pb is 1.7 mCi/μAhr. At the moment the production is restricted to 4 mCi of 201 Tl for each irradiation. (Author) [pt

  8. 27 CFR 40.201 - Inventories. (United States)


    ... PROCESSED TOBACCO Operations by Manufacturers of Tobacco Products Inventories and Reports § 40.201 Inventories. Every manufacturer of tobacco products shall make true and accurate inventories on Form 5210.9... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Inventories. 40.201...

  9. 47 CFR 201.2 - Definitions. (United States)


    ... private sector must become engaged in the interests of national survival and recovery. (g) National... (47 U.S.C. 606), as amended. (j) Private sector means those sectors of non-government entities that... 47 Telecommunication 5 2010-10-01 2010-10-01 false Definitions. 201.2 Section 201.2...

  10. 31 CFR 31.201 - Definitions. (United States)


    ... agency agreement between a private sector entity and the Treasury for services under the TARP, other than... Stabilization Act of 2008. Key individual means an individual providing services to a private sector entity who... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Definitions. 31.201 Section 31.201...

  11. 48 CFR 3019.201 - General policy. (United States)


    ... Section 3019.201 Federal Acquisition Regulations System DEPARTMENT OF HOMELAND SECURITY, HOMELAND SECURITY ACQUISITION REGULATION (HSAR) SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 3019.201 General policy. (d) DHS is committed to a unified team approach involving senior management, small business...

  12. Brain SPECT with Tl-201 DDC

    International Nuclear Information System (INIS)

    Bruine, J.F. de.


    The development, animal and human experiments and the first clinical results of a new blood flow tracer thallium-201 diethyldithiocarbamate (Tl-201 DDC) are discussed for functional brain imaging with single-photon emission computed tomography (SPECT). 325 refs.; 43 figs.; 22 tabs

  13. 42 CFR 93.201 - Allegation. (United States)



  14. Investigation of corrosion, water reaction, polonium evaporation and bismuth resource in liquid metal lead-bismuth technology

    Energy Technology Data Exchange (ETDEWEB)

    Takano, Hideki; Takizuka, Takakazu [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kitano, Teruaki [Mitsui Shipbuilding and Engineering Co. Ltd., Tokyo (Japan)


    Lead-bismuth is the first candidate material for liquid metal target find coolant of fueled blanket system in accelerator-driven system (ADS) studied at JAERI. Advantages of the lead-bismuth utilization are non-active material, very low capture cross section, low melting point of 125degC and high boiling point of 1670degC, and beside coolant void reactivity become negative. But problems are due to the high corrosivity to most of the structural materials and the corrosive data are scarcity. In this report, corrosivity, reaction with water, thermal-hydraulics, chemical toxicity etc. are studied by investigating some facilities utilized and researched really for lead or lead-bismuth. And, furthermore, polonium evaporation rate and bismuth resource are investigated. Main results obtained are as follows: (1) In a refinery, there are enough employment experience for liquid Pb-Bi in period of about 17 years and not corrosion for the thermal conductive materials (1Cr-0.5Mo steel) used under the condition of natural convection with temperature around 400degC. (2) In Russia, extensive experience in the use as Russian submarines and in R and D during about 50 years are available. And as a result, it will be able to lead approximately zero corrosion for Cr-Si materials by adjusting oxygen film with oxygen concentration control between 10{sup -7} to 10{sup -5}% mass. However, the corrosion data are not enough systematically collected involving them in radiation dose field. (3) In liquid-dropping experiment, it is shown that interaction between water and high temperature liquid Pb-Bi is reduced steeply with rising of atmosphere pressure. But, in order to design the second circuit removal model of ADS, the interaction should be evaluated by water continuous injection experiment. (4) Polonium forms PbPo in Pb-Bi, and the evaporation rate become less three factor than that of Po, and furthermore, the rate decreases in the atmosphere. The effects of Po on employee and environment

  15. Mechanisms of thallium-201 myocardial accumulation

    International Nuclear Information System (INIS)

    Wackers, F.J.Th.; Samson, G.


    The practical advantages of 201 Tl over other suitable myocardial imaging agents such as potassium-43 ( 43 K), rubidium-81 ( 81 Rb), and cesium-129 ( 129 Cs), are its relatively low energy photons which makes it possible to employ high-resolution low-energy collimators and its physical half-life of 73 hr which provides sufficiently long shelf-life for practical clinical imaging. Toxicological considerations do not play a role using 201 Tl as thallous chloride. The concentration of thallous chloride in a dose of 2 mCi of 201 Tl is less than 4μg. The LD 50 of thallous chloride is a factor 10 4 more. The minimal lethal dose in man is reported to be 12 mg/kg. The kinetics of 201 Tl, its tissue distributions and radiation doses are assessed, and the effect of cardiac drugs on thallium-201 uptake are discussed. (Auth.)

  16. Bismuth Silver Oxysulfide for Photoconversion Applications: Structural and Optoelectronic Properties

    KAUST Repository

    Baqais, Amal Ali Abdulallh; Curutchet, Antton; Ziani, Ahmed; Ait Ahsaine, Hassan; Sautet, Philippe; Takanabe, Kazuhiro; Le Bahers, Tangui


    Single-phase bismuth silver oxysulfide, BiAgOS, was prepared by a hydrothermal method. Its structural, morphological and optoelectronic properties were investigated and compared with bismuth copper oxysulfide (BiCuOS). Rietveld refinement of the powder X-ray diffraction (XRD) measurements revealed that the BiAgOS and BiCuOS crystals have the same structure as ZrSiCuAs: the tetragonal space group P4/nmm. X-ray photoelectron spectroscopy (XPS) analyses confirmed that the BiAgOS has a high purity, in contrast with BiCuOS, which tends to have Cu vacancies. The Ag has a monovalent oxidation state, whereas Cu is present in the oxidation states of +1 and +2 in the BiCuOS system. Combined with experimental measurements, density functional theory calculations employing the range-separated hybrid HSE06 exchange-correlation functional with spin-orbit coupling quantitatively elucidated photophysical properties such as ab-sorption coefficients, effective masses and dielectric constants. BiCuOS and BiAgOS were found to have indirect bandgaps of 1.1 and 1.5 eV, respectively. Both possess high dielectric constants and low electron and hole effective masses. Therefore, these materials are expected to have high exciton dissociation capabilities and excellent carrier diffusion properties. This study reveals that BiAgOS is a promising candidate for photoconversion applications.

  17. Synthesis and characterization of bismuth alkaline titanate powders

    Energy Technology Data Exchange (ETDEWEB)

    Torres-Huerta, A.M., E-mail: [CICATA-Altamira, Instituto Politecnico Nacional, Km. 14.5 Carretera Tampico Puerto Industrial Altamira, Altamira, Tamps. 89600 (Mexico); Dominguez-Crespo, M.A. [CICATA-Altamira, Instituto Politecnico Nacional, Km. 14.5 Carretera Tampico Puerto Industrial Altamira, Altamira, Tamps. 89600 (Mexico); Hernandez-Perez, M.A. [ESIQIE, Metalurgia, Instituto Politecnico Nacional, Mexico, D. F (Mexico); Garcia-Zaleta, D.S. [CICATA-Altamira, Instituto Politecnico Nacional, Km. 14.5 Carretera Tampico Puerto Industrial Altamira, Altamira, Tamps. 89600 (Mexico); Brachetti-Sibaja, S.B. [CICATA-Altamira, Instituto Politecnico Nacional, Km. 14.5 Carretera Tampico Puerto Industrial Altamira, Altamira, Tamps. 89600 (Mexico); Instituto Tecnologico de Ciudad Madero, Av. 1o. de Mayo esq. Sor Juana Ines de la Cruz s/n Col. Los Mangos C.P.89440 Cd. Madero Tamaulipas (Mexico)


    In this work, samples of bismuth alkaline titanate, (K{sub 0.5}Na{sub 0.5}){sub (2-x/2)}Bi{sub (x/6)}TiO{sub 3}, (x = 0.05-0.75) have been prepared by conventional ceramic technique and molten salts. Metal oxides or carbonates powders were used as starting raw materials. The crystalline phase of the synthesized powders was identified by the X-ray diffraction (XRD) and particle morphology was characterized by scanning electron microscopy (SEM). Solid state reaction method was unsuccessful to obtain pellets. From XRD results, a rhombohedral structure was detected and the parameter lattice were estimated to be a = 5.5478 A and {alpha} = 59.48{sup o}. These parameters were used to refine the structure by Rietveld analysis. SEM results showed several morphologies. Apparently, bismuth is promoting the grain growth whose sizes vary from 30 nm to 180 nm It is expected that these materials can be utilized in practical applications as substitutes for lead zirconatetitanate (PZT)-based ceramics.

  18. Angle Dependence of the Orbital Magnetoresistance in Bismuth

    Directory of Open Access Journals (Sweden)

    Aurélie Collaudin


    Full Text Available We present an extensive study of angle-dependent transverse magnetoresistance in bismuth, with a magnetic field perpendicular to the applied electric current and rotating in three distinct crystallographic planes. The observed angular oscillations are confronted with the expectations of semiclassic transport theory for a multivalley system with anisotropic mobility and the agreement allows us to quantify the components of the mobility tensor for both electrons and holes. A quadratic temperature dependence is resolved. As Hartman argued long ago, this indicates that inelastic resistivity in bismuth is dominated by carrier-carrier scattering. At low temperature and high magnetic field, the threefold symmetry of the lattice is suddenly lost. Specifically, a 2π/3 rotation of magnetic field around the trigonal axis modifies the amplitude of the magnetoresistance below a field-dependent temperature. By following the evolution of this anomaly as a function of temperature and magnetic field, we map the boundary in the (field, temperature plane separating two electronic states. In the less symmetric state, confined to low temperature and high magnetic field, the three Dirac valleys cease to be rotationally invariant. We discuss the possible origins of this spontaneous valley polarization, including a valley-nematic scenario.

  19. Bismuth Silver Oxysulfide for Photoconversion Applications: Structural and Optoelectronic Properties

    KAUST Repository

    Baqais, Amal Ali Abdulallh


    Single-phase bismuth silver oxysulfide, BiAgOS, was prepared by a hydrothermal method. Its structural, morphological and optoelectronic properties were investigated and compared with bismuth copper oxysulfide (BiCuOS). Rietveld refinement of the powder X-ray diffraction (XRD) measurements revealed that the BiAgOS and BiCuOS crystals have the same structure as ZrSiCuAs: the tetragonal space group P4/nmm. X-ray photoelectron spectroscopy (XPS) analyses confirmed that the BiAgOS has a high purity, in contrast with BiCuOS, which tends to have Cu vacancies. The Ag has a monovalent oxidation state, whereas Cu is present in the oxidation states of +1 and +2 in the BiCuOS system. Combined with experimental measurements, density functional theory calculations employing the range-separated hybrid HSE06 exchange-correlation functional with spin-orbit coupling quantitatively elucidated photophysical properties such as ab-sorption coefficients, effective masses and dielectric constants. BiCuOS and BiAgOS were found to have indirect bandgaps of 1.1 and 1.5 eV, respectively. Both possess high dielectric constants and low electron and hole effective masses. Therefore, these materials are expected to have high exciton dissociation capabilities and excellent carrier diffusion properties. This study reveals that BiAgOS is a promising candidate for photoconversion applications.

  20. Magneto-photoconductivity of three dimensional topological insulator bismuth telluride (United States)

    Cao, Bingchen; Eginligil, Mustafa; Yu, Ting


    Magnetic field dependence of the photocurrent in a 3D topological insulator is studied. Among the 3D topological insulators bismuth telluride has unique hexagonal warping and spin texture which has been studied by photoemission, scanning tunnelling microscopy and transport. Here, we report on low temperature magneto-photoconductivity, up to 7 T, of two metallic bismuth telluride topological insulator samples with 68 and 110 nm thicknesses excited by 2.33 eV photon energy along the magnetic field perpendicular to the sample plane. At 4 K, both samples exhibit negative magneto-photoconductance below 4 T, which is as a result of weak-antilocalization of Dirac fermions similar to the previous observations in electrical transport. However the thinner sample shows positive magneto-photoconductance above 4 T. This can be attributed to the coupling of surface states. On the other hand, the thicker sample shows no positive magneto-photoconductance up to 7 T since there is only one surface state at play. By fitting the magneto-photoconductivity data of the thicker sample to the localization formula, we obtain weak antilocalization behaviour at 4, 10, and 20 K, as expected; however, weak localization behaviour at 30 K, which is a sign of surface states masked by bulk states. Also, from the temperature dependence of phase coherence length bulk carrier-carrier interaction is identified separately from the surface states. Therefore, it is possible to distinguish surface states by magneto-photoconductivity at low temperature, even in metallic samples.

  1. Genotoxic effects of bismuth (III oxide nanoparticles by comet assay

    Directory of Open Access Journals (Sweden)

    Reecep Liman


    Full Text Available Bismuth oxide is one of the important transition metal oxides and it has been intensively studied due to their peculiar characteristics (semiconductor band gap, high refractive index, high dielectric permittivity, high oxygen conductivity, resistivity, photoconductivity and photoluminescence etc.. Therefore, it is used such as microelectronics, sensor technology, optical coatings, transparent ceramic glass manufacturing, nanoenergetic gas generator, biosensor for DNA hybridization, potential immobilizing platforms for glucose oxidase and polyphenol oxidase, fuel cells, a additive in paints, an astringent in a variety of medical creams and topical ointments, and for the determination of heavy metal ions in drinking water, mineral water and urine. In addition this, Bismuth (III oxide nanoparticles (BONPs are favorable for the biomolecules adsorption than regular sized particles because of their greater advantages and novel characteristics (much higher specific surface, greater surface free energy, and good electrochemical stability etc.. Genotoxic effects of BONPs were investigated on the root cells of Allium cepa by Comet assay. A. cepa roots were treated with the aqueous dispersions of BONPs at 5 different concentrations (12.5, 25, 50, 75, and 100 ppm for 4 h. A significant increase in DNA damage was also observed at all concentrations of BONPs except 12.5 ppm by Comet assay. The results were also analyzed statistically by using SPSS for Windows; Duncan’s multiple range test was performed. These result indicate that BONPs exhibit genotoxic activity in A. cepa root meristematic cells.

  2. Magnetic anisotropies in ultrathin bismuth iron garnet films

    International Nuclear Information System (INIS)

    Popova, Elena; Franco Galeano, Andres Felipe; Deb, Marwan; Warot-Fonrose, Bénédicte; Kachkachi, Hamid; Gendron, François; Ott, Frédéric


    Ultrathin bismuth iron garnet Bi 3 Fe 5 O 12 films were grown epitaxially on (001)-oriented gadolinium gallium garnet substrates. Film thickness varied from two to three dozens of unit cells. Bi 3 Fe 5 O 12 films grow pseudomorphically on substrates up to a thickness of 20 nm, and then a lattice relaxation occurs. Magnetic properties of the films were studied as a function of bismuth iron garnet thickness. The magnetization and cubic anisotropy decrease with decreasing film thickness. The uniaxial magnetocrystalline anisotropy is constant for all film thicknesses. For two unit cell thick films, the easy magnetization axis changes from in-plane to perpendicular to the plane direction. Such a reorientation takes place as a result of the competition of constant uniaxial perpendicular anisotropy with weakening film magnetization. - Highlights: ► Ultrathin Bi 3 Fe 5 O 12 films were grown epitaxially on structure-matching substrates. ► Magnetic properties of Bi 3 Fe 5 O 12 were studied down to the thickness of 2.5 nm. ► Reorientation of easy magnetization axis as a function of film thickness was observed

  3. Magnetic anisotropies in ultrathin bismuth iron garnet films

    Energy Technology Data Exchange (ETDEWEB)

    Popova, Elena, E-mail: [Groupe d' Etude de la Matière Condensée (GEMaC), CNRS/Université de Versailles-Saint-Quentin, 45 Avenue des Etats-Unis, 78035 Versailles (France); Franco Galeano, Andres Felipe [Laboratoire PROcédés, Matériaux et Energie Solaire (PROMES), CNRS/Université de Perpignan Via Domitia, 52 Avenue Paul Alduy, 66860 Perpignan (France); Deb, Marwan [Groupe d' Etude de la Matière Condensée (GEMaC), CNRS/Université de Versailles-Saint-Quentin, 45 Avenue des Etats-Unis, 78035 Versailles (France); Warot-Fonrose, Bénédicte [Centre d' Elaboration de Matériaux et d' Etudes Structurales (CEMES), CNRS, 29 rue Jeanne Marvig, 31055 Toulouse (France); Transpyrenean Associated Laboratory for Electron Microscopy (TALEM), CEMES-INA, CNRS–Universidad de Zaragoza (Spain); Kachkachi, Hamid [Laboratoire PROcédés, Matériaux et Energie Solaire (PROMES), CNRS/Université de Perpignan Via Domitia, 52 Avenue Paul Alduy, 66860 Perpignan (France); Gendron, François [Institut des NanoSciences de Paris (INSP), CNRS/Université Pierre et Marie Curie-Paris 6, 4 place Jussieu, Boîte courrier 840, 75252 Paris Cedex 05 (France); Ott, Frédéric [Laboratoire Léon Brillouin (LLB), CNRS/CEA, Bâtiment 563, CEA Saclay, 91191 Gif sur Yvette Cedex (France); and others


    Ultrathin bismuth iron garnet Bi{sub 3}Fe{sub 5}O{sub 12} films were grown epitaxially on (001)-oriented gadolinium gallium garnet substrates. Film thickness varied from two to three dozens of unit cells. Bi{sub 3}Fe{sub 5}O{sub 12} films grow pseudomorphically on substrates up to a thickness of 20 nm, and then a lattice relaxation occurs. Magnetic properties of the films were studied as a function of bismuth iron garnet thickness. The magnetization and cubic anisotropy decrease with decreasing film thickness. The uniaxial magnetocrystalline anisotropy is constant for all film thicknesses. For two unit cell thick films, the easy magnetization axis changes from in-plane to perpendicular to the plane direction. Such a reorientation takes place as a result of the competition of constant uniaxial perpendicular anisotropy with weakening film magnetization. - Highlights: ► Ultrathin Bi{sub 3}Fe{sub 5}O{sub 12} films were grown epitaxially on structure-matching substrates. ► Magnetic properties of Bi{sub 3}Fe{sub 5}O{sub 12} were studied down to the thickness of 2.5 nm. ► Reorientation of easy magnetization axis as a function of film thickness was observed.

  4. Superconductivity in Bismuth. A New Look at an Old Problem. (United States)

    Mata-Pinzón, Zaahel; Valladares, Ariel A; Valladares, Renela M; Valladares, Alexander


    To investigate the relationship between atomic topology, vibrational and electronic properties and superconductivity of bismuth, a 216-atom amorphous structure (a-Bi216) was computer-generated using our undermelt-quench approach. Its pair distribution function compares well with experiment. The calculated electronic and vibrational densities of states (eDOS and vDOS, respectively) show that the amorphous eDOS is about 4 times the crystalline at the Fermi energy, whereas for the vDOS the energy range of the amorphous is roughly the same as the crystalline but the shapes are quite different. A simple BCS estimate of the possible crystalline superconducting transition temperature gives an upper limit of 1.3 mK. The e-ph coupling is more preponderant in a-Bi than in crystalline bismuth (x-Bi) as indicated by the λ obtained via McMillan's formula, λc = 0.24 and experiment λa = 2.46. Therefore with respect to x-Bi, superconductivity in a-Bi is enhanced by the higher values of λ and of eDOS at the Fermi energy.

  5. System design study of small lead-bismuth cooled reactor

    International Nuclear Information System (INIS)

    Chikazawa, Yoshitaka; Hori, Toru; Konomura, Mamoru


    In phase II of the feasibility study of JNC, we will make a concept of a dispersion power source reactor with various requirements, such as economical competitiveness and safety. In the study of a small lead-bismuth cooled reactor, a concept whose features are long life core, inherent safety, natural convection of cooling system and steam generators in the reactor vessel has been designed since 2000. The investigations which have been done in 2002 are shown as follows; Safety analysis of UTOP considering uncertainty of reactivity. Possibility of reduction of number of control rods. Estimation of construction cost. Transient analyses of UTOP have been done in considering uncertainty of reactivity in order to show the inherent safety in the probabilistic method. And the inherent safety in UTOP is realized under the condition of considering uncertainty. Transient analyses of UTOP with various numbers of control rods have been done and it is suggested that there is possibility of reduction of the number of control rods considering accident managements. The method of cost estimation is a little modified. The cost of reactor vessel is estimated from that of medium sized lead-bismuth cooled reactor and the estimation of a purity control system is by coolant volume flow rate. The construction cost is estimated 850,000yen/kWe. (author)

  6. Electrodeposition of bismuth alloys by the controlled potential method

    International Nuclear Information System (INIS)

    Lopez Alvarez, F.A.


    We worked with the electrodeposition of three bismuth alloys, the composition of the first electrolyte was: 0.3 g/l. Bi; 20 g/l. Ni; and the conditions were pH = 5.2 - 5.6; T = 25 Centigrade degrees; current density 0.3 A / dm 2 - 6.6 A / dm 2 . Following alloy was between Bi - Pb, composition of the electrolyte was 3.18 g/l. Bi (metallic); 31.81 g/l. Pb (Pb(NO 3 ) 2 ) pH : 1; T = 20 Centigrade degrees; current density 10.20 A/dm 2 . The third electrolyte was Bi-Cu, its composition was: 20.89 g/l. Bi; (metallic) 63.54 g/l Cu (Cu(NO 3 ) 2 ) pH : 1.5 - 1.8; T = 25-30 Centigrade degrees; current density 1-2 A/dm 2 . The best results were obtained with the third electrolyte. The purpose of this work was to experiment with different parameters like temperature, pH and the electrolyte concentration to obtain a bismuth alloy. (Author)

  7. Helicobacter pylori second-line rescue therapy with levofloxacin- and bismuth-containing quadruple therapy, after failure of standard triple or non-bismuth quadruple treatments. (United States)

    Gisbert, J P; Romano, M; Gravina, A G; Solís-Muñoz, P; Bermejo, F; Molina-Infante, J; Castro-Fernández, M; Ortuño, J; Lucendo, A J; Herranz, M; Modolell, I; Del Castillo, F; Gómez, J; Barrio, J; Velayos, B; Gómez, B; Domínguez, J L; Miranda, A; Martorano, M; Algaba, A; Pabón, M; Angueira, T; Fernández-Salazar, L; Federico, A; Marín, A C; McNicholl, A G


    The most commonly used second-line Helicobacter pylori eradication regimens are bismuth-containing quadruple therapy and levofloxacin-containing triple therapy, both offering suboptimal results. Combining bismuth and levofloxacin may enhance the efficacy of rescue eradication regimens. To evaluate the efficacy and tolerability of a second-line quadruple regimen containing levofloxacin and bismuth in patients whose previous H. pylori eradication treatment failed. This was a prospective multicenter study including patients in whom a standard triple therapy (PPI-clarithromycin-amoxicillin) or a non-bismuth quadruple therapy (PPI-clarithromycin-amoxicillin-metronidazole, either sequential or concomitant) had failed. Esomeprazole (40 mg b.d.), amoxicillin (1 g b.d.), levofloxacin (500 mg o.d.) and bismuth (240 mg b.d.) was prescribed for 14 days. Eradication was confirmed by (13) C-urea breath test. Compliance was determined through questioning and recovery of empty medication envelopes. Incidence of adverse effects was evaluated by questionnaires. 200 patients were included consecutively (mean age 47 years, 67% women, 13% ulcer). Previous failed therapy included: standard clarithromycin triple therapy (131 patients), sequential (32) and concomitant (37). A total of 96% took all medications correctly. Per-protocol and intention-to-treat eradication rates were 91.1% (95%CI = 87-95%) and 90% (95%CI = 86-94%). Cure rates were similar regardless of previous (failed) treatment or country of origin. Adverse effects were reported in 46% of patients, most commonly nausea (17%) and diarrhoea (16%); 3% were intense but none was serious. Fourteen-day bismuth- and levofloxacin-containing quadruple therapy is an effective (≥90% cure rate), simple and safe second-line strategy in patients whose previous standard triple or non-bismuth quadruple (sequential or concomitant) therapies have failed. © 2015 John Wiley & Sons Ltd.

  8. Complexometric consequent titration of bismuth-titanium mixtures in the μg-region

    International Nuclear Information System (INIS)

    Schaefer, H.


    A quantitative method is described for the determination of microquantities of bismuth and titanium. Both metals are determined complexometrically with EDTA and potentiometric equivalence point indication using a Cu-ion sensitive electrode in a consequent titration. The analysis is conducted as back-titration with standard Cu-solution. The relative error of the determination is 0.8% for bismuth (50-100 μg) and for titanium (10-30 μg) at 1.0%. Under the chosen conditions, it is possible to determine as little as 15 μg bismuth and 5 μg titanium by means of this procedure. (author)

  9. Specificities of reactor coolant pumps units with lead and lead-bismuth coolant

    International Nuclear Information System (INIS)

    Beznosov, A.V.; Anotonenkov, M.A.; Bokov, P.A.; Baranova, V.S.; Kustov, M.S.


    The analysis results of impact of lead and lead-bismuth coolants specific properties on the coolants flow features in flow channels of the main and auxiliary circulating pumps are presented. Impossibility of cavitation initiation in flow channels of vane pumps pumping lead and lead-bismuth coolants was demonstrated. The experimental research results of discontinuity of heavy liquid metal coolant column were presented and conditions of gas cavitation initiation in coolant flow were discussed. Invalidity of traditional calculation methods of water and sodium coolants circulation pumps calculations for lead and lead-bismuth coolants circulation pumps was substantiated [ru

  10. Topological Insulator State in Thin Bismuth Films Subjected to Plane Tensile Strain (United States)

    Demidov, E. V.; Grabov, V. M.; Komarov, V. A.; Kablukova, N. S.; Krushel'nitskii, A. N.


    The results of experimental examination of galvanomagnetic properties of thin bismuth films subjected to plane tensile strain resulting from the difference in thermal expansion coefficients of the substrate material and bismuth are presented. The resistivity, the magnetoresistance, and the Hall coefficient were studied at temperatures ranging from 5 to 300 K in magnetic fields as strong as 0.65 T. Carrier densities were calculated. A considerable increase in carrier density in films thinner than 30 nm was observed. This suggests that surface states are more prominent in thin bismuth films on mica substrates, while the films themselves may exhibit the properties of a topological insulator.

  11. Chemical structure of bismuth compounds determines their gastric ulcer healing efficacy and anti-Helicobacter pylori activity. (United States)

    Sandha, G S; LeBlanc, R; Van Zanten, S J; Sitland, T D; Agocs, L; Burford, N; Best, L; Mahoney, D; Hoffman, P; Leddin, D J


    The recognition of the role of Helicobacter pylori in the pathogenesis of peptic ulcer disease has led to renewed interest in bismuth pharmacology since bismuth compounds have both anti-Helicobacter pylori and ulcer healing properties. The precise chemical structure of current bismuth compounds is not known. This has hindered the development of new and potentially more efficacious formulations. We have created two new compounds, 2-chloro-1,3-dithia-2-bismolane (CDTB) and 1,2-[bis(1,3-dithia-2-bismolane)thio]ethane (BTBT), with known structure. In a rat model of gastric ulceration, BTBT was comparable to, and CDTB was significantly less effective than colloidal bismuth subcitrate in healing cryoprobe-induced ulcers. However, both BTBT and CDTB inhibited H. pylori growth in vitro at concentrations <1/10 that of colloidal bismuth subcitrate. The effects on ulcer healing are not mediated by suppression of acid secretion, pepsin inhibition, or prostaglandin production. Since all treated animals received the same amount of elemental bismuth, it appears that the efficacy of bismuth compounds varies with compound structure and is not simply dependent on the delivery of bismuth ion. Because the structure of the novel compounds is known, our understanding of the relationship of bismuth compound structure and to biologic activity will increase. In the future it may be possible to design other novel bismuth compounds with more potent anti-H. pylori and ulcer healing effects.

  12. 41 CFR 50-201.101 - Employees affected. (United States)


    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Employees affected. 50-201.101 Section 50-201.101 Public Contracts and Property Management Other Provisions Relating to Public Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 201-GENERAL REGULATIONS § 50-201.101 Employees...

  13. Theoretical Investigation of Bismuth-Based Semiconductors for Photocatalytic Applications

    KAUST Repository

    Laradhi, Shaikhah


    Converting solar energy to clean fuel has gained remarkable attention as an emerged renewable energy resource but optimum efficiency in photocatalytic applications has not yet been reached. One of the dominant factors is designing efficient photocatalytic semiconductors. The research reveals a theoretical investigation of optoelectronic properties of bismuth-based metal oxide and oxysulfide semiconductors using highly accurate first-principles quantum method based on density functional theory along with the range-separated hybrid HSE06 exchange-correlation functional. First, bismuth titanate compounds including Bi12TiO20, Bi4Ti3O12, and Bi2Ti2O7 were studied in a combined experimental and theoretical approach to prove its photocatalytic activity under UV light. They have unique bismuth layered structure, tunable electronic properties, high dielectric constant and low electron and effective masses in one crystallographic direction allowing for good charge separation and carrier diffusion properties. The accuracy of the investigation was determined by the good agreement between experimental and theoretical values. Next, BiVO4 with the highest efficiency for oxygen evolution was investigated. A discrepancy between the experimental and theoretical bandgap was reported and inspired a systematic study of all intrinsic defects of the material and the corresponding effect on the optical and transport properties. A candidate defective structure was proposed for an efficient photocatalytic performance. To overcome the carrier transport limitation, a mild hydrogen treatment was also introduced. Carrier lifetime was enhanced due to a significant reduction of trap-assisted recombination, either via passivation of deep trap states or reduction of trap state density. Finally, an accurate theoretical approach to design a new family of semiconductors with enhanced optoelectronic properties for water splitting was proposed. We simulated the solid solutions Bi1−xRExCuOS (RE = Y, La

  14. Dicty_cDB: VHO201 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHO201 (Link to dictyBase) - - - Contig-U12425-1 VHO201P (Link... to Original site) VHO201F 596 VHO201Z 398 VHO201P 974 - - Show VHO201 Library VH (Link to library) Clone ID VHO201 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12425-1 Original site URL http://dict...SGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICTNALYDLFLAASDQINFQQCKENGFEVLKKLINS...CKREXMELRIPTFVSNILNTLFLHSLGVEGLFRISGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICT

  15. Status and future application of pilot lead-bismuth target circuit TC-1 for ADS

    Energy Technology Data Exchange (ETDEWEB)

    Ignatiev, S.; Leonchuk, M.; Orlov, Y.; Pankratov, D.; Reshetnikova, O.; Suvorov, G.; Zabudko, A. [Institute for Physics and Power Engineering, Obninsk (Russian Federation); Stepanov, V.; Klimov, N. [Experimental and Design Organization, Gidropress, Podolsk (Russian Federation); Hechanova, A.; Ma, J. [Nevada Univ., Las Vegas, NV (United States); Li, N. [Los Alamos National Lab., NM (United States); Gudowski, W. [International Science and Technology Center, Moscow (Russian Federation)


    A complicated evolution, status and future application of the pilot molten lead-bismuth target circuit of 1 MW proton beam power (TC-1) as an important part of a target-blanket accelerator driven system (ADS), that has been developed, created and twice tested under the auspice of the International Science and Technology Center (ISTC), is analyzed. The target complex TC-1 is a circulation lead-bismuth loop whose beam window is made of ferritic steel EP-823 (this steel was used in the past as material of fuel rods cladding in reactors cooled with lead-bismuth). At present TC-1 is operating at coolant temperature up to 300 C degrees and will be used to study different issues linked to the use of lead-bismuth: -) interaction with air, water and hydrogen, -) different regimes of flow, -) corrosion, -) filtering, or -) slag formation.

  16. Shielding property of bismuth glass based on MCNP 5 and WINXCOM simulated calculation

    International Nuclear Information System (INIS)

    Zhang Zhicheng; Zhang Jinzhao; Liu Ze; Lu Chunhai; Chen Min


    Background: Currently, lead glass is widely used as observation window, while lead is toxic heavy metal. Purpose: Non-toxic materials and their shielding effects are researched in order to find a new material to replace lead containing material. Methods: The mass attenuation coefficients of bismuth silicate glass were investigated with gamma-ray's energy at 0.662 MeV, 1.17 MeV and 1.33 MeV, respectively, by MCNP 5 (Monte Carlo) and WINXCOM program, and compared with those of the lead glass. Results: With attenuation factor K, shielding and mechanical properties taken into consideration bismuth glass containing 50% bismuth oxide might be selected as the right material. Dose rate distributions of water phantom were calculated with 2-cm and 10-cm thick glass, respectively, irradiated by 137 Cs and 60 Co in turn. Conclusion: Results show that the bismuth glass may replace lead glass for radiation shielding with appropriate energy. (authors)

  17. Corrosion by liquid lead and lead-bismuth: experimental results review and analysis

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Jinsuo [Los Alamos National Laboratory


    Liquid metal technologies for liquid lead and lead-bismuth alloy are under wide investigation and development for advanced nuclear energy systems and waste transmutation systems. Material corrosion is one of the main issues studied a lot recently in the development of the liquid metal technology. This study reviews corrosion by liquid lead and lead bismuth, including the corrosion mechanisms, corrosion inhibitor and the formation of the protective oxide layer. The available experimental data are analyzed by using a corrosion model in which the oxidation and scale removal are coupled. Based on the model, long-term behaviors of steels in liquid lead and lead-bismuth are predictable. This report provides information for the selection of structural materials for typical nuclear reactor coolant systems when selecting liquid lead or lead bismuth as heat transfer media.

  18. On the origin of near-IR luminescence in SiO{sub 2} glass with bismuth as the single dopant. Formation of the photoluminescent univalent bismuth silanolate by SiO{sub 2} surface modification

    Energy Technology Data Exchange (ETDEWEB)

    Romanov, A.N., E-mail:; Haula, E.V.; Shashkin, D.P.; Vtyurina, D.N.; Korchak, V.N.


    Near infrared photoluminescent bismuth(I) silanolate centers ((≡Si-O){sub 3}Si–O-Bi) were prepared on the surface of SiO{sub 2} xerogel, by the treatment in the vapors of bismuth(I) chloride. The optical properties of these groups are almost identical to that of photoluminescent centers in the bulk SiO{sub 2} glasses with bismuth as the single dopant. - Highlights: • univalent bismuth silanolate can be prepared on SiO{sub 2} surface by treatment in BiCl vapors. • univalent bismuth silanolate is responsible for NIR photoluminescence in Bi-doped SiO{sub 2} glass. • univalent bismuth silanolate is the active center in laser, operating on Bi-doped SiO{sub 2} fiber.

  19. Study of irradiation defects in bismuth by electric transport measurements

    International Nuclear Information System (INIS)

    Le Goff, M.


    Pure monocrystalline bismuth is irradiated near 4K by electrons of different energies. Irradiation effects are measured by galvanomagnetic properties at low temperature. Frenkel pairs created during irradiation have a strong effect on carrier mobilities. The data are quantitatively analyzed assuming a rigid band model. After irradiation with 1 MeV electrons, each Frankel pair created corresponds to a total charge of 0.14 electrons. This result obtained by magnetoresistance and Hall effect is confirmed by Shubnikov-de Haas experiments. There is a linear variation between the excess carrier density (p-n) and the Frenkel pair concentration. The more important step of annealing is observed around 40-50 K. This step is attributed to interstitial migration. Resistivity presents a minimum at low temperature after irradiation with electrons of energy over 1.3 MeV. This is explained by virtual bound levels near the Fermi level. The Kondo effect bound to magnetic defects is discussed [fr

  20. Ni-rich precipitates in a lead bismuth eutectic loop

    International Nuclear Information System (INIS)

    Kikuchi, K.; Saito, S.; Hamaguchi, D.; Tezuka, M.


    Solidified LBE was sampled from the specimens, electro-magnetic pump, filter, drain valve and oxygen sensor at the JAEA Lead Bismuth Loop-1 (JLBL-1) where the structural material was made of SS316. The concentration of Ni, Fe and Cr in LBE were analyzed by the Inductive Coupled Plasma atomic emission spectrometer. It was concluded that the solution of Ni into LBE was not saturated although the concentration of Fe and Cr almost achieved to the values in the literature. A needle-type structure appeared on the surface of solidified LBE inside the tube specimens. It was found to be Ni-rich precipitates by X-ray analyses (Field Emission Scanning Electron Microscope, FE-SEM). LBE samples collected from a circulating loop after discharging did not show the amount of impurities equivalent to the LBE bulk property.

  1. Ni-rich precipitates in a lead bismuth eutectic loop

    Energy Technology Data Exchange (ETDEWEB)

    Kikuchi, K., E-mail: [Ibaraki University, IQBRC, Tokai, Ibaraki 319-1106 (Japan); Saito, S.; Hamaguchi, D.; Tezuka, M. [J-PARC Center, JAEA, Tokai, Ibaraki 319-1195 (Japan)


    Solidified LBE was sampled from the specimens, electro-magnetic pump, filter, drain valve and oxygen sensor at the JAEA Lead Bismuth Loop-1 (JLBL-1) where the structural material was made of SS316. The concentration of Ni, Fe and Cr in LBE were analyzed by the Inductive Coupled Plasma atomic emission spectrometer. It was concluded that the solution of Ni into LBE was not saturated although the concentration of Fe and Cr almost achieved to the values in the literature. A needle-type structure appeared on the surface of solidified LBE inside the tube specimens. It was found to be Ni-rich precipitates by X-ray analyses (Field Emission Scanning Electron Microscope, FE-SEM). LBE samples collected from a circulating loop after discharging did not show the amount of impurities equivalent to the LBE bulk property.

  2. Ni-rich precipitates in a lead bismuth eutectic loop (United States)

    Kikuchi, K.; Saito, S.; Hamaguchi, D.; Tezuka, M.


    Solidified LBE was sampled from the specimens, electro-magnetic pump, filter, drain valve and oxygen sensor at the JAEA Lead Bismuth Loop-1 (JLBL-1) where the structural material was made of SS316. The concentration of Ni, Fe and Cr in LBE were analyzed by the Inductive Coupled Plasma atomic emission spectrometer. It was concluded that the solution of Ni into LBE was not saturated although the concentration of Fe and Cr almost achieved to the values in the literature. A needle-type structure appeared on the surface of solidified LBE inside the tube specimens. It was found to be Ni-rich precipitates by X-ray analyses (Field Emission Scanning Electron Microscope, FE-SEM). LBE samples collected from a circulating loop after discharging did not show the amount of impurities equivalent to the LBE bulk property.

  3. Coolant Chemistry Control: Oxygen Mass Transport in Lead Bismuth Eutectic

    International Nuclear Information System (INIS)

    Weisenburger, A.; Mueller, G.; Bruzzese, C.; Glass, A.


    In lead-bismuth cooled transmutation systems, oxygen, dissolved in the coolant at defined quantities, is required for stable long-term operation by assuring the formation of protective oxide scales on structural steel surfaces. Extracted oxygen must be permanently delivered to the system and distributed in the entire core. Therefore, coolant chemistry control involves detailed knowledge on oxygen mass transport. Beside the different flow regimes a core might have stagnant areas at which oxygen delivery can only be realised by diffusion. The difference between oxygen transport in flow paths and in stagnant zones is one of the targets of such experiments. To investigate oxygen mass transport in flowing and stagnant conditions, a dedicated facility was designed based on computational fluid dynamics (CFD). CFD also was applied to define the position of oxygen sensors and ultrasonic Doppler velocimetry transducers for flow measurements. This contribution will present the test facility, design relevant CFD calculations and results of first tests performed. (authors)

  4. Bismuth Sodium Titanate Based Materials for Piezoelectric Actuators. (United States)

    Reichmann, Klaus; Feteira, Antonio; Li, Ming


    The ban of lead in many electronic products and the expectation that, sooner or later, this ban will include the currently exempt piezoelectric ceramics based on Lead-Zirconate-Titanate has motivated many research groups to look for lead-free substitutes. After a short overview on different classes of lead-free piezoelectric ceramics with large strain, this review will focus on Bismuth-Sodium-Titanate and its solid solutions. These compounds exhibit extraordinarily high strain, due to a field induced phase transition, which makes them attractive for actuator applications. The structural features of these materials and the origin of the field-induced strain will be revised. Technologies for texturing, which increases the useable strain, will be introduced. Finally, the features that are relevant for the application of these materials in a multilayer design will be summarized.

  5. Lead-Bismuth technology ; corrosion resistance of structural materials

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Ji Young; Park, Won Seok [Korea Atomic Energy Research Institute, Taejeon (Korea)


    Lead-Bismuth (Pb-Bi) eutectic alloy was determined as a coolant material for the HYPER system being studied by KAERI. The Pb-Bi alloy as a coolant, has a number of the favorable thermo-physical and technological properties, while it is comparatively corrosive to the structural materials. It is necessary to solve this problem for providing a long failure-proof operation of the facilities with Pb-Bi coolant. It seems to be possible to maintain corrosion resistance on structural material up to 600 deg C by using of various technologies, but it needs more studies for application to large-scale NPPs. 22 refs., 11 figs., 7 tabs. (Author)

  6. Stimulated Raman scattering of sub-millimeter waves in bismuth (United States)

    Kumar, Pawan; Tripathi, V. K.


    A high-power sub-millimeter wave propagating through bismuth, a semimetal with non-spherical energy surfaces, parametrically excites a space-charge mode and a back-scattered electromagnetic wave. The free carrier density perturbation associated with the space-charge wave couples with the oscillatory velocity due to the pump to derive the scattered wave. The scattered and pump waves exert a pondermotive force on electrons and holes, driving the space-charge wave. The collisional damping of the decay waves determines the threshold for the parametric instability. The threshold intensity for 20 μm wavelength pump turns out to be ˜2×1012 W/cm2. Above the threshold, the growth rate scales increase with ωo, attain a maximum around ωo=6.5ωp, and, after this, falls off.

  7. Radiopacity and histological assessment of Portland cement plus bismuth oxide. (United States)

    Coutinho-Filho, Tauby; De-Deus, Gustavo; Klein, Leila; Manera, Gisele; Peixoto, Carla; Gurgel-Filho, Eduardo Diogo


    The present study evaluated the subcutaneous connective tissue reactions and the radiopacity of MTA, Portland cement (PC), and Portland cement plus bismuth oxide (BO). Forty rats were divided into 5 groups (n = 8 per group): A1: Control (empty capsule); A2: Pro-Root MTA; A3: PC; A4: PC + BO 1:1; and A5: PC + BO 2:1. Polyethylene tubes were filled with the test materials and standardized radiographic images were taken. Histological evaluation was done after 7 and 60 days. Student t test and Fisher's test were used in the statistical analysis (P A4 > A5 > A3. No differences were found for the tissue response in the 2 experimental periods. A positive correlation between BO concentration and radiopacity of PC was determined. The histological evaluation suggests that all studied materials were biocompatible at 7 and 60 days.

  8. High ionic conductivity in confined bismuth oxide-based heterostructures

    Directory of Open Access Journals (Sweden)

    Simone Sanna


    Full Text Available Bismuth trioxide in the cubic fluorite phase (δ-Bi2O3 exhibits the highest oxygen ionic conductivity. In this study, we were able to stabilize the pure δ-Bi2O3 at low temperature with no addition of stabilizer but only by engineering the interface, using highly coherent heterostructures made of alternative layers of δ-Bi2O3 and Yttria Stabilized Zirconia (YSZ, deposited by pulsed laser deposition. The resulting [δ-Bi2O3/YSZ] heterostructures are found to be stable over a wide temperature range (500-750 °C and exhibits stable high ionic conductivity over a long time comparable to the value of the pure δ-Bi2O3, which is approximately two orders of magnitude higher than the conductivity of YSZ bulk.

  9. High ionic conductivity in confined bismuth oxide-based heterostructures

    DEFF Research Database (Denmark)

    Sanna, Simone; Esposito, Vincenzo; Christensen, Mogens


    Bismuth trioxide in the cubic fluorite phase (δ-Bi2O3) exhibits the highest oxygen ionic conductivity. In this study, we were able to stabilize the pure -Bi2O3 at low temperature with no addition of stabilizer but only by engineering the interface, using highly coherent heterostructures made...... of alternative layers of δ-Bi2O3 and Yttria Stabilized Zirconia (YSZ), deposited by pulsed laser deposition. The resulting [δ-Bi2O3=YSZ] heterostructures are found to be stable over a wide temperature range (500-750 °C) and exhibits stable high ionic conductivity over a long time comparable to the value...... of the pure δ-Bi2O3, which is approximately two orders of magnitude higher than the conductivity of YSZ bulk....

  10. Study of bismuth minerals belonging to the mineralogical collection from the National Museum

    International Nuclear Information System (INIS)

    Baptista, A.; Baptista, N.R.


    With the purpose of searching the presence of Tellurium minerals in the Ouro Preto-Mariana country, Minas Gerais State, and considering the existence of a great number of minerals in which this element come across allied with Bismuth, samples of the mineralogical collection of the Museu Nacional, proceeding that region and classified as Bismuth minerals were studied by X-ray fluorescence analysis and diffractometric analysis. In this report the results of this research are presented. (Author)

  11. About thermo-electric properties of bismuth telluride doped by gadolinium

    International Nuclear Information System (INIS)

    Akperov, M.M.; Ismailov, Sh.S.; Shukyurova, A.A.


    Results of study of the Gd impurities effect on the bismuth telluride thermo-electric properties are presented. The experiment was carried out within the temperature range T=300-700 K. It is determined, that at temperature increase the energy level is appreciably closing up to bismuth telluride forbidden zone which makes up 0.16-0.24 eV. Such anomalous energy properties of gadolinium in telluride affect on material thermoelectric properties

  12. An acclerator-based installation of small power with the lead-bismuth coolant

    Energy Technology Data Exchange (ETDEWEB)

    Gorshkov, V.T.; Yefimov, E.I.; Novikova, N.N. [Research and Development Bereau, Podolsk (Russian Federation)] [and others


    The structure of the accelerator-based installation is described that includes the subcritical reactor-blanket with power 15 MW(h) cooled with lead-bismuth, the lead-bismuth flow target where a beam of {alpha}-particle is injected, the equipment of a primary and secondary curcuits. Some results of calculations and estimations are discussed that have been carried out to justify the target and blanket constructions. Some main characteristics of the installation are presented.

  13. Bismuth oxide nanorods based immunosensor for mycotoxin detection

    Energy Technology Data Exchange (ETDEWEB)

    Solanki, Pratima R., E-mail: [DST Centre for Biomolecular Electronics, CSIR-National Physical Laboratory, K.S. Krishnan Marg, New Delhi (India); Special Centre for Nano Sciences, Jawaharlal Nehru University, New Delhi 110067 (India); Singh, Jay [DST Centre for Biomolecular Electronics, CSIR-National Physical Laboratory, K.S. Krishnan Marg, New Delhi (India); Department of Applied Chemistry and Polymer Technology, Delhi Technological University, Shahbad Daulatpur, Main Bawana Road, Delhi 110042 (India); Rupavali, Bharti [DST Centre for Biomolecular Electronics, CSIR-National Physical Laboratory, K.S. Krishnan Marg, New Delhi (India); Tiwari, Sachchidanand [Special Centre for Nano Sciences, Jawaharlal Nehru University, New Delhi 110067 (India); Malhotra, Bansi D., E-mail: [DST Centre for Biomolecular Electronics, CSIR-National Physical Laboratory, K.S. Krishnan Marg, New Delhi (India); Department of Biotechnology, Delhi Technological University, Shahbad Daulatpur, Main Bawana Road, Delhi 110042 (India)


    We report results of the studies relating to fabrication of an efficient immunosensor based on bismuth oxide nanorods (nBi{sub 2}O{sub 3}), electrophoretically deposited onto indium-tin-oxide (ITO) coated glass substrate. This immunosensor was fabricated by immobilization of anti-aflatoxin monoclonal antibodies (Ab-AFB1) and bovine serum albumin (BSA) for aflatoxin B1 detection. The structural and morphological studies of n-Bi{sub 2}O{sub 3} have been carried out by XRD, UV–vis spectrophotometer; SEM, AFM and FTIR. It was found that the nBi{sub 2}O{sub 3} provided improved sensing characteristics to the electrode interface in terms of electroactive surface area, diffusion coefficient, charge transfer rate constant and electron transfer kinetics. The results of electrochemical response studies of this BSA/Ab-AFB1/nBi{sub 2}O{sub 3}/ITO immunosensor revealed good linearity in the range of 1–70 ng dL{sup −1} with low detection limit of 8.715 ng/dL, improved sensitivity of 1.132 μA/(ng/dL cm{sup −2}), regression coefficient R{sup 2} of 0.918 and reproducibility of > 11 times. The association constant for the BSA/Ab-AFB1/nBi{sub 2}O{sub 3}/ITO immunosensor was determined as 7.318 ng/dL. - Highlights: • Use of Bismuth oxide nanorods for aflatoxin B1 detection. • It improved the electrochemical properties. • First report on nBi{sub 2}O{sub 3} for mycotoxin detection.

  14. Magnetic properties of the binary Nickel/Bismuth alloy

    Energy Technology Data Exchange (ETDEWEB)

    Keskin, Mustafa; Şarlı, Numan, E-mail:


    Highlights: • We model and investigate the magnetic properties of the Ni/Bi alloy within the EFT. • Magnetizations of the Ni/Bi alloy are observed as Bi1 > Bi2 > Ni/Bi > Ni at T < Tc. • Magnetization of the Bi1 is dominant and Ni is at least dominant T < Tc. • Total magnetization of the Ni/Bi alloy is close to those of Ni at T < Tc. • Hysteresis curves are overlap at T < 0.1 and they behave separately at T > 0.1. - Abstract: Magnetic properties of the binary Nickel/Bismuth alloy (Ni/Bi) are investigated within the effective field theory. The Ni/Bi alloy has been modeled that the rhombohedral Bi lattice is surrounded by the hexagonal Ni lattice. According to lattice locations, Bi atoms have two different magnetic properties. Bi1 atoms are in the center of the hexagonal Ni atoms (Ni/Bi1 single layer) and Bi2 atoms are between two Ni/Bi1 bilayers. The Ni, Bi1, Bi2 and Ni/Bi undergo a second-order phase transition from the ferromagnetic phase to paramagnetic phase at Tc = 1.14. The magnetizations of the Ni/Bi alloy are observed as Bi1 > Bi2 > Ni/Bi > Ni at T < Tc; hence the magnetization of the Bi1 is dominant and Ni is at least dominant. However, the total magnetization of the Ni/Bi alloy is close to magnetization of the Ni at T < Tc. The corcivities of the Ni, Bi1, Bi2 and Ni/Bi alloy are the same with each others, but the remanence magnetizations are different. Our theoretical results of M(T) and M(H) of the Ni/Bi alloy are in quantitatively good agreement with the some experimental results of binary Nickel/Bismuth systems.

  15. 23 CFR 230.201 - Purpose. (United States)


    ... HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CIVIL RIGHTS EXTERNAL PROGRAMS Supportive Services for Minority, Disadvantaged, and Women Business Enterprises § 230.201 Purpose. To prescribe the... programs for minority, disadvantaged, and women business enterprises. ...

  16. Quantitative analysis of thallium-201 myocardial scintigraphy

    International Nuclear Information System (INIS)

    Kanemoto, Nariaki; Hoer, G.; Johost, S.; Maul, F.-D.; Standke, R.


    The method of quantitative analysis of thallium-201 myocardial scintigraphy using computer assisted technique was described. Calculated indices are washout factor, vitality index and redistribution factor. Washout factor is the ratio of counts at certain period of time after exercise and immediately after exercise. This value is neccessary for the evaluation of redistribution to the ischemic areas in serial imagings to correct the Tl-201 washout from the myocardium under the assumption that the washout is constant in the whole myocardium. Vitality index is the ratio between the Tl-201 uptake in the region of interest and that of the maximum. Redistribution factor is the ratio of the redistribution in the region of interest in serial imagings after exercise to that of immediately after exercise. Four examples of exercise Tl-201 myocardial scintigrams and the quantitative analyses before and after the percutaneous transluminal coronary angioplasty were presented. (author)

  17. 46 CFR 201.74 - Declaratory orders. (United States)


    ... PROCEDURE Formal Proceedings, Notice, Pleadings, Replies (Rule 7) § 201.74 Declaratory orders. The... the issuance thereof shall state clearly and concisely the nature of the controversy or uncertainty...

  18. 46 CFR 201.72 - Notice. (United States)


    ... Formal Proceedings, Notice, Pleadings, Replies (Rule 7) § 201.72 Notice. Notice of any matter which may... Register in sufficient detail and in sufficient time to apprise interested persons of the nature of the...

  19. 7 CFR 1260.201 - Reports. (United States)


    ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... Promotion and Research Order Reports, Books and Records § 1260.201 Reports. Each importer, person marketing... of Management and Budget. ...

  20. 7 CFR 201.50 - Weed seed. (United States)


    ... REGULATIONS Purity Analysis in the Administration of the Act § 201.50 Weed seed. Seeds (including bulblets or... sieve are considered weed seeds. For wild onion and wild garlic (Allium spp.) bulblets classed as inert...

  1. Production of thallium 201 for medical use

    International Nuclear Information System (INIS)

    Venikov, N.I.; Konyakhin, N.A.; Kozlova, M.D.; Volkova, N.M.


    An important product among the radiopharmaceuticals currently used in cardiology is T1 201 chloride, due to its nuclear-physical properties and its clinical value as a diagnostic tool. The authors explain and discuss the basic characteristics which determine the radiopharmaceutical quality of T1 201: its radiochemical purity and its chemical impurity content, which depend on the target-irradiation conditions - type of nuclear reaction, target material and design, particle energy, irradiation time - and the reprocessing technology. A production flow chart is presented which shows that ions are accelerated within a wide mass and energy range suitable for the production of T1 201 in different nuclear reactions. Cyclotron reconstruction for T1 201 production is discussed

  2. Studies of corrosion resistance of Japanese steels in liquid lead-bismuth

    International Nuclear Information System (INIS)

    Kamata, Kin-ya; Ono, Hiroshi; Kitano, Teruaki; Ono, Mikinori


    Liquid lead-bismuth has attractive characteristics as a coolant in future fast reactors and Accelerator Driven Sub-critical Systems (ADS) applications. The corrosion behavior of structural materials in lead-bismuth eutectic is one of key problems in developing nuclear power plants and installations using lead-bismuth coolant. Our experiences with heat exchangers using liquid lead-bismuth and the results of corrosion tests of Japanese steels are reported in this paper. A series of corrosion tests was carried out in collaboration with the Institute of Physics and Power Engineering (IPPE). Test specimens of various Japanese steels were exposed in a non-isothermal forced circulation loop. The influence of maximum temperature and oxygen content in lead bismuth were chosen for study as the primary causes of corrosion in Japanese steels. After the corrosion tests, corrosion behavior was analyzed by visual inspection, measurement of weight loss and metallurgical examination of the microstructure of the corroded zone. The corrosion mechanism in liquid lead bismuth is discussed on the basis of the metallurgical examination of the corroded zone. (author)

  3. Nano sized bismuth oxy chloride by metal organic chemical vapour deposition

    Energy Technology Data Exchange (ETDEWEB)

    Jagdale, Pravin, E-mail: [Department of Applied Science and Technology (DISAT), Politecnico di Torino, 10129 (Italy); Castellino, Micaela [Center for Space Human Robotics, Istituto Italiano di Tecnologia, Corso Trento 21, 10129 Torino (Italy); Marrec, Françoise [Laboratory of Condensed Matter Physics, University of Picardie Jules Verne (UPJV), Amiens 80039 (France); Rodil, Sandra E. [Instituto de Investigaciones en Materiales, Universidad Nacional Autonoma de Mexicom (UNAM), Mexico D.F. 04510 (Mexico); Tagliaferro, Alberto [Department of Applied Science and Technology (DISAT), Politecnico di Torino, 10129 (Italy)


    Metal organic chemical vapour deposition (MOCVD) method was used to prepare thin films of bismuth based nano particles starting from bismuth salts. Nano sized bismuth oxy chloride (BiOCl) crystals were synthesized from solution containing bismuth chloride (BiCl{sub 3}) in acetone (CH{sub 3}-CO-CH{sub 3}). Self-assembly of nano sized BiOCl crystals were observed on the surface of silicon, fused silica, copper, carbon nanotubes and aluminium substrates. Various synthesis parameters and their significant impact onto the formation of self-assembled nano-crystalline BiOCl were investigated. BiOCl nano particles were characterized by X-ray diffraction, X-ray photoelectron spectroscopy, field emission scanning electron microscopy, energy-dispersive X-ray spectroscopy and Micro-Raman spectroscopy. These analyses confirm that bismuth nanometer-sized crystal structures showing a single tetragonal phase were indeed bismuth oxy chloride (BiOCl) square platelets 18–250 nm thick and a few micrometres wide.

  4. Evaluation of the strength and radiopacity of Portland cement with varying additions of bismuth oxide. (United States)

    Saliba, E; Abbassi-Ghadi, S; Vowles, R; Camilleri, J; Hooper, S; Camilleri, J


    To study the effect of addition of various proportions of bismuth oxide on compressive strength and radiopacity of Portland cement. The compressive strength of white Portland cement and cement replaced with 10, 15, 20, 25 and 30% bismuth oxide was evaluated by testing cylinders 6 mm in diameter and 12 mm high. Twelve cylinders were tested for each material under study. The radiopacity of the cements tested was evaluated using an aluminium step-wedge and densitometer. The optical density was compared with the relevant thickness of aluminium (Al). Statistical analysis was performed using Analysis of Variance (ANOVA) with P = 0.05 and Tukey test to perform multiple comparison tests. Various additions of bismuth oxide had no significant effect on the strength of the material when compared with the unmodified Portland cement (P > 0.05). The radiopacity of the cements tested ranged from 2.02 mm Al for Portland cement to 9.79 mm Al for the highest bismuth replacement. Addition of bismuth oxide did not affect the compressive strength of Portland cement. All the bismuth oxide cement mixtures had radio-opacities higher than 3 mm thickness of aluminium.

  5. Extreme Pressure Synergistic Mechanism of Bismuth Naphthenate and Sulfurized Isobutene Additives (United States)

    Xu, Xin; Hu, Jianqiang; Yang, Shizhao; Xie, Feng; Guo, Li

    A four-ball tester was used to evaluate the tribological performances of bismuth naphthenate (BiNap), sulfurized isobutene (VSB), and their combinations. The results show that the antiwear properties of BiNap and VSB are not very visible, but they possess good extreme pressure (EP) properties, particularly sulfur containing bismuth additives. Synergistic EP properties of BiNap with various sulfur-containing additives were investigated. The results indicate that BiNap exhibits good EP synergism with sulfur-containing additives. The surface analytical tools, such as X-ray photoelectron spectrometer (XPS) scanning electron microscope (SEM) and energy dispersive X-ray (EDX), were used to investigate the topography, composition contents, and depth profile of some typical elements on the rubbing surface. Smooth topography of wear scar further confirms that the additive showed good EP capacities, and XPS and EDX analyzes indicate that tribochemical mixed protective films composed of bismuth, bismuth oxides, sulfides, and sulfates are formed on the rubbing surface, which improves the tribological properties of lubricants. In particular, a large number of bismuth atoms and bismuth sulfides play an important role in improving the EP properties of oils.

  6. Intrinsic stress of bismuth oxide thin films: effect of vapour chopping and air ageing

    International Nuclear Information System (INIS)

    Patil, R B; Puri, R K; Puri, V


    Bismuth oxide thin films of thickness 1000 A 0 have been prepared by thermal oxidation (in air) of vacuum evaporated bismuth thin films (on glass substrate) at different oxidation temperatures and duration. Both the vapour chopped and nonchopped bismuth oxide thin films showed polycrystalline and polymorphic structure. The monoclinic bismuth oxide was found to be predominant in both the cases. The effect of vapour chopping and air exposure for 40 days on the intrinsic stress of bismuth oxide thin films has been studied. The vapour chopped films showed low (3.92 - 4.80 x 10 9 N/m 2 ) intrinsic stress than those of nonchopped bismuth oxide thin films (5.77 - 6.74 x 10 9 N/m 2 ). Intrinsic stress was found to increase due to air ageing. The effect of air ageing on the vapour chopped films was found low. The vapour chopped films showed higher packing density. Higher the packing density, lower the film will age. The process of chopping vapour flow creates films with less inhomogenety i.e. a low concentration of flaws and non-planar defects which results in lower intrinsic stress

  7. Value of thyroid scintigraphy using thallium 201

    International Nuclear Information System (INIS)

    Hermans, J.; Parmentier, S.; Beauduin, M.; Schmitz, A.; Therasse, G.


    The value of thallium-201 scintigraphy in the differential diagnosis of cold thyroid nodules demonstrated on the thyroid scan with technetium-99m was emphasized. From the clinical results it can be deduced that if a cold nodule is positive with thallium-201 the lesion has a high percentage of being a high risk of malignancy. This information might be quite valuable in selecting patients for operation [fr

  8. Thallium-201 stress imaging in hypertensive patients

    International Nuclear Information System (INIS)

    Schulman, D.S.; Francis, C.K.; Black, H.R.; Wackers, F.J.


    To assess the potential effect of hypertension on the results of thallium-201 stress imaging in patients with chest pain, 272 thallium-201 stress tests performed in 133 hypertensive patients and 139 normotensive patients over a 1-year period were reviewed. Normotensive and hypertensive patients were similar in age, gender distribution, prevalence of cardiac risk factors (tobacco smoking, hyperlipidemia, and diabetes mellitus), medications, and clinical symptoms of coronary disease. Electrocardiographic criteria for left ventricular hypertrophy were present in 16 hypertensive patients. Stepwise probability analysis was used to determine the likelihood of coronary artery disease for each patient. In patients with mid to high likelihood of coronary disease (greater than 25% probability), abnormal thallium-201 stress images were present in 54 of 60 (90%) hypertensive patients compared with 51 of 64 (80%) normotensive patients. However, in 73 patients with a low likelihood of coronary disease (less than or equal to 25% probability), abnormal thallium-201 stress images were present in 21 patients (29%) of the hypertensive group compared with only 5 of 75 (7%) of the normotensive patients (p less than 0.001). These findings suggest that in patients with a mid to high likelihood of coronary artery disease, coexistent hypertension does not affect the results of thallium-201 exercise stress testing. However, in patients with a low likelihood of coronary artery disease, abnormal thallium-201 stress images are obtained more frequently in hypertensive patients than in normotensive patients

  9. Extraction of lanthanide elements and bismuth in molten lithium chloride-liquid bismuth-lithium alloy system

    International Nuclear Information System (INIS)

    Harada, Makoto; Adachi, Motonari; Kai, Yuichi; Koike, Kenichi


    The equilibrium distributions of neodymium and samarium between molten LiCl and liquid Bi-Li alloy were measured in a wide range of Li-mole fraction in the alloy phase, X Li . These lanthanide elements were extracted through redox reactions. In high X Li range, X Li > 0.03, the distributions of neodymium and bismuth in the salt phase increased markedly. The anomalous increase is attributed to the formation of the compound comprized of Nd, Li, Bi and oxygen in the salt phase. The reaction processes in samarium and neodymium were very fast and the extraction rates are controlled by the diffusion processes of the solutes and metallic lithium. (author)

  10. NZG 201 portable spectrometric unit

    International Nuclear Information System (INIS)

    Jursa, P.; Novakova, O.; Slezak, V.

    The NZG 201 spectrometric unit is a portable single-channel processing unit supplied from the mains or a battery which allows the qualitative and quantitative measurement of different types of ionizing radiation when connected to a suitable detection unit. The circuit layout and the choice of control elements makes the spectrometric unit suitable for use with scintillation detector units. The spectrometric unit consists of a pulse amplifier, an amplitude pulse analyzer, a pulse counter, a pulse rate counter with an output for a recorder, a high voltage source and a low voltage source. The block diagram is given. All circuits are modular and are mounted on PCB's. The apparatus is built in a steel cabinet with a raised edge which protects the control elements. The linear pulse amplifier has a maximum gain of 1024, the pulse counter has a maximum capacity of 10 6 -1 imp and time resolution better than 0.5 μs. The temperature interval at which the apparatus is operational is 0 to 45 degC, its weight is 12.5 kg and dimensions 36x280x310 mm, energy range O.025 to 2.5 MeV, for 137 Cs the energy resolution is 8 to 10%. The spectrometric unit NZG 2O1 may, with regard to its parameters, number and range of control elements, be used as a universal measuring unit. (J.P.)

  11. Neutron activation determination of impurities in high-purity bismuth with separation of matrix in form of hydroxide

    International Nuclear Information System (INIS)

    Artyukhin, P.I.; Shavinskij, B.M.; Mityakin, Yu.L.


    The technique of neutron activation determination of 15 impurity elements (Au, Ag, Ba, Cd, Co, Cs, Cu, Hg, K, Na, Ni, Se, Sr, Te, Zn) in high-purity bismuth (impurity content is approximately 10 -6 -10 -10 %) is presented. Bismuth hydroxide precipitation by ammonia from nitric acid solutions was used to separate bismuth from alkali, alkaline earth metals and elements forming stable ammines. Gold, selenium and tellurium are isolated in the form of metals at reduction by muriatic hydrazine. Results of analyzing two samples of special purity bismuth are presented. Neutron flux comprised 0.8-1x10 13 n/cm 2 xs. Radiation time was equal to 90 hours

  12. Corrosion behavior of Si-enriched steels for nuclear applications in liquid lead–bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Kurata, Yuji, E-mail: [Japan Atomic Energy Agency, Tokai-mura, Ibaraki-ken 319-1195 (Japan)


    Highlights: ► The corrosion behavior of Si-enriched steels in liquid lead–bismuth was studied. ► The corrosion tests were conducted at the two controlled oxygen levels. ► The Si addition reduces the scale thickness under the high oxygen condition. ► The Si addition has no significant effect under the low oxygen condition. -- Abstract: The corrosion behavior of Si-enriched steels in liquid lead–bismuth was studied in order to develop accelerator driven systems for transmutation of long-lived radioactive wastes and lead–bismuth cooled fast reactors. The corrosion tests of 316SS, Si-enriched 316SS, Mod.9Cr–1Mo steel (T91) and Si-enriched T91 were conducted at 550 °C in liquid lead–bismuth at the two controlled oxygen levels. Both the additions of 2.5 wt.% Si to 316SS and 1.5 wt.% Si to T91 had the effect of reducing the thickness of oxide layer in liquid lead–bismuth at the high oxygen concentration (2.5 × 10{sup −5} wt.%). Although the Si addition to 316SS reduced the depth of ferritization caused by Ni dissolution in liquid lead–bismuth at the low oxygen concentration (4.4 × 10{sup −8} wt.%), it could not suppress the ferritization and the penetration of Pb and Bi completely. The Si addition to T91 did not have the effect of preventing the penetration of Pb and Bi in the liquid lead–bismuth at the low oxygen concentration. The oxide scales formed on both Si-enriched steels did not have sufficient corrosion resistance under the low oxygen condition.

  13. Zerovalent bismuth nanoparticles inhibit Streptococcus mutans growth and formation of biofilm

    Directory of Open Access Journals (Sweden)

    Hernandez-Delgadillo R


    Full Text Available Rene Hernandez-Delgadillo1, Donaji Velasco-Arias2, David Diaz2, Katiushka Arevalo-Niño1, Marianela Garza-Enriquez1, Myriam A De la Garza-Ramos1, Claudio Cabral-Romero11Instituto de Biotecnologia, Centro de Investigacion y Desarrollo en Ciencias de la Salud, CIDICS, Facultad de Odontologia, Universidad Autonoma de Nuevo Leon, UANL, Monterrey, Nuevo Leon, 2Facultad de Quimica, Universidad Nacional Autonoma de Mexico, Distrito Federal, MexicoBackground and methods: Despite continuous efforts, the increasing prevalence of resistance among pathogenic bacteria to common antibiotics has become one of the most significant concerns in modern medicine. Nanostructured materials are used in many fields, including biological sciences and medicine. While some bismuth derivatives has been used in medicine to treat vomiting, nausea, diarrhea, and stomach pain, the biocidal activity of zerovalent bismuth nanoparticles has not yet been studied. The objective of this investigation was to analyze the antimicrobial activity of bismuth nanoparticles against oral bacteria and their antibiofilm capabilities.Results: Our results showed that stable colloidal bismuth nanoparticles had 69% antimicrobial activity against Streptococcus mutans growth and achieved complete inhibition of biofilm formation. These results are similar to those obtained with chlorhexidine, the most commonly used oral antiseptic agent. The minimal inhibitory concentration of bismuth nanoparticles that interfered with S. mutans growth was 0.5 mM.Conclusion: These results suggest that zerovalent bismuth nanoparticles could be an interesting antimicrobial agent to be incorporated into an oral antiseptic preparation.Keywords: zerovalent bismuth nanoparticles, antimicrobial agent, biofilm, Streptococcus mutans

  14. Bismuth oxide aqueous colloidal nanoparticles inhibit Candida albicans growth and biofilm formation

    Directory of Open Access Journals (Sweden)

    Hernandez-Delgadillo R


    Full Text Available Rene Hernandez-Delgadillo,1 Donaji Velasco-Arias,3 Juan Jose Martinez-Sanmiguel,2 David Diaz,3 Inti Zumeta-Dube,3 Katiushka Arevalo-Niño,1 Claudio Cabral-Romero2 1Facultad de Ciencias Biológicas, Instituto de Biotecnologia, Universidad Autonoma de Nuevo Leon, UANL, Monterrey, Mexico; 2Facultad de Odontología, Universidad Autonoma de Nuevo Leon, UANL, Monterrey, México; 3Facultad de Quimica, Universidad Nacional Autonoma de Mexico, UNAM, Distrito Federal, México Abstract: Multiresistance among microorganisms to common antimicrobials has become one of the most significant concerns in modern medicine. Nanomaterials are a new alternative to successfully treat the multiresistant microorganisms. Nanostructured materials are used in many fields, including biological sciences and medicine. Recently, it was demonstrated that the bactericidal activity of zero-valent bismuth colloidal nanoparticles inhibited the growth of Streptococcus mutans; however the antimycotic potential of bismuth nanostructured derivatives has not yet been studied. The main objective of this investigation was to analyze the fungicidal activity of bismuth oxide nanoparticles against Candida albicans, and their antibiofilm capabilities. Our results showed that aqueous colloidal bismuth oxide nanoparticles displayed antimicrobial activity against C. albicans growth (reducing colony size by 85% and a complete inhibition of biofilm formation. These results are better than those obtained with chlorhexidine, nystatin, and terbinafine, the most effective oral antiseptic and commercial antifungal agents. In this work, we also compared the antimycotic activities of bulk bismuth oxide and bismuth nitrate, the precursor metallic salt. These results suggest that bismuth oxide colloidal nanoparticles could be a very interesting candidate as a fungicidal agent to be incorporated into an oral antiseptic. Additionally, we determined the minimum inhibitory concentration for the synthesized

  15. Sulfate-reducing bacteria slow intestinal transit in a bismuth-reversible fashion in mice. (United States)

    Ritz, N L; Lin, D M; Wilson, M R; Barton, L L; Lin, H C


    Hydrogen sulfide (H 2 S) serves as a mammalian cell-derived gaseous neurotransmitter. The intestines are exposed to a second source of this gas by sulfate-reducing bacteria (SRB). Bismuth subsalicylate binds H 2 S rendering it insoluble. The aim of this study was to test the hypothesis that SRB may slow intestinal transit in a bismuth-reversible fashion. Eighty mice were randomized to five groups consisting of Live SRB, Killed SRB, SRB+Bismuth, Bismuth, and Saline. Desulfovibrio vulgaris, a common strain of SRB, was administered by gavage at the dose of 1.0 × 10 9 cells along with rhodamine, a fluorescent dye. Intestinal transit was measured 50 minutes after gavage by euthanizing the animals, removing the small intestine between the pyloric sphincter and the ileocecal valve and visualizing the distribution of rhodamine across the intestine using an imaging system (IVIS, Perkin-Elmer). Intestinal transit (n=50) was compared using geometric center (1=minimal movement, 100=maximal movement). H 2 S concentration (n=30) was also measured when small intestinal luminal content was allowed to generate this gas. The Live SRB group had slower intestinal transit as represented by a geometric center score of 40.2 ± 5.7 when compared to Saline: 73.6 ± 5.7, Killed SRB: 77.9 ± 6.9, SRB+Bismuth: 81.0 ± 2.0, and Bismuth: 73.3 ± 4.2 (Pfashion in mice. Our results demonstrate that intestinal transit is slowed by SRB and this effect could be abolished by H 2 S-binding bismuth. © 2016 John Wiley & Sons Ltd.

  16. Spectroscopic Characterization of Extracellular Polymeric Substances from Escherichia coli and Serratia marcescens: Suppression using Sub-Inhibitory Concentrations of Bismuth Thiols

    Energy Technology Data Exchange (ETDEWEB)

    Badireddy, Appala R.; Korpol, Bhoom Reddy; Chellam, Shankararaman; Gassman, Paul L.; Engelhard, Mark H.; Lea, Alan S.; Rosso, Kevin M.


    Free and capsular EPS produced by Escherichia coli and Serratia marcescens were characterized in detail using Fourier transform infrared spectroscopy (FTIR), X-ray photoelectron spectroscopy (XPS), and Auger electron spectroscopy (AES). Total EPS production decreased upon treatment with sub-inhibitory concentrations of lipophilic bismuth thiols (bismuth dimercaptopropanol, BisBAL; bismuth ethanedithiol, BisEDT; and bismuth pyrithione, BisPYR), BisBAL being most effective. Bismuth thiols also influenced acetylation and carboxylation of polysaccharides in EPS from S. marcescens. Extensive homology between EPS samples in the presence and absence of bismuth was observed with proteins, polysaccharides, and nucleic acids varying predominantly only in the total amount expressed. Second derivative analysis of the amide I region of FTIR spectra revealed decreases in protein secondary structures in the presence of bismuth thiols. Hence, anti-fouling properties of bismuth thiols appear to originate in their ability to suppress O-acetylation and protein secondary structures in addition to total EPS secretion.

  17. Thallium-201 scintigraphy in unstable angina pectoris

    International Nuclear Information System (INIS)

    Wackers, F.J.T.; Lie, K.I.; Liem, K.L.; Sokole, E.B.; Samson, G.; Van Der Schoot, J.B.; Durrer, D.


    Thallium-201 scintigraphy was performed during the pain free period in 98 patients with unstable angina. Scintiscans were positive in 39 patients, questionable in 27 patients and normal in 32 patients. Eighty-one patients responded favorably to treatment (group I). Seventeen patients had complicated courses (group II) and despite maximal treatment with propranolol either developed infarction (six patients) or continued to have angina necessitating coronary surgery (11 patients). In group I during the pain free period 26 of 81 patients had positive thallium-201 scans, whereas 20 patients had an abnormal ECG at that time; during angina 18 patients had transient ECG changes. In group II during the pain free period 13 of 17 patients had positive scans, whereas two patients had abnormal ECG at that time; during angina 12 patients showed transient ECG changes. The sensitivity to recognize group II was 76% for thallium-201 scintigraphy, 11% for ECG during the pain free period; 70% for ECG during angina; 94% for the combination of either positive scans or abnormal ECG. Thus, positive thallium-201 scans occur in patients with unstable angina, positive scans can be obtained during the pain free period, thallium-201 scans are more frequently positive in patients with complicated course

  18. Reactive magnetron sputtering deposition of bismuth tungstate onto titania nanoparticles for enhancing visible light photocatalytic activity

    Energy Technology Data Exchange (ETDEWEB)

    Ratova, Marina, E-mail: [Surface Engineering Group, School of Engineering, Manchester Metropolitan University, Manchester, M1 5GD (United Kingdom); Kelly, Peter J.; West, Glen T. [Surface Engineering Group, School of Engineering, Manchester Metropolitan University, Manchester, M1 5GD (United Kingdom); Tosheva, Lubomira; Edge, Michele [School of Science and the Environment, Manchester Metropolitan University, Manchester M1 5GD (United Kingdom)


    Highlights: • Bismuth tungstate coatings were deposited by reactive magnetron sputtering. • Oscillating bowl was introduced to the system to enable coating of nanopartulates. • Deposition of Bi{sub 2}WO{sub 6} enhanced visible light activity of titania nanoparticles. • The best results were obtained for coating with Bi:W ratio of approximately 2:1. • Deposition of Bi{sub 2}WO{sub 6} onto TiO{sub 2} resulted in more efficient electron-hole separation. - Abstract: Titanium dioxide − bismuth tungstate composite materials were prepared by pulsed DC reactive magnetron sputtering of bismuth and tungsten metallic targets in argon/oxygen atmosphere onto anatase and rutile titania nanoparticles. The use of an oscillating bowl placed beneath the two magnetrons arranged in a co-planar closed field configuration enabled the deposition of bismuth tungstate onto loose powders, rather than a solid substrate. The atomic ratio of the bismuth/tungsten coatings was controlled by varying the power applied to each target. The effect of the bismuth tungstate coatings on the phase, optical and photocatalytic properties of titania was investigated by X-ray diffraction, energy-dispersive X-ray spectroscopy (EDX), Brunauer–Emmett–Teller (BET) surface area measurements, transmission electron microscopy (TEM), UV–vis diffuse reflectance spectroscopy and an acetone degradation test. The latter involved measurements of the rate of CO{sub 2} evolution under visible light irradiation of the photocatalysts, which indicated that the deposition of bismuth tungstate resulted in a significant enhancement of visible light activity, for both anatase and rutile titania particles. The best results were achieved for coatings with a bismuth to tungsten atomic ratio of 2:1. In addition, the mechanism by which the photocatalytic activity of the TiO{sub 2} nanoparticles was enhanced by compounding it with bismuth tungstate was studied by microwave cavity perturbation. The results of these

  19. ONC201: Stressing tumors to death. (United States)

    Endo Greer, Yoshimi; Lipkowitz, Stanley


    The small molecule ONC201 was identified in a screen for compounds that would induce expression of the gene encoding tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) in tumors and thus cause an autocrine- or paracrine-induced death in tumor cells. Two Research Articles in this issue of Science Signaling by Ishizawa et al. and Kline et al. describe how ONC201 can also trigger cytotoxicity by inducing a stress response. The mechanisms of the stress response induced differ between hematological malignancies and solid tumors, highlighting the complexity of ONC201-induced toxicity and raising intriguing issues of tissue-specific pathways activated by the drug. Copyright © 2016, American Association for the Advancement of Science.

  20. Bismuth nanoparticles synthesized by laser ablation in lubricant oils for tribological tests

    Energy Technology Data Exchange (ETDEWEB)

    Flores-Castañeda, M., E-mail: [Universidad Autónoma del Estado de México, Av. Instituto Literario No. 100, Oriente Col. Centro, Toluca, Estado de México C.P. 50000, México (Mexico); Instituto Nacional de Investigaciones Nucleares, Carretera México-Toluca s/n, La Marquesa, Ocoyoacac, Edo. de México C.P. 52750, México (Mexico); Camps, E. [Instituto Nacional de Investigaciones Nucleares, Carretera México-Toluca s/n, La Marquesa, Ocoyoacac, Edo. de México C.P. 52750, México (Mexico); Camacho-López, M. [Universidad Autónoma del Estado de México, Av. Instituto Literario No. 100, Oriente Col. Centro, Toluca, Estado de México C.P. 50000, México (Mexico); Muhl, S. [Instituto de Investigación en Materiales (UNAM), Circuito Exterior, Ciudad Universitaria, Coyoacán, 04510 México, D.F., México (Mexico); and others


    Highlights: • Bismuth nanoparticles have been obtained by laser ablation of solids in liquids. • The technique allows controlling the size and concentration of the samples. • Bi np’s in base oils can improve the tribological characteristics of the lubricant. - Abstract: The improvement of the tribological properties of mineral base oils through the addition of bismuth nanoparticles as an additive, together with the idea of obtaining lubricants free of heavy metals, was evaluated. Bismuth nanoparticles were produced directly in the heavy and light viscosity mineral base oils (BS900 and BS6500) using the technique of laser ablation of solids immersed in liquids. Transmission electron microscopy measurements showed the presence of pure bismuth nanoparticles. Small Angle X-ray Scattering (SAXS) measurements showed that the average size of the nanoparticles was between 7 and 65 nm depending on the experimental conditions used. The tribological properties of the base oil with the bismuth nanoparticles additives were evaluated using a four-ball tester. Tests were performed using the base oil with and without Bi nanoparticles. It was observed that the coefficient of friction of the oil decrease with an increasing concentration of the nanoparticles. The results also showed that the wear rate was reduced when the Bi nanoparticle additives were used.

  1. Photoinduced switchable wettability of bismuth coating with hierarchical dendritic structure between superhydrophobicity and superhydrophilicity

    Energy Technology Data Exchange (ETDEWEB)

    Su, Chunping; Lu, Zhong; Zhao, Huiping; Yang, Hao, E-mail:; Chen, Rong, E-mail:


    Graphical abstract: - Highlights: • Hierarchical bismuth nanostructures were synthesized by galvanic replacement reaction. • The bismuth coating shows superhydrophobicity after being modified by stearic acid. • Wetting transition could be realized by alternation of irradiation and modification. - Abstract: Special wettability such as superhydrophobicity and superhydrophilicity has aroused considerable attention in recent years, especially for the surface that can be switched between superhydrophobicity and superhydrophilicity. In this work, hierarchical bismuth nanostructures with hyperbranched dendritic architectures were synthesized via the galvanic replacement reaction between zinc plate and BiCl{sub 3} in ethylene glycol solution, which was composed of a trunk, branches (secondary branch), and leaves (tertiary branch). After being modified by stearic acid, the as-prepared bismuth coating shows superhydrophobicity with a high water contact angle of 164.8° and a low sliding angle of 3°. More importantly, a remarkable surface wettability transition between superhydrophobicity and superhydrophilicity could be easily realized by the alternation of UV–vis irradiation and modification with stearic acid. The tunable wetting behavior of bismuth coating could be used as smart materials to make a great application in practice.

  2. Electronic Properties of Tin and Bismuth from Angular Correlation of Annihilation Photons

    DEFF Research Database (Denmark)

    Mogensen, O.E.; Trumpy, Georg


    ) deformed bismuth. For both metals, the single-crystal angular-correlation curves lie near to the free-electron parabola. The tin curves show more anisotropy than the bismuth curves. An important result is the clear anisotropy found in the high-momentum part of the curves—the tails—for both metals. Little......A linear slit setup has been used to obtain results of angular-correlation measurements in (a) tin single crystals in three orientations: [001], [100], and [110], (b) bismuth single crystals in four orientations: [111], [100], [1¯10], and [2¯1¯1], (c) solid and liquid tin and bismuth, and (d...... of the liquid-metal curves are smaller and of another form than the tails of polycrystalline curves; no Gaussian with only one adjustable constant factor can give a fit to both tails. No useful method for interpreting liquid-metal angular-correlation curves seems to exist. Two deformed bismuth samples gave...

  3. Characterization and re-activation of oxygen sensors for use in liquid lead-bismuth

    International Nuclear Information System (INIS)

    Kurata, Yuji; Abe, Yuji; Futakawa, Masatoshi; Oigawa, Hiroyuki


    Control of oxygen concentration in liquid lead-bismuth is one of the most important tasks to develop accelerator driven systems. In order to improve the reliability of oxygen sensors, re-activation treatments were investigated as well as characterization of oxygen sensors for use in liquid lead-bismuth. The oxygen sensor with a solid electrolyte of yttria-stabilized zirconia and a Pt/gas reference electrode showed almost the same electromotive force values in gas and liquid lead-bismuth, respectively, as the theoretical ones at temperatures above 400 deg. C or 450 deg. C. After long-term use of 6500 h, the outputs of the sensor became incorrect in liquid lead-bismuth. The state of the sensor that indicated incorrect outputs could not be recovered by cleaning with a nitric acid. However, it was found that the oxygen sensor became a correct sensor indicating theoretical values in liquid lead-bismuth after re-activation by the Pt-treatment of the outer surface of the sensor.

  4. Bismuth nanoparticles synthesized by laser ablation in lubricant oils for tribological tests

    International Nuclear Information System (INIS)

    Flores-Castañeda, M.; Camps, E.; Camacho-López, M.; Muhl, S.


    Highlights: • Bismuth nanoparticles have been obtained by laser ablation of solids in liquids. • The technique allows controlling the size and concentration of the samples. • Bi np’s in base oils can improve the tribological characteristics of the lubricant. - Abstract: The improvement of the tribological properties of mineral base oils through the addition of bismuth nanoparticles as an additive, together with the idea of obtaining lubricants free of heavy metals, was evaluated. Bismuth nanoparticles were produced directly in the heavy and light viscosity mineral base oils (BS900 and BS6500) using the technique of laser ablation of solids immersed in liquids. Transmission electron microscopy measurements showed the presence of pure bismuth nanoparticles. Small Angle X-ray Scattering (SAXS) measurements showed that the average size of the nanoparticles was between 7 and 65 nm depending on the experimental conditions used. The tribological properties of the base oil with the bismuth nanoparticles additives were evaluated using a four-ball tester. Tests were performed using the base oil with and without Bi nanoparticles. It was observed that the coefficient of friction of the oil decrease with an increasing concentration of the nanoparticles. The results also showed that the wear rate was reduced when the Bi nanoparticle additives were used

  5. Facile solvothermal synthesis of a graphene nanosheet-bismuth oxide composite and its electrochemical characteristics

    Energy Technology Data Exchange (ETDEWEB)

    Wang Huanwen [Key Laboratory of Eco-Environment-Related Polymer Materials of Ministry of Education, Key Laboratory of Polymer Materials of Gansu Province, College of Chemistry and Chemical Engineering, Northwest Normal University, Lanzhou 730070 (China); Hu Zhongai, E-mail: [Key Laboratory of Eco-Environment-Related Polymer Materials of Ministry of Education, Key Laboratory of Polymer Materials of Gansu Province, College of Chemistry and Chemical Engineering, Northwest Normal University, Lanzhou 730070 (China); Chang Yanqin; Chen Yanli; Lei Ziqiang; Zhang Ziyu; Yang Yuying [Key Laboratory of Eco-Environment-Related Polymer Materials of Ministry of Education, Key Laboratory of Polymer Materials of Gansu Province, College of Chemistry and Chemical Engineering, Northwest Normal University, Lanzhou 730070 (China)


    This work demonstrates a novel and facile route for preparing graphene-based composites comprising of metal oxide nanoparticles and graphene. A graphene nanosheet-bismuth oxide composite as electrode materials of supercapacitors was firstly synthesized by thermally treating the graphene-bismuth composite, which was obtained through simultaneous solvothermal reduction of the colloidal dispersions of negatively charged graphene oxide sheets in N,N-dimethyl formamide (DMF) solution of bismuth cations at 180 {sup o}C. The morphology, composition, and microstructure of the composites together with pure graphite oxide, and graphene were characterized using powder X-ray diffraction (XRD), FT-IR, field emission scanning electron microscopy (FESEM), transmission electron microscope (TEM), thermogravimetry and differential thermogravimetry (TG-DTG). The electrochemical behaviors were measured by cyclic voltammogram (CV), galvanostatic charge-discharge and electrochemical impedance spectroscopy (EIS). The specific capacitance of 255 F g{sup -1} (based on composite) is obtained at a specific current of 1 A g{sup -1} as compared with 71 F g{sup -1} for pure graphene. The loaded-bismuth oxide achieves a specific capacitance as high as 757 F g{sup -1} even at 10 A g{sup -1}. In addition, the graphene nanosheet-bismuth oxide composite electrode exhibits the excellent rate capability and well reversibility.

  6. Facile solvothermal synthesis of a graphene nanosheet-bismuth oxide composite and its electrochemical characteristics

    International Nuclear Information System (INIS)

    Wang Huanwen; Hu Zhongai; Chang Yanqin; Chen Yanli; Lei Ziqiang; Zhang Ziyu; Yang Yuying


    This work demonstrates a novel and facile route for preparing graphene-based composites comprising of metal oxide nanoparticles and graphene. A graphene nanosheet-bismuth oxide composite as electrode materials of supercapacitors was firstly synthesized by thermally treating the graphene-bismuth composite, which was obtained through simultaneous solvothermal reduction of the colloidal dispersions of negatively charged graphene oxide sheets in N,N-dimethyl formamide (DMF) solution of bismuth cations at 180 o C. The morphology, composition, and microstructure of the composites together with pure graphite oxide, and graphene were characterized using powder X-ray diffraction (XRD), FT-IR, field emission scanning electron microscopy (FESEM), transmission electron microscope (TEM), thermogravimetry and differential thermogravimetry (TG-DTG). The electrochemical behaviors were measured by cyclic voltammogram (CV), galvanostatic charge-discharge and electrochemical impedance spectroscopy (EIS). The specific capacitance of 255 F g -1 (based on composite) is obtained at a specific current of 1 A g -1 as compared with 71 F g -1 for pure graphene. The loaded-bismuth oxide achieves a specific capacitance as high as 757 F g -1 even at 10 A g -1 . In addition, the graphene nanosheet-bismuth oxide composite electrode exhibits the excellent rate capability and well reversibility.

  7. Bismuth Modified Carbon-Based Electrodes for the Determination of Selected Neonicotinoid Insecticides

    Directory of Open Access Journals (Sweden)

    Marko Rodić


    Full Text Available Two types of bismuth modified electrodes, a bismuth-film modified glassy carbon (BiF-GCE and a bismuth bulk modified carbon paste, were applied for the determination of selected nitroguanidine neonicotinoid insecticides. The method based on an ex situ prepared BiF-GCE operated in the differential pulse voltammetric (DPV mode was applied to determine clothianidin in the concentration range from 2.5 to 23 μg cm−3 with a relative standard deviation (RSD not exceeding 1.5%. The tricresyl phosphate-based carbon paste electrodes (TCP-CPEs, bulk modified with 5 and 20 w/w% of bismuth, showed a different analytical performance in the determination of imidacloprid, regarding the peak shape, potential window, and noise level. The TCP-CPE with 5% Bi was advantageous, and the developed DPV method based on it allowed the determination in the concentration range from 1.7 to 60 μg cm−3 with an RSD of 2.4%. To get a deeper insight into the morphology of the bismuth-based sensor surfaces, scanning electron microscopic measurements were performed of both the surface film and the bulk modified electrodes.

  8. Electrochemical study on determination of diffusivity, activity and solubility of oxygen in liquid bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Ganesan, Rajesh [Liquid Metals and Structural Chemistry Division, Chemistry Group, Indira Gandhi Centre for Atomic Research, Kalpakkam 603 102 (India); Gnanasekaran, T. [Liquid Metals and Structural Chemistry Division, Chemistry Group, Indira Gandhi Centre for Atomic Research, Kalpakkam 603 102 (India)]. E-mail:; Srinivasa, Raman S. [Department of Metallurgical Engineering and Materials Science, Indian Institute of Technology Bombay, Mumbai 400 076 (India)


    Diffusivity of oxygen in liquid bismuth was measured by potentiostatic method and is given bylg(D{sub O}{sup Bi}/cm{sup 2}.s{sup -1})(+/-0.042)=-3.706-1377/(TK{sup -1})(804bismuth was determined by coulometric titrations and using the measured data standard free energy of dissolution of oxygen in liquid bismuth was derived for the reaction:1/2O{sub 2}(g)=[O]{sub Bi}(at.%)and is given by{delta}G{sub O(Bi)}{sup o}/(J.g-atomO{sup -1})(+/-720)=-108784+20.356TK{sup -1}(753bismuth was derived as a function of temperature and is given by the following expressions:lg(S/at%O)(+/-0.05)=-4476/TK{sup -1}+4.05(753bismuth is compared with the literature data.

  9. Crystallinity and electrical properties of neodymium-substituted bismuth titanate thin films

    International Nuclear Information System (INIS)

    Chen, Y.-C.; Hsiung, C.-P.; Chen, C.-Y.; Gan, J.-Y.; Sun, Y.-M.; Lin, C.-P.


    We report on the properties of Nd-substituted bismuth titanate Bi 4-x Nd x Ti 3 O 12 (BNdT) thin films for ferroelectric non-volatile memory applications. The Nd-substituted bismuth titanate thin films fabricated by modified chemical solution deposition technique showed much improved properties compared to pure bismuth titanate. A pyrochlore free crystalline phase was obtained at a low annealing temperature of 640 deg. C and grain size was found to be considerably increased as the annealing temperature increased. The film properties were found to be strongly dependent on the Nd content and annealing temperatures. The measured dielectric constant of BNdT thin films was in the range 172-130 for Bi 4-x Nd x Ti 3 O 12 with x 0.0-0.75. Ferroelectric properties of Nd-substituted bismuth titanate thin films were significantly improved compared to pure bismuth titanate. For example, the observed 2P r and E c for Bi 3.25 Nd 0.75 Ti 3 O 12 , annealed at 680 deg. C, were 38 μC/cm 2 and 98 kV/cm, respectively. The improved microstructural and ferroelectric properties of BNdT thin films suggest their suitability for high density ferroelectric random access memory applications

  10. Emulsion liquid membrane for selective extraction of bismuth from nitrate medium

    International Nuclear Information System (INIS)

    Mokhtari, Bahram; Pourabdollah, Kobra


    The novelty of this work is the selective extraction of bismuth ions from nitrate medium by emulsion liquid membrane. Di(2-ethylhexyl)phosphoric acid was used as extractant of bismuth ions from nitrate medium by emulsion liquid membrane, and Triton X-100 was used as the biodegradable surfactant in n-pentanol n-pentanol bulk membrane. The extraction of bismuth ions was evaluated by the yield of extraction. The experimental parameters were evaluated and were optimized. They included the ratio of di(2-ethylhexyl)phosphoric acid concentration to the concentration of /Triton X-100 concentration (1.0 : 0.5% w/w), nature of diluents (n-pentanol), nature and concentration of the stripping solution (sulfuric acid, 0.5M), stirring speed (1,800 rpm) and equilibrium time of extraction (20min), initial feed solution of bismuth (350 ppm) and the volume ratio of the internal stripping phase to the membrane phase (14 times). The experimental parameters of kinetic extraction revealed that the bismuth ions were extracted at 100% 97%

  11. Emulsion liquid membrane for selective extraction of bismuth from nitrate medium

    Energy Technology Data Exchange (ETDEWEB)

    Mokhtari, Bahram; Pourabdollah, Kobra [Islamic Azad University, Shahreza (Iran, Islamic Republic of)


    The novelty of this work is the selective extraction of bismuth ions from nitrate medium by emulsion liquid membrane. Di(2-ethylhexyl)phosphoric acid was used as extractant of bismuth ions from nitrate medium by emulsion liquid membrane, and Triton X-100 was used as the biodegradable surfactant in n-pentanol n-pentanol bulk membrane. The extraction of bismuth ions was evaluated by the yield of extraction. The experimental parameters were evaluated and were optimized. They included the ratio of di(2-ethylhexyl)phosphoric acid concentration to the concentration of /Triton X-100 concentration (1.0 : 0.5% w/w), nature of diluents (n-pentanol), nature and concentration of the stripping solution (sulfuric acid, 0.5M), stirring speed (1,800 rpm) and equilibrium time of extraction (20min), initial feed solution of bismuth (350 ppm) and the volume ratio of the internal stripping phase to the membrane phase (14 times). The experimental parameters of kinetic extraction revealed that the bismuth ions were extracted at 100% 97%.

  12. How reliable are environmental data on 'orphan' elements? The case of bismuth concentrations in surface waters. (United States)

    Filella, Montserrat


    Like all elements of the periodic table, bismuth is ubiquitously distributed throughout the environment as a result of natural processes and human activities. It is present as Bi(III) in environmental, biological and geochemical samples. Although bismuth and its compounds are considered to be non-toxic to humans, its increasing use as a replacement for lead has highlighted how little is known about its environmental and ecotoxicological behaviour. In this first critical review paper on the existing information on bismuth occurrence in natural waters, 125 papers on fresh and marine waters have been collated. Although the initial objective of this study was to establish the range of the typical concentrations of total dissolved bismuth in natural waters, this proved impossible to achieve due to the wide, and hitherto unexplained, dispersion of published data. Since analytical limitations might be one of the reasons underlying value dispersion, new analytical methods published since 2000--intended to be applied to natural waters--have also been reviewed. Disappointingly, the detection limits of the bulk of them are well above those required; they are thus of limited usefulness. Analysis of the existing information on bismuth in secondary references (i.e., books, review chapters) and on its chemical speciation in seawater revealed that the uncritical reproduction of old data is a widespread practice.

  13. Recent Advances in Bismuth-Based Nanomaterials for Photoelectrochemical Water Splitting. (United States)

    Bhat, Swetha S M; Jang, Ho Won


    In recent years, bismuth-based nanomaterials have drawn considerable interest as potential candidates for photoelectrochemical (PEC) water splitting owing to their narrow band gaps, nontoxicity, and low costs. The unique electronic structure of bismuth-based materials with a well-dispersed valence band comprising Bi 6s and O 2p orbitals offers a suitable band gap to harvest visible light. This Review presents significant advancements in exploiting bismuth-based nanomaterials for solar water splitting. An overview of the different strategies employed and the new ideas adopted to improve the PEC performance of bismuth-based nanomaterials are discussed. Morphology control, the construction of heterojunctions, doping, and co-catalyst loading are several approaches that are implemented to improve the efficiency of solar water splitting. Key issues are identified and guidelines are suggested to rationalize the design of efficient bismuth-based materials for sunlight-driven water splitting. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Comparison of Second-Line Quadruple Therapies with or without Bismuth for Helicobacter pylori Infection

    Directory of Open Access Journals (Sweden)

    Guang-Hong Jheng


    Full Text Available The bismuth-based quadruple regimen has been applied in Helicobacter pylori rescue therapy worldwide. The non-bismuth-based quadruple therapy or “concomitant therapy” is an alternative option in first-line eradication but has not been used in second-line therapy. Discovering a valid regimen for rescue therapy in bismuth-unavailable countries is important. We conducted a randomized controlled trial to compare the efficacies of the standard quadruple therapy and a modified concomitant regimen. One hundred and twenty-four patients were randomly assigned into two groups: RBTM (rabeprozole 20 mg bid., bismuth subcitrate 120 mg qid, tetracycline 500 mg qid, and metronidazole 250 mg qid and RATM (rabeprozole 20 mg bid., amoxicillin 1 g bid., tetracycline 500 mg qid, and metronidazole 250 mg qid for 10 days. The eradication rate of the RBTM and RATM regimen was 92.1% and 90.2%, respectively, in intention-to-treat analysis. Patients in both groups had good compliance (~96%. The overall incidence of adverse events was higher in the RATM group (42.6% versus 22.2%, P=0.02, but only seven patients (11.5% experienced grades 2-3 events. In conclusion, both regimens had good efficacy, compliance, and acceptable side effects. The 10-day RATM treatment could be an alternative rescue therapy in bismuth-unavailable countries.

  15. Evaluation on the characteristics of tin-silver-bismuth solder (United States)

    Xia, Z.; Shi, Y.; Chen, Z.


    Tin-silver-bismuth solder is characterized by its lower melting point, good wetting behavior, and good mechanical property for which it is expected to be a new lead-free solder to replace tin-lead solder. In this article, Sn-3.33Ag-4.83Bi solder was investigated concerning its physical, spreading, and mechanical properties under specific conditions. Cooling curves and DSC results showed that it was close to eutectic composition (m.p. 210° 212 °C). Coefficiency of thermal expansion (CTE) of this solder, between that of PCBs and copper substrates, was beneficial to alleviate the thermal mismatch of the substrates. It was also a good electrical and thermal conductor. Using a rosin-based, mildly activated (RMA) flux, a spreading test indicated that SnAgBi solder paste had good solderability. Meanwhile, the solder had high tensile strength and fracture energy. Its fracture mechanism was a mixture of ductile and brittle fracture morphology. The metallographic and EDAX analyses indicated that it was composed of a tin-based solid solution and some intermetallic compound (IMC) that could strengthen the substrate. However, these large needle-like IMCs would cut the substrate and this resulted in the decreasing of the toughness of the solder.

  16. Ballistic edge states in Bismuth nanowires revealed by SQUID interferometry. (United States)

    Murani, Anil; Kasumov, Alik; Sengupta, Shamashis; Kasumov, Yu A; Volkov, V T; Khodos, I I; Brisset, F; Delagrange, Raphaëlle; Chepelianskii, Alexei; Deblock, Richard; Bouchiat, Hélène; Guéron, Sophie


    The protection against backscattering provided by topology is a striking property. In two-dimensional insulators, a consequence of this topological protection is the ballistic nature of the one-dimensional helical edge states. One demonstration of ballisticity is the quantized Hall conductance. Here we provide another demonstration of ballistic transport, in the way the edge states carry a supercurrent. The system we have investigated is a micrometre-long monocrystalline bismuth nanowire with topological surfaces, that we connect to two superconducting electrodes. We have measured the relation between the Josephson current flowing through the nanowire and the superconducting phase difference at its ends, the current-phase relation. The sharp sawtooth-shaped phase-modulated current-phase relation we find demonstrates that transport occurs selectively along two ballistic edges of the nanowire. In addition, we show that a magnetic field induces 0-π transitions and ϕ 0 -junction behaviour, providing a way to manipulate the phase of the supercurrent-carrying edge states and generate spin supercurrents.

  17. On the use of bismuth as a neutron filter

    CERN Document Server

    Adib, M


    A formula is given which, for neutron energies in the range 10 sup - sup 4 bismuth temperature and crystalline form. Computer programs have been developed which allow calculations for the Bi rhombohedral structure in its poly-crystalline form and its equivalent hexagonal close-packed structure. The calculated total neutron cross-sections for poly-crystalline Bi at different temperatures were compared with the measured values. An overall agreement is indicated between the formula fits and experimental data. Agreement was also obtained for values of Bi-single crystals, at room and liquid nitrogen temperatures. A feasibility study for use of Bi in powdered form, as a cold neutron filter, is detailed in terms of the optimum Bi-single crystal thickness, mosaic spread, temperature and cutting plane for efficient transmission of thermal-reactor neutrons, and also for rejection of the accom...

  18. On the use of bismuth as a neutron filter (United States)

    Adib, M.; Kilany, M.


    A formula is given which, for neutron energies in the range 10 -4< E<10 eV, permits calculation of the nuclear capture, thermal diffuse and Bragg scattering cross-sections as a function of bismuth temperature and crystalline form. Computer programs have been developed which allow calculations for the Bi rhombohedral structure in its poly-crystalline form and its equivalent hexagonal close-packed structure. The calculated total neutron cross-sections for poly-crystalline Bi at different temperatures were compared with the measured values. An overall agreement is indicated between the formula fits and experimental data. Agreement was also obtained for values of Bi-single crystals, at room and liquid nitrogen temperatures. A feasibility study for use of Bi in powdered form, as a cold neutron filter, is detailed in terms of the optimum Bi-single crystal thickness, mosaic spread, temperature and cutting plane for efficient transmission of thermal-reactor neutrons, and also for rejection of the accompanying fast neutrons and gamma rays.

  19. On the use of bismuth as a neutron filter

    Energy Technology Data Exchange (ETDEWEB)

    Adib, M.; Kilany, M. E-mail:


    A formula is given which, for neutron energies in the range 10{sup -4}bismuth temperature and crystalline form. Computer programs have been developed which allow calculations for the Bi rhombohedral structure in its poly-crystalline form and its equivalent hexagonal close-packed structure. The calculated total neutron cross-sections for poly-crystalline Bi at different temperatures were compared with the measured values. An overall agreement is indicated between the formula fits and experimental data. Agreement was also obtained for values of Bi-single crystals, at room and liquid nitrogen temperatures. A feasibility study for use of Bi in powdered form, as a cold neutron filter, is detailed in terms of the optimum Bi-single crystal thickness, mosaic spread, temperature and cutting plane for efficient transmission of thermal-reactor neutrons, and also for rejection of the accompanying fast neutrons and gamma rays.

  20. On the use of bismuth as a neutron filter

    International Nuclear Information System (INIS)

    Adib, M.; Kilany, M.


    A formula is given which, for neutron energies in the range 10 -4 < E<10 eV, permits calculation of the nuclear capture, thermal diffuse and Bragg scattering cross-sections as a function of bismuth temperature and crystalline form. Computer programs have been developed which allow calculations for the Bi rhombohedral structure in its poly-crystalline form and its equivalent hexagonal close-packed structure. The calculated total neutron cross-sections for poly-crystalline Bi at different temperatures were compared with the measured values. An overall agreement is indicated between the formula fits and experimental data. Agreement was also obtained for values of Bi-single crystals, at room and liquid nitrogen temperatures. A feasibility study for use of Bi in powdered form, as a cold neutron filter, is detailed in terms of the optimum Bi-single crystal thickness, mosaic spread, temperature and cutting plane for efficient transmission of thermal-reactor neutrons, and also for rejection of the accompanying fast neutrons and gamma rays

  1. Natural convection in enclosures containing lead-bismuth and lead

    International Nuclear Information System (INIS)

    Dzodzo, M.; Cuckovic-Dzodzo, D.


    The design of liquid metal reactors such as Encapsulated Nuclear Heat Source (ENHS) which are based predominantly on the flow generated by natural convection effects demands knowledge of velocity and temperature fields, distribution of the local Nusselt numbers and values of the average Nusselt numbers for small coolant velocity regimes. Laminar natural convection in rectangular enclosures with different aspect ratios, containing lead-bismuth and lead is studied numerically in this paper. The numerical model takes into account variable properties of the liquid metals. The developed correlation for average Nusselt numbers is presented. It is concluded that average Nusselt numbers are lower than in 'normal' fluids (air, water and glycerol) for the same values of Rayleigh numbers. However, the heat flux, which can be achieved, is greater due to the high thermal conductivity of liquid metals. Some specific features of the flow fields generated by natural convection in liquid metals are presented. Their consequences on the design of heat exchangers for liquid metals are discussed. An application of the obtained results to the design of a new type of steam generator, which integrates the intermediate heat exchanger and secondary pool functions of the ENHS reactor, is presented. (authors)

  2. Antibacterial effect of bismuth subsalicylate nanoparticles synthesized by laser ablation

    International Nuclear Information System (INIS)

    Flores-Castañeda, Mariela; Vega-Jiménez, Alejandro L.; Almaguer-Flores, Argelia; Camps, Enrique; Pérez, Mario; Silva-Bermudez, Phaedra; Berea, Edgardo; Rodil, Sandra E.


    The antimicrobial properties of bismuth subsalicylate (BSS) nanoparticles against four opportunistic pathogens; E. coli, P. aeruginosa, S. aureus, and S. epidermidis were determined. BSS nanoparticles were synthesized by pulse laser ablation of a solid target in distilled water under different conditions. The nanoparticles were characterized using high-resolution transmission electron microscopy and absorption spectra and small angle X-ray scattering. The analysis shows that the colloids maintained the BSS structure and presented average particle size between 20 and 60 nm, while the concentration ranges from 95 to 195 mg/L. The antibacterial effect was reported as the inhibition ratio of the bacterial growth after 24 h and the cell viability was measured using the XTT assay. The results showed that the inhibition ratio of E. coli and S. epidermidis was dependant on the NPs size and/or concentration, meanwhile P. aeruginosa and S. aureus were more sensitive to the BSS nanoparticles independently of both the size and the concentration. In general, the BSS colloids with average particle size of 20 nm were the most effective, attaining inhibition ratios >80 %, similar or larger than those obtained with the antibiotic used as control. The results suggest that the BSS colloids could be used as effective antibacterial agents with potential applications in the medical area

  3. Possible superconductivity in the Bismuth IV solid phase under pressure. (United States)

    Valladares, Ariel A; Rodríguez, Isaías; Hinojosa-Romero, David; Valladares, Alexander; Valladares, Renela M


    The first successful theory of superconductivity was the one proposed by Bardeen, Cooper and Schrieffer in 1957. This breakthrough fostered a remarkable growth of the field that propitiated progress and questionings, generating alternative theories to explain specific phenomena. For example, it has been argued that Bismuth, being a semimetal with a low number of carriers, does not comply with the basic hypotheses underlying BCS and therefore a different approach should be considered. Nevertheless, in 2016 based on BCS we put forth a prediction that Bi at ambient pressure becomes a superconductor at 1.3 mK. A year later an experimental group corroborated that in fact Bi is a superconductor with a transition temperature of 0.53 mK, a result that eluded previous work. So, since Bi is superconductive in almost all the different structures and phases, the question is why Bi-IV has been elusive and has not been found yet to superconduct? Here we present a study of the electronic and vibrational properties of Bi-IV and infer its possible superconductivity using a BCS approach. We predict that if the Bi-IV phase structure were cooled down to liquid helium temperatures it would also superconduct at a T c of 4.25 K.

  4. Optical bleaching of bismuth implanted silica glass: A threshold effect

    International Nuclear Information System (INIS)

    Park, S.Y.; Magruder, R.H. III; Weeks, R.A.


    The near surface regions of high purity silica glass discs, Spectrosil A, were modified by implantation with bismuth ions at 160 key and room temperature. The glasses implanted with a nominal dose of 6x10 16 Bi/cm 2 at ∼5 μA/cm 2 were subsequently bleached with a 5.0 eV KrF pulsed excimer laser. The laser had an average pulse duration of ∼20 ns and repetition rate of 10 Hz. It was found that the bleaching was dependent upon the power density of the laser for a constant total integrated energy. Ion backscattering and optical absorption measurements were made before and after laser irradiation. Large changes in optical density and depth distribution of the implanted ions were observed at power densities of ≥45 mJ/cm 2 -pulse. Onset of threshold for bleaching of silica glass implanted with 6x10 16 Bi/cm 2 at 160 key and at room temperature is between 30 and 45 mJ/cm 2 -pulse

  5. Bismuth alloying properties in GaAs nanowires

    Energy Technology Data Exchange (ETDEWEB)

    Ding, Lu [State Key Laboratory of Information Photonics and Optical Communications, Ministry of Education, Beijing University of Posts and Telecommunications, PO Box 72, Beijing 100876 (China); Lu, Pengfei, E-mail: [State Key Laboratory of Information Photonics and Optical Communications, Ministry of Education, Beijing University of Posts and Telecommunications, PO Box 72, Beijing 100876 (China); Cao, Huawei; Cai, Ningning; Yu, Zhongyuan [State Key Laboratory of Information Photonics and Optical Communications, Ministry of Education, Beijing University of Posts and Telecommunications, PO Box 72, Beijing 100876 (China); Gao, Tao [Institute of Atomic and Molecular Physics, Sichuan University, Chengdu 610065 (China); Wang, Shumin [State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Chinese Academy of Sciences, Shanghai 200050 (China); Photonics Laboratory, Department of Microtechnology and Nanoscience, Chalmers University of Technology, 41296 Gothenburg (Sweden)


    First-principles calculations have been performed to investigate the structural, electronic and optical properties of bismuth alloying in GaAs nanowires. A typical model of Ga{sub 31}As{sub 31} nanowires is introduced for its reasonable band gap. The band gap of GaAs{sub 1−x}Bi{sub x} shrinks clearly with the increasing Bi concentration and the band edge shifts when spin–orbit coupling (SOC) is considered. The insertion of Bi atom leads to hybridization of Ga/As/Bi p states which contributes a lot around Fermi level. Scissor effect is involved. The optical properties are presented, including dielectric function, optical absorption spectra and reflectivity, which are also varied with the increasing of Bi concentrations. - Graphical abstract: Top view of Bi-doped GaAs nanowires. Ga, As, and Bi atoms are denoted with grey, purple and red balls, respectively. Display Omitted - Highlights: • A typical model of Ga{sub 31}As{sub 31} nanowires is introduced for its reasonable band gap. • The band gap of GaAs{sub 1−x}Bi{sub x} shrinks clearly with the increasing Bi concentration. • The band edge shifts when spin–orbit coupling (SOC) is considered. • The insertion of Bi atom leads to hybridization of Ga/As/Bi p states.

  6. Antibacterial effect of bismuth subsalicylate nanoparticles synthesized by laser ablation (United States)

    Flores-Castañeda, Mariela; Vega-Jiménez, Alejandro L.; Almaguer-Flores, Argelia; Camps, Enrique; Pérez, Mario; Silva-Bermudez, Phaedra; Berea, Edgardo; Rodil, Sandra E.


    The antimicrobial properties of bismuth subsalicylate (BSS) nanoparticles against four opportunistic pathogens; E. coli, P. aeruginosa, S. aureus, and S. epidermidis were determined. BSS nanoparticles were synthesized by pulse laser ablation of a solid target in distilled water under different conditions. The nanoparticles were characterized using high-resolution transmission electron microscopy and absorption spectra and small angle X-ray scattering. The analysis shows that the colloids maintained the BSS structure and presented average particle size between 20 and 60 nm, while the concentration ranges from 95 to 195 mg/L. The antibacterial effect was reported as the inhibition ratio of the bacterial growth after 24 h and the cell viability was measured using the XTT assay. The results showed that the inhibition ratio of E. coli and S. epidermidis was dependant on the NPs size and/or concentration, meanwhile P. aeruginosa and S. aureus were more sensitive to the BSS nanoparticles independently of both the size and the concentration. In general, the BSS colloids with average particle size of 20 nm were the most effective, attaining inhibition ratios >80 %, similar or larger than those obtained with the antibiotic used as control. The results suggest that the BSS colloids could be used as effective antibacterial agents with potential applications in the medical area.

  7. Synthesis and characterization of bismuth zinc niobate pyrochlore nanopowders

    Directory of Open Access Journals (Sweden)

    Sonia Maria Zanetti


    Full Text Available Bismuth zinc niobate pyrochlores Bi1.5ZnNb1.5O7 (alpha-BZN, and Bi2(Zn1/3Nb2/32O 7 (beta-BZN have been synthesized by chemical method based on the polymeric precursors. The pyrochlore phase was investigated by differential scanning calorimetry, infrared spectroscopy, and X ray diffraction. Powder and sintered pellets morphology was examined by scanning electron microscopy. The study of alpha-BZN phase formation reveals that, at 500 °C, the pyrochlore phase was already present while a single-phased nanopowder was obtained after calcination at 700 °C. The crystallization mechanism of the beta-BZN is quite different, occurring through the crystallization of alpha-BZN and BiNbO4 intermediary phases. Both compositions yielded soft agglomerated powders. alpha-BZN pellets, sintered at 800 °C for 2 hours, presented a relative density of 97.3% while those of beta-BZN, sintered at 900 °C for 2 hours, reached only 91.8%. Dielectric constant and dielectric loss, measured at 1 MHz, were 150 and 4 x/10-4 for a-BZN, and 97 and 8 x 10-4 for beta-BZN.

  8. Structure, spectra and stability of solid bismuth carbonates

    International Nuclear Information System (INIS)

    Taylor, Peter; Sunder, S.; Lopata, V.J.


    A previously unreported basic bismuth carbonate, (BiO)sub(4)(OH)sub(2)COsub(3), has been identified as an intermediate product in the interconversion of α-Bisub(2)Osub(3) and synthetic bismutite, (BiO)sub(2)COsub(3), in aqueous carbonate solutions. It has a narrow stability field between COsub(2) partial pressures of 10sup(-5.5+-1.0) Pa, in the presence of dilute aqueous solution at 25 degrees C. Gibbs energies of formation, calculated from these partial pressures, are Δsub(f)Gsup(0)((BiO)sub(4)(OH)sub(2)COsub(3),s,298.15 K)-1678 +- 9 kJ molsup(-1) and Δsub(f)Gsup(0)((BiO)sub(2)COsub(3),s,298.15 K)=-945 +- 7 kJ molsup(-1). The two carbonates have been compared by thermogravimetric analysis, X-ray powder diffractometry, and infrared and Raman spectroscopy. The unit cell of (BiO)sub(4)(OH)sub(2)COsub(3) is dimensionally orthorhombic, with a=10.772(1), b=5.4898(5), c=14.757(1)angstrom,Z=4, but its true symmetry is probably triclinic. A structural model for (BiO)sub(4)(OH)sub(2)COsub(3), and two modified models for (BiO)sub(2)COsub(3), are proposed. The possible natural occurrence of (BiO)sub(4)(OH)sub(2)COsub(3) is discussed

  9. Modular Lead-Bismuth Fast Reactors in Nuclear Power

    Directory of Open Access Journals (Sweden)

    Vladimir Petrochenko


    Full Text Available On the basis of the unique experience of operating reactors with heavy liquid metal coolant–eutectic lead-bismuth alloy in nuclear submarines, the concept of modular small fast reactors SVBR-100 for civilian nuclear power has been developed and validated. The features of this innovative technology are as follows: a monoblock (integral design of the reactor with fast neutron spectrum, which can operate using different types of fuel in various fuel cycles including MOX fuel in a self-providing mode. The reactor is distinct in that it has a high level of self-protection and passive safety, it is factory manufactured and the assembled reactor can be transported by railway. Multipurpose application of the reactor is presumed, primarily, it can be used for regional power to produce electricity, heat and for water desalination. The Project is being realized within the framework of state-private partnership with joint venture OJSC “AKME-Engineering” established on a parity basis by the State Atomic Energy Corporation “Rosatom” and the Limited Liability Company “EuroSibEnergo”.

  10. Antibacterial effect of bismuth subsalicylate nanoparticles synthesized by laser ablation

    Energy Technology Data Exchange (ETDEWEB)

    Flores-Castañeda, Mariela [Instituto Nacional de Investigaciones Nucleares (Mexico); Vega-Jiménez, Alejandro L., E-mail:; Almaguer-Flores, Argelia [Universidad Nacional Autónoma de México, Facultad de Odontología, DEPeI, I (Mexico); Camps, Enrique; Pérez, Mario [Instituto Nacional de Investigaciones Nucleares (Mexico); Silva-Bermudez, Phaedra [Instituto Nacional de Rehabilitación, Unidad de Ingeniería de Tejidos, Terapia Celular y Medicina Regenerativa (Mexico); Berea, Edgardo [FarmaQuimia SA de CV. (Mexico); Rodil, Sandra E. [Universidad Nacional Autónoma de México, Instituto de Investigaciones en Materiales (Mexico)


    The antimicrobial properties of bismuth subsalicylate (BSS) nanoparticles against four opportunistic pathogens; E. coli, P. aeruginosa, S. aureus, and S. epidermidis were determined. BSS nanoparticles were synthesized by pulse laser ablation of a solid target in distilled water under different conditions. The nanoparticles were characterized using high-resolution transmission electron microscopy and absorption spectra and small angle X-ray scattering. The analysis shows that the colloids maintained the BSS structure and presented average particle size between 20 and 60 nm, while the concentration ranges from 95 to 195 mg/L. The antibacterial effect was reported as the inhibition ratio of the bacterial growth after 24 h and the cell viability was measured using the XTT assay. The results showed that the inhibition ratio of E. coli and S. epidermidis was dependant on the NPs size and/or concentration, meanwhile P. aeruginosa and S. aureus were more sensitive to the BSS nanoparticles independently of both the size and the concentration. In general, the BSS colloids with average particle size of 20 nm were the most effective, attaining inhibition ratios >80 %, similar or larger than those obtained with the antibiotic used as control. The results suggest that the BSS colloids could be used as effective antibacterial agents with potential applications in the medical area.

  11. Superconductivity in the unconventional high pressure phase bismuth-III

    Energy Technology Data Exchange (ETDEWEB)

    Semeniuk, Konstantin; Brown, Philip; Vasiljkovic, Aleksandar; Grosche, Malte [University of Cambridge (United Kingdom)


    One of the most surprising developments in high pressure research was the realisation that many elements assume very unexpected high pressure structures, described in terms of extremely large or even infinite unit cells. Elemental bismuth, which has been known to undergo a series of pressure induced structural transitions between 25 kbar and 80 kbar, is an interesting example: the intermediate pressure Bi-III phase has a complex 'host-guest' structure consisting of two incommensurate sublattices. Since the unit cell is infinitely large, the description of electronic and lattice excitations is problematic. Apart from its metallic character and the observation of superconductivity at low temperature, little is known about the electronic structure in this phase. We investigate the electrical resistivity within the metallic Bi-III phase under high hydrostatic pressure and in applied magnetic field using a piston cylinder cell. Superconductivity is observed below 7.1 K, and we extract the temperature dependence of the upper critical field, which exceeds 2 T at low temperature. The normal state resistivity exhibits an approximately linear temperature dependence. This could be attributed to strong scattering from low-lying excitations, as caused by an unusually soft phonon spectrum. The results suggest that strong coupling superconductivity arises within the host-guest structure of Bi-III out of an unusual electronic state.

  12. Studies on 201Th myocardial scintiscanning

    International Nuclear Information System (INIS)

    Buchner, U.


    The diagnostical evidence of myocardial scintiscanning with thallium-201 was tested on 98 patients with coronary heart disease. 2 mCi thallium-201 were injected into an arm vene and then scintigrams of the heart were registered partly with a scanner, partly with a gamma camera in several views. The healthy myocardium was found in the thallium-201-scintigram to be a rather homogeneous, horeshoe-shaped activity pattern with intramyocardial activity differences of up to 20% of the maximal thallium-201-activity above the myocard which can be declared to be physiological. In dependency on the local blood flow conditions, thallium-201 is stored only in the healthy, but not in the ischaemic or infarcted myocardium. In the scintigram, these regions are seen as regions with reduced radioactivity. A comparison of the localisation of the infarction in the scintigram with those in the electrocardiagram and coronary angiogram showed a good congrucucy. Scintigrams taken at different times after the infarction brought a decrease in the number of diagnosed storage failures, from 90% to 68% in infarctions older than 6 weeks. A scintigraphical differentiation between fresh and old infarctions was not possible. In cases of angiographically established coronary heart disease without infarction, pathological storage reductions were observed. By comparing the findings obtained by scintiscanning with the results of laevocardiography it was seen that hypokinetic regions in the thallium-201-myocardial scintigram showed in only 6% of the cases a pathological storage defect; akinetic, dyskinetic, and aneurysmatic regions, however, were seen in 65% of the cases as clear activity reductions or failures. (orig./MG) [de

  13. A method for the production of thallium-201

    International Nuclear Information System (INIS)

    Ageev, V.A.; Kljuchnikov, A.A.; Linev, A.F.; Khalkin, V.A.; Zaitseva, N.G.


    For the production of thallium-201 a target of at least 95% enriched pure lead-206 is irradiated by a proton beam of an energy of between 50 and 70 MeV. During irradiation the reaction 206 Pb(p,6n) 201 Bi takes place. The target is kept sufficiently long for the transition 201 Bi- 201 Pb- 201 Tl to take place. The target is then dissolved in acid. The thallium-201 contained in the acid is oxidized to the trivalent state followed by precipitation of the lead. Lead traces remaining in solution are separated from the thallium-201 through cation exchange following which the thallium-201 is eluted using hydrochloric acid

  14. 47 CFR 2.201 - Emission, modulation, and transmission characteristics. (United States)


    ... characteristics. 2.201 Section 2.201 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL FREQUENCY..., and transmission characteristics. The following system of designating emission, modulation, and transmission characteristics shall be employed. (a) Emissions are designated according to their classification...

  15. MEXICO loop provides essential technology for MYRRHA. SCK•CEN investigates the chemistry of lead-bismuth

    International Nuclear Information System (INIS)


    In the MYRRHA facility, Lead-Bismuth Eutectic (LBE) alloy will act as the primary coolant. There are different experimental lead-bismuth loops in the world. Most have been designed to study steel corrosion in LBE or the thermohydraulics of LBE. The article discusses the MEXICO test loop, which has been developed by SCK-CEN to investigate the chemistry of leadbismuth.

  16. The safety and efficacy of ranitidine bismuth citrate in combination with antibiotics for the eradication of Helicobacter pylori

    NARCIS (Netherlands)

    Wyeth, J. W.; Pounder, R. E.; Duggan, A. E.; O'Morain, C. A.; Schaufelberger, H. D.; de Koster, E. H.; Rauws, E. A.; Bardhan, K. D.; Gilvarry, J.; Buckley, M. J.; Gummett, P. A.; Logan, R. P.


    Ranitidine bismuth citrate is a novel salt of ranitidine and a bismuth citrate complex. It has intrinsic antisecretory and anti-Helicobacter pylori activity, but monotherapy rarely eradicates H. pylori infection in man. A pilot study to investigate rates of H. pylori eradication achieved by

  17. The influence of metronidazole resistance on the efficacy of ranitidine bismuth citrate triple therapy regimens for Helicobacter pylori infection

    NARCIS (Netherlands)

    Van der Wouden, EJ; Thijs, JC; Van Zwet, AA; Kooy, A; Kleibeuker, JH

    Aim: To assess the influence of metronidazole resistance on the efficacy of ranitidine bismuth citrate-based triple therapy regimens in two consecutive studies. Methods: In the first study, patients with a culture-proven Helicobacter pylori infection were treated with ranitidine bismuth citrate 400

  18. Fabrication of crystal-oriented barium-bismuth titanate ceramics in high magnetic field and subsequent reaction sintering

    International Nuclear Information System (INIS)

    Tanaka, Satoshi; Tomita, Yusuke; Furushima, Ryoichi; Uematsu, Keizo; Shimizu, Hiroyuki; Doshida, Yutaka


    High magnetic field was applied to fabricate novel lead-free piezoelectric ceramics with a textured structure. A compact of crystallographically oriented grains was prepared by dry forming in a high magnetic field from a mixed slurry of bismuth titanate and barium titanate powders. Bismuth titanate particles with a size of about 1 μ m were used as the host material. In the forming process, the slurry was poured into a mold and set in a magnetic field of 10 T until completely dried. Bismuth titanate particles were highly oriented in the slurry under the magnetic field. The dried powder compact consisted of highly oriented bismuth titanate particles and randomly oriented barium titanate particles. Barium bismuth titanate ceramics with a- and b-axis orientations were successfully produced from the dried compact by sintering at temperatures above 1100 deg. C.

  19. Overview of the use of ATHENA for thermal-hydraulic analysis of systems with lead-bismuth coolant

    International Nuclear Information System (INIS)

    Davis, C.B.; Shieh, A. S.


    The INEEL and MIT are investigating the suitability of lead-bismuth cooled fast reactor for producing low-cost electricity as well as for actinide burning. This paper is concerned with the general area of thermal-hydraulics of lead-bismuth cooled reactors. The ATHENA code is being used in the thermal-hydraulic design and analysis of lead-bismuth cooled reactors. The ATHENA code was reviewed to determine its applicability for simulating lead-bismuth cooled reactors. Two modifications were made to the code as a result of this review. Specifically, a correlation to represent heat transfer from rod bundles to a liquid metal and a void correlation based on data taken in a mixture of lead-bismuth and steam were added the code. The paper also summarizes the analytical work that is being performed with the code and plans for future analytical work

  20. Overview of the Use of ATHENA for Thermal-Hydraulic Analysis of Systems with Lead-Bismuth Coolant

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Cliff Bybee; Shieh, Arthur Shan Luk


    The INEEL and MIT are investigating the suitability of lead-bismuth cooled fast reactor for producing low-cost electricity as well as for actinide burning. This paper is concerned with the general area of thermal-hydraulics of lead-bismuth cooled reactors. The ATHENA code is being used in the thermal-hydraulic design and analysis of lead-bismuth cooled reactors. The ATHENA code was reviewed to determine its applicability for simulating lead-bismuth cooled reactors. Two modifications were made to the code as a result of this review. Specifically, a correlation to represent heat transfer from rod bundles to a liquid metal and a void correlation based on data taken in a mixture of lead-bismuth and steam were added the code. The paper also summarizes the analytical work that is being performed with the code and plans for future analytical work.

  1. 46 CFR 201.144 - Offer of proof. (United States)


    ... 46 Shipping 8 2010-10-01 2010-10-01 false Offer of proof. 201.144 Section 201.144 Shipping... PROCEDURE Evidence (Rule 14) § 201.144 Offer of proof. An offer of proof made in connection with an... accompany the record as the offer of proof. ...

  2. 46 CFR 201.7 - Information; special instructions. (United States)


    ... 46 Shipping 8 2010-10-01 2010-10-01 false Information; special instructions. 201.7 Section 201.7 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE General Information (Rule 1) § 201.7 Information; special instructions. Information...

  3. 4 CFR 201.9 - Restrictions on charging fees. (United States)


    ... 4 Accounts 1 2010-01-01 2010-01-01 false Restrictions on charging fees. 201.9 Section 201.9 Accounts RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD PUBLIC INFORMATION AND REQUESTS § 201.9... the news media. (2) The Board shall provide without charge to all but commercial users: (i) The first...

  4. 14 CFR 1203.201 - Information security objectives. (United States)


    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Information security objectives. 1203.201 Section 1203.201 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION INFORMATION SECURITY PROGRAM NASA Information Security Program § 1203.201 Information security objectives. The objectives of...

  5. 20 CFR 701.201 - Office of Workers' Compensation Programs. (United States)


    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Office of Workers' Compensation Programs. 701.201 Section 701.201 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR...; DEFINITIONS AND USE OF TERMS Office of Workers' Compensation Programs § 701.201 Office of Workers...

  6. 46 CFR 201.125 - Attendance and mileage fees. (United States)


    ... 46 Shipping 8 2010-10-01 2010-10-01 false Attendance and mileage fees. 201.125 Section 201.125 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Subpoenas (Rule 12) § 201.125 Attendance and mileage fees. Persons attending...

  7. 45 CFR 201.11 - Personnel merit system review. (United States)


    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Personnel merit system review. 201.11 Section 201... STATES FOR PUBLIC ASSISTANCE PROGRAMS Review and Audits § 201.11 Personnel merit system review. A personnel merit system review is carried out by the Office of State Merit Systems of the Office of the...

  8. 14 CFR 1206.201 - Records which have been published. (United States)


    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Records which have been published. 1206.201 Section 1206.201 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION AVAILABILITY OF AGENCY RECORDS TO MEMBERS OF THE PUBLIC Records Available § 1206.201 Records which have been published...

  9. 10 CFR 830.201 - Performance of work. (United States)


    ... 10 Energy 4 2010-01-01 2010-01-01 false Performance of work. 830.201 Section 830.201 Energy DEPARTMENT OF ENERGY NUCLEAR SAFETY MANAGEMENT Safety Basis Requirements § 830.201 Performance of work. A contractor must perform work in accordance with the safety basis for a hazard category 1, 2, or 3 DOE nuclear...

  10. 49 CFR 234.201 - Location of plans. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Location of plans. 234.201 Section 234.201..., Inspection, and Testing Maintenance Standards § 234.201 Location of plans. Plans required for proper maintenance and testing shall be kept at each highway-rail grade crossing warning system location. Plans shall...

  11. 48 CFR 201.303 - Publication and codification. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Publication and codification. 201.303 Section 201.303 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... Regulations 201.303 Publication and codification. (a)(i) The DFARS is codified under chapter 2 in title 48...

  12. 7 CFR 201.36c - Hermetically-sealed containers. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Hermetically-sealed containers. 201.36c Section 201... ACT FEDERAL SEED ACT REGULATIONS Advertising § 201.36c Hermetically-sealed containers. The 5-month... been met: (a) The seed was packaged within 9 months after harvest; (b) The container used does not...

  13. 19 CFR 201.110 - Self-evaluation. (United States)


    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Self-evaluation. 201.110 Section 201.110 Customs... Commission § 201.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its current policies... in the self-evaluation process by submitting comments (both oral and written). (c) The agency shall...

  14. Thallium-201 accumulation in cerebral candidiasis: Unexpected finding on SPECT

    International Nuclear Information System (INIS)

    Tonami, N.; Matsuda, H.; Ooba, H.; Yokoyama, K.; Hisada, K.; Ikeda, K.; Yamashita, J.


    The authors present an unexpected finding of Tl-201 uptake in the intracerebral lesions due to candidiasis. SPECT demonstrated the extent of the lesions and a high target-to-background ratio. The regions where abnormal Tl-201 accumulation was seen were nearly consistent with CT scans of those enhanced by a contrast agent. After treatment, most of the abnormal Tl-201 accumulation disappeared

  15. 21 CFR 201.61 - Statement of identity. (United States)


    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Statement of identity. 201.61 Section 201.61 Food...: GENERAL LABELING Labeling Requirements for Over-the-Counter Drugs § 201.61 Statement of identity. (a) The... features a statement of the identity of the commodity. (b) Such statement of identity shall be in terms of...

  16. 21 CFR 201.119 - In vitro diagnostic products. (United States)


    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false In vitro diagnostic products. 201.119 Section 201...) DRUGS: GENERAL LABELING Exemptions From Adequate Directions for Use § 201.119 In vitro diagnostic products. (a) “In vitro diagnostic products” are those reagents, instruments and systems intended for use...

  17. 7 CFR 201.54 - Number of seeds for germination. (United States)


    ... REGULATIONS Germination Tests in the Administration of the Act § 201.54 Number of seeds for germination. At least 400 seeds shall be tested for germination; except that in mixtures, 200 seeds of each of those... 7 Agriculture 3 2010-01-01 2010-01-01 false Number of seeds for germination. 201.54 Section 201.54...

  18. 37 CFR 201.1 - Communication with the Copyright Office. (United States)


    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Communication with the Copyright Office. 201.1 Section 201.1 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES GENERAL PROVISIONS § 201.1 Communication with the Copyright Office...

  19. Thallium-201 accumulation in cerebral candidiasis: Unexpected finding on SPECT

    Energy Technology Data Exchange (ETDEWEB)

    Tonami, N.; Matsuda, H.; Ooba, H.; Yokoyama, K.; Hisada, K.; Ikeda, K.; Yamashita, J. (Kanazawa Univ. (Japan))


    The authors present an unexpected finding of Tl-201 uptake in the intracerebral lesions due to candidiasis. SPECT demonstrated the extent of the lesions and a high target-to-background ratio. The regions where abnormal Tl-201 accumulation was seen were nearly consistent with CT scans of those enhanced by a contrast agent. After treatment, most of the abnormal Tl-201 accumulation disappeared.

  20. 19 CFR 201.149 - Program accessibility: Discrimination prohibited. (United States)


    .... 201.149 Section 201.149 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF... Conducted by the U.S. International Trade Commission § 201.149 Program accessibility: Discrimination... agency's facilities are inaccessible to or unusable by handicapped persons, be denied the benefits of, be...

  1. 7 CFR 868.201 - Definition of rough rice. (United States)


    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Definition of rough rice. 868.201 Section 868.201... FOR CERTAIN AGRICULTURAL COMMODITIES United States Standards for Rough Rice Terms Defined § 868.201 Definition of rough rice. Rice (Oryza sativa L.) which consists of 50 percent or more of paddy kernels (see...

  2. 48 CFR 36.201 - Evaluation of contractor performance. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Evaluation of contractor performance. 36.201 Section 36.201 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION... Contracting for Construction 36.201 Evaluation of contractor performance. See 42.1502(e) for the requirements...

  3. 46 CFR 201.117 - Inclusion in record. (United States)


    ... 46 Shipping 8 2010-10-01 2010-10-01 false Inclusion in record. 201.117 Section 201.117 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Discovery and Depositions (Rule 11) § 201.117 Inclusion in record. No deposition or part thereof...

  4. 46 CFR 201.20 - Attorneys at law. (United States)


    ... 46 Shipping 8 2010-10-01 2010-10-01 false Attorneys at law. 201.20 Section 201.20 Shipping... PROCEDURE Appearance and Practice Before the Administration (Rule 2) § 201.20 Attorneys at law. Attorneys at law who are admitted to practice before the Federal courts or before the courts of any State or...

  5. 24 CFR 125.201 - Administrative Enforcement Initiative. (United States)


    ... Initiative. 125.201 Section 125.201 Housing and Urban Development Regulations Relating to Housing and Urban... FAIR HOUSING FAIR HOUSING INITIATIVES PROGRAM § 125.201 Administrative Enforcement Initiative. The Administrative Enforcement Initiative provides funding to State and local fair housing agencies administering...

  6. 48 CFR 1327.201 - Patent and copyright infringement liability. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Patent and copyright infringement liability. 1327.201 Section 1327.201 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Patents and Copyrights 1327.201 Patent and...

  7. 48 CFR 1536.201 - Evaluation of contracting performance. (United States)


    ... performance. 1536.201 Section 1536.201 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY... Contracting for Construction 1536.201 Evaluation of contracting performance. (a) The Contracting Officer will... will file the form in the contractor performance evaluation files which it maintains. (e) The Quality...

  8. 41 CFR 50-201.1101 - Minimum wages. (United States)


    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Minimum wages. 50-201... Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 201-GENERAL REGULATIONS § 50-201.1101 Minimum wages. Determinations of prevailing minimum wages or changes therein will be published in the Federal Register by the...

  9. 7 CFR 201.1 - Meaning of words. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Meaning of words. 201.1 Section 201.1 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... REGULATIONS Definitions § 201.1 Meaning of words. Words in the regulations in this part in the singular form...

  10. 9 CFR 201.1 - Meaning of words. (United States)


    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Meaning of words. 201.1 Section 201.1 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND... § 201.1 Meaning of words. Words used in this part in the singular form shall be deemed to import the...

  11. 20 CFR 201.1 - Words and phrases. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Words and phrases. 201.1 Section 201.1 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT DEFINITIONS § 201.1 Words and phrases. For the purposes of the regulations in this chapter, except where the...

  12. 17 CFR 201.67 - Applications by legal guardians. (United States)


    ... guardians. 201.67 Section 201.67 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES... Securities Exchange Act of 1934 § 201.67 Applications by legal guardians. An application pursuant to this... information that may be subject to a bounty payment, or by the parent or guardian of such a person if that...

  13. Synthesis of binary bismuth-cadmium oxide nanorods with sensitive electrochemical sensing performance

    International Nuclear Information System (INIS)

    Wen, Yong; Pei, Lizhai; Wei, Tian


    Binary bismuth-cadmium oxide nanorods have been synthesized by a simple hydrothermal process without templates and additives. X-ray diffraction and high-resolution transmission electron microscopy reveal that the nanorods possess single crystalline tetragonal Bi 2 CdO 4 phase. Scanning electron microscopy and transmission electron microscopy images show that the length and diameter of the nanorods are 20-300 nm and 5-10 μm, respectively. The formation of the binary bismuth-cadmium oxide nanorods is closely related to the hydrothermal parameters. The electrochemical sensing performance of the binary bismuth-cadmium oxide nanorods has been investigated using the nanorods as glassy carbon electrode modifiers. The detection limit is 0.19 μM with a linear range of 0.0005-2 mM. The nanorod-modified glassy carbon electrode exhibits good electrocatalytic activity toward L-cysteine and great application potential for electrochemical sensors.

  14. Advanced bismuth-doped lead-germanate glass for broadband optical gain devices

    International Nuclear Information System (INIS)

    Hughes, M.; Suzuki, T.; Ohishi, Y.


    We fabricated a series of glasses with the composition 94.7-χGeO 2 -5Al 2 O 3 -0.3Bi 2 O 3 -χPbO (χ=0-24 mol. %). Characteristic absorption bands of bismuth centered at 500, 700, 800, and 1000 nm were observed. Adding PbO was found to decrease the strength of bismuth absorption. The addition of 3%-4% PbO resulted in a 50% increase in lifetime, a 20-fold increase in quantum efficiency, and a 28-fold increase in the product of emission cross section and lifetime on the 0% PbO composition. We propose that the 800 nm absorption band relates a different bismuth center than the other absorption bands

  15. Potentiation of the action of metronidazole on Helicobacter pylori by omeprazole and bismuth subcitrate

    DEFF Research Database (Denmark)

    Andersen, L P; Colding, H; Kristiansen, J E


    test (Etest). With 0.5 MIC of either of the two drugs, the susceptibility of all H. pylori4 mg/l) reverted to being metronidazole sensitive. These results suggested that either bismuth salts or proton pump inhibitors may be effective in the treatment of some infections with metronidazole-resistant H...... to regimens that include proton pump inhibitors. In the present study, the synergistic effect of subinhibitory concentrations (0.25-0.5 MIC) of either bismuth subcitrate or omeprazole with metronidazole on the susceptibility of 42 H. pylori strains was investigated by agar dilution method and the Epsilometer......Treatment failures using triple therapy that include metronidazole, are common in patients infected with metronidazole-resistant Helicobacter pylori in the gastric mucosa. Higher eradication rates in such patients have been described when treatment regimens include bismuth salts compared...

  16. Characteristics of polonium contamination from neutral irradiated lead-bismuth eutectic

    International Nuclear Information System (INIS)

    Miura, T.; Obara, T.; Sekimoto, H.


    After neutron capture, bismuth-209 changes to polonium-210 that emits α-particles. Lead-Bismuth eutectic (LBE) in reactor system contaminates the system by polonium. We analyzed adsorbed materials from melted LBE on quartz glass plate. Lead, bismuth and their oxides were confirmed in adsorbed materials. And, we evaluated the baking method in vacuum for removal of polonium and adsorbed materials on quartz glass plate. It was evaluated that it is possible to remove almost all the polonium from the quartz glass plate by baking at temperature more than 300 C. degrees. Unfolding method was applied to calculate polonium distribution in LBE ingot. From measured α-particle pulse height distribution, the polonium distribution in depth of LBE ingot was calculated using quadratic programming code, where response functions are calculated by Monte Carlo method. (authors)

  17. Synthesis of Bismuth Stannate Nanoparticles with High Photocatalytic Activity under the Visible Light Irradiation

    Directory of Open Access Journals (Sweden)

    G. Gnanamoorthy


    Full Text Available Malachite Green is one of the most important organic dye, it contains triphenylmethane groups and it has been widely used for many industries. The hazardous dyes were rapidly act on immune and reproductive systems with carcinogenic effect of human health. Different methods were used for the hazardous removal in various industries, such as photocatalysis, biological treatment and adsorption process. The bismuth stannate nanoparticles have special properties of the hydrogen storage, biomolecule detection, gas sensors and catalysis. The bismuth stannate nanoparticles can be used for the degradation of organic pollutants and bismuth stannate is an important ternary oxide semiconductor with a wide band gap material. The composites were synthesized by a hydrothermal method, the obtained product was characterized by XRD, Raman, the morphology structure was confirmed by scanning electron microscopy and optical properties were carried out by DRS-UV-Vis spectroscopy. The excellent photocatalytic performance of the catalyst was evaluated by malachite green under the visible light.

  18. Synthesis of binary bismuth-cadmium oxide nanorods with sensitive electrochemical sensing performance

    Energy Technology Data Exchange (ETDEWEB)

    Wen, Yong [Xinjiang Univ., Xinjiang (China). School of Civil Engineering and Architecture; Pei, Lizhai; Wei, Tian [Anhui Univ. of Technology, Anhui (China). School of Materials Science and Engineering


    Binary bismuth-cadmium oxide nanorods have been synthesized by a simple hydrothermal process without templates and additives. X-ray diffraction and high-resolution transmission electron microscopy reveal that the nanorods possess single crystalline tetragonal Bi{sub 2}CdO{sub 4} phase. Scanning electron microscopy and transmission electron microscopy images show that the length and diameter of the nanorods are 20-300 nm and 5-10 μm, respectively. The formation of the binary bismuth-cadmium oxide nanorods is closely related to the hydrothermal parameters. The electrochemical sensing performance of the binary bismuth-cadmium oxide nanorods has been investigated using the nanorods as glassy carbon electrode modifiers. The detection limit is 0.19 μM with a linear range of 0.0005-2 mM. The nanorod-modified glassy carbon electrode exhibits good electrocatalytic activity toward L-cysteine and great application potential for electrochemical sensors.

  19. Bismuth- and lithium-loaded plastic scintillators for gamma and neutron detection

    International Nuclear Information System (INIS)

    Cherepy, Nerine J.; Sanner, Robert D.; Beck, Patrick R.; Swanberg, Erik L.; Tillotson, Thomas M.; Payne, Stephen A.; Hurlbut, Charles R.


    Transparent plastic scintillators based on polyvinyltoluene (PVT) have been fabricated with high loading of bismuth carboxylates for gamma spectroscopy, and with lithium carboxylates for neutron detection. When activated with a combination of standard fluors, 2,5-diphenyloxazole (PPO) and tetraphenylbutadiene (TPB), gamma light yields with 15 wt% bismuth tripivalate of 5000 Ph/MeV are measured. A PVT plastic formulation including 30 wt% lithium pivalate and 30 wt% PPO offers both pulse shape discrimination, and a neutron capture peak at ~400 keVee. In another configuration, a bismuth-loaded PVT plastic is coated with ZnS( 6 Li) paint, permitting simultaneous gamma and neutron detection via pulse shape discrimination with a figure-of-merit of 3.8, while offering gamma spectroscopy with energy resolution of R(662 keV)=15%

  20. Study of magnesium bismuth alloys with a composition close to Mg3Bi2

    International Nuclear Information System (INIS)

    Tournier, Jean


    The author reports the study of magnesium-bismuth alloys with a high bismuth content. These alloys were aimed to be irradiated in a pile at a temperature of about 300 C, and thus had specific requirements regarding their bismuth content, a high density, a high fusion point with also a pressure strength constraint. The author first reports the determination of an alloy grade which could meet these requirements, and then reports issues related to their elaboration by performing optical micrography and X ray analysis in order to investigate their homogeneity. Then, the alloy hot compression strength has been assessed under significantly higher constraining conditions. Fusion point and density have also been measured. As a fast alloy degradation has been noticed, brief corrosion tests have been performed

  1. Optical properties of thermally reduced bismuth-doped sodium aluminosilicate glasses

    DEFF Research Database (Denmark)

    Nielsen, K.H.; Smedskjær, Morten Mattrup; Yue, Yuanzheng

    Heat-treatment of multivalent ion containing glasses in a hydrogen atmosphere may cause both reduction of the multivalent ions and ionic inward diffusion, resulting in improved glass properties. Bismuth-doped glasses are also interesting objects not only concerning the reduction induced diffusion...... pressure of hydrogen. Here, we present results on the effect of the heat-treatment on the optical properties of bismuth-doped sodium aluminosilicate glasses.......Heat-treatment of multivalent ion containing glasses in a hydrogen atmosphere may cause both reduction of the multivalent ions and ionic inward diffusion, resulting in improved glass properties. Bismuth-doped glasses are also interesting objects not only concerning the reduction induced diffusion...

  2. Peculiarities of the interaction of indium-tin and indium-bismuth alloys with ammonium halides

    International Nuclear Information System (INIS)

    Red'kin, A.N.; Smirnov, V.A.; Sokolova, E.A.; Makovej, Z.I.; Telegin, G.F.


    Peculiarities of fusible metal alloys interaction with ammonium halogenides in vertical reactor are considered using indium-tin and indium-bismuth binary alloys. It is shown that at the end of the process the composition of metal and salt phases is determined by the equilibrium type and constant characteristic of the given salt-metal system. As a result the interaction of indium-tin and indium-bismuth alloys with ammonium halogenides leads to preferential halogenation of indium-bismuth alloys with ammonium halogenides leads to preferential halogenation of indium which may be used in the processes of separation or purification. A model is suggested to calculate the final concentration of salt and metal phase components

  3. Evaluation of the gamma radiation shielding parameters of bismuth modified quaternary glass system (United States)

    Kaur, Parminder; Singh, K. J.; Thakur, Sonika


    Glasses modified with heavy metal oxides (HMO) are an interesting area of research in the field of gamma-ray shielding. Bismuth modified lithium-zinc-borate glasses have been studied whereby bismuth oxide is added from 0 to 50 mol%. The gamma ray shielding properties of the glasses were evaluated at photon energy 662 keV with the help of XMuDat computer program by using the Hubbell and Seltzer database. Various gamma ray shielding parameters such as attenuation coefficient, shield thickness in terms of half and tenth value layer, effective atomic number have been studied in this work. A useful comparison of this glass system has been made with standard radiation shielding concretes viz. ordinary, barite and iron concrete. The glass samples containing 20 to 50 mol% bismuth oxide have shown better gamma ray shielding properties and hence have the potential to become good radiation absorbers.

  4. Bismuth Passivation Technique for High-Resolution X-Ray Detectors (United States)

    Chervenak, James; Hess, Larry


    The Athena-plus team requires X-ray sensors with energy resolution of better than one part in 3,000 at 6 keV X-rays. While bismuth is an excellent material for high X-ray stopping power and low heat capacity (for large signal when an X-ray is stopped by the absorber), oxidation of the bismuth surface can lead to electron traps and other effects that degrade the energy resolution. Bismuth oxide reduction and nitride passivation techniques analogous to those used in indium passivation are being applied in a new technique. The technique will enable improved energy resolution and resistance to aging in bismuth-absorber-coupled X-ray sensors. Elemental bismuth is lithographically integrated into X-ray detector circuits. It encounters several steps where the Bi oxidizes. The technology discussed here will remove oxide from the surface of the Bi and replace it with nitridized surface. Removal of the native oxide and passivating to prevent the growth of the oxide will improve detector performance and insulate the detector against future degradation from oxide growth. Placing the Bi coated sensor in a vacuum system, a reduction chemistry in a plasma (nitrogen/hydrogen (N2/H2) + argon) is used to remove the oxide and promote nitridization of the cleaned Bi surface. Once passivated, the Bi will perform as a better X-ray thermalizer since energy will not be trapped in the bismuth oxides on the surface. A simple additional step, which can be added at various stages of the current fabrication process, can then be applied to encapsulate the Bi film. After plasma passivation, the Bi can be capped with a non-diffusive layer of metal or dielectric. A non-superconducting layer is required such as tungsten or tungsten nitride (WNx).

  5. Synthesis and characterization of titanium oxide/bismuth sulfide nanorods for solar cells applications

    International Nuclear Information System (INIS)

    Solis, M.; Rincon, M. E.


    In the present work is showed the synthesis and characterization of titanium oxide/bismuth sulfide nanowires hetero-junctions for solar cells applications. Conductive glass substrates (Corning 25 x 75 mm) were coated with a thin layer of sol-gel TiO2 and used as substrates for the subsequent deposition of bismuth sulfide nanorods (BN). TiO2 films (∼400 nm) were deposited with a semiautomatic immersion system with controlled immersion/withdraw velocity, using titanium isopropoxide as the titania precursor [1]. For BN synthesis and deposition, the solvo-thermal method was used, introducing air annealed TiO2-substrates in the autoclave. The typical bilayer TiO2/BN hetero-junction was 600 nm thick. The synthesized materials (powders and films) were characterized by X-Ray Diffraction, Scanning Electron Microscopy, and UV-Visible Spectroscopy. Anatase was the crystalline phase of TiO2, while bismuth sulfide nanotubes show a diffraction pattern characteristic of bismuthinite distorted by the preferential growth of some planes [2-4]. The optoelectronic characterization of TiO2/NB hetero-junctions was compared with hetero-junctions obtained by sensitizing TiO2 with chemically deposited bismuth sulfide films. Bismuth sulfide nanowires are 2µm long and 70nm wide (aspect ratio L/D = 43), while chemically deposited bismuth sulfide have L/D = 1, therefore the effect of particle size evaluation and geometry in the photosensitization phenomena will be discussed in the context of new materials for solar-cells applications. (Full text)

  6. Basic principles of lead and lead-bismuth eutectic application in blanket of fusion reactors

    International Nuclear Information System (INIS)

    Beznosov, A.V.; Pinaev, S.S.; Muraviev, E.V.; Romanov, P.V.


    High magnetohydrodynamic pressure drop is an important issue for liquid metal blanket concepts. To decrease magnetohydrodynamic resistance authors propose to form insulating coatings on internal surface of blanket ducts at any moment of fusion reactor exploitation. It may be achieved easily if lead or lead-bismuth eutectic is used and technology of oxidative potential handling is applied. A number of experiments carried out in NNSTU show the availability of the proposed technology. It bases on formation of the insulating coatings that consist of the oxides of components of the structural materials and of the coolant components. In-situ value of the insulating coatings characteristics ρδ is ∼ 10 -5 Ohm·m 2 for steels and 5,0x10 -6 - 5,0x10 -5 Ohm·m 2 for vanadium alloys. Thermal cycling is possible during exploitation of a blanket. The experimental research of the insulating coatings properties during thermal cycling have shown that the coatings formed into the lead and lead-bismuth coolants save there insulating properties. Experience of many years is an undoubted advantage of the lead-bismuth coolant and less of the lead coolant in comparison with lithium. Russian Federation possesses of experience of exploitation of the research and industrial facilities, of experience of creation of the pumps, steamgenerators and equipment with heavy liquid metal coolants. The unique experience of designing, assembling and exploitation of the fission reactors with lead-bismuth coolant is also available. The problem of technology of lead and lead-bismuth coolants for power high temperature radioactive facilities has been solved. Accidents, emergency situations such as leakage of steamgenerators or depressurization of gas system in facilities with lead and lead-bismuth coolants have been explored and suppressed. (author)

  7. Thallium-201 chloride dynamic analysis using thallium-201 chloride and sodium iodide-131 thyroid subtraction scintigraphy

    Energy Technology Data Exchange (ETDEWEB)

    Morimoto, Setsuo; Hiraki, Yoshio; Togami, Izumi [Okayama Univ. (Japan). School of Medicine


    The mechanism of /sup 201/Tl chloride accumulation is unclear in thyroid gland and thyroid tumor. This report examines 108 patients that received thyroid scintigraphy examinations with both /sup 201/Tl chloride and sodium /sup 131/I. The patients were diagnosed clinically and histologically whenever possible. The ROI were obtained by subtraction imaging with both isotopes and by subtraction positive and negative areas of imaging. Dynamic curves were obtained for /sup 201/Tl chloride per square unit of each ROI. The dynamic curve in the radioiodide-accumulated area was examined. The data indicate that the clearance rate of /sup 201/Tl chloride (T/sub 15/) was correlated with the sodium /sup 131/I uptake rate at 24 h (r=0.70).

  8. 5 CFR 412.201 - Management succession. (United States)


    ... programs must be supported by employee training and development programs. The focus of the program should... learning experiences throughout an employee's career, such as details, mentoring, coaching, learning groups..., MANAGEMENT, AND EXECUTIVE DEVELOPMENT Succession Planning § 412.201 Management succession. The head of each...

  9. 48 CFR 12.201 - General. (United States)


    ... ACQUISITION OF COMMERCIAL ITEMS Special Requirements for the Acquisition of Commercial Items 12.201 General. Public Law 103-355 establishes special requirements for the acquisition of commercial items intended to more closely resemble those customarily used in the commercial marketplace. This subpart identifies...

  10. 48 CFR 51.201 - Policy. (United States)


    ... GOVERNMENT SOURCES BY CONTRACTORS Contractor Use of Interagency Fleet Management System (IFMS) 51.201 Policy... contractors to obtain, for official purposes only, interagency fleet management system (IFMS) vehicles and... instance. (c) Government contractors shall not be authorized to obtain interagency fleet management system...

  11. 48 CFR 18.201 - Contingency operation. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contingency operation. 18... METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Emergency Acquisition Flexibilities 18.201 Contingency operation. (a) Contingency operation is defined in 2.101. (b) Micro-purchase threshold. The threshold...

  12. 27 CFR 46.201 - General. (United States)


    ... record (book) inventory in accordance with § 46.203. The following table lists the taxable articles and the method to use for each to determine quantities: Article Inventory method Small cigarettes Count... Sale on April 1, 2009 Inventories § 46.201 General. (a) Date. The dealer must take an inventory to...

  13. 48 CFR 2419.201 - General policy. (United States)


    ...-owned small businesses. (d) Each head of a contracting activity shall designate a small business...; (6) Advise such businesses with respect to the financial assistance available under existing laws and... SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 2419.201 General policy. (c) The Director, Office of...

  14. 7 CFR 3430.201 - Purpose. (United States)


    ...-GENERAL AWARD ADMINISTRATIVE PROVISIONS Specialty Crop Research Initiative § 3430.201 Purpose. (a) Focus areas. The purpose of this program is to address the critical needs of the specialty crop industry by developing and disseminating science-based tools to address needs of specific crops and their regions...

  15. 48 CFR 9903.201-5 - Waiver (United States)


    ... the applicability of the Cost Accounting Standards for a contract or subcontract with a value of less... 9903.201-5 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS...

  16. 48 CFR 1313.201 - General. (United States)


    ... 1313.201 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CONTRACTING METHODS AND CONTRACT... General. DOC employees, other than warranted contracting officers, must be delegated micro-purchase authority by the designee set forth in CAM 1301.70 according to FAR 1.603-3(b), and must be trained pursuant...

  17. Neuro-oncology Thallium 201 interest

    International Nuclear Information System (INIS)

    Guyot, M.; Latry, C.; Basse-Cathalinat, B.; Ducassou, D.; Guerin, J.; Maire, J.P.


    So and in spite of its histologic specificity absence, Tl 201 has an evident interest in neuro-oncology: for the low grade astrocytoma transformation diagnosis toward one higher grad; for the neoplasm residue and recidive diagnosis; and more generally as forecasted evolution element during the therapy. 2 figs., 4 tabs., 4 graphs

  18. 7 CFR 201.55 - Retests. (United States)


    ... Germination Tests in the Administration of the Act § 201.55 Retests. Retests shall be made as follows: (a) When the range of 100-seed replicates of a given test exceeds the maximum tolerated range in the table... replicates of a given test, rounding off the result to the nearest whole number. The germination is found in...

  19. 7 CFR 201.56 - Interpretation. (United States)


    ... REGULATIONS Germination Tests in the Administration of the Act § 201.56 Interpretation. (a) A seed shall be... and the final count. During the progress of the germination test, seeds which are obviously dead and... evaluation of germination tests made on approved artificial media. This is intended to provide a method of...

  20. 7 CFR 201.6 - Germination. (United States)


    ... REGULATIONS Records for Agricultural and Vegetable Seeds § 201.6 Germination. The complete record shall include the records of all laboratory tests for germination and hard seed for each lot of seed offered for transportation in whole or in part. The record shall show the kind of seed, lot number, date of test, percentage...

  1. 7 CFR 201.57 - Hard seeds. (United States)


    ... REGULATIONS Germination Tests in the Administration of the Act § 201.57 Hard seeds. Seeds which remain hard at the end of the prescribed test because they have not absorbed water, due to an impermeable seed coat... percentage of germination. For flatpea, continue the swollen seed in test for 14 days when germinating at 15...

  2. 44 CFR 201.3 - Responsibilities. (United States)


    ... receive the reduced cost share for the Flood Mitigation Assistance (FMA) and Severe Repetitive Loss (SRL... HOMELAND SECURITY DISASTER ASSISTANCE MITIGATION PLANNING § 201.3 Responsibilities. (a) General. This... Administrator are to: (1) Oversee all FEMA related pre- and post-disaster hazard mitigation programs and...

  3. 48 CFR 419.201 - General policy. (United States)


    ... SMALL BUSINESS PROGRAMS Policies 419.201 General policy. It is the policy of USDA to provide maximum practicable contracting and subcontracting opportunities to small business (SB), small disadvantaged business (SDB), HUBZone small business, women-owned business (WOB), veteran-owned small business (VOSB), and...

  4. 22 CFR 1203.735-201 - General. (United States)


    ...) Losing independence or impartiality; (5) Making a Government decision outside official channels; or (6... Foreign Relations UNITED STATES INTERNATIONAL DEVELOPMENT COOPERATION AGENCY EMPLOYEE RESPONSIBILITIES AND CONDUCT Ethical and Other Conduct and Responsibilities of Employees § 1203.735-201 General. (a) Proscribed...

  5. 7 CFR 201.51 - Inert matter. (United States)


    ... REGULATIONS Purity Analysis in the Administration of the Act § 201.51 Inert matter. Inert matter shall include... kochia that pass through a 1 mm opening, square-hole sieve, when shaken for 30 seconds. (8) The thin... devoid of the husk and pass through a 1/13th-inch, round-hole sieve. (ii) Bulblets which show evident...

  6. 48 CFR 49.201 - General. (United States)


    ... strict accounting principles, is the heart of a settlement. (b) The primary objective is to negotiate a... TERMINATION OF CONTRACTS Additional Principles for Fixed-Price Contracts Terminated for Convenience 49.201... on or segregating the particular elements of costs or profit comprising this amount. (c) Cost and...

  7. 5 CFR 591.201 - Definitions. (United States)


    ... Cost-of-Living Allowance and Post Differential-Nonforeign Areas § 591.201 Definitions. In this subpart... the BLS survey of the change of consumer prices over time. Cost-of-living allowance (COLA) means an... nonforeign area where living costs are substantially higher than in the Washington, DC, area. Cost-of-living...

  8. 48 CFR 201.404 - Class deviations. (United States)


    ..., and the Defense Logistics Agency, may approve any class deviation, other than those described in 201...) Diminish any preference given small business concerns by the FAR or DFARS; or (D) Extend to requirements imposed by statute or by regulations of other agencies such as the Small Business Administration and the...

  9. When is 201Tl myocardial scintigraphy indicated?

    International Nuclear Information System (INIS)

    Klepzig, H. Jr.; Kaltenbach, M.


    Myocardial scintigraphy with thallium-201 has met with good acceptance in cardiology and has proven its value. The method implies only low risk and yields diagnostic results that allow verification or disqualification of suspected myocardial ischemia in those cases where there is only reduced accuracy of the exercise electrocardiogram. (TRV) [de

  10. 19 CFR 201.43 - Program. (United States)


    ... UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION National Security Information § 201.43 Program. The Director of Administration is designated as the official of the Commission who is responsible for implementation and oversight of information security programs and procedures...

  11. 30 CFR 75.201 - Definitions. (United States)


    ... SAFETY STANDARDS-UNDERGROUND COAL MINES Roof Support § 75.201 Definitions. Automated temporary roof support (ATRS) system. A device to provide temporary roof support from a location where the equipment operator is protected from roof falls. Pillar recovery. Any reduction in pillar size during retreat mining. ...

  12. 48 CFR 2919.201 - General policy. (United States)


    ... Business Utilization, prior to being advertised. The Acquisition Screening and Review Form DL-1-2004 shall... BUSINESS AND SMALL DISADVANTAGED BUSINESS CONCERNS Policies 2919.201 General policy. (a) It is the policy of the Department of Labor to provide maximum practicable opportunities to small businesses in...

  13. 11 CFR 201.2 - Definitions. (United States)


    ... Elections FEDERAL ELECTION COMMISSION ADMINISTRATIVE REGULATIONS EX PARTE COMMUNICATIONS § 201.2 Definitions. As used in this part: (a) Ex parte communication means any written or oral communication by any... candidate or committee applying for or participating in the public funding process, or (2) Any ongoing audit...

  14. Growth morphology and structure of bismuth thin films on GaSb(110)

    DEFF Research Database (Denmark)

    Gemmeren, T. van; Lottermoser, L.; Falkenberg, G.


    Photoelectron spectroscopy, low-energy electron diffraction, scanning tunneling microscopy and surface X-ray diffraction were used to investigate the growth of thin layers of bismuth on GaSb(110). At submonolayer coverages, growth of two-dimensional islands occurs. A uniform (1 x I)-reconstructio...... that the (1 x 1)-phases formed by antimony and bismuth adsorbates on (110) surfaces of other III-V compound semiconductors are also described by the epitaxial continued layer model. (C) 1998 Elsevier Science B.V. All rights reserved....

  15. Evaluation of gamma-ray attenuation properties of bismuth borate glass systems using Monte Carlo method

    International Nuclear Information System (INIS)

    Tarim, Urkiye Akar; Ozmutlu, Emin N.; Yalcin, Sezai; Gundogdu, Ozcan; Bradley, D.A.; Gurler, Orhan


    A Monte Carlo method was developed to investigate radiation shielding properties of bismuth borate glass. The mass attenuation coefficients and half-value layer parameters were determined for different fractional amounts of Bi 2 O 3 in the glass samples for the 356, 662, 1173 and 1332 keV photon energies. A comparison of the theoretical and experimental attenuation coefficients is presented. - Highlights: • Radiation shielding properties of bismuth borate glass systems have been reported. • Mass attenuation coefficients increase linearly with increase in Bi concentration. • Half-value layer decreases with increasing concentration of Bi. • Half-value layer decreases with the increase in the sample density.

  16. Neutron scattering differential cross sections of carbon and bismuth at 37 MeV

    International Nuclear Information System (INIS)

    Zhou Zuying; Tang Hongqing; Qi Bujia; Zhou Chenwei; Du Yanfeng; Xia Haihong; Walter, R.L.; Tornow, W.; Howell, C.; Braun, R.; Roper, C.; Chen Zemin; Chen Zhengpeng; Chen Yingtang


    Elastic differential cross sections of 37 MeV neutrons scattered from carbon and bismuth were measured in the angular range 11 to 160 degrees by means of the multi-detector TOF facility. The 37 MeV neutrons were produced via the T(d,n) 4 He reaction in a tritium gas target. The pulsed 20 MeV deuteron beam was provided by the HI-13 tandem accelerator. The angular distribution of scattered neutrons from carbon and bismuth were measured in the angular range 11 degree to 145 degree and 11 degree to 160 degree respectively in steps of about 3 degree

  17. Bismuth germanate's role in the new revolution in gamma-ray spectroscopy

    International Nuclear Information System (INIS)

    Johnson, N.R.; Baktash, C.; Lee, I.Y.


    Some of the considerations on how to effectively incorporate bismuth germanate into complex detection systems are covered, and some of these new systems now in operation or under construction are discussed. Significant achievements in gamma ray spectroscopy are reviewed as well as some recent results based on data taken with coincidence arrays of germanium detectors and Compton-suppression spectrometers. Then the first impact of bismuth germanate detectors on our understanding of the properties of nuclei that have high energy and very high angular momentum states are addressed

  18. Formic acid oxidation at platinum-bismuth catalysts

    Directory of Open Access Journals (Sweden)

    Popović Ksenija Đ.


    Full Text Available The field of heterogeneous catalysis, specifically catalysis on bimetallic surfaces, has seen many advances over the past few decades. Bimetallic catalysts, which often show electronic and chemical properties that are distinct from those of their parent metals, offer the opportunity to obtain new catalysts with enhanced selectivity, activity, and stability. The oxidation of formic acid is of permanent interest as a model reaction for the mechanistic understanding of the electrooxidation of small organic molecules and because of its technical relevance for fuel cell applications. Platinum is one of the most commonly used catalysts for this reaction, despite the fact that it shows a few significant disadvantages: high cost and extreme susceptibility to poisoning by CO. To solve this problem, several approaches have been used, but generally, they all consist in the modification of platinum with a second element. Especially, bismuth has received significant attention as Pt modifier. According to the results presented in this survey dealing with the effects influencing the formic acid oxidation it was found that two types of Pt-Bi bimetallic catalysts (bulk and low loading deposits on GC showed superior catalytic activity in terms of the lower onset potential and oxidation current density, as well as exceptional stability compared to Pt. The findings in this report are important for the understanding of mechanism of formic acid electrooxidation on a bulk alloy and decorated surface, for the development of advanced anode catalysts for direct formic acid fuel cells, as well as for the synthesis of novel low-loading bimetallic catalysts. The use of bimetallic compounds as the anode catalysts is an effective solution to overcoming the problems of the formic acid oxidation current stability for long term applications. In the future, the tolerance of both CO poisoning and electrochemical leaching should be considered as the key factors in the development

  19. Bismuth subsalicylate nanoparticles with anaerobic antibacterial activity for dental applications (United States)

    Vega-Jiménez, A. L.; Almaguer-Flores, A.; Flores-Castañeda, M.; Camps, E.; Uribe-Ramírez, M.; Aztatzi-Aguilar, O. G.; De Vizcaya-Ruiz, A.


    In recent years, nanomaterials have been used in the medical-dental field as new alternative antimicrobial agents. Bismuth subsalicylate (BSS) has been used as an antimicrobial agent, but the effect of BSS in the form of nanoparticles (BSS-nano) as a potential antimicrobial agent has not been tested, in specific against bacteria responsible for periodontal disease. The aim of this study was to evaluate the antibacterial effect of BSS-nano against oral anaerobic bacteria and to assess the safety of BSS-nano by evaluating their cytotoxicity in human gingival fibroblast (HGF-1) cells. BSS-nano were synthesized by laser ablation and were previously physico-chemically characterized using in vitro assays. The antibacterial activity was measured using the tetrazolium-based XTT assay, and cytotoxicity was determined using lactate dehydrogenase (LDH) and MTS assays in HGF-1 cells. Transmission electron microscopy of HGF-1 exposed to BSS-nano was also performed. BSS-nano was shown to have a primary size of 4-22 nm and a polygonal shape. Among the tested bacterial strains, those with a greater sensitivity to BSS-nano (highest concentration of 21.7 μg ml-1) were A. actinomycetemcomitans, C. gingivalis, and P. gingivalis. BSS-nano at a concentration of 60 μg ml-1 showed low cytotoxicity (6%) in HFG-1 cells and was mainly localized intracellularly in acidic vesicles. Our results indicate that the concentration of BSS-nano used as an effective antibacterial agent does not induce cytotoxicity in mammalian cells; thus, BSS-nano can be applied as an antibacterial agent in dental materials or antiseptic solutions.

  20. Lead-Bismuth-Eutectic Spallation Neutron Source for Nuclear Transmuter

    International Nuclear Information System (INIS)

    Gohar, Y.; Herceg, J.; Krajtl, L.; Micklich, B.; Pointer, D.; Saiveau, J.; Sofu, T.; Finck, P.


    A lead-bismuth eutectic (LBE) spallation target design concept has been developed for the subcritical multiplier (SCM) design of the accelerator-driven test facility (ADTF). The design is based on a coaxial geometrical configuration, which has been carefully analyzed and designed to achieve an optimum performance. The target design description, the results from the parametric studies, and the design analyses including neutronics, heat transfer, and hydraulics analyses are given in this paper. A detailed MCNPX geometrical model for the target has been developed to generate heating rates and nuclear responses in the structural material for the design process. The beam has a uniform distribution of 600 MeV protons and 5-MW total power. A small LBE buffer is optimized to reduce the irradiation damage in the SCM fuel elements from the scatter protons and the high-energy neutrons, to maximize the neutron yield to the SCM operation, and to provide inlet and outlet manifolds for the LBE coolant. A special attention has been given to the target window design to enhance its lifetime. The window volumetric heating is 766 W/cm 3 relative to 750 W/cm 3 in LBE for a 40-μA/cm 2 current density. The results show that the nuclear heating from the proton beam diminishes at about 32 cm along the beam axis in the LBE target material. The neutron contribution to the atomic displacement is in the range of 94 to ∼100% for the structure material outside the proton beam path. In the beam window, the neutron contribution is ∼74% and the proton beam is responsible for more than 95% of the total gas production. The proton contribution to the gas production vanishes outside the beam path. The LBE average velocity is ∼2 m/s. The heat transfer and the hydraulics analyses have been iterated to reduce the maximum temperature and the thermal stress level in the target window to enhance its operating life. (authors)

  1. Adsorption of volatile polonium and bismuth species on metals in various gas atmospheres. Pt. I. Adsorption of volatile polonium and bismuth on gold

    Energy Technology Data Exchange (ETDEWEB)

    Maugeri, Emilio Andrea; Neuhausen, Joerg; Dressler, Rugard; Piguet, David; Voegele, Alexander; Schumann, Dorothea [Paul Scherrer Institut (PSI), Villigen (Switzerland). Lab. for Radiochemistry; Eichler, Robert [Paul Scherrer Institut (PSI), Villigen (Switzerland). Lab. for Radiochemistry; Bern Univ. (Switzerland). Dept. for Chemistry and Biochemistry; Rijpstra, Kim [Ghent Univ., Zwijnaarde (Belgium). Center for Molecular Modeling (CMM); Cottenier, Stefaan [Ghent Univ., Zwijnaarde (Belgium). Center for Molecular Modeling (CMM); Ghent Univ., Zwijnaarde (Belgium). Dept. of Materials Science and Engineering


    Polonium isotopes are considered the most hazardous radionuclides produced during the operation of accelerator driven systems (ADS) when lead-bismuth eutectic (LBE) is used as the reactor coolant and as the spallation target material. In this work the use of gold surfaces for capturing polonium from the cover gas of the ADS reactor was studied by thermochromatography. The results show that gaseous monoatomic polonium, formed in dry hydrogen, is adsorbed on gold at 1058 K. Its adsorption enthalpy was calculated as -250±7 kJ mol{sup -1}, using a Monte Carlo simulation code. Highly volatile polonium species that were observed in similar experiments in fused silica columns in the presence of moisture in both inert and reducing gas were not detected in the experiments studying adsorption on gold surfaces. PoO{sub 2} is formed in both dry and moist oxygen, and its interaction with gold is characterized by transport reactions. The interaction of bismuth, present in large amounts in the atmosphere of the ADS, with gold was also evaluated. It was found that bismuth has a higher affinity for gold, compared to polonium, in an inert, reducing, and oxidizing atmosphere. This fact must be considered when using gold as a material for filtering polonium in the cover gas of ADS.

  2. Effects of crystallite structure and interface band alignment on the photocatalytic property of bismuth ferrite/ (N-doped) graphene composites

    International Nuclear Information System (INIS)

    Li, Pai; Chen, Qiang; Lin, Yinyin; Chang, Gang; He, Yunbin


    Bismuth ferrite/graphene (N-doped graphene) photocatalysts are successfully prepared by a facile and effective two-step hydrothermal method. Bismuth ferrite/graphene shows superior photocatalytic activity compared with bismuth ferrite/N-doped graphene and pure BiFeO 3 . X-ray diffraction, scanning electron microscopy and energy-dispersive spectroscopy analyses indicate that Bi 25 FeO 40 crystalline phase is obtained with the addition of graphene, while BiFeO 3 is formed under the same hydrothermal conditions in the presence of N-doped graphene. Core-level and valence-band X-ray photoelectron spectroscopy analyses reveal a downward band bending of bismuth ferrite (∼0.5 eV) at the interface of the bismuth ferrite/(N-doped) graphene composites, which facilitates the electron transfer from bismuth ferrite to (N-doped) graphene and suppresses the recombination of photo-generated electron–hole pairs. This downward bending band alignment at the interface supposes to be the main mechanism underlying the enhanced photocatalytic activity of the bismuth ferrite/graphene composites that are currently of great interest in the photocatalysis field. - Highlights: • Bismuth ferrite/(N-doped) graphene composites were prepared by a hydrothermal method. • Bi 25 FeO 40 and BiFeO 3 were obtained with presence of graphene and N-graphene, respectively. • Bi 25 FeO 40 /graphene shows superior photocatalytic activity over BiFeO 3 and BiFeO 3 /N-graphene. • A downward band bending (∼0.5 eV) of bismuth ferrite exists at the composites interface. • The downward band bending supposes to be the mechanism for the enhanced photocatalytic activity.

  3. Ultrathin bismuth nanosheets from in situ topotactic transformation for selective electrocatalytic CO2 reduction to formate. (United States)

    Han, Na; Wang, Yu; Yang, Hui; Deng, Jun; Wu, Jinghua; Li, Yafei; Li, Yanguang


    Electrocatalytic carbon dioxide reduction to formate is desirable but challenging. Current attention is mostly focused on tin-based materials, which, unfortunately, often suffer from limited Faradaic efficiency. The potential of bismuth in carbon dioxide reduction has been suggested but remained understudied. Here, we report that ultrathin bismuth nanosheets are prepared from the in situ topotactic transformation of bismuth oxyiodide nanosheets. They process single crystallinity and enlarged surface areas. Such an advantageous nanostructure affords the material with excellent electrocatalytic performance for carbon dioxide reduction to formate. High selectivity (~100%) and large current density are measured over a broad potential, as well as excellent durability for >10 h. Its selectivity for formate is also understood by density functional theory calculations. In addition, bismuth nanosheets were coupled with an iridium-based oxygen evolution electrocatalyst to achieve efficient full-cell electrolysis. When powered by two AA-size alkaline batteries, the full cell exhibits impressive Faradaic efficiency and electricity-to-formate conversion efficiency.

  4. Study of bismuth oxide compounds as cathodic materials in lithium accumulators

    International Nuclear Information System (INIS)

    Apostolova, R.D.; Shembel', E.M.


    Two groups of bismuth oxide base compounds: rare earth bismuthides - SmBiO 3 and EuBiO 3 , as well as the Aurivillius phase - Bi 4 V 2 O 11 , were synthesized and electrochemically studied as novel cathodic materials for high-energy lithium current sources [ru

  5. 75 FR 14491 - Listing of Color Additives Exempt From Certification; Bismuth Citrate (United States)


    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES Food and Drug Administration 21 CFR Part 73 [Docket No... Safety and Applied Nutrition (HFS-265), Food and Drug Administration, 5100 Paint Branch Pkwy., College... results from a 90-day oral toxicity study on bismuth citrate in rats, genotoxicity studies, dermal...

  6. Sensing characteristics of nanocrystalline bismuth oxide clad-modified fiber optic gas sensor (United States)

    Manjula, M.; Karthikeyan, B.; Sastikumar, D.


    Gas sensing properties of nanocrystalline bismuth oxide clad - modified fiber optic sensor is reported for ammonia, ethanol, methanol and acetone gasses at room temperature. The output of sensor increases or decreases for certain gasses when the concentration of the gas is increased. The sensor exhibits high response and good selectivity to methanol gas. Time response characteristics of the sensor are also reported.

  7. The design of the data acquisition system for a very large bismuth germanate calorimeter

    Energy Technology Data Exchange (ETDEWEB)

    Bakken, J.; Isaila, M.; Piroue, P.; Stickland, D.; Sumner, R.


    LEPC, the Large Electron Positron Collider being built at CERN, will be ready for experiments in 1988. A large array of bismuth germanate crystals will be part of one of the first experiments to be installed. Particles (including photons) resulting from the collisions will be identified and measured in the surrounding detector. At the center of this composite detector is a tracking device to observe the trajectories of all particles. Beyond this is the bismuth germanate array; it will measure the energy of electrons and photons from a few MeV to 100 GeV. This is surrounded by the hadron calorimeter. The bismuth germanate calorimeter will consist of about 12,000 individual bismuth germanate crystals. Each crystal will have an independent readout system. This system uses silicon photodiodes, each with its own ADC, to measure the scintillation light from each crystal. The ADC is implemented in software in a single chip microcomputer, using a modification of successive approximation, which produces a very wide dynamic range. The microcomputer also provides data buffering and several other housekeeping functions. The initial design of the readout system, presented in this paper, evolved from an attempt to minimize the size requirements and the number of cables needed, and to meet the dynamic range requirement in a practical way.

  8. The design of the data acquisition system for a very large bismuth germanate calorimeter

    International Nuclear Information System (INIS)

    Bakken, J.; Isaila, M.; Piroue, P.; Stickland, D.; Sumner, R.


    LEPC, the Large Electron Positron Collider being built at CERN, will be ready for experiments in 1988. A large array of bismuth germanate crystals will be part of one of the first experiments to be installed. Particles (including photons) resulting from the collisions will be identified and measured in the surrounding detector. At the center of this composite detector is a tracking device to observe the trajectories of all particles. Beyond this is the bismuth germanate array; it will measure the energy of electrons and photons from a few MeV to 100 GeV. This is surrounded by the hadron calorimeter. The bismuth germanate calorimeter will consist of about 12,000 individual bismuth germanate crystals. Each crystal will have an independent readout system. This system uses silicon photodiodes, each with its own ADC, to measure the scintillation light from each crystal. The ADC is implemented in software in a single chip microcomputer, using a modification of successive approximation, which produces a very wide dynamic range. The microcomputer also provides data buffering and several other housekeeping functions. The initial design of the readout system, presented in this paper, evolved from an attempt to minimize the size requirements and the number of cables needed, and to meet the dynamic range requirement in a practical way

  9. Fridel-Crafts acylation using bismuth triflate in [BMI][PF6

    DEFF Research Database (Denmark)

    Tran, Phuong Hoang; Duus, Fritz; Le, Thach Ngoc


    Bismuth trifluoromethanesulfonate was found to be a good catalyst for the Friedel–Craftsacylation. Bismuthtriflate immobilized in an ionic liquid was the most efficient catalytic system. Bismuthtriflate in [BMI][PF6] catalyzes this reaction under microwave irradiation allowing the rapid synthesis...

  10. Studying Impact of Different Precipitating Agents on Crystal Structure, Morphology and Photocatalytic Activity of Bismuth Oxide

    Directory of Open Access Journals (Sweden)

    Yayuk Astuti


    How to Cite: Astuti, Y., Arnelli, Pardoyo, Fauziyah, A., Nurhayati, S., Wulansari, A.D., Andianingrum, R., Widiyandari, H., Bhaduri, G.A. (2017. Studying Impact of Different Precipitating Agents on Crystal Structure, Morphology and Photocatalytic Activity of Bismuth Oxide. Bulletin of Chemical Reaction Engineering & Catalysis, 12 (3: 478-484 (doi:10.9767/bcrec.12.3.1144.478-484

  11. Microwave-assisted facile and rapid Friedel-Crafts benzoylation of arenes catalysed by bismuth trifluoromethanesulfonate

    DEFF Research Database (Denmark)

    Tran, Phoung Hoang; Hansen, Poul Erik; Pham, Thuy Than


    The catalytic activity of metal triflates was investigated in Friedel–Crafts benzoylation under microwave irradiation. Friedel–Crafts benzoylation with benzoyl chloride of a variety of arenes containing electron-rich and electron-poor rings using bismuth triflate under microwave irradiation is de...

  12. Mucosa protectives: sucralfate and colloidal bismuth subcitrate in peptic ulcer disease

    NARCIS (Netherlands)

    Tytgat, G. N.; Nio, C. Y.


    Mucosa protective drugs are thought to have an important role in the treatment of both duodenal (DU) and gastric ulcer (GU) disease by means of correcting the disturbed defensive factors. Sucralfate as well as colloidal bismuth subcitrate (CBS) form a layer on the ulcer base and in this way protect

  13. Dynamic spatial structure of spontaneous beams in photorefractive bismuth sillicon oxide

    DEFF Research Database (Denmark)

    Buchhave, Preben; Lyuksyutov, S.; Vasnetsov, M.


    We report the domain structure of spontaneously occurring beams (subharmonics) in photorefractive bismuth silicon oxide with an applied electric field from 1 to 6 kV/cm and a running grating. The subharmonic beams are generated in a pattern of domains that evolve dynamically as they move through ...

  14. Dismantling and chemical characterization of spent Peltier thermoelectric devices for antimony, bismuth and tellurium recovery. (United States)

    Balva, Maxime; Legeai, Sophie; Garoux, Laetitia; Leclerc, Nathalie; Meux, Eric


    Major uses of thermoelectricity concern refrigeration purposes, using Peltier devices, mainly composed of antimony, bismuth and tellurium. Antimony was identified as a critical raw material by EU and resources of bismuth and tellurium are not inexhaustible, so it is necessary to imagine the recycling of thermoelectric devices. That for, a complete characterization is needed, which is the aim of this work. Peltier devices were manually dismantled in three parts: the thermoelectric legs, the alumina plates on which remain the electrical contacts and the silicone paste used to connect the plates. The characterization was performed using five Peltier devices. It includes mass balances of the components, X-ray diffraction analysis of the thermoelectric legs and elemental analysis of each part of the device. It appears that alumina represents 45% of a Peltier device in weight. The electrical contacts are mainly composed of copper and tin, and the thermoelectric legs of bismuth, tellurium and antimony. Thermoelectric legs appear to be Se-doped Bi 2 Te 3 and (Bi 0,5 Sb 1,5 )Te 3 for n type and p type semiconductors, respectively. This work shows that Peltier devices can be considered as a copper ore and that thermoelectric legs contain high amounts of bismuth, tellurium and antimony compared to their traditional resources.

  15. Improvements in the energy resolution and high-count-rate performance of bismuth germanate

    International Nuclear Information System (INIS)

    Koehler, P.E.; Wender, S.A.; Kapustinsky, J.S.


    Several methods for improving the energy resolution of bismuth germanate (BGO) have been investigated. It is shown that some of these methods resulted in a substantial improvement in the energy resolution. In addition, a method to improve the performance of BGO at high counting rates has been systematically studied. The results of this study are presented and discussed

  16. Structure-Composition-Property Relationships of Complex Bismuth Oxide Based Photocatalysts

    Energy Technology Data Exchange (ETDEWEB)

    Vogt, Thomas [Univ. of South Carolina, Columbia, SC (United States). Dept. of Chemistry and Biochemistry


    Development of a new family of up- and down-conversion materials based on oxtfluorides that can potentially increase photocatalytic activities of photocatalysts such as bismuth oxides and can also be used as phosphors in Al1-xGaxN-based devices and solar devices.

  17. Nanodomains and nanometer-scale disorder in multiferroic bismuth ferrite single crystals

    Czech Academy of Sciences Publication Activity Database

    Jia, C.L.; Jin, L.; Wang, D.; Mi, S.B.; Alexe, M.; Hesse, D.; Reichlová, Helena; Martí, Xavier; Bellaiche, L.; Urban, K.W.


    Roč. 82, Jan (2015), s. 356-368 ISSN 1359-6454 Institutional support: RVO:68378271 Keywords : bismuth ferrite * crystal growth * high-resolution electron microscopy * atomic structure * first-principles calculations Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 5.058, year: 2015

  18. Study of inclusive proton spectra from 20 MeV deuteron breakup by bismuth

    International Nuclear Information System (INIS)

    Badiger, N.M.; Hallur, B.R.; Madhusoodhanan, T.; Sathyavathiamma, M.P.; Puttaswamy, N.G.; Darshan, V.P.; Sharma, H.; Chintalapudi, S.N.


    The breakup of deuteron into proton and neutron has been studied earlier to understand the breakup mechanism. Inclusive measurements show the expected broad bumps near the beam velocity. In the present experiment, the breakup of 20 MeV deuterons by bismuth target has been investigated

  19. A sensitive fluorescence quenching method for determination of bismuth with tiron

    Energy Technology Data Exchange (ETDEWEB)

    Taher, Mohammad Ali; Rahimi, Mina [Department of Chemistry, Shahid Bahonar University of Kerman, Kerman (Iran, Islamic Republic of); Fazelirad, Hamid, E-mail: [Department of Chemistry, Shahid Bahonar University of Kerman, Kerman (Iran, Islamic Republic of); Department of Chemistry, Science and Research Branch, Islamic Azad University, Yazd (Iran, Islamic Republic of); Young Researchers Society, Shahid Bahonar University of Kerman, P.O. Box 76175-133, Kerman (Iran, Islamic Republic of)


    We describe a fluorescence quenching method for determination of bismuth with tiron. The method is based on the reaction of tiron by bismuth(III) in acidic media. The influence of variables such as the pH, type of buffer, tiron concentration, reaction time and temperature were investigated. Under optimized conditions, the fluorescence quenching extent is proportional to the concentration of bismuth for Bi–tiron system at the range 0.13–2.09 μg mL{sup −1} and the detection limit is 0.05 μg mL{sup −1}. The proposed sensor presented good repeatability, evaluated in terms of relative standard deviation (R.S.D.=±0.498%) for 11 replicates. This sensitive, rapid and accurate method has been successfully applied to the determination of trace bismuth(III) in water and hair samples and certified reference materials. -- Highlights: • No previous paper report on use of fluorescence quenching for determination of Bi. • Fluorescence quenching of trion is a sensitive method for determination of Bi(III). • Under the optimum conditions the detection limit is very low (0.05 μg mL{sup −1}). • The procedure is simple and safe and has high tolerance limit to interferences.

  20. Effect of bismuth citrate, lactose, and organic acid on necrotic enteritis in broilers (United States)

    Clostridium perfringens – associated necrotic enteritis causes significant losses and increased morbidity in poultry. The objective of this study was to evaluate the effect of bismuth citrate and acidifiers on the development of necrotic enteritis in broilers. The first study was a dose response t...

  1. Influence of bismuth on properties and microstructures of Sr0⋅ 5Ba0 ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 29; Issue 5. Influence of bismuth on properties and microstructures of Sr0.5Ba0.5–Bi TiO3 thin films. Tao Wenhong Wang Yin Fu Xinghua Wei Qihong. Thin Films Volume 29 Issue 5 October 2006 pp 523-527 ...

  2. Bismuth knowledge during the Renaissance strengthened by its use in Italian lustres production (United States)

    Padeletti, G.; Fermo, P.

    The knowledge of bismuth during the XV and XVI centuries represents an open question since, according to some authors, this element was confused with lead, tin and silver. On the contrary, G. Agricola (1494-1555), the pioneer of mineralogical science in Europe, in his two works (De Natura Fossilium, Lib X, 1546 and Bermannus Sive De Re Metallica Dialogus, 1528) asserts that bismuth was considered as an element distinct from the other metals at that time. This question gave rise to some interest, and von Lippmann in 1930 wrote a treatise dealing with the history of bismuth between 1400 and 1800. In this work we present the results obtained on Italian and Hispano-Moresque shards studied by means of X-ray diffraction, atomic absorption spectrometry with electrothermal atomisation, inductively coupled plasma optical emission spectrometry and scanning electron microscopy. It seems that our work could provide a new and important contribution to this debate, because we found bismuth in lustre composition of Renaissance shards produced in central Italy. Furthermore, we found that it could also be considered as a discriminating element between Italian and Hispano-Moresque productions, useful to assess their origin.

  3. Radioprotection to the Gonads in Pediatric Pelvic Radiography: Effectiveness of Developed Bismuth Shield

    Directory of Open Access Journals (Sweden)

    Vahid Karami


    Full Text Available Background: The use and effectiveness of traditional lead gonad shields in pediatric pelvic radiography has been challenged by several literatures over the past two decades. The aim of this study was to develop a new radioprotective gonad shields to be use in pediatric pelvic radiography. Materials and Methods: The commercially available 0.06 mm lead equivalent bismuth garment has cropped squarely and used as ovarian shield to cover the entire region of pelvis. In order to prevent deterioration of image quality due to beam hardening artifacts, a 1-cm foam as spacer was located between the shield and patients pelvis. Moreover, we added a lead piece at the cranial position of the bismuth garment to absorb the scatter radiations to the radiosensitive organs. In girls, 49 radiographs with shield and 46 radiographs without shield was taken. The radiation dose was measured using thermoluminescent dosimeters (TLDs. Image quality assessments were performed using the European guidelines. For boys, the lead testicular shields was developed using 2 cm bismuth garment, added to the sides. The prevalence and efficacy of testicular shields was assessed in clinical practice fromFebruary 2016 to June 2016. Results: Without increasing the dose to the breast, thyroid and the lens of the eyes, the use of bismuth shield has reduced the entrance skin dose(ESD of the pelvis and radiation dose to the ovaries by 62.2% and 61.7%, respectively (P

  4. Bismuth oxide based ceramics with improved electrical and mechanical properties: Part II. Structural and mechanical properties

    NARCIS (Netherlands)

    Kruidhof, H.; Seshan, Kulathuiyer; van de Velde, G.M.H.; de Vries, K.J.; Burggraaf, A.J.


    Coprecipitation as a method of preparation for bismuth oxides based ceramics yields relatively strong and machineable materials in comparison with the solid state reaction. Compositions within the system (1−x)Bi2O3|xEr2O3 containing up to twenty five mole percent of erbium oxide show a slow

  5. Solution processed bismuth sulfide nanowire array core/silver shuffle shell solar cells

    NARCIS (Netherlands)

    Cao, Y.; Bernechea, M.; Maclachlan, A.; Zardetto, V.; Creatore, M.; Haque, S.A.; Konstantatos, G.


    Low bandgap inorganic semiconductor nanowires have served as building blocks in solution processed solar cells to improve their power conversion capacity and reduce fabrication cost. In this work, we first reported bismuth sulfide nanowire arrays grown from colloidal seeds on a transparent

  6. Bio-assisted synthesis and characterization of nanostructured bismuth (III) sulphide using Clostridium acetobutylicum

    International Nuclear Information System (INIS)

    Kamaraj, Sathish Kumar; Venkatachalam, Ganesh; Arumugam, Palaniappan; Berchmans, Sheela


    Nanostructured bismuth (III) sulphide is synthesized at room temperature using a hydrogen sulphide producing microorganism namely Clostridium acetobutylicum. On contrary to chemical routes involving both the high and room temperature methods, the present experimental procedure involves a bio-assisted approach. This method is free from the usage of toxic and hazardous chemicals making it an environment friendly route. The synthesized bismuth sulphide is characterized using transmission electron microscope (TEM), powder X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and cyclic voltammetry (CV). From our experiments we find that bismuth sulphide produced using this bio-assisted approach exhibits a hexagonal shaped plate-like structures and is stabilized by the extracellular proteins present in the culture medium. - Graphical abstract: A green chemistry approach towards the synthesis of bismuth (III) sulphide nanostructures at room temperature using a hydrogen sulphide producing microorganism namely, Clostridium acetobutylicum is demonstrated. - Highlights: • Environmentally benign (greener) route towards synthesis of Bi 2 S 3 nanostructures. • Bio-assisted synthesis of Bi 2 S 3 at room temperature using Clostridium acetobutylicum. • Extracellular proteins in H 2 S producing microorganism as stabilizer for Bi 2 S 3 NPs. • Hexagonal platelets of Bi 2 S 3 possessing an orthorhombic crystalline structure

  7. Dietary intake of barium, bismuth, chromium, lithium, and strontium in a Spanish population (Canary Islands, Spain). (United States)

    González-Weller, Dailos; Rubio, Carmen; Gutiérrez, Ángel José; González, Gara Luis; Caballero Mesa, José María; Revert Gironés, Consuelo; Burgos Ojeda, Antonio; Hardisson, Arturo


    The aim of this study was to analyze barium, bismuth, chromium, lithium, and strontium contents in food and beverages consumed by the population of the Canary Islands (Spain) as well as determine dietary intake of these metals in the archipelago as a whole and in its individual islands. To this end, 440 samples were analyzed by ICP-OES and GFAAS. Barium concentrations ranged from 5.210 ± 2.117 mg/kg in nuts to 0.035 ± 0.043 mg/L in water. Viscera exhibited the highest levels of bismuth (38.07 ± 36.80 mg/kg). The cold meat and sausages group stood out for its high chromium concentrations (0.494 ± 0.257 mg/kg). The highest concentration of lithium and strontium came out in nuts (8.761 ± 5.368 mg/kg and 9.759 ± 5.181 mg/kg, respectively). The total intakes of barium, bismuth, chromium, lithium, and strontium were 0.685, 1.274, 0.087, 3.674, and 1.923 mg/day, respectively. Cereals turned out to contribute most to the dietary intake of barium, bismuth, chromium, and lithium in the Canary Islands, while fruit contributes most to the strontium intake. We also performed a metal intake study by age and sex of the population and compared the outcome with data from other regions, both national and international.

  8. First heats of cerium solution in liquid aluminium, gallium, indium, tin, lead and bismuth

    International Nuclear Information System (INIS)

    Yamshchikov, L.F.; Lebedev, V.A.; Nichkov, I.F.; Raspopin, S.P.; Shein, V.G.


    Cerium solution heats in liquid alluminium, gallium, indium, tin, lead and bismuth are determined in high temperature mixing calorimeter with an isothermal shell. The statistical analysis carried out proves that values of cerium solution heat in fusible metals obtained by the methods of electric motive forces and calorimety give a satisfactory agreement

  9. Evaluation of gamma-ray attenuation properties of bismuth borate glass systems using Monte Carlo method (United States)

    Tarim, Urkiye Akar; Ozmutlu, Emin N.; Yalcin, Sezai; Gundogdu, Ozcan; Bradley, D. A.; Gurler, Orhan


    A Monte Carlo method was developed to investigate radiation shielding properties of bismuth borate glass. The mass attenuation coefficients and half-value layer parameters were determined for different fractional amounts of Bi2O3 in the glass samples for the 356, 662, 1173 and 1332 keV photon energies. A comparison of the theoretical and experimental attenuation coefficients is presented.

  10. Light-Induced Surface Reactions at the Bismuth Vanadate/Potassium Phosphate Interface. (United States)

    Favaro, Marco; Abdi, Fatwa F; Lamers, Marlene; Crumlin, Ethan J; Liu, Zhi; van de Krol, Roel; Starr, David E


    Bismuth vanadate has recently drawn significant research attention as a light-absorbing photoanode due to its performance for photoelectrochemical water splitting. In this study, we use in situ ambient pressure X-ray photoelectron spectroscopy with "tender" X-rays (4.0 keV) to investigate a polycrystalline bismuth vanadate (BiVO 4 ) electrode in contact with an aqueous potassium phosphate (KPi) solution at open circuit potential under both dark and light conditions. This is facilitated by the creation of a 25 to 30 nm thick electrolyte layer using the "dip-and-pull" method. We observe that under illumination bismuth phosphate forms on the BiVO 4 surface leading to an increase of the surface negative charge. The bismuth phosphate layer may act to passivate surface states observed in photoelectrochemical measurements. The repulsive interaction between the negatively charged surface under illumination and the phosphate ions in solution causes a shift in the distribution of ions in the thin aqueous electrolyte film, which is observed as an increase in their photoelectron signals. Interestingly, we find that such changes at the BiVO 4 /KPi electrolyte interface are reversible upon returning to dark conditions. By measuring the oxygen 1s photoelectron peak intensities from the phosphate ions and liquid water as a function of time under dark and light conditions, we determine the time scales for the forward and reverse reactions. Our results provide direct evidence for light-induced chemical modification of the BiVO 4 /KPi electrolyte interface.

  11. Improvements to a Flow Sensor for Liquid Bismuth-Fed Hall Thrusters (United States)

    Bonds, Kevin; Polzin, Kurt A.


    Recently, there has been significant interest in using bismuth metal as a propellant in Hall Thrusters [1, 2]. Bismuth offers some considerable cost, weight, and space savings over the traditional propellant--xenon. Quantifying the performance of liquid metal-fed Hall thrusters requires a very precise measure of the low propellant flow rates [1, 2]. The low flow rates (10 mg/sec) and the temperature at which free flowing liquid bismuth exists (above 300 C) preclude the use of off-the-shelf flow sensing equipment [3]. Therefore a new type of sensor is required. The hotspot bismuth flow sensor, described in Refs. [1-5] is designed to perform a flow rate measurement by measuring the velocity at which a thermal feature moves through a flow chamber. The mass flow rate can be determined from the time of flight of the thermal peak, [4, 5]. Previous research and testing has been concerned mainly with the generation of the thermal peak and it's subsequent detection. In this paper, we present design improvements to the sensor concept; and the results of testing conducted to verify the functionality of these improvements. A ceramic material is required for the sensor body (see Fig. 1), which must allow for active heating of the bismuth flow channel to keep the propellant in a liquid state. The material must be compatible with bismuth and must be bonded to conductive elements to allow for conduction of current into the liquid metal and measurement of the temperature in the flow. The new sensor requires fabrication techniques that will allow for a very small diameter flow chamber, which is required to produce useful measurements. Testing of various materials has revealed several that are potentially compatible with liquid bismuth. Of primary concern in the fabrication and testing of a robust, working prototype, is the compatibility of the selected materials with one another. Specifically, the thermal expansion rates of the materials relative to the ceramic body cannot expand so

  12. The synthesis, structure and reactivity of iron-bismuth complexes : Potential Molecular Precursors for Multiferroic BiFeO3


    Wójcik, Katarzyna


    The thesis presented here is focused on the synthesis of iron-bismuth alkoxides and siloxides as precursors for multiferroic BiFeO3 systems. Spectrum of novel cyclopentadienyl substituted iron-bismuth complexes of the general type [{Cpy(CO)2Fe}BiX2], as potential precursors for cyclopentadienyl iron-bismuth alkoxides or siloxides [{Cpy(CO)2Fe}Bi(OR)2] (R-OtBu, OSiMe2tBu), were obtained and characterised. The use of wide range of cyclopentadienyl rings in the iron carbonyl compounds allowed fo...

  13. Bismuth silicate glass containing heavy metal oxide as a promising radiation shielding material (United States)

    Elalaily, Nagia A.; Abou-Hussien, Eman M.; Saad, Ebtisam A.


    Optical and FTIR spectroscopic measurements and electron paramagnetic resonance (EPR) properties have been utilized to investigate and characterize the given compositions of binary bismuth silicate glasses. In this work, it is aimed to study the possibility of using the prepared bismuth silicate glasses as a good shielding material for γ-rays in which adding bismuth oxide to silicate glasses causes distinguish increase in its density by an order of magnitude ranging from one to two more than mono divalent oxides. The good thermal stability and high density of the bismuth-based silicate glass encourage many studies to be undertaken to understand its radiation shielding efficiency. For this purpose a glass containing 20% bismuth oxide and 80% SiO2 was prepared using the melting-annealing technique. In addition the effects of adding some alkali heavy metal oxides to this glass, such as PbO, BaO or SrO, were also studied. EPR measurements show that the prepared glasses have good stability when exposed to γ-irradiation. The changes in the FTIR spectra due to the presence of metal oxides were referred to the different housing positions and physical properties of the respective divalent Sr2+, Ba2+ and Pb2+ ions. Calculations of optical band gap energies were presented for some selected glasses from the UV data to support the probability of using these glasses as a gamma radiation shielding material. The results showed stability of both optical and magnetic spectra of the studied glasses toward gamma irradiation, which validates their irradiation shielding behavior and suitability as the radiation shielding candidate materials.

  14. Alkali metal bismuth(III) chloride double salts

    Energy Technology Data Exchange (ETDEWEB)

    Kelly, Andrew W. [Department of Chemistry, College of William and Mary, Williamsburg, VA 23187 (United States); Nicholas, Aaron; Ahern, John C. [Department of Chemistry, University of Maine, Orono, ME 04469 (United States); Chan, Benny [Department of Chemistry, College of New Jersey, Ewing, NJ 08628-0718 (United States); Patterson, Howard H. [Department of Chemistry, University of Maine, Orono, ME 04469 (United States); Pike, Robert D., E-mail: [Department of Chemistry, College of William and Mary, Williamsburg, VA 23187 (United States)


    near 295, 340, and 380 nm and a broad emission near 440 nm. - Graphical abstract: The double salts Na2BiCl5·5H2O, K7Bi3Cl16, Rb3BiCl6·0.5H2O, Cs3BiCl6, and Cs3Bi2Cl9 were formed by co-crystallization of MCl (M = Na, K, Rb, Cs) with BiOCl in aqueous HCl. The crystal structures and solid state luminescence are reported. - Highlights: • New double salt phases are reported for NaCl/BiCl{sub 3}, KCl/BiCl{sub 3}, RbCl/BiCl{sub 3}, and CsCl/BiCl{sub 3}. • A variety of alkali chloride:bismuth chloride ratios are reported. • Chloride bridging produces oligomeric and/or polymeric bismuth chloride chains in several cases. • Convenient bulk synthesis from BiOCl is reported. • Four of the five reported double salts exhibit photoluminescence as a result of charge transfer.

  15. Reproducibility of 201Tl myocardial imaging

    International Nuclear Information System (INIS)

    McLaughlin, P.R.; Martin, R.P.; Doherty, P.; Daspit, S.; Goris, M.; Haskell, W.; Lewis, S.; Kriss, J.P.; Harrison, D.C.


    Seventy-six thallium-201 myocardial perfusion studies were performed on twenty-five patients to assess their reproducibility and the effect of varying the level of exercise on the results of imaging. Each patient had a thallium-201 study at rest. Fourteen patients had studies on two occasions at maximum exercise, and twelve patients had studies both at light and at maximum exercise. Of 70 segments in the 14 patients assessed on each of two maximum exercise tests, 64 (91 percent) were reproducible. Only 53 percent (16/30) of the ischemic defects present at maximum exercise were seen in the light exercise study in the 12 patients assessed at two levels of exercise. Correlation of perfusion defects with arteriographically proven significant coronary stenosis was good for the left anterior descending and right coronary arteries, but not as good for circumflex artery disease. Thallium-201 myocardial imaging at maximum exercise is reproducible within acceptable limits, but careful attention to exercise technique is essential for valid comparative studies

  16. Determination of zinc and cadmium with characterized Electrodes of carbon and polyurethane modified by a bismuth film

    Directory of Open Access Journals (Sweden)

    Jossy Karla Brasil Bernardelli


    Full Text Available This study aims to use electrodes modified with bismuth films for the determination of zinc and cadmium. The film was electrodeposited ex situ on a composite carbon electrode with polyurethane and 2% metallic bismuth (2BiE and on a carbon bar electrode (CBE. The electrodes were characterized by scanning electron microscopy and energy dispersive spectroscopy. Through differential pulse anodic stripping voltammetry, the electrodes 2BiE and CBE containing bismuth films showed a limit of detection (LOD of 5.56 × 10-5 and 3.07 × 10-5 g.L-1 for cadmium and 1.24 × 10-4 and 1.53 × 10-4 g.L-1 for zinc, respectively. The presence of a bismuth film increased the sensitivity of both electrodes.

  17. Determination of Lung-to-Blood Absorption Rates for Lead and Bismuth which are Appropriate for Radon Progeny

    International Nuclear Information System (INIS)

    Marsh, J.W.; Birchall, A.


    The ICRP Publication 66 Human Respiratory Tract Model (HRTM) treats clearance as a competitive process between absorption into blood and particle transport to the gastrointestinal tract and lymphatics. The ICRP recommends default absorption rates for lead and bismuth in ICRP Publication 71 but states that the values are not appropriate for short-lived radon progeny. This paper describes an evaluation of published data from volunteer experiments to estimate the absorption half-times of lead and bismuth that are appropriate for short-lived radon progeny. The absorption half-time for lead was determined to be 10±2 h, based on 212 Pb lung and blood retention data from several studies. The absorption half-time for bismuth was estimated to be about 13 h, based on 212 Bi urinary excretion data from one experiment and the ICRP biokinetic model for bismuth as a decay product of lead. (author)

  18. Correlation between near infrared emission and bismuth radical species of Bi2O3-containing aluminoborate glass

    International Nuclear Information System (INIS)

    Masai, Hirokazu; Takahashi, Yoshihiro; Fujiwara, Takumi; Suzuki, Takenobu; Ohishi, Yasutake


    A strong correlation between bismuth radical species and emission in the near infrared (NIR) region of SnO-doped bismuth-containing aluminoborate glass, (CaO-B 2 O 3 -Bi 2 O 3 -Al 2 O 3 -TiO 2 ) (CaBBAT), was observed. Since the activation energy of the NIR emission was similar to that of electron spin resonance signal, it is expected that bismuth radical species in the CaBBAT glass is an origin of the NIR emission. Compared to the observed emission spectra with energy diagram of previous data, we have confirmed that bismuth ion possessing low valence is the origin of broad emission in the NIR region.

  19. Tl-201 per rectum scintigraphy in chronic liver disease: assessment of Tl-201 uptake indices

    International Nuclear Information System (INIS)

    Moon, Won Jin; Choi, Yun Young; Cho, Suk Shin; Lee, Min Ho


    Heart to liver ratio on Tl-201 per rectal scintigraphy (shunt index) is known to be useful in the assessment of portal systemic shunt. We assessed Tl-201 uptake pattern and early liver/heart uptake rate of Tl-201 and correlated with shunt index in patients with chronic active hepatitis (CAH) and liver cirrhosis (LC). Fifty eight patients with biopsy-proven chronic liver disease (35 with CAH, 23 with LC) underwent Tl-201 per rectum scintigraphy after instillation of 18.5 MBq of Tl-201 into the upper rectum. We evaluated hepatic uptake (type 1: homogeneous, 2: inhomogeneous segmental, 3: inhomogeneous nonsegmental) and extrahepatic uptake of spleen, heart and kidney (grade 0: no uptake, 1: less than liver, 2: equal to liver, 3: greater than liver). We measured the early liver/heart uptake rate (the slope of the liver to heart uptake ratio for 10 mim) and shunt index (heart to liver uptake ratio). Tl-201 uptake pattern and early liver/heart uptake rate of Tl-201 was correlated with the pathologic diagnosis and shunt index. Hepatic uptake patterns of type 1 and 2 were dominant in CAH (CAH: 27/35, LC: 8/23), and type 3 in LC (CAH: 8/35, LC: 15/23)(p<0.005). The grades of extrahepatic uptake were higher in LC than in CAH (spleen: p<0.001, other soft tissue: p<0.005). The early liver/heart uptake rate of CAH (0.110±0.111) was significantly higher than that of LC (0.014±0.090)(p<0.001). The sensitivity and specificity of the early liver/heart uptake rate were 77.7% and 67.7% in differentiating LC from CAH. There was negative correlation between early liver/heart uptake rate and shunt index (r=-0.3347, p<0.01). Hepatic and extrahepatic uptake pattern and early liver/heart uptake rate on Tl-201 per rectum scintigraphy are useful in the assessment of portal systemic shunt in patients with chronic liver disease

  20. Clearance of thallium-201 from the peripheral blood: comparison of immediate and standard thallium-201 reinjection

    International Nuclear Information System (INIS)

    Eck-Smit, B.L.F. van; Wall, E.E. van der; Verhoeven, P.P.A.M.; Poots, S.; Zwinderman, A.H.; Pauwels, E.K.J.


    We investigated whether the kinetics of thallium-201 would differ between the standard stress-redistribution-reinjection approach and the stress-immediate reinjection approach. In 53 patients with undiagnosed chest pain, 75 MBq (2 mCi) 201 Tl was injected at maximal exercise. In 26 patients (group I), 37 MBq (1 mCi) 201 Tl was reinjected immediately after completing the exercise images and in 27 patients (group II), 37 MBq (1 mCi) 201 Tl was reinjected after completing 3-h redistribution images. Mean peak 201 Tl blood activity after exercise was 17.7±12.5 kBq/ml (4.8±3.4 mCi/ml) for group I versus 16.4±9.2 kBq/ml (4.4±2.5 mCi/ml) for group II (NS). The relative increase in 201 Tl blood activity after reinjection of half the initial dose [37 MBq (1 mCi)] exceeded 50% of the initial peak in both groups. The relative amount of 201 Tl delivered to the myocardium was assessed by the area under the curve after both exercise and reinjection, and was 117%±72% for group I and 112%±73% for group II (NS). Blood clearance of 201 Tl was at least biexponential. Mean early decay constants (λ 1 ) after exercise and reinjection were 0.30±0.18 min -1 and 0.22±0.046 min -1 resp. for group I, and 0.30±0.12 min -1 and 0.24±0.07 min -1 resp. for group II. For both procedures no significant differences were found between λ 1 after exercise and λ 1 after injection. The mean late clearance (λ 2 ) from the blood was 0.032±0.056 min -1 and 0.012±0.012 min -1 resp. for group I, and 0.036±0.030 min -1 and 0.014±0.014 min -1 resp. for group II. Also, no significant differences were found between λ 2 after exercise for both groups and between λ 2 after reinjection for both groups. (orig./MG)

  1. 7 CFR 201.26 - Kind, variety, and hybrid. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Kind, variety, and hybrid. 201.26 Section 201.26... REGULATIONS Labeling Vegetable Seeds § 201.26 Kind, variety, and hybrid. The label shall bear the name of each... kind or variety named on the label is “hybrid” seed, it shall be so designated on the label. If two or...

  2. Features of an emergency heat-conducting path in reactors about lead-bismuth and lead heat-carriers

    International Nuclear Information System (INIS)

    Beznosov, A.V.; Bokova, T.A.; Molodtsov, A.A.


    The reactor emergency heat removal systems should transfer heat from the surface of reactor core fuel element claddings to the primary circuit followed by heat transfer to the environment. One suggests three design approaches for emergency heat removal systems in lead-bismuth and lead cooled reactor circuits that take account of the peculiar nature of their features. Application of the discussed systems for emergency heat removal improves safety of lead-bismuth and lead cooled reactor plants [ru

  3. Characterization of cartilaginous tumors with 201Tl scintigraphy

    International Nuclear Information System (INIS)

    Higuchi, Takahiro; Taki, Junichi; Sumiya, Hisashi; Kinuya, Seigo; Nakajima, Kenichi; Tonami, Norihisa


    Histological diagnosis and grading of cartilaginous tumors are closely correlated with patient prognosis; consequently, they are essential elements. We attempted to clarify the characteristics of 201 Tl uptake in various histological types of cartilaginous tumors and to assess its clinical value. Twenty-two cases with histologically proven cartilaginous tumors (3 enchondromas, 15 conventional chondrosarcomas (grade I=9, II=5, III=1), 3 mesenchymal chondrosarcomas, and 1 de-differentiated chondrosarcoma) were examined retrospectively. Planar 201 Tl images were recorded 15 mm following intravenous injection of 201 Tl (111 MBq). 201 Tl uptake in the tumor was evaluated visually employing a five-grade scoring system: 0=no appreciable uptake, 1=faint uptake above the background level, 2=moderate uptake, 3=intense uptake but lower than heart uptake and 4=uptake higher than heart uptake. 201 Tl uptake scores were 0 in 3 of 3 enchondromas, 9 of 9 grade I, and 4 of 5 grade II conventional chondrosarcomas. 201 Tl uptake scores were 1 among 1 of 5 grades II and a grade III conventional chondrosarcoma. Mesenchymal chondrosarcoma and de-differentiated chondrosarcoma displayed 201 Tl uptake scores of 2 or 3. Absence of elevated 201 Tl uptake in cartilaginous tumors was indicative of enchondroma or low-grade conventional chondrosarcoma. However, in instances in which 201 Tl uptake is obvious, high-grade chondrosarcoma or variant types should be considered. (author)

  4. Methods, qualitative and quantitative evaluations of 201Tl myocardial scintiscans

    International Nuclear Information System (INIS)

    Buell, U.; Kleinhans, E.; Klepzig, M.; Seiderer, M.; Strauer, B.E.


    Exercise 201 Tl myocardial scintiscanning is a technique used to supplement exercise electrocardiography. The procedure employed should be identical to the standard procedure of electrocardiography. If the coronary disease has already been established by coronary angiography and kineventriculography, 201 Tl examinations should be carried out before surgery in order to determine the ''regional functional reserve''. Visual evaluations of the 201 Tl scintiscans should be supplemented by quantification methods. Quantification is also required between 201 Tl examination and surgery and to assure constant diagnostic accuracy in case of examination by different examiners. (orig./MG) [de

  5. Bismuth-ceramic nanocomposites through ball milling and liquid crystal synthetic methods (United States)

    Dellinger, Timothy Michael

    Three methods were developed for the synthesis of bismuth-ceramic nanocomposites, which are of interest due to possible use as thermoelectric materials. In the first synthetic method, high energy ball milling of bismuth metal with either MgO or SiO2 was found to produce nanostructured bismuth dispersed on a ceramic material. The morphology of the resulting bismuth depended on its wetting behavior with respect to the ceramic: the metal wet the MgO, but did not wet on the SiO2. Differential Scanning Calorimetry measurements on these composites revealed unusual thermal stability, with nanostructure retained after multiple cycles of heating and cooling through the metal's melting point. The second synthesis methodology was based on the use of lyotropic liquid crystals. These mixtures of water and amphiphilic molecules self-assemble to form periodic structures with nanometer-scale hydrophilic and hydrophobic domains. A novel shear mixing methodology was developed for bringing together reactants which were added to the liquid crystals as dissolved salts. The liquid crystals served to mediate synthesis by acting as nanoreactors to confine chemical reactions within the nanoscale domains of the mesophase, and resulted in the production of nanoparticles. By synthesizing lead sulfide (PbS) and bismuth (Bi) particles as proof-of-concept, it was shown that nanoparticle size could be controlled by controlling the dimensionality of the nanoreactors through control of the liquid crystalline phase. Particle size was shown to decrease upon going from three-dimensionally percolating nanoreactors, to two dimensional sheet-like nanoreactors, to one dimensional rod-like nanoreactors. Additionally, particle size could be controlled by varying the precursor salt concentration. Since the nanoparticles did not agglomerate in the liquid crystal immediately after synthesis, bismuth-ceramic nanocomposites could be prepared by synthesizing Bi nanoparticles and mixing in SiO2 particles which

  6. Separation of bismuth from gram amounts of thallium and silver by cation-exchange chromatography in nitric acid. (United States)

    Meintjies, E; Strelow, F W; Victor, A H


    Traces and small amounts of bismuth can be separated from gram amounts of thallium and silver by successively eluting these elements with 0.3M and 0.6M nitric acid from a column containing 13 ml (3 g) of AG50W-X4, a cation-exchanger (100-200 mesh particle size) with low cross-linking. Bismuth is retained and can be eluted with 0.2M hydrobromic acid containing 20% v/v acetone, leaving many other trace elements absorbed. Elution of thallium is quite sharp, but silver shows a small amount of tailing (less than 1 gmg/ml silver in the eluate) when gram amounts are present, between 20 and 80 mug of silver appearing in the bismuth fraction. Relevant elution curves and results for the analysis of synthetic mixtures containing between 50 mug and 10 mg of bismuth and up to more than 1 g of thallium and silver are presented, as well as results for bismuth in a sample of thallium metal and in Merck thallium(I) carbonate. As little as 0.01 ppm of bismuth can be determined when the separation is combined with electrothermal atomic-absorption spectrometry.

  7. Characterization, Leaching, and Filtration Testing for Bismuth Phosphate Sludge (Group 1) and Bismuth Phosphate Saltcake (Group 2) Actual Waste Sample Composites

    International Nuclear Information System (INIS)

    Lumetta, Gregg J.; Buck, Edgar C.; Daniel, Richard C.; Draper, Kathryn; Edwards, Matthew K.; Fiskum, Sandra K.; Hallen, Richard T.; Jagoda, Lynette K.; Jenson, Evan D.; Kozelisky, Anne E.; MacFarlan, Paul J.; Peterson, Reid A.; Shimskey, Rick W.; Sinkov, Sergey I.; Snow, Lanee A.


    A testing program evaluating actual tank waste was developed in response to Task 4 from the M-12 External Flowsheet Review Team (EFRT) issue response plan.() The test program was subdivided into logical increments. The bulk water-insoluble solid wastes that are anticipated to be delivered to the Waste Treatment and Immobilization Plant (WTP) were identified according to type such that the actual waste testing could be targeted to the relevant categories. Eight broad waste groupings were defined. Samples available from the 222S archive were identified and obtained for testing. The actual waste-testing program included homogenizing the samples by group, characterizing the solids and aqueous phases, and performing parametric leaching tests. Two of the eight defined groups - bismuth phosphate sludge (Group 1) and bismuth phosphate saltcake (Group 2) - are the subjects of this report. The Group 1 waste was anticipated to be high in phosphorus and was implicitly assumed to be present as BiPO4 (however, results presented here indicate that the phosphate in Group 1 is actually present as amorphous iron(III) phosphate). The Group 2 waste was also anticipated to be high in phosphorus, but because of the relatively low bismuth content and higher aluminum content, it was anticipated that the Group 2 waste would contain a mixture of gibbsite, sodium phosphate, and aluminum phosphate. Thus, the focus of the Group 1 testing was on determining the behavior of P removal during caustic leaching, and the focus of the Group 2 testing was on the removal of both P and Al. The waste-type definition, archived sample conditions, homogenization activities, characterization (physical, chemical, radioisotope, and crystal habit), and caustic leaching behavior as functions of time, temperature, and hydroxide concentration are discussed in this report. Testing was conducted according to TP-RPP-WTP-467

  8. Bismuth adjuvant ameliorates adverse effects of high-dose chemotherapy in patients with multiple myeloma and malignant lymphoma undergoing autologous stem cell transplantation

    DEFF Research Database (Denmark)

    Hansen, Per Boye; Penkowa, Milena


    show for the first time that bismuth significantly reduces grade 2 stomatitis, febrile neutropenia and infections caused by melphalan in multiple myeloma, where adverse effects also were significantly linked to gender. In lymphoma patients, bismuth significantly reduces diarrhoea relative to placebo......PURPOSE: High-dose chemotherapy prior to autologous stem cell transplantation (ASCT) leads to adverse effects including mucositis, neutropenia and bacteremia. To reduce the toxicity, we treated myeloma and lymphoma patients with peroral bismuth as an adjuvant to chemotherapy to convey...

  9. Quantitative Analysis of Thallium-201 Myocardial Tomograms

    International Nuclear Information System (INIS)

    Kim, Sang Eun; Nam, Gi Byung; Choi, Chang Woon


    The purpose of this study was to assess the ability of quantitative Tl-201 tomography to identify and localize coronary artery disease (CAD). The study population consisted of 41 patients (31 males, 10 females; mean age 55 ± 7 yr) including 14 with prior myocardial infarction who underwent both exercise Tl-201 myocardium SPECT and coronary angiography for the evaluation of chest pain. From the short axis and vertical long axis tomograms, stress extent polar maps were generated by Cedars-Sinai Medical Center program, and the 9 stress defect extent (SDE) was quantified for each coronary artery territory. For the purpose of this study, the coronary circulation was divided into 6 arterial segments, and the myocardial ischemic score (MIS) was calculated from the coronary angiogram. Sensitivity for the detection of CAD (>50% coronary stenosis by angiography) by stress extent polar map was 95% in single vessel disease, and 100% in double and triple vessel diseases. Overall sensitivity was 97%<. Sensitivity and specificity for the detection of individual diseased vessels were, respectively, 87% and 90% for the left anterior descending artery (LAD), 36% and 93% for the left circumflex artery (LCX), and 71% and 70%, for the right coronary artery (RCA). Concordance for the detection of individual diseased vessels between the coronary angiography and stress polar map was fair for the LAD (kappa=0.70), and RCA (kappa=0.41) lesions, whereas it was poor for the LCK lesions (kappa =0.32) There were significant correlations between the MIS and SDE in LAD (rs=0. 56, p=0.0027), and RCA territory (rs=0.60, p=0.0094). No significant correlation was found in LCX territory. When total vascular territories were combined, there was a significant correlation between the MIS and SDE (rs=0.42, p=0,0116). In conclusion, the quantitative analysis of Tl-201 tomograms appears to be accurate for determining the presence and location of CAD.

  10. Spectral investigation of highly ionized bismuth plasmas produced by subnanosecond Nd:YAG laser pulses (United States)

    Wu, Tao; Higashiguchi, Takeshi; Li, Bowen; Arai, Goki; Hara, Hiroyuki; Kondo, Yoshiki; Miyazaki, Takanori; Dinh, Thanh-Hung; Dunne, Padraig; O'Reilly, Fergal; Sokell, Emma; O'Sullivan, Gerry


    The unresolved transition arrays (UTAs) emitted from laser produced bismuth (Bi) plasma sources show potential for single-shot live cell imaging. We have measured extreme ultraviolet spectra from bismuth laser produced plasmas in the 1-7 nm region using a λ = 1064 nm Nd:YAG laser with a pulse duration of 150 ps. Comparison of spectra obtained under different laser power densities with calculations using the Hartree-Fock with configuration interaction Cowan suite of codes and the UTA formalism, as well as consideration of previous predictions of isoelectronic trends, are employed to identify lines and a number of new features in spectra from Bi XXIII to Bi XLVII. The results show that Δn = 0, n = 4-4 emission from highly charged ions merges to form intense UTAs in the 4 nm region and Δn = 1, n = 4-5 resonance transitions UTAs dominate the 1-3 nm region of the Bi spectrum.

  11. The photorefractive characteristics of bismuth-oxide doped lithium niobate crystals

    International Nuclear Information System (INIS)

    Zheng, Dahuai; Yao, Jiaying; Kong, Yongfa; Liu, Shiguo; Zhang, Ling; Chen, Shaolin; Xu, Jingjun


    Bismuth-doped lithium niobate (LN:Bi) crystals were grown by Czochralski method and their optical damage resistance, photorefraction, absorption spectra, and defect energy levels were investigated. The experimental results indicate that the photorefractive properties of LN:Bi were enhanced as compared with congruent one, the photorefractive response time was greatly shortened, the photorefractive sensitivity was increased, and the diffraction efficiency of near-stoichiometric LN:Bi (SLN:Bi) reached 31.72% and 49.08% at 532 nm and 488 nm laser, respectively (light intensity of 400 mW/cm 2 ). An absorption peak at about 350 nm was observed in the absorption spectrum of LN:Bi. And the defect energy levels simulation indicates new defect levels appear in the forbidden gap of LN:Bi crystals. Therefore bismuth can act as photorefractive centers in LN crystals

  12. Evaluation of bismuth shielding effectiveness in reducing breast absorbed dose during thoracic CT scan

    Energy Technology Data Exchange (ETDEWEB)

    Alonso, T. C.; Mourao, A. P.; Santana, P. C.; Silva, T. A. [Federal University of Minas Gerais, Program of Nuclear Science and Techniques, Av. Pte. Antonio Carlos 6627, 31270-901 Belo Horizonte, Minas Gerais (Brazil)


    Computed Tomography (CT) is an essential method for tracking neoplasia and efficiently diagnosing a wide variety of thoracic diseases. CT is generally considered the most accurate choice for lung examination. Due to the growing use of CT, breast and other superficial and radiosensitive organs are unnecessarily irradiated during radiological procedures, thus requiring the development of strategies appropriate to optimize and, if possible, to reduce the radiation dose. The use of bismuth shielding to reduce radiation dose absorbed by breast during thoracic CT examinations has been the subject of many studies recently published by Brazilian and foreign authors of various fields. The purpose of this paper is both to accurately determine the glandular dose when breast is exposed to radiation and to assess the reduction in absorbed dose during thoracic CT examinations, using a set of Thermoluminescent Dosimeters, an anthropomorphic phantom and bismuth shielding. (Author)

  13. The Role of Bismuth in the Treatment of Gastroduodenal Pathology (Literature Review and Own Researches

    Directory of Open Access Journals (Sweden)

    Yu.M. Stepanov


    Full Text Available The article presents the history of colloidal bismuth subcitrate and considers the basic mechanisms of its effects on the gastric mucosa, both cytoprotective and anti-helicobacter. The recent data of the worldwide researches are given on the use of the bismuth subcitrate as a component of antibacterial therapy in order to improve the effectiveness of the eradication, especially under the resistance to the basic drugs. The results of own researches are also shown, they are dedicated to the dynamics of structural adjustment of the gastric mucosa in patients with chronic atrophic gastritis for 3 years after the eradication of H.pylori. The use of first-line therapy with the addition of the drug De-Nol allowed to achieve eradication in 94.3 % of patients and positive microstructural changes of the gastric mucosa.

  14. Conceptual design of module fast reactor of ultimate safety cooled by lead-bismuth alloy

    International Nuclear Information System (INIS)

    Myasnikov, V.O.; Stekolnikov, V.V.; Stepanov, V.S.; Gorshkov, V.T.; Kulikov, M.L.; Shulyndin, V.A.; Gromov, B.F.; Kalashnikov, A.G.; Pashkin, Yu.G.


    During past time all basic problems arisen during working-out of NPP with lead-bismuth coolant were solved: physics and thermal physics of the cores, heat transfer and hydrodynamics, corrosion resistance of the structural materials and coolant technology, radiation and nuclear safety, investigations of emergency situations, development of fuel elements and absorbing elements of the reactor, equipment of the primary circuit and other circuits. A powerful experimental base equpped by unique rigs is made. A series of ship and test NPP has been constructed whereat repair of the plants and reactor refuelling are developed. Highly-skilled groups of investigators, designers and operation personnel capable of performing the development of the reactor plant with MFR within short terms have been formed. In this case MFR with lead-bismuth coolant may become the initial step in development of large-scale nuclear power engineering with fast reactors cooled by liquid lead

  15. The photorefractive characteristics of bismuth-oxide doped lithium niobate crystals

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, Dahuai; Yao, Jiaying [School of Physics, Nankai University, Tianjin 300071 (China); Collaborative Innovation Center of Chemical Science and Engineering (Tianjin), Tianjin 300072 (China); Kong, Yongfa, E-mail: [School of Physics, Nankai University, Tianjin 300071 (China); MOE Key Laboratory of Weak-Light Nonlinear Photonics and TEDA Applied Physics School, Nankai University, Tianjin 300457 (China); R and D Center, Taishan Sports Industry Group, Leling 253600 (China); Collaborative Innovation Center of Chemical Science and Engineering (Tianjin), Tianjin 300072 (China); Liu, Shiguo [School of Physics, Nankai University, Tianjin 300071 (China); Zhang, Ling; Chen, Shaolin [MOE Key Laboratory of Weak-Light Nonlinear Photonics and TEDA Applied Physics School, Nankai University, Tianjin 300457 (China); Xu, Jingjun [School of Physics, Nankai University, Tianjin 300071 (China); MOE Key Laboratory of Weak-Light Nonlinear Photonics and TEDA Applied Physics School, Nankai University, Tianjin 300457 (China); Collaborative Innovation Center of Chemical Science and Engineering (Tianjin), Tianjin 300072 (China)


    Bismuth-doped lithium niobate (LN:Bi) crystals were grown by Czochralski method and their optical damage resistance, photorefraction, absorption spectra, and defect energy levels were investigated. The experimental results indicate that the photorefractive properties of LN:Bi were enhanced as compared with congruent one, the photorefractive response time was greatly shortened, the photorefractive sensitivity was increased, and the diffraction efficiency of near-stoichiometric LN:Bi (SLN:Bi) reached 31.72% and 49.08% at 532 nm and 488 nm laser, respectively (light intensity of 400 mW/cm{sup 2}). An absorption peak at about 350 nm was observed in the absorption spectrum of LN:Bi. And the defect energy levels simulation indicates new defect levels appear in the forbidden gap of LN:Bi crystals. Therefore bismuth can act as photorefractive centers in LN crystals.

  16. Rapid synthesis of single-phase bismuth ferrite by microwave-assisted hydrothermal method

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Wenqian [College of Materials Science and Engineering, China Jiliang University, 258 Xueyuan Street, Xiasha Higher Education District, Hangzhou 310018, Zhejiang Province (China); Chen, Zhi, E-mail: [College of Materials Science and Engineering, China Jiliang University, 258 Xueyuan Street, Xiasha Higher Education District, Hangzhou 310018, Zhejiang Province (China); Gao, Tong; Zhou, Dantong; Leng, Xiaonan; Niu, Feng [College of Materials Science and Engineering, China Jiliang University, 258 Xueyuan Street, Xiasha Higher Education District, Hangzhou 310018, Zhejiang Province (China); Zhu, Yuxiang [College of Materials Science and Engineering, China Jiliang University, 258 Xueyuan Street, Xiasha Higher Education District, Hangzhou 310018, Zhejiang Province (China); Tianjin Key Laboratory of Marine Resources and Chemistry, Tianjin University of Science and Technology, Tianjin (China); Qin, Laishun, E-mail: [College of Materials Science and Engineering, China Jiliang University, 258 Xueyuan Street, Xiasha Higher Education District, Hangzhou 310018, Zhejiang Province (China); Wang, Jiangying; Huang, Yuexiang [College of Materials Science and Engineering, China Jiliang University, 258 Xueyuan Street, Xiasha Higher Education District, Hangzhou 310018, Zhejiang Province (China)


    This paper describes on the fast synthesis of bismuth ferrite by the simple microwave-assisted hydrothermal method. The phase transformation and the preferred growth facets during the synthetic process have been investigated by X-ray diffraction. Bismuth ferrite can be quickly prepared by microwave hydrothermal method by simply controlling the reaction time, which is further confirmed by Fourier Transform infrared spectroscopy and magnetic measurement. - Graphical abstract: Single-phase BiFeO{sub 3} could be realized at a shortest reaction time of 65 min. The reaction time has strong influences on the phase transformation and the preferred growth facets. - Highlights: • Rapid synthesis (65 min) of BiFeO{sub 3} by microwave-assisted hydrothermal method. • Reaction time has influence on the purity and preferred growth facets. • FTIR and magnetic measurement further confirm the pure phase.

  17. Spectral investigation of highly ionized bismuth plasmas produced by subnanosecond Nd:YAG laser pulses

    International Nuclear Information System (INIS)

    Wu, Tao; Higashiguchi, Takeshi; Arai, Goki; Hara, Hiroyuki; Kondo, Yoshiki; Miyazaki, Takanori; Dinh, Thanh-Hung; Li, Bowen; Dunne, Padraig; O’Reilly, Fergal; Sokell, Emma; O’Sullivan, Gerry


    The unresolved transition arrays (UTAs) emitted from laser produced bismuth (Bi) plasma sources show potential for single-shot live cell imaging. We have measured extreme ultraviolet spectra from bismuth laser produced plasmas in the 1–7 nm region using a λ = 1064 nm Nd:YAG laser with a pulse duration of 150 ps. Comparison of spectra obtained under different laser power densities with calculations using the Hartree–Fock with configuration interaction Cowan suite of codes and the UTA formalism, as well as consideration of previous predictions of isoelectronic trends, are employed to identify lines and a number of new features in spectra from Bi XXIII to Bi XLVII. The results show that Δn = 0, n = 4–4 emission from highly charged ions merges to form intense UTAs in the 4 nm region and Δn = 1, n = 4–5 resonance transitions UTAs dominate the 1–3 nm region of the Bi spectrum. (paper)

  18. High precision hyperfine measurements in Bismuth challenge bound-state strong-field QED. (United States)

    Ullmann, Johannes; Andelkovic, Zoran; Brandau, Carsten; Dax, Andreas; Geithner, Wolfgang; Geppert, Christopher; Gorges, Christian; Hammen, Michael; Hannen, Volker; Kaufmann, Simon; König, Kristian; Litvinov, Yuri A; Lochmann, Matthias; Maaß, Bernhard; Meisner, Johann; Murböck, Tobias; Sánchez, Rodolfo; Schmidt, Matthias; Schmidt, Stefan; Steck, Markus; Stöhlker, Thomas; Thompson, Richard C; Trageser, Christian; Vollbrecht, Jonas; Weinheimer, Christian; Nörtershäuser, Wilfried


    Electrons bound in highly charged heavy ions such as hydrogen-like bismuth 209 Bi 82+ experience electromagnetic fields that are a million times stronger than in light atoms. Measuring the wavelength of light emitted and absorbed by these ions is therefore a sensitive testing ground for quantum electrodynamical (QED) effects and especially the electron-nucleus interaction under such extreme conditions. However, insufficient knowledge of the nuclear structure has prevented a rigorous test of strong-field QED. Here we present a measurement of the so-called specific difference between the hyperfine splittings in hydrogen-like and lithium-like bismuth 209 Bi 82+,80+ with a precision that is improved by more than an order of magnitude. Even though this quantity is believed to be largely insensitive to nuclear structure and therefore the most decisive test of QED in the strong magnetic field regime, we find a 7-σ discrepancy compared with the theoretical prediction.

  19. Bismuth Basic Nitrate as a Novel Adsorbent for Azo Dye Removal

    Directory of Open Access Journals (Sweden)

    E. A. Abdullah


    Full Text Available Bismuth basic nitrate (BBN and its TiO2-Ag modified sorbent, PTBA were successfully synthesized via a precipitation method. The structural characteristics of prepared sorbents were determined through different analytical techniques. The potential use of prepared sorbents for organic compounds' removal was evaluated using Methyl Orange and Sunset Yellow dyes as model pollutants in aqueous solutions. The experimental results showed that the presence of TiO2 and Ag particles during the crystal growth of bismuth basic nitrate has an effect on the crystal structure, point of zero charge (pHpzc, pore volume and diameter. The lower binding energy of Ti 2p core level peak indicates the octahedral coordination of TiO2 particles on the PTBA surface. The alteration of hydrophilic-hydrophobic characteristics of sorbent's surface improves the adsorptive performance of the modified sorbent and provides an efficient route for organic contaminants' removal from aqueous solutions.

  20. Evaluation of bismuth shielding effectiveness in reducing breast absorbed dose during thoracic CT scan

    International Nuclear Information System (INIS)

    Alonso, T. C.; Mourao, A. P.; Santana, P. C.; Silva, T. A.


    Computed Tomography (CT) is an essential method for tracking neoplasia and efficiently diagnosing a wide variety of thoracic diseases. CT is generally considered the most accurate choice for lung examination. Due to the growing use of CT, breast and other superficial and radiosensitive organs are unnecessarily irradiated during radiological procedures, thus requiring the development of strategies appropriate to optimize and, if possible, to reduce the radiation dose. The use of bismuth shielding to reduce radiation dose absorbed by breast during thoracic CT examinations has been the subject of many studies recently published by Brazilian and foreign authors of various fields. The purpose of this paper is both to accurately determine the glandular dose when breast is exposed to radiation and to assess the reduction in absorbed dose during thoracic CT examinations, using a set of Thermoluminescent Dosimeters, an anthropomorphic phantom and bismuth shielding. (Author)

  1. Analysis of lenses absorbed dose in head CT scan with the use of bismuth shielding

    Energy Technology Data Exchange (ETDEWEB)

    Santos, F.S.; Santana, P.C., E-mail: [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte (Brazil); Mourão, A.P. [Centro de Educação Tecnológica de Minas Gerais (CEFET-MG), Belo Horizonte, MG (Brazil)


    Computed Tomography (CT) has become an important tool to diagnose cancer and to obtain additional information for different clinical questions. However, CT scan usually requires a higher radiation exposure than a conventional radiography examination. Head CT scans are used for diagnosis of traumatic head injuries, infections and other diseases with instability. Based on this information, it was studied the dose variation deposited in the lenses and in nearby organs, such as: pharynx, hypophysis and salivary gland with and without the use of bismuth shield. In this study a head CT scan was performed on anthropomorphic male phantom using a GE scanner. Dose measurements have been performed by using radiochromic film strips to register the individual doses in the organs of interest. The results show that the lenses had a reduction of 26% of the dose with the use of the bismuth shield. (author)

  2. Rapid synthesis of single-phase bismuth ferrite by microwave-assisted hydrothermal method

    International Nuclear Information System (INIS)

    Cao, Wenqian; Chen, Zhi; Gao, Tong; Zhou, Dantong; Leng, Xiaonan; Niu, Feng; Zhu, Yuxiang; Qin, Laishun; Wang, Jiangying; Huang, Yuexiang


    This paper describes on the fast synthesis of bismuth ferrite by the simple microwave-assisted hydrothermal method. The phase transformation and the preferred growth facets during the synthetic process have been investigated by X-ray diffraction. Bismuth ferrite can be quickly prepared by microwave hydrothermal method by simply controlling the reaction time, which is further confirmed by Fourier Transform infrared spectroscopy and magnetic measurement. - Graphical abstract: Single-phase BiFeO_3 could be realized at a shortest reaction time of 65 min. The reaction time has strong influences on the phase transformation and the preferred growth facets. - Highlights: • Rapid synthesis (65 min) of BiFeO_3 by microwave-assisted hydrothermal method. • Reaction time has influence on the purity and preferred growth facets. • FTIR and magnetic measurement further confirm the pure phase.

  3. Formation of planar waveguides in bismuth germanate by 4He+ ion implantation

    International Nuclear Information System (INIS)

    Mahdavi, S.M.; Chandler, P.J.; Townsend, P.D.


    Planar optical waveguides have been formed in crystalline bismuth germanate (BGO) Bi 4 Ge 3 O 12 , by He + ion implantation. The refractive index profiles have been determined using a dark-mode technique at 0.6328 and 0.488 micrometres. In the region of the electronic and nuclear stopping power of the ion beam in bismuth germanate there is an index enhancement, which forms an optical 'well', This is stable up to ∼ 200 0 C, but then there is a gradual recovery of index up to 400 0 C. Between 425 and 450 0 C, for heavily implanted samples (≥4 x 10 16 ions/cm 2 ), the well rapidly disappears, and is replaced by a sharp 'barrier' of reduced index. For lower dose implants ( 16 ion/cm 2 ) at 450 0 C many of the modes disappear without being replaced by a sharp barrier. (author)

  4. The study of the sample size on the transverse magnetoresistance of bismuth nanowires

    International Nuclear Information System (INIS)

    Zare, M.; Layeghnejad, R.; Sadeghi, E.


    The effects of sample size on the galvanomagnetice properties of semimetal nanowires are theoretically investigated. Transverse magnetoresistance (TMR) ratios have been calculated within a Boltzmann Transport Equation (BTE) approach by specular reflection approximation. Temperature and radius dependence of the transverse magnetoresistance of cylindrical Bismuth nanowires are given. The obtained values are in good agreement with the experimental results, reported by Heremans et al. - Highlights: ► In this study effects of sample size on the galvanomagnetic properties of Bi. ► Nanowires were explained by Parrott theorem by solving the Boltzmann Transport Equation. ► Transverse magnetoresistance (TMR) ratios have been measured by specular reflection approximation. ► Temperature and radius dependence of the transverse magnetoresistance of cylindrical Bismuth nanowires are given. ► The obtained values are in good agreement with the experimental results, reported by Heremans et al.

  5. Role of Bismuth in the Electrokinetics of Silicon Photocathodes for Solar Rechargeable Vanadium Redox Flow Batteries. (United States)

    Flox, Cristina; Murcia-López, Sebastián; Carretero, Nina M; Ros, Carles; Morante, Juan R; Andreu, Teresa


    The ability of crystalline silicon to photoassist the V 3+ /V 2+ cathodic reaction under simulated solar irradiation, combined with the effect of bismuth have led to important electrochemical improvements. Besides the photovoltage supplied by the photovoltaics, additional decrease in the onset potentials, high reversibility of the V 3+ /V 2+ redox pair, and improvement in the electrokinetics were attained thanks to the addition of bismuth. In fact, Bi 0 deposition has shown to slightly decrease the photocurrent, but the significant enhancement in the charge transfer, reflected in the overall electrochemical performance clearly justifies its use as additive in a photoassisted system for maximizing the efficiency of solar charge to battery. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. Graphite felt modified with bismuth nanoparticles as negative electrode in a vanadium redox flow battery. (United States)

    Suárez, David J; González, Zoraida; Blanco, Clara; Granda, Marcos; Menéndez, Rosa; Santamaría, Ricardo


    A graphite felt decorated with bismuth nanoparticles was studied as negative electrode in a vanadium redox flow battery (VRFB). The results confirm the excellent electrochemical performance of the bismuth modified electrode in terms of the reversibility of the V(3+) /V(2+) redox reactions and its long-term cycling performance. Moreover a mechanism that explains the role that Bi nanoparticles play in the redox reactions in this negative half-cell is proposed. Bi nanoparticles favor the formation of BiHx , an intermediate that reduces V(3+) to V(2+) and, therefore, inhibits the competitive irreversible reaction of hydrogen formation (responsible for the commonly observed loss of Coulombic efficiency of VRFBs). Thus, the total charge consumed during the cathodic sweep in this electrode is used to reduce V(3+) to V(2+) , resulting in a highly reversible and efficient process. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. Interlayer interactions in absorption and reflection spectra of bismuth HTSC crystals

    International Nuclear Information System (INIS)

    Kruchinin, S.P.; Yaremko, A.M.


    The HTSC reflection and absorption optic spectra peculiarities are analysed in the paper on the basis of bismuth and thallium. The approach suggested takes into account the complex character of crystals structure, possible localization of excitations in the isolated layers and further excitations exchange due to the interlayer interaction between cuprate (Cu O) and quasi-degenerate bismuth layers (Bi O/3pO). The expressions for the excitation and intensity energies of the corresponding transitions are obtained. It is shown that only part of excitations whose number is determined by the number of layers in the unit cell will be manifest in optical reflection and absorption spectra. The experimental results on spectral dependence of crystal reflection coefficients are analysed

  8. Evidence for a temperature-driven structural transformation in liquid bismuth

    International Nuclear Information System (INIS)

    Greenberg, Y.; Dariel, M.P.; Greenberg, Y.; Yahel, E.; Caspi, E.N.; Makov, G.; Benmore, C.; Beuneu, B.


    The thermodynamic properties of liquid bismuth have been explored from the melting point to 1100 C degrees by high-resolution measurements of the density, the heat capacity and the static structure factor. These physical properties display a number of anomalies. In particular, we have observed evidence for the presence of a temperature-driven liquid-liquid structural transformation that takes place at ambient pressure. The latter is characterized by a density discontinuity that occurs at 740 C degrees. Differential thermal analysis measurements revealed the endo-thermal nature of this transformation. A rearrangement of liquid bismuth structure was found by neutron diffraction measurements, supporting the existence of a liquid-liquid transformation far above the liquidus. (authors)

  9. Mixed-layered bismuth--oxygen--iodine materials for capture and waste disposal of radioactive iodine (United States)

    Krumhansl, James L; Nenoff, Tina M


    Materials and methods of synthesizing mixed-layered bismuth oxy-iodine materials, which can be synthesized in the presence of aqueous radioactive iodine species found in caustic solutions (e.g. NaOH or KOH). This technology provides a one-step process for both iodine sequestration and storage from nuclear fuel cycles. It results in materials that will be durable for repository conditions much like those found in Waste Isolation Pilot Plant (WIPP) and estimated for Yucca Mountain (YMP). By controlled reactant concentrations, optimized compositions of these mixed-layered bismuth oxy-iodine inorganic materials are produced that have both a high iodine weight percentage and a low solubility in groundwater environments.

  10. Mixed-layered bismuth-oxygen-iodine materials for capture and waste disposal of radioactive iodine (United States)

    Krumhansl, James L; Nenoff, Tina M


    Materials and methods of synthesizing mixed-layered bismuth oxy-iodine materials, which can be synthesized in the presence of aqueous radioactive iodine species found in caustic solutions (e.g. NaOH or KOH). This technology provides a one-step process for both iodine sequestration and storage from nuclear fuel cycles. It results in materials that will be durable for repository conditions much like those found in Waste Isolation Pilot Plant (WIPP) and estimated for Yucca Mountain (YMP). By controlled reactant concentrations, optimized compositions of these mixed-layered bismuth oxy-iodine inorganic materials are produced that have both a high iodine weight percentage and a low solubility in groundwater environments.

  11. Report - Melter Testing of New High Bismuth HLW Formulations VSL-13R2770-1

    Energy Technology Data Exchange (ETDEWEB)

    Kruger, Albert A.; Pegg, I. L.; Kot, W. K.; Gan, H.; Matlack, K. S.


    The primary objective of the work described was to test two glasses formulated for a high bismuth waste stream on the DM100 melter system. Testing was designed to determine processing characteristics and production rates, assess the tendency for foaming, and confirm glass properties. The glass compositions tested were previously developed to maintain high waste loadings and processing rates while suppressing the foaming observed in previous tests

  12. A circulating loop tester for liquid alloyed metal of lead-bismuth

    International Nuclear Information System (INIS)

    Kitano, Teruaki; Ono, Mikinori; Kamata, Kinya


    Mitsui Engineering and Shipbuilding Co., Ltd. (MES) had focused to merits of this lead-bismuth alloy, to actively carry out many works on this field such as an experience of development of heat exchanger at industrial level of intercourse with IPPE (Institute of Physics and Power Engineering) in Russia with an experience of using results for 80 years on coolant for nuclear reactor. Before about 20 years, MES developed a heat exchanger for installation at a lead-zinc separation process in a refinery in Japan under cooperation of the Mitsui Metal and Mine Co., Ltd., to deliver it for a power generation system at the Hachinohe refinery. As the heat exchanger aims at control of cooling in the separation process, it also contributes to power generation of about 4,300 kW, and now it continues to separate and contribute to self-power generation in the refinery. The heat exchanger is filled with the liquid alloyed metal of lead-bismuth for an intermediate thermal medium in its casing. The metal has some merits such as inactivity to air and water, high boiling point (1,700 centigrade), almost no volume change at its coagulation, and its minus reactivity coefficient. However, the metal has some problems to be solved, such as its steel corrosion, its purification, and control technology. To grow up lead-bismuth technology to a nuclear energy technology in Japan, the lead-bismuth circulating loop tester was produced on May, 2001, to establish application technology on this system to nuclear energy technology in Japan. (G.K.)

  13. Effect of bismuth addition to the triple therapy of Helicobacter pylori eradication

    Directory of Open Access Journals (Sweden)

    Ezel Taşdemir


    Full Text Available Objective: Success rates of amoxicillin, clarithromycin, and proton-pump inhibitor therapy in the Helicobacter pylori (Hp eradication have been decreasing. The aim of this study was to investigate the impact of bismuth subcitrate addition to triple therapy.Materials and methods: 148 patients diagnosed Hp infection with both histology and Hp stool antigen (HpSA tests were examined retrospectively. The patients were divided into 3 groups according to the eradication therapy. The first group received triple therapy with claritromycine 2x 500 mg, amoxicilline 2x1 g and PPI 2x1 for 14 days (n=40. The second group had bismuth subcitrate 4x120 mg with triple therapy for 14 days (n=73. The third group received 14 days pretreatment with bismuth subcitrate 4x1 together with PPI 2x1 then had triple therapy for 14 days (n=35. (14C urea breath and HpSA tests were used to detect posttreatment H.pylori status.Results: There were no statistical difference between the groups in terms of gender and age (p > 0.05. In group one 12 patients, in group two 20 patients and in group three 10 patients were identified as Hp positive after treatment. Eradication rates were 70% for group one, 72.6% for group two and 71.4% for group three respectively. There was no statistical difference between the groups in terms of eradication rates of treatment (p > 0.05.Conclusions: The addition of bismuth to conventional triple therapy did not affect treatment success rates.

  14. Study of some health physics parameters of bismuth-ground granulated blast furnace slag shielding concretes

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Sandeep, E-mail: [Department of Physics, Punjabi University, Patiala (India); Singh, Sukhpal, E-mail: [Department of Basic and Applied Sciences, Punjabi University, Patiala (India)


    The Bismuth-ground granulated blastfurnace slang (Bi-GGBFS) concrete samples were prepared. The weight percentage of different elements present in Bi-GGBFS Shielding concretewas evaluated by Energy Dispersive X-ray Microanalysis (EDX). The exposure rate and absorbed dose rate characteristics were calculated theoretically for radioactive sources namely {sup 241}Am and {sup 137}Cs. Our calculations reveal that the Bi-GGBFS concretes are effective in shielding material for gamma radiations.

  15. Study of some health physics parameters of bismuth-ground granulated blast furnace slag shielding concretes (United States)

    Kumar, Sandeep; Singh, Sukhpal


    The Bismuth-ground granulated blastfurnace slang (Bi-GGBFS) concrete samples were prepared. The weight percentage of different elements present inBi-GGBFS Shielding concretewas evaluated by Energy Dispersive X-ray Microanalysis (EDX). The exposure rate and absorbed dose rate characteristics were calculated theoretically for radioactive sources namely 241Am and 137Cs. Our calculations reveal that the Bi-GGBFS concretes are effective in shielding material for gamma radiations.

  16. Large-scale synthesis of bismuth sulfide nanorods by microwave irradiation

    International Nuclear Information System (INIS)

    Wu Jiliang; Qin Fan; Cheng Gang; Li Hui; Zhang Jiuhong; Xie Yaoping; Yang Haijian; Lu Zhong; Yu Xianglin; Chen Rong


    Graphical abstract: Display Omitted Research highlights: → Large-scale Bi 2 S 3 nanorods have been prepared by microwave irradiation methods. → CTAB and β-CD are beneficial to the formation of Bi 2 S 3 nanorods. → DMF, EG and DEG were favorable solvents. → Bismuth and sulfur precursors influenced the size and morphology. → A proposed formation mechanism of Bi 2 S 3 nanorods was summarized. - Abstract: Bismuth sulfide (Bi 2 S 3 ) has attracted considerable interest due to its potential applications in thermoelectric and electronic devices, optoelectronic devices, and biomedicine. In this study, large-scale highly crystalline Bi 2 S 3 nanorods were successfully prepared from bismuth citrate and thiourea (Tu) by microwave irradiation methods. The products were characterized by powder X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM, HRTEM) and selected area electron diffraction (SAED). The influences of reaction time, surfactants, solvents, and precursors on the formation of Bi 2 S 3 nanorods were discussed. The microwave irradiation method reduced reaction time by at least 80% in the synthesis of Bi 2 S 3 nanorods compared with the refluxing method. Cetyltrimethylammonium bromide (CTAB) and β-cyclodextrin (β-CD) were found to be beneficial to the formation of Bi 2 S 3 nanorods. N,N-dimethylformamide, ethylene glycol, and diethylene glycol were the favorable solvents in the fabrication of these nanorods. It was found that different bismuth and sulfur precursors influenced the sizes and morphologies of the Bi 2 S 3 nanorods. The proposed growth mechanism of Bi 2 S 3 nanorods was also discussed.

  17. Determination of the two-loop Lamb shift in lithiumlike bismuth

    International Nuclear Information System (INIS)

    Sapirstein, J.; Cheng, K. T.


    The energy levels of lithiumlike bismuth are shown to be accurately described in a representation-independent manner when all diagrams involving one and two photons, with the exception of the two-loop Lamb shift, are evaluated. Comparison with the experimental value of the 2p 3/2 -2s 1/2 splitting then shows that, assuming three-photon effects are negligible, the contribution of the two-loop Lamb shift is 0.175(39) eV

  18. Bismuth Infusion of ABS Enables Additive Manufacturing of Complex Radiological Phantoms and Shielding Equipment

    Directory of Open Access Journals (Sweden)

    Justin Ceh


    Full Text Available Radiopacity is a critical property of materials that are used for a range of radiological applications, including the development of phantom devices that emulate the radiodensity of native tissues and the production of protective equipment for personnel handling radioactive materials. Three-dimensional (3D printing is a fabrication platform that is well suited to creating complex anatomical replicas or custom labware to accomplish these radiological purposes. We created and tested multiple ABS (Acrylonitrile butadiene styrene filaments infused with varied concentrations of bismuth (1.2–2.7 g/cm3, a radiopaque metal that is compatible with plastic infusion, to address the poor gamma radiation attenuation of many mainstream 3D printing materials. X-ray computed tomography (CT experiments of these filaments indicated that a density of 1.2 g/cm3 of bismuth-infused ABS emulates bone radiopacity during X-ray CT imaging on preclinical and clinical scanners. ABS-bismuth filaments along with ABS were 3D printed to create an embedded human nasocranial anatomical phantom that mimicked radiological properties of native bone and soft tissue. Increasing the bismuth content in the filaments to 2.7 g/cm3 created a stable material that could attenuate 50% of 99mTechnetium gamma emission when printed with a 2.0 mm wall thickness. A shielded test tube rack was printed to attenuate source radiation as a protective measure for lab personnel. We demonstrated the utility of novel filaments to serve multiple radiological purposes, including the creation of anthropomorphic phantoms and safety labware, by tuning the level of radiation attenuation through material customization.

  19. Donor impurity self-compensation by neutral complexes in bismuth doped lead telluride

    International Nuclear Information System (INIS)

    Ravich, Yu.I.; Nemov, S.A.; Proshin, V.I.


    Self-compensation is calculated of impurity doping action in semiconductors of the A 4 B 6 type by neutral complexes, consisting of a vacancy and two impurity atoms. Complexes entropy is estimated and the thermodynamic potential is minimized in the concentration of single two-charge vacancies and complexes. Calculation results are compared with experimental data, obtained when lead telluride doping by bismuth. Account for complex formation improves agreement theory with experiment. 4 refs., 1 fig

  20. Ultrasonic and Thermal Properties of Borate and Phosphate Glasses Containing Bismuth and Lead

    International Nuclear Information System (INIS)

    Aziz, Sidek Hj. Abd.; Ahmad, Hamezan; Wahab, Zaidan A.; Sulaiman, Zainal Abidin; Talib, Zainal Abidin; Shaari, A. Halim; Senin, H. B.


    Systematic series of (B2O3,P2O5)-Bi2O3-PbO glasses have been successfully prepared by using the rapid quenching technique in which each oxide content changes for every series on the basis of its weight percentage. Their amorphous natures were confirmed earlier by the x-ray diffraction technique. The experimental results show that the density of both glasses, determined by using the Archimedes principle, increases with the glass modifier content. This is due to the replacement of Bi2O3 and PbO in the borate and phosphate glassy networks. The molar volume for borate glass increases with the addition of bismuth and lead oxides, but a reverse trend occurs for the phosphate glass. The longitudinal and shear ultrasound velocities, determined by the MBS 8000 system, of both lead bismuth borate and phosphate glasses show a decreasing trend as more PbO and Bi2O3 are added to the glass system. The increase in PbO/Bi2O3 content was probably related to the progressive increase in the concentration of non-bridging oxygen (NBOs). Thermal studies of the glass, using the Labsys DTA-Setaram machine, show that the value of the glass transition temperature (Tg) is closely related to the chemical bond in the system. In lead bismuth borate glasses, the addition of more Pb2+ and Bi3+ results in a more dominant ionic bond character in the system and hence decreases Tg of the sample. However, in lead bismuth phosphate glasses, the addition of Pb2+ and Bi3+ not only failed to weaken the covalent character in P-O-P bonds, but strengthened it further, leading to an increment in the values of Tg

  1. Systematics of c-axis phonons in the thallium- and bismuth-based cuprate superconductors

    NARCIS (Netherlands)

    Tsvetkov, A.A.; Dulic, Diana; Marel, D. van der; Damascelli, A.; Kaljushnaia, G.A.; Gorina, J.I.; Senturina, N.N.; Kolesnikov, N.N.; Ren, Z.F.; Wang, J.H.; Menovsky, A.A.; Palstra, T.T.M.


    We present grazing incidence reflectivity measurements in the far-infrared region at temperatures above and below Tc for a series of thallium- (Tl2Ba2CuO6, Tl2Ba2CaCu2O8) and bismuth- (Bi2Sr2CuO6, Bi2Sr2CaCu2O8, and Bi2-xPbxSr2CaCu2O8) based cuprate superconductors. From the spectra, which are

  2. Eye-lens bismuth shielding in paediatric head CT: artefact evaluation and reduction

    International Nuclear Information System (INIS)

    Raissaki, Maria; Perisinakis, Kostas; Damilakis, John; Gourtsoyiannis, Nicholas


    CT scans of the brain, sinuses and petrous bones performed as the initial imaging test for a variety of indications have the potential to expose the eye-lens, considered among the most radiosensitive human tissues, to a radiation dose. There are several studies in adults discussing the reduction of orbital dose resulting from the use of commercially available bismuth-impregnated latex shields during CT examinations of the head. To evaluate bismuth shielding-induced artefacts and to provide suggestions for optimal eye-lens shielding in paediatric head CT. A bismuth shield was placed over the eyelids of 60 consecutive children undergoing head CT. Images were assessed for the presence and severity of artefacts with regard to eye-shield distance and shield wrinkling. An anthropomorphic paediatric phantom and thermoluminescence dosimeters (TLDs) were used to study the effect of eye lens-to-shield distance on shielding efficiency. Shields were tolerated by 56/60 children. Artefacts were absent in 45% of scans. Artefacts on orbits, not affecting and affecting orbit evaluation were noted in 39% and 14% of scans, respectively. Diagnostically insignificant artefacts on intracranial structures were noted in 1 case (2%) with shield misplacement. Mean eye-lens-to-shield distance was 8.8 mm in scans without artefacts, and 4.3 mm and 2.2 mm in scans with unimportant and diagnostically important artefacts, respectively. Artefacts occurred in 8 out of 9 cases with shield wrinkling. Dose reduction remained unchanged for different shield-to-eye distances. Bismuth shielding-related artefacts occurring in paediatric head CT are frequent, superficial and diagnostically insignificant when brain pathology is assessed. Shields should be placed 1 cm above the eyes when orbital pathology is addressed. Shield wrinkling should be avoided. (orig.)

  3. Radioprotection to the Gonads in Pediatric Pelvic Radiography: Effectiveness of Developed Bismuth Shield


    Vahid Karami; Mansour Zabihzadeh; Nasim Shams; Mehrdad Golami


    Background: The use and effectiveness of traditional lead gonad shields in pediatric pelvic radiography has been challenged by several literatures over the past two decades. The aim of this study was to develop a new radioprotective gonad shields to be use in pediatric pelvic radiography. Materials and Methods: The commercially available 0.06 mm lead equivalent bismuth garment has cropped squarely and used as ovarian shield to cover the entire region of pelvis. In order to prevent deteriorati...

  4. Study of some health physics parameters of bismuth-ground granulated blast furnace slag shielding concretes

    International Nuclear Information System (INIS)

    Kumar, Sandeep; Singh, Sukhpal


    The Bismuth-ground granulated blastfurnace slang (Bi-GGBFS) concrete samples were prepared. The weight percentage of different elements present in Bi-GGBFS Shielding concretewas evaluated by Energy Dispersive X-ray Microanalysis (EDX). The exposure rate and absorbed dose rate characteristics were calculated theoretically for radioactive sources namely "2"4"1Am and "1"3"7Cs. Our calculations reveal that the Bi-GGBFS concretes are effective in shielding material for gamma radiations.

  5. Technical tutorial: How to pack a nose with bismuth iodoform paraffin paste gauze safely and effectively. (United States)

    Amen, F; Pace-Balzan, A


    The current primary treatment for epistaxis in accident and emergency departments is the insertion of Merocel packs. If these are properly inserted, but fail to control bleeding, it is necessary to insert a bismuth iodoform paraffin paste (BIPP) pack. A BIPP pack, when properly inserted, has the potential to stop most bleeds, but books and journals suggest a method of insertion that limits its effectiveness. A safer and more effective way of packing a nose with BIPP than the traditional method is described.

  6. Effect of Gamma Irradiation on Some Properties of Bismuth Silicate Glasses and Their Glass Derivatives

    International Nuclear Information System (INIS)

    Abo Hussein, E.M.K.


    Glasses containing bismuth oxide have attracted considerable attention, although it is non-conventional glass forming oxide, but it has wide applications. In this work, it is aimed to prove that bismuth silicate glass can act as a good shielding material for γ- rays. For this purpose glass containing 20% bismuth oxide and 80% SiO_2 was prepared using melting-annealing technique. Also effects of adding some alkali heavy metal oxides to this glass such as PbO, BaO or SrO were also studied. The formed glasses were also heat treated at 450 degree C for 4 hours to give the corresponding heat treated glasses. Electron Paramagnetic Resonance (EPR) measurements show that the prepared glasses and heat treated glasses have very good stability when exposed to γ- irradiation, which encourage the assumption of using these glasses as gamma ray shielding materials. Many properties have been investigated, such as density to understand the structural properties, also mechanical properties were verified by measuring microhardness, while the chemical resistance was identified by testing their durability in both acidic and basic solutions. The EPR results were supported by measuring electrical conductivity of the glass and heat treated glass samples at different temperatures ranging from 298 to 553 K, which proved that these glasses have very low conductivity even at high temperature. The formed phases of heat treated glass or glass ceramic samples were demonstrated by means of X-ray diffraction (XRD). Also studying the structure of glasses and heat treated glasses before and after irradiation was investigated by the Infrared transmitting spectra. Calculations of optical band gap energies were demonstrated for some selected glasses and heat treated glasses from the data of UV optical absorption spectra to support the probability of using these bismuth silicate glasses for gamma radiation shielding processing.

  7. 17 CFR 201.500 - Expedited consideration of proceedings. (United States)


    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Expedited consideration of proceedings. 201.500 Section 201.500 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... Expedited consideration of proceedings. Consistent with the Commission's or the hearing officer's other...

  8. 17 CFR 201.401 - Consideration of stays. (United States)


    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Consideration of stays. 201... PRACTICE Rules of Practice Appeal to the Commission and Commission Review § 201.401 Consideration of stays... consideration. Where the action complained of has already taken effect and the motion for stay is filed within...

  9. 7 CFR 201.8 - Contents of the label. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Contents of the label. 201.8 Section 201.8 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT...

  10. 7 CFR 201.25 - Contents of the label. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Contents of the label. 201.25 Section 201.25 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT...

  11. 24 CFR 201.26 - Conditions for loan disbursement. (United States)


    ... with § 201.20(c). (4) Where the proceeds are to be used for a fire safety equipment loan, the lender... jurisdiction over the fire safety requirements of health care facilities in accordance with § 201.20(c). (5) In... transaction, and if any part of the initial payment was obtained through a gift or loan, the source of the...

  12. 45 CFR 201.70 - Treatment of replacement checks. (United States)


    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Treatment of replacement checks. 201.70 Section... STATES FOR PUBLIC ASSISTANCE PROGRAMS Review and Audits § 201.70 Treatment of replacement checks. (a... (FFP) for replacement checks under titles I, VI-A, X, XIV, XVI (AABD) except under the circumstances...

  13. 20 CFR 726.201 - Insurance contracts-generally. (United States)


    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Insurance contracts-generally. 726.201 Section 726.201 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR FEDERAL COAL MINE HEALTH AND SAFETY ACT OF 1969, AS AMENDED BLACK LUNG BENEFITS; REQUIREMENTS FOR COAL MINE OPERATOR...

  14. 5 CFR 250.201 - Coverage and purpose. (United States)


    ....201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERSONNEL MANAGEMENT IN AGENCIES Strategic Human Capital Management § 250.201 Coverage and purpose. The Chief Human... effective and efficient operation of Government. As a part of OPM's overall leadership responsibilities in...

  15. 24 CFR 92.201 - Distribution of assistance. (United States)


    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Distribution of assistance. 92.201 Section 92.201 Housing and Urban Development Office of the Secretary, Department of Housing and Urban... and objective measures of rural housing need, such as poverty and substandard housing, as set forth in...

  16. Dependence of quality of Thallium-201 on irradiation data

    International Nuclear Information System (INIS)

    Sattari, I.; Aslani, G.; Dehghan, M. K.; Shirazi, B.; Shafie, M.; Shadanpour, N.; Winkel, P. V.


    Background: Thallium-201 is produced through 203 Tl (p,3 n) 201 pb 201 Tl reaction by cyclotron. This radioisotope has known as one of the cyclotron radioisotopes which is used for myocardial perfusion in the coronary artery disease, Ti-201 after chemical purification and quality control in the form of 201 Tl-chloride is ready to send the hospitals. Materials and methods: In this work the effect of the proton energy on quality of a Ti-201, was studied. Radionuclidic purity was determined by high purity Ge (H P Ge) detector Gamma spectrometer, in production time and after one half-life (73 h). The targets were coated with Enriched Thallium-203 (97%). Results: The variation of thickness of targets was 18.3±1.3μm. The different energies of bombardment on quality of Tl-201 and Tl-200, Tl-202, and Pb-203 (as impurity) were studied. The results have been that optimum energy for proton was 28.5 MeV. Conclusion: The variation energy of bombardment can change the purity of Tl-201 but all results were in standard range according to the United States Pharmacopoeia (USP) and European Pharmacopoeia

  17. 14 CFR 201.5 - Advertising and sales by applicants. (United States)


    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Advertising and sales by applicants. 201.5... CODE-[AMENDED] Application Procedures § 201.5 Advertising and sales by applicants. (a) An applicant for new or amended certificate or commuter air carrier authority shall not: (1) Advertise, list schedules...

  18. 24 CFR 201.13 - Interest and discount points. (United States)


    .... Interest on the loan shall accrue from the date of the loan, and shall be calculated on a simple interest... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Interest and discount points. 201... TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Loan and Note Provisions § 201.13 Interest and...

  19. 17 CFR 201.152 - Filing of papers: Form. (United States)


    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Filing of papers: Form. 201... PRACTICE Rules of Practice General Rules § 201.152 Filing of papers: Form. (a) Specifications. Papers filed... white paper measuring 81/2×11 inches, except that, to the extent that the reduction of larger documents...

  20. 19 CFR 201.203 - Delegation of authority. (United States)


    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Delegation of authority. 201.203 Section 201.203 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION Debt... accordance with the policies contained herein and as otherwise provided by law. ...

  1. 17 CFR 201.233 - Depositions upon oral examination. (United States)


    ... examination. 201.233 Section 201.233 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... upon oral examination. (a) Procedure. Any party desiring to take the testimony of a witness by.... Examination and cross-examination of deponents may proceed as permitted at a hearing. The witness being...

  2. 46 CFR 201.42 - Subscription, authentication of documents. (United States)


    ... 46 Shipping 8 2010-10-01 2010-10-01 false Subscription, authentication of documents. 201.42 Section 201.42 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND... Subscription, authentication of documents. (a) Documents filed shall be subscribed: (1) By the person or...

  3. 17 CFR 201.65 - Identity and signature. (United States)


    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Identity and signature. 201.65... of 1934 § 201.65 Identity and signature. Applications pursuant to this subpart may omit the identity, mailing address, and signature of the applicant; provided, that such identity, mailing address and...

  4. 17 CFR 201.1100 - Creation of Fair Fund. (United States)


    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Creation of Fair Fund. 201... PRACTICE Fair Fund and Disgorgement Plans § 201.1100 Creation of Fair Fund. In any agency process initiated... requiring the payment of disgorgement by a respondent and also assessing a civil money penalty against that...

  5. 21 CFR 201.50 - Statement of identity. (United States)


    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Statement of identity. 201.50 Section 201.50 Food... identity. (a) The label of prescription and insulin-containing drugs in package form shall bear as one of its principal features a statement of the identity of the drug. (b) Such statement of identity shall...

  6. 37 CFR 201.25 - Visual Arts Registry. (United States)


    ... the copyright law. Visual Arts Registry Statements which are illegible or fall outside of the scope of... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Visual Arts Registry. 201.25 Section 201.25 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE...

  7. 7 CFR 201.52 - Noxious-weed seeds. (United States)


    ... 64499, Dec. 14, 1994] germination tests in the administration of the act ... 7 Agriculture 3 2010-01-01 2010-01-01 false Noxious-weed seeds. 201.52 Section 201.52 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT...

  8. 29 CFR 530.201 - Conflict with State law. (United States)


    ... 29 Labor 3 2010-07-01 2010-07-01 false Conflict with State law. 530.201 Section 530.201 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS EMPLOYMENT... Conflict with State law. No certificate will be issued pursuant to § 530.101 of subpart B above authorizing...

  9. Effect of thallium-201 blood levels on reversible myocardial defects

    International Nuclear Information System (INIS)

    Nelson, C.W.; Wilson, R.A.; Angello, D.A.; Palac, R.T.


    To determine if 201 Tl plasma blood levels correlate with the presence of reversible myocardial defects during exercise testing, 14 patients with stable coronary artery disease underwent two separate exercise 201 Tl stress tests. Between initial and delayed imaging, on one test the patients drank an instant breakfast drink (eating) and on the other they drank an equivalent volume of water as a control (H 2 O). Thallium-201 imaging was performed immediately postexercise, immediately after eating/H 2 O and 210 min after eating/H 2 O. Between initial and immediate post eating/H 2 O images 201Tl reversible defects occurred in 27/38 regions in the H 2 O test versus 15/38 regions in the eating test (p = 0.02). Over this early time period, plasma 201 Tl activity was significantly higher in the H 2 O test than eating test (p less than 0.05). In conclusion, early reversal of 201 Tl defects may, in part, be the result of higher plasma 201 Tl activity early after initial postexercise 201 Tl imaging

  10. 24 CFR 1003.201 - Basic eligible activities. (United States)


    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Basic eligible activities. 1003.201... Activities § 1003.201 Basic eligible activities. ICDBG funds may be used for the following activities: (a... interest rates and mortgage principal amounts for low-and moderate-income homebuyers; (2) Finance the...

  11. 48 CFR 27.201-2 - Contract clauses. (United States)


    ... the patent indemnity clause. Exclusion from indemnity of identified patents, as distinguished from... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contract clauses. 27.201-2... REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Patents and Copyrights 27.201-2 Contract clauses. (a)(1) Insert the...

  12. Abnormal 201Tl limb scan due to unilateral tremor

    International Nuclear Information System (INIS)

    Simons, M.; Schelstraete, K.; Bratzlavsky, M.


    A abnormal intra- and interextremity distribution pattern on 201 Tl was observed on the limb scan of a patient with a unilateral tremor. This is ascribed to the increased blood flow in the muscles responsible for the tremor. The suggestion is made that the existence of tremor should be considered as a possible explanation for unexpected abnormalities on 201 Tl limb scintigrams

  13. 20 CFR 718.201 - Definition of pneumoconiosis. (United States)


    ... purposes of this definition, “pneumoconiosis” is recognized as a latent and progressive disease which may... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Definition of pneumoconiosis. 718.201 Section... DEATH DUE TO PNEUMOCONIOSIS Determining Entitlement to Benefits § 718.201 Definition of pneumoconiosis...

  14. 19 CFR 201.130 - General prohibitions against discrimination. (United States)


    ....130 Section 201.130 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF... Conducted by the U.S. International Trade Commission § 201.130 General prohibitions against discrimination... in, be denied the benefits of, or otherwise be subjected to discrimination under any program or...

  15. 24 CFR 945.201 - Approval to designate housing. (United States)


    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Approval to designate housing. 945.201 Section 945.201 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR PUBLIC AND INDIAN HOUSING, DEPARTMENT OF HOUSING AND...

  16. 48 CFR 2936.201 - Evaluation of contractor performance. (United States)


    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Evaluation of contractor... Construction 2936.201 Evaluation of contractor performance. The HCA must establish procedures to evaluate construction contractor performance and prepare performance reports as required by FAR 36.201. ...

  17. 48 CFR 3036.201 - Evaluation of contractor performance. (United States)


    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Evaluation of contractor performance. 3036.201 Section 3036.201 Federal Acquisition Regulations System DEPARTMENT OF HOMELAND SECURITY... contractor performance. (a)(2) Performance reports shall be prepared and entered into the Contractor...

  18. 42 CFR 403.201 - State regulation of insurance policies. (United States)


    ... 42 Public Health 2 2010-10-01 2010-10-01 false State regulation of insurance policies. 403.201 Section 403.201 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PROVISIONS SPECIAL PROGRAMS AND PROJECTS Medicare Supplemental Policies General Provisions...

  19. 40 CFR 86.201-94 - General applicability. (United States)


    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false General applicability. 86.201-94 Section 86.201-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... 1994 and Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium...

  20. 40 CFR 86.201-11 - General applicability. (United States)


    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false General applicability. 86.201-11 Section 86.201-11 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... 1994 and Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium...

  1. Cerebral blood flow imaging with thallium-201 diethyldithiocarbamate SPECT

    NARCIS (Netherlands)

    van Royen, E. A.; de Bruïne, J. F.; Hill, T. C.; Vyth, A.; Limburg, M.; Byse, B. L.; O'Leary, D. H.; de Jong, J. M.; Hijdra, A.; van der Schoot, J. B.


    Thallium-201 diethyldithiocarbamate ([201TI]DDC) was studied in humans as an agent for cerebral blood flow imaging. Brain uptake proved to be complete 90 sec after injection with no appreciable washout or redistribution for hours. Intracarotid injection suggested an almost 100% extraction during the

  2. 5 CFR 294.201 - Public information policy. (United States)


    ... Office. (b) The Assistant Director for Public Affairs carries out the public information policy of the... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Public information policy. 294.201... AVAILABILITY OF OFFICIAL INFORMATION The Public Information Function § 294.201 Public information policy. (a...

  3. 41 CFR 50-201.603 - Full administrative exemptions. (United States)


    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Full administrative exemptions. 50-201.603 Section 50-201.603 Public Contracts and Property Management Other Provisions Relating... contract for materials, supplies, articles, or equipment to be manufactured or furnished in part within and...

  4. Analysis of the color alteration and radiopacity promoted by bismuth oxide in calcium silicate cement. (United States)

    Marciano, Marina Angélica; Estrela, Carlos; Mondelli, Rafael Francisco Lia; Ordinola-Zapata, Ronald; Duarte, Marco Antonio Hungaro


    The aim of the study was to determine if the increase in radiopacity provided by bismuth oxide is related to the color alteration of calcium silicate-based cement. Calcium silicate cement (CSC) was mixed with 0%, 15%, 20%, 30% and 50% of bismuth oxide (BO), determined by weight. Mineral trioxide aggregate (MTA) was the control group. The radiopacity test was performed according to ISO 6876/2001. The color was evaluated using the CIE system. The assessments were performed after 24 hours, 7 and 30 days of setting time, using a spectrophotometer to obtain the ΔE, Δa, Δb and ΔL values. The statistical analyses were performed using the Kruskal-Wallis/Dunn and ANOVA/Tukey tests (poxide was added showed radiopacity corresponding to the ISO recommendations (>3 mm equivalent of Al). The MTA group was statistically similar to the CSC/30% BO group (p>0.05). In regard to color, the increase of bismuth oxide resulted in a decrease in the ΔE value of the calcium silicate cement. The CSC group presented statistically higher ΔE values than the CSC/50% BO group (poxide has no relation to the color alteration of calcium silicate-based cements.

  5. Performance of solid electrolyte type oxygen sensor in flowing lead bismuth

    International Nuclear Information System (INIS)

    Kondo, Masatoshi; Takahashi, Minoru


    A solid electrolyte type oxygen sensor for liquid 45%lead-55%bismuth (Pb-Bi) was developed. The performance of the oxygen sensor in the flowing lead-bismuth (Pb-Bi) was investigated. The initial performance of the sensor was not reliable, since the reference fluid of the oxygen saturated bismuth in the sensor cell was not compact initially. The electromotive force (EMF) obtained from the yttria stabilized zirconia (YSZ) cell was the same as that from the magnesia stabilized zirconia (MSZ) cell in the flowing Pb-Bi. The EMF of the sensor in the flowing Pb-Bi was lower than that in the stagnant Pb-Bi. However, the difference was small. The sensor showed repeatability after the long term interruption and the Pb-Bi drain/charge operation. After the performance tests, the corrosion of the sensor cells were investigated metallurgically. The YSZ cell was eroded around the free surface of the flowing Pb-Bi after 3500 hour-exposure in the flowing Pb-Bi. The MSZ cell showed smooth surface without the erosion. Although the YSZ cell worked more stably than the MSZ cell, the mechanical strength of the YSZ cell is weaker than that of the MSZ cell. (author)

  6. Behaviour of F82H mod. stainless steel in lead-bismuth under temperature gradient (United States)

    Gómez Briceño, D.; Martín Muñoz, F. J.; Soler Crespo, L.; Esteban, F.; Torres, C.


    Austenitic steels can be used in a hybrid system in contact with liquid lead-bismuth eutectic if the region of operating temperatures is not beyond 400°C. For higher temperatures, martensitic steels are recommended. However, at long times, the interaction between the structural material and the eutectic leads to the dissolution of some elements of the steel (Ni, Cr and Fe, mainly) in the liquid metal. In a non-isothermal lead-bismuth loop, the material dissolution takes place at the hot leg of the circuit and, due to the mass transfer, deposition occurs at the cold leg. One of the possible ways to improve the performance of structural materials in lead-bismuth is the creation of an oxide layer. Tests have been performed in a small natural convection loop built of austenitic steel (316L) that has been operating for 3000 h. This loop contains a test area in which several samples of F82Hmod. martensitic steel have been tested at different times. A gas with an oxygen content of 10 ppm was bubbled in the hot area of the circuit during the operation time. The obtained results show that an oxide layer is formed on the samples introduced in the loop at the beginning of the operation and this layer increases with time. However, the samples introduced at different times during the loop operation, are not protected by oxide layers and present material dissolution in some cases.

  7. Behaviour of F82H mod. stainless steel in lead-bismuth under temperature gradient

    International Nuclear Information System (INIS)

    Gomez Briceno, D.; Martin Munoz, F.J.; Soler Crespo, L.; Esteban, F.; Torres, C.


    Austenitic steels can be used in a hybrid system in contact with liquid lead-bismuth eutectic if the region of operating temperatures is not beyond 400 deg. C. For higher temperatures, martensitic steels are recommended. However, at long times, the interaction between the structural material and the eutectic leads to the dissolution of some elements of the steel (Ni, Cr and Fe, mainly) in the liquid metal. In a non-isothermal lead-bismuth loop, the material dissolution takes place at the hot leg of the circuit and, due to the mass transfer, deposition occurs at the cold leg. One of the possible ways to improve the performance of structural materials in lead-bismuth is the creation of an oxide layer. Tests have been performed in a small natural convection loop built of austenitic steel (316L) that has been operating for 3000 h. This loop contains a test area in which several samples of F82Hmod. martensitic steel have been tested at different times. A gas with an oxygen content of 10 ppm was bubbled in the hot area of the circuit during the operation time. The obtained results show that an oxide layer is formed on the samples introduced in the loop at the beginning of the operation and this layer increases with time. However, the samples introduced at different times during the loop operation, are not protected by oxide layers and present material dissolution in some cases

  8. Synthesis, structure and photoluminescence properties of amine-templated open-framework bismuth sulfates

    International Nuclear Information System (INIS)

    Marri, Subba R.; Behera, J.N.


    Two organically-templated bismuth sulfates of the compositions, [C 6 N 2 H 14 ] [Bi(SO 4 ) 2 (NO 3 )], (1) and [C 4 N 2 H 12 ] 4 [Bi 4 (SO 4 ) 10 (H 2 O) 4 ], (2), with open architecture have been synthesized and their structures determined by single crystal X-ray diffraction. 1 has a corrugated layered structure with 8-membered aperture wherein the SO 4 tetrahedra and the BiO 8 polyhedra join together to form (4, 4) net sheets of the metal centers while 2 has a three-dimensional structure possessing 8- and 12-membered channels. Both the compounds show good fluorescence properties exhibiting blue luminescence. Time-resolved fluorescence behavior of 1 and 2 shows mean fluorescence life time of 0.9 and 1.0 ns, respectively. - Graphical abstract: Two open-framework bismuth sulfates with the layered and three-dimensional structures have been synthesized and characterized. Both the compounds show good fluorescence properties exhibiting blue luminescence. Display Omitted - Highlights: • Two organically-templated bismuth sulfates with open architecture have been synthesized and characterized. • One has a corrugated layered structure while the other one has a three-dimensional structure possessing channels. • They are novel in that open-framework three-dimensional main group metal sulfates are first to be reported. • They show good fluorescence properties exhibiting blue luminescence

  9. The fabrication and thermal properties of bismuth-aluminum oxide nanothermometers. (United States)

    Wang, Chiu-Yen; Chen, Shih-Hsun; Tsai, Ping-Hsin; Chiou, Chung-Han; Hsieh, Sheng-Jen


    Bismuth (Bi) nanowires, well controlled in length and diameter, were prepared by using an anodic aluminum oxide (AAO) template-assisted molding injection process with a high cooling rate. A high performance atomic layer deposition (ALD)-capped bismuth-aluminum oxide (Bi-Al 2 O 3 ) nanothermometer is demonstrated that was fabricated via a facile, low-cost and low-temperature method, including AAO templated-assisted molding injection and low-temperature ALD-capped processes. The thermal behaviors of Bi nanowires and Bi-Al 2 O 3 nanocables were studied by in situ heating transmission electron microscopy. Linear thermal expansion of liquid Bi within native bismuth oxide nanotubes and ALD-capped Bi-Al 2 O 3 nanocables were evaluated from 275 °C to 700 °C and 300 °C to 1000 °C, respectively. The results showed that the ALD-capped Bi-Al 2 O 3 nanocable possesses the highest working temperature, 1000 °C, and the broadest operation window, 300 °C-1000 °C, of a thermal-expanding type nanothermometer. Our innovative approach provides another way of fabricating core-shell nanocables and to further achieve sensing local temperature under an extreme high vacuum environment.

  10. Determination of bismuth and cadmium after solid-phase extraction with chromosorb-107 in a syringe

    International Nuclear Information System (INIS)

    Tokman, Nilgun; Akman, Suleyman


    The determination of bismuth and cadmium by graphite furnace atomic absorption spectrometry (GFAAS) after solid-phase extraction (SPE) on Chromosorb-107 filled in a syringe was described. To retain the analytes, the sample solution treated with and without ammonium pyrolidine dithiocarbamate (APDC) was drawn into the syringe filled with Chromosorb-107 and discharged back manually. Bismuth and cadmium were quantitatively sorbed at pH ≥ 6 irrespective of whether the analyte was complexed with APDC prior to passing through the Chromosorb-107. Analyte elements sorbed on the resin were quantitatively eluted with 3.0 M of HNO 3 again drawing and discharging the eluent into the syringe and ejected it back. Optimum flow rates of sample or eluent for sorption and elution processes were 20 ml min -1 for drawing and 20 ml min -1 for discharging in all cases. Bismuth and cadmium were analyzed by graphite furnace atomic absorption spectrometry. The elements could be concentrated by drawing and discharging several portions of sample successively but eluting only one time. The validity of the proposed method was checked with standard reference materials (NIST SRM 1515 Apple-Leaves, CWW-TM-E Waste Water and CRM-SW Sea Water). The analyte elements were quantitatively (>95%) recovered from different matrices irrespective of treated samples with APDC. Detection limits (δ) were 0.8 and 1.2 μg l -1 for Bi and Cd, respectively. The method can be characterized with fastness, simplicity, quantitative recovery and high reproducibility

  11. Opto-electronic properties of bismuth oxide films presenting different crystallographic phases

    Energy Technology Data Exchange (ETDEWEB)

    Gomez, Celia L. [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico); Posgrado en Ciencia e Ingeniería de Materiales, UNAM, Unidad de Posgrado, Edificio C, Piso 1, Zona Cultural de CU, México, D.F. 04510 (Mexico); Depablos-Rivera, Osmary, E-mail: [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico); Posgrado en Ciencia e Ingeniería de Materiales, UNAM, Unidad de Posgrado, Edificio C, Piso 1, Zona Cultural de CU, México, D.F. 04510 (Mexico); Silva-Bermudez, Phaedra [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico); Instituto Nacional de Rehabilitación, Calz. México Xochimilco No. 289 Col. Arenal de Guadalupe, C.P.14389, Ciudad de México, D.F. (Mexico); Muhl, Stephen [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico); Zeinert, Andreas; Lejeune, Michael; Charvet, Stephane; Barroy, Pierre [Laboratoire de Physique de la Matière Condensée, Université de Picardie Jules Verne, 33 rue Saint Leu, 80039 Amiens Cedex 1 (France); Camps, Enrique [Instituto Nacional de Investigaciones Nucleares, Carretera México-Toluca S/N, kilómetro 36.5. La Marquesa, Municipio de Ocoyoacac, CP 52750, Estado de México (Mexico); Rodil, Sandra E. [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico)


    The optical, electrical and structural properties of bismuth oxide thin films deposited by radio frequency reactive magnetron sputtering were studied. The Bi{sub 2}O{sub 3} thin films were grown on Si and glass substrates under different power and substrate temperatures in an oxygen-enriched plasma leading to films with different crystalline phase as evidenced by X-ray diffraction and Raman spectroscopy. The optical properties of the films were measured using ellipsometric spectroscopy and optical transmission spectra. In order to parameterize the optical dispersion functions (n, k) of the films, the Tauc–Lorentz dispersion model was used. The optical bandgap was then assessed by different methods and the results are compared to the thermal variations of the electrical resistivity of the films. It was found that the refractive index, extinction coefficient and optical gap strongly depend on the deposition conditions and the crystalline phase; the fluorite defect cubic δ-Bi{sub 2}O{sub 3} phase showed the lowest optical gap and lower resistivity. - Highlights: • Different bismuth oxide phases were obtained by sputtering. • The power and substrate temperature were the two key parameters. • Room temperature delta-Bi{sub 2}O{sub 3} thin films were obtained. • The optical bandgap was around 1.5 and 2.2 eV, depending on the phase. • The bismuth oxide films presented activation energies around 1 eV.

  12. Effect of bismuth ion substitution on structural properties of zinc ferrite nanoparticles

    Directory of Open Access Journals (Sweden)

    Naraavula Suresh Kumar


    Full Text Available Bismuth doped nano zinc ferrite particles having the general formula ZnFe2-xBixO4 (x = 0.00, 0.05, 0.10, 0.15, 0.20 and 0.25 were synthesized by sol-gel combustion method. The effect of bismuth doping on structural properties were investigated. The X-ray diffraction (XRD spectra confirm the single phase cubic spinel structure. The average crystallite sizes of all the samples were determined by Debye-Scherrer equation and are in the range 16–20 nm. The lattice parameter increases with the increase of bismuth ion concentration. This is due to the larger ionic radius of Bi3+ ions substituting smaller Fe3+ ions at octahedral sites (B-sites. The surface morphology of all compounds was studied by scanning electron microscope (SEM. The microstructure analysis and the particle size were examined by transmission electron microscope (TEM. The compositional stoichiometry of these samples was verified by energy dispersive spectroscopy (EDS analysis.

  13. Selective resputtering of bismuth in sputtered Bi-Sr-Ca-Cu-O films (United States)

    Grace, J. M.; McDonald, D. B.; Reiten, M. T.; Olson, J.; Kampwirth, R. T.; Gray, K. E.


    We present studies using a dc magnetron in an on-axis configuration to sputter Bi-Sr-Ca-Cu-O films from a composite target. These studies show that bismuth can be preferentially resputtered. The influence of ozone, molecular oxygen, and total pressure on the resputtering of bismuth is investigated and discussed. Ozone, in low concentrations, can dramatically affect the degree of resputtering. By comparing the effects of molecular oxygen and ozone, some insight is gained regarding the possible mechanisms of negative ion formation in the magnetron environment. Based on our results we suggest that molecular oxygen can bring about resputtering primarily by forming O+2, which collides with the target to produce energetic negative oxygen ions. In contrast, ozone may form negative ions by electron impact in the dark space above the target, giving rise to lower-energy negative ions, which can traverse the plasma unneutralized and can be stopped with an applied bias on the sample block. With no added oxidant, negative oxygen ions from the target oxygen may dominate the background resputtering. Similarity is found between our results and those for similar studies on Y-Ba-Cu-O by other workers. Bismuth in Bi-Sr-Ca-Cu-O behaves as barium in Y-Ba-Cu-O with regards to preferential resputtering; furthermore, the response of strontium, calcium, and copper to oxygen in sputtered Bi-Sr-Ca-Cu-O is similar to what is observed for copper in Y-Ba-Cu-O.

  14. Selective resputtering of bismuth in sputtered Bi-Sr-Ca-Cu-O films

    International Nuclear Information System (INIS)

    Grace, J.M.; McDonald, D.B.; Reiten, M.T.; Olson, J.; Kampwirth, R.T.; Gray, K.E.


    We present studies using a dc magnetron in an on-axis configuration to sputter Bi-Sr-Ca-Cu-O films from a composite target. These studies show that bismuth can be preferentially resputtered. The influence of ozone, molecular oxygen, and total pressure on the resputtering of bismuth is investigated and discussed. Ozone, in low concentrations, can dramatically affect the degree of resputtering. By comparing the effects of molecular oxygen and ozone, some insight is gained regarding the possible mechanisms of negative ion formation in the magnetron environment. Based on our results we suggest that molecular oxygen can bring about resputtering primarily by forming O + 2 , which collides with the target to produce energetic negative oxygen ions. In contrast, ozone may form negative ions by electron impact in the dark space above the target, giving rise to lower-energy negative ions, which can traverse the plasma unneutralized and can be stopped with an applied bias on the sample block. With no added oxidant, negative oxygen ions from the target oxygen may dominate the background resputtering. Similarity is found between our results and those for similar studies on Y-Ba-Cu-O by other workers. Bismuth in Bi-Sr-Ca-Cu-O behaves as barium in Y-Ba-Cu-O with regards to preferential resputtering; furthermore, the response of strontium, calcium, and copper to oxygen in sputtered Bi-Sr-Ca-Cu-O is similar to what is observed for copper in Y-Ba-Cu-O

  15. Performance comparison of metallic, actinide burning fuel in lead-bismuth and sodium cooled fast reactors

    International Nuclear Information System (INIS)

    Weaver, K.D.; Herring, J.S.; Macdonald, P.E.


    Various methods have been proposed to ''incinerate'' or ''transmute'' the current inventory of transuranic waste (TRU) that exits in spent light-water-reactor (LWR) fuel, and weapons plutonium. These methods include both critical (e.g., fast reactors) and non-critical (e.g., accelerator transmutation) systems. The work discussed here is part of a larger effort at the Idaho National Engineering and Environmental Laboratory (INEEL) and at the Massachusetts Institute of Technology (MIT) to investigate the suitability of lead and lead-alloy cooled fast reactors for producing low-cost electricity as well as for actinide burning. The neutronics of non fertile fuel loaded with 20 or 30-wt% light water reactor (LWR) plutonium plus minor actinides for use in a lead-bismuth cooled fast reactor are discussed in this paper, with an emphasis on the fuel cycle life and isotopic content. Calculations show that the average actinide burn rate is similar for both the sodium and lead-bismuth cooled cases ranging from -1.02 to -1.16 g/MWd, compared to a typical LWR actinide generation rate of 0.303 g/MWd. However, when using the same parameters, the sodium-cooled case went subcritical after 0.2 to 0.8 effective full power years, and the lead-bismuth cooled case ranged from 1.5 to 4.5 effective full power years. (author)

  16. Red light emission from europium doped zinc sodium bismuth borate glasses (United States)

    Hegde, Vinod; Viswanath, C. S. Dwaraka; Upadhyaya, Vyasa; Mahato, K. K.; Kamath, Sudha D.


    Zinc sodium bismuth borate (ZNBB) glasses doped with different concentrations of europium were prepared by conventional melt quenching method and characterized through the measurements of density, refractive index, X-ray diffraction (XRD), Fourier Transform Infrared (FTIR) spectra, optical absorption, luminescence and radiative lifetimes. FTIR spectra showed seven characteristic peaks of bismuth and borate functional groups in the range of 400-1600 cm-1. The optical band gap and bonding parameters have been calculated from absorption spectra. Photoluminescence spectra recorded in the visible region with 394 nm excitation are used to calculate the Judd-Ofelt (JO) intensity parameters (Ω2 and Ω4). The JO intensity parameters have been used to calculate the radiative parameters such as branching ratio (β), stimulated emission cross-section (σse), transition probability (A) for the fluorescent level of 5D0→7F2. Decay rates through single exponential are used to calculate the lifetime (τm) of the meta-stable state 5D0 of (Eu3+ ion) these glasses. The radiative parameters measured for all these glasses show 0.7 mol% europium doped zinc sodium bismuth borate glass 5D0→7F2 transition has the potential for red laser applications. The quality of the colour emitted by the present glasses are estimated quantitatively by CIE chromaticity coordinates, which confirms the suitability of these glasses as a red emitting material for field emission technologies and LEDs.

  17. Use of a Soluble Anode in Electrodeposition of Thick Bismuth Telluride Layers (United States)

    Maas, M.; Diliberto, S.; de Vaulx, C.; Azzouz, K.; Boulanger, C.


    Integration of thermoelectric devices within an automotive heat exchanger could enable conversion of lost heat into electrical energy, contributing to improved total output from the engine. For this purpose, synthesis of thick bismuth telluride (Bi2Te3) films is required. Bismuth telluride has been produced by an electrochemical method in nitric acid with a sacrificial bismuth telluride anode as the source of cations. The binary layer grows on the working electrode while the counter-electrode, a Bi2Te3 disk obtained by high frequency melting, is oxidized to BiIII and TeIV. This process leads to auto-regeneration of the solution without modification of its composition. The thickness of films deposited by use of the Bi2Te3 anode was approximately 10 times that without. To demonstrate the utility of a soluble anode in electrochemical deposition, we report characterization of the composition and morphology of the films obtained under different experimental conditions. Perfectly dense and regular Bi2Te3 films (˜400 μm) with low internal stress and uniform composition across the cross-section were prepared. Their thermoelectric properties were assessed.

  18. Opto-electronic properties of bismuth oxide films presenting different crystallographic phases

    International Nuclear Information System (INIS)

    Gomez, Celia L.; Depablos-Rivera, Osmary; Silva-Bermudez, Phaedra; Muhl, Stephen; Zeinert, Andreas; Lejeune, Michael; Charvet, Stephane; Barroy, Pierre; Camps, Enrique; Rodil, Sandra E.


    The optical, electrical and structural properties of bismuth oxide thin films deposited by radio frequency reactive magnetron sputtering were studied. The Bi 2 O 3 thin films were grown on Si and glass substrates under different power and substrate temperatures in an oxygen-enriched plasma leading to films with different crystalline phase as evidenced by X-ray diffraction and Raman spectroscopy. The optical properties of the films were measured using ellipsometric spectroscopy and optical transmission spectra. In order to parameterize the optical dispersion functions (n, k) of the films, the Tauc–Lorentz dispersion model was used. The optical bandgap was then assessed by different methods and the results are compared to the thermal variations of the electrical resistivity of the films. It was found that the refractive index, extinction coefficient and optical gap strongly depend on the deposition conditions and the crystalline phase; the fluorite defect cubic δ-Bi 2 O 3 phase showed the lowest optical gap and lower resistivity. - Highlights: • Different bismuth oxide phases were obtained by sputtering. • The power and substrate temperature were the two key parameters. • Room temperature delta-Bi 2 O 3 thin films were obtained. • The optical bandgap was around 1.5 and 2.2 eV, depending on the phase. • The bismuth oxide films presented activation energies around 1 eV

  19. Study on the extraction of rare earth elements in liquid bismuth

    International Nuclear Information System (INIS)

    Harada, M.; Adachi, M.; Kai, Y.; Koike, K.


    Three factors, which are important for the extraction of rare earth elements in liquid bismuth - molten salt system, were studied, i. e., the equilibrium distribution of neodymium, samarium and bismuth between molten LiCl - liquid Bi-Li alloys, the extraction rate of rare earths, and the characteristics of the extractor with drop dispersion. The rare earth elements were extracted through redox reactions. In high range of Li-mole fraction in the alloy phase, X Li , the distribution of neodymium and bismuth in the salt phase markedly increased as X Li increased. The anomalous increase is attributed to the formation of the compound comprised of Nd, Li, Bi and oxygen in the salt phase. The redox reaction processes were very fast and the extraction rates for rare earths are controlled by the diffusion processes of the solute and the metallic lithium. The process for the formation of liquid metal drops in the continuous phase is predictable from semiempirical correlations reported for aqueous solution - organic solvent systems. The height of droplet bed being accumulated on drop settling portion is predictable from the coalescence time of single drop to a flat metal interface. The coalescence of metal drop to clean interface was very fast. The extractor type of liquid metal dispersion in molten salt is suitable for the extraction process in the fuel reprocessing of MSR or MSBR. (author)

  20. Glass composite waste forms for iodine confined in bismuth-embedded SBA-15 (United States)

    Yang, Jae Hwan; Park, Hwan Seo; Ahn, Do-Hee; Yim, Man-Sung


    The aim of this study was to stabilize bismuth-embedded SBA-15 that captured iodine gas by fabrication of monolithic waste forms. The iodine containing waste was mixed with Bi2O3 (a stabilizing additive) and low-temperature sintering glass followed by pelletizing and the sintering process to produce glass composite materials. Iodine volatility during the sintering process was significantly affected by the ratio of Bi2O3 and the glass composition. It was confirmed that BiI3, the main iodine phase within bismuth-embedded SBA-15, was effectively transformed to the mixed phases of Bi5O7I and BiOI. The initial leaching rates of iodine from the glass composite waste forms ranged 10-3-10-2 g/m2 day, showing the stability of the iodine phases encapsulated by the glassy networks. It was also observed that common groundwater anions (e.g., chloride, carbonate, sulfite, and fluoride) elevated the iodine leaching rate by anion exchange reactions. The present results suggest that the glass composite waste form of bismuth-embedded SBA-15 could be a candidate material for stable storage of 129I.