
Sample records for bismuth 196

  1. Bismuth Subsalicylate (United States)

    Pink Bismuth® ... Bismuth subsalicylate is used to treat diarrhea, heartburn, and upset stomach in adults and children 12 years of age and older. Bismuth subsalicylate is in a class of medications called ...

  2. Bismuth, Metronidazole, and Tetracycline (United States)

    Helidac® (as a kit containing Bismuth Subsalicylate, Metronidazole, Tetracycline) ... Bismuth, metronidazole, and tetracycline is used along with other ulcer medications to treat duodenal ulcers. It is ...

  3. Bismuth and polonium

    International Nuclear Information System (INIS)

    Brown, Paul L.; Ekberg, Christian


    Bismuth and polonium are the only elements in their respective chemical series that form cations. The lighter elements in both groups only form anions. Bismuth has trivalent and pentavalent oxidation states, but the latter is relatively unstable with respect to formation of the oxide. Polonium exhibits a range of oxidation states, with the divalent and tetravalent states forming the cations Po 2+ and PoO 2+ in aqueous solution. In aqueous solution, polonium(IV) forms the oxoanion PoO 2+ . Levy, Danford and Agron conducted X-ray diffraction studies of bismuth(III) solutions and established a structure for the hexameric species, Bi 6 (OH) 12 6+ . The reported data for the solubility constants of polymeric species of bismuth (III) are listed in this chapter. The stability and solubility constants derived at 25 C for zero ionic strength have been used to create a predominance speciation diagram for bismuth(III).

  4. Refining method for bismuth nitrate

    International Nuclear Information System (INIS)

    Shibata, Shigeyuki.


    The present invention concerns a method of separating and removing α ray emitting nuclides present in an aqueous solution of bismuth nitrate by an industrially convenient method. A nitric acid concentration in the aqueous solution of bismuth nitrate in which α ray emitting nuclides are dissolved is lowered to coprecipitate the bismuth oxynitrate and the α ray emitting nuclides. The coprecipitation materials are separated from the aqueous solution of bismuth nitrate to separate the α ray emitting nuclides dissolved in the aqueous solution of bismuth nitrate thereby refining the aqueous solution of bismuth nitrate. (T.M.)

  5. Tribochemistry of Bismuth and Bismuth Salts for Solid Lubrication. (United States)

    Gonzalez-Rodriguez, Pablo; van den Nieuwenhuijzen, Karin J H; Lette, Walter; Schipper, Dik J; Ten Elshof, Johan E


    One of the main trends in the past decades is the reduction of wastage and the replacement of toxic compounds in industrial processes. Some soft metallic particles can be used as nontoxic solid lubricants in high-temperature processes. The behavior of bismuth metal particles, bismuth sulfide (Bi2S3), bismuth sulfate (Bi2(SO4)3), and bismuth oxide (Bi2O3) as powder lubricants was studied in a range of temperatures up to 580 °C. The mechanical behavior was examined using a high-temperature pin-on-disc setup, with which the friction force between two flat-contact surfaces was recorded. The bismuth-lubricated surfaces showed low coefficients of friction (μ ≈ 0.08) below 200 °C. Above the melting temperature of the metal powder at 271 °C, a layer of bismuth oxide developed and the friction coefficient increased. Bismuth oxide showed higher friction coefficients at all temperatures. Bismuth sulfide exhibited partial oxidation upon heating but the friction coefficient decreased to μ ≈ 0.15 above 500 °C, with the formation of bismuth oxide-sulfate, while some bismuth sulfate remained. All surfaces were studied by X-ray diffraction (XRD), confocal microscopy, high-resolution scanning electron microscopy (HR-SEM), and energy-dispersive X-ray spectroscopy (EDS). This study reveals how the partial oxidation of bismuth compounds at high temperatures affects their lubrication properties, depending on the nature of the bismuth compound.


    Bryner, J.S.


    The growth of thorium bismutaide particles, which are formed when thorium is suspended in liquid bismuth, is inhibited when the liquid metal suspension is being flowed through a reactor and through a heat exchanger in sequence. It involves the addition of as little as 1 part by weight of tellurium to 100 parts of thorium. This addition is sufficient to inhibit particle growth and agglomeration.

  7. Bismuth toxicity in patients treated with bismuth iodoform paraffin packs. (United States)

    Atwal, A; Cousin, G C S


    Bismuth is a heavy metal used in bismuth iodoform paraffin paste (BIPP) antiseptic dressings and in a number of other medical preparations. It can be absorbed systemically and cause toxicity. We report 2 cases of such neurotoxicity after it was used in operations on the jaws. Copyright © 2015. Published by Elsevier Ltd.

  8. Tribochemistry of Bismuth and Bismuth Salts for Solid Lubrication

    NARCIS (Netherlands)

    Gonzalez Rodriguez, P.; van den Nieuwenhuijzen, Karin Jacqueline Huberta; Lette, W.; Schipper, Dirk J.; ten Elshof, Johan E.


    One of the main trends in the past decades is the reduction of wastage and the replacement of toxic compounds in industrial processes. Some soft metallic particles can be used as nontoxic solid lubricants in high-temperature processes. The behavior of bismuth metal particles, bismuth sulfide

  9. 32 CFR 196.310 - Recruitment. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Recruitment. 196.310 Section 196.310 National... Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 196.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 196.300 through 196.310 apply shall not discriminate on the...

  10. Adsorption and condensation of bismuth on tungsten

    International Nuclear Information System (INIS)

    Radon, T.; Sidorski, Z.


    The bismuth-tungsten system was studied by means of field emission microscopy. The average work function changes induced by the bismuth adsorption were measured for different amounts of adsorbed bismuth. It was found that the adsorption of bismuth changes the work function of tungsten only slightly. The penetration of bismuth into the tungsten substrate was observed. The growth of bismuth single crystals was studied when bismuth was deposited with a rate of about 6 monolayers per minute onto the tungsten substrate and kept at 470 K. Bismuth single crystals with two-fold symmetry occurred most often on the (100) tungsten planes. On the (111) tungsten plane bismuth crystals with three-fold symmetry were observed. An explanation of the observed phenomena is proposed. (Auth.)

  11. 21 CFR 73.1162 - Bismuth oxychloride. (United States)


    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Bismuth oxychloride. 73.1162 Section 73.1162 Food... COLOR ADDITIVES EXEMPT FROM CERTIFICATION Drugs § 73.1162 Bismuth oxychloride. (a) Identity. (1) The color additive bismuth oxychloride is a synthetically prepared white or nearly white amorphous or finely...

  12. 21 CFR 73.2162 - Bismuth oxychloride. (United States)


    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Bismuth oxychloride. 73.2162 Section 73.2162 Food... COLOR ADDITIVES EXEMPT FROM CERTIFICATION Cosmetics § 73.2162 Bismuth oxychloride. (a) Identity and specifications. (1) The color additive bismuth oxychloride shall conform in identity and specifications to the...

  13. Bismuth bronze from machu picchu, peru. (United States)

    Gordon, R B; Rutledge, J W


    The decorative bronze handle of a tumi excavated at the Inca city of Machu Picchu, Peru, contains 18 percent bismuth and appears to be the first known example of the use of bismuth with tin to make bronze. The alloy is not embrittled by the bismuth because the bismuth-rich constituent does not penetrate the grain boundaries of the matrix phase. The use of bismuth facilitates the duplex casting process by which the tumi was made and forms an alloy of unusual color.

  14. Investigation of iron-bismuth-molybdenum catalysts

    International Nuclear Information System (INIS)

    Ven'yaminov, S.A.; Pitaeva, A.N.; Barannik, G.B.; Plyasova, L.M.; Maksimovskaya, R.I.; Kustova, G.N.


    Using the methods of roentgenography, derivatography, EPR-and infrared-spectroscopy, the phase composition of an iron-bismut molybdenum system is investigated. It is shown that the method of introducing iron additives substantially affects the phase composition of the system. Interaction of a mixture of bismuth and iron hydroxides with a molybdic acid solution results in the formation of bismuth and iron molybdates. If iron hydroxide reacts with previously synthesized bismuth molybdate, a compound containing bismuth, molybdenum, and iron (the X-phase) is formed in the specimens along with the bismuth and iron molybdates

  15. 32 CFR 196.500 - Employment. (United States)


    ...) Application. The provisions of §§ 196.500 through 196.550 apply to: (1) Recruitment, advertising, and the..., leave for persons of either sex to care for children or dependents, or any other leave; (7) Fringe...

  16. 46 CFR 196.15-10 - Sanitation. (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Sanitation. 196.15-10 Section 196.15-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS OPERATIONS Test, Drills, and Inspections § 196.15-10 Sanitation. (a) It shall be the duty of the master and chief engineer...

  17. 32 CFR 196.525 - Fringe benefits. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Fringe benefits. 196.525 Section 196.525... Prohibited § 196.525 Fringe benefits. (a) “Fringe benefits” defined. For purposes of these Title IX regulations, fringe benefits means: Any medical, hospital, accident, life insurance, or retirement benefit...

  18. 46 CFR 196.43-5 - Availability. (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Availability. 196.43-5 Section 196.43-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS OPERATIONS Placard of Lifesaving Signals § 196.43-5 Availability. On all vessels to which this subpart applies there must be...

  19. 12 CFR 19.196 - Disreputable conduct. (United States)


    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Disreputable conduct. 19.196 Section 19.196... PROCEDURE Parties and Representational Practice Before the OCC; Standards of Conduct § 19.196 Disreputable conduct. Disreputable conduct for which an individual may be censured, debarred, or suspended from...

  20. 32 CFR 196.405 - Housing. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Housing. 196.405 Section 196.405 National... Discrimination on the Basis of Sex in Education Programs or Activities Prohibited § 196.405 Housing. (a... different fees or requirements, or offer different services or benefits related to housing, except as...

  1. Aspects of the magmatic geochemistry of bismuth (United States)

    Greenland, L.P.; Gottfried, D.; Campbell, E.Y.


    Bismuth has been determined in 74 rocks from a differentiated tholeiitic dolerite, two calc-alkaline batholith suites and in 66 mineral separates from one of the batholiths. Average bismuth contents, weighted for rock type, of the Great Lake (Tasmania) dolerite, the Southern California batholith and the Idaho batholith are, 32, 50 and 70 ppb respectively. All three bodies demonstrate an enrichment of bismuth in residual magmas with magmatic differentiation. Bismuth is greatly enriched (relative to the host rock) in the calcium-rich accessory minerals, apatite and sphene, but other mineral analyses show that a Bi-Ca association is of little significance to the magmatic geochemistry of bismuth. Most of the bismuth, in the Southern California batholith at least, occurs in a trace mineral phase (possibly sulfides) present as inclusions in the rock-forming minerals. ?? 1973.

  2. Iodine Gas Trapping using Granular Porous Bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Jae Hwan; Shin, Jin Myeong; Park, Jang Jin; Park, Geun Il [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Yim, Mansung [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of)


    {sup 129}I is a radionuclide with a very long half-life of 1.57 Χ 10{sup 7} years and has negative health effects to the human body. Therefore, the emission of {sup 129}I into the air is closely regulated by the Environmental Protection Agency (EPA). Many methods for trapping gaseous {sup 129}I have been developed thus far, including wet scrubbing and adsorption using silver loaded zeolites. Although wet scrubbing can effectively remove iodine, it suffers from corrosion of the vessel due to high concentration of the scrubbing solution. Silver loaded zeolites also show effectiveness in capturing {sup 129}I gas, yet weak thermal stability of physisorbed iodine remains a challenge. We studied a novel and facile method to trap iodine gas using bismuth. Granular bismuth having many pores was synthesized using bismuth nitrate and polyvinyl alcohol as a bismuth precursor and pore forming agent, respectively. Reaction of iodine and our samples resulted in an iodine capturing capacity of more than 2 times that of the commercial grade silver exchanged zeolite (AgX). Granular porous bismuths synthesized using bismuth nitrate and PVA show a promising performance in capturing iodine gas. The use of bismuth in trapping {sup 129}I gas can reduce the process cost as bismuth is cheap. Further study is going on to improve the mechanical property of granular porous bismuths for their easy handling.

  3. Recent advances in bioinorganic chemistry of bismuth. (United States)

    Li, Hongyan; Sun, Hongzhe


    Bismuth has been used in medicine for over two centuries for the treatment of various diseases, in particular for gastrointestinal disorders, owing to its antimicrobial activity. Recent structural characterization of bismuth drugs provides an insight into assembly and pharmacokinetic pathway of the drugs. Mining potential protein targets inside the pathogen via metallomic/metalloproteomic approach and further characterization on the interactions of bismuth drugs with these targets laid foundation in understanding the mechanism of action of bismuth drugs. Such studies would be beneficial in rational design of new potential drugs. Copyright © 2012 Elsevier Ltd. All rights reserved.


    Finzel, T.G.


    An improvement in the bismuth phosphate carrier precipitation process for recovering plutonium is described. It has been found that a more granular and more easily filterable carrier precipitiite is formed if the addition of the bismuth and phosphate ions is effected by first adding 9/10 of the bismuth ions necessary, then slowly adding all of the source of the phosphate ions to be incorporated in the precipitate, while digesting at 75 C and afterwards incorporating the remainder of the total bismuth ions necessary

  5. Hydrothermal synthesis of bismuth germanium oxide (United States)

    Boyle, Timothy J.


    A method for the hydrothermal synthesis of bismuth germanium oxide comprises dissolving a bismuth precursor (e.g., bismuth nitrate pentahydrate) and a germanium precursor (e.g., germanium dioxide) in water and heating the aqueous solution to an elevated reaction temperature for a length of time sufficient to produce the eulytite phase of bismuth germanium oxide (E-BGO) with high yield. The E-BGO produced can be used as a scintillator material. For example, the air stability and radioluminescence response suggest that the E-BGO can be employed for medical applications.

  6. Investigation of iron-bismuth-molybdenum catalysts

    International Nuclear Information System (INIS)

    Ven'yaminov, S.A.; Barannik, G.B.; Pitaeva, A.N.; Sazonova, N.N.; Plyasova, L.M.


    The catalytic properties of an oxide iron-bismuth-molybdenum system in reactions of oxidative ammonolysis of propylene and oxidative dehydrogenation of butene-1 are investigated. It is shown that catalysts containing double molybdate of bismuth and iron (the X-phase) exhibit an increased catalytic activity as compared with bismuth molybdate (Bi 2 O 3 x3MoO 3 ). Preliminary reduction of such specimens increases their activity and selectivity in subsequent work under conditions of a stationary course of the oxidation reaction. The activity and selectivity of catalysts containing only bismuth molybdate and iron molybdate are due to the additivity of the properties of the separate molybdates

  7. Bismuth absorption from sup 205 Bi-labelled pharmaceutical bismuth compounds used in the treatment of peptic ulcer disease

    Energy Technology Data Exchange (ETDEWEB)

    Dresow, B.; Fischer, R.; Gabbe, E.E.; Wendel, J.; Heinrich, H.C. (Eppendorf University Hospital, Hamburg (Germany))


    The absorption of bismuth from five {sup 205}Bi-labelled pharmaceutically used bismuth compounds was studied in man. From single oral doses of all compounds under investigation only <0.1% bismuth was absorbed and excreted with the urine. A significantly higher absorption was observed from the colloidal bismuth subcitrate and the basic bismuth gallate than from the basic bismuth salicylate, nitrate and aluminate. No retention of bismuth in the whole body was found from the single dose experiment. The biologic fast-term half-lives of absorbed bismuth were calculated to be 0.12 and 1.5 days. 14 refs., 2 figs., 1 tab.

  8. Ranitidine bismuth citrate: A review

    Directory of Open Access Journals (Sweden)

    N Chiba


    Full Text Available Recognition of the relationship between Helicobacter pylori infection and the development of gastroduodenal disease has increased greatly in recent years. To avoid complications of H pylori infection, such as the development of recurrent duodenal and gastric ulcers, effective therapies are required for eradication of the infection. This article reviews ranitidine bismuth citrate (RBC, a novel complex of ranitidine, bismuth and citrate, which was developed specifically for the purpose of eradicating H pylori. Dual therapy with RBC in combination with clarithromycin for 14 days yields eradication rates of 76%. Triple therapy bid for one week with a proton pump inhibitor, clarithromycin and either amoxicillin or a nitroimidazole (tinidazole or metronidazole is advocated as the treatment of choice for H pylori eradication. Analogous regimens with RBC in place of proton pump inhibitors show effective eradication rates in comparative studies and with pooled data. RBC, used alone or in combination with other antibiotics, appears to be a safe and effective drug for the treatment of H pylori infection. Bismuth levels do not appear to rise to toxic levels.

  9. Crystal growth of bismuth tungstate

    Energy Technology Data Exchange (ETDEWEB)

    De L' Eprevier, A. G.; Shukla, V. N.; Payne, D. A.


    Bi/sub 2/WO/sub 6/ is a polar material in the bismuth titanate family, Bi/sub 2/M/sub n-1/R/sub n/0/sub 3n+3/. Additions of NaF to a Na/sub 2/WO/sub 4/ - WO/sub 3/ flux yielded large single crystals up to 0.8 mm thick, which were free of inclusions. Total impurities were less than 500 ppM, and the crystals were single domain.

  10. Bismuth ions are metabolized into autometallographic traceable bismuth-sulphur quantum dots

    Directory of Open Access Journals (Sweden)

    M Stoltenberg


    Full Text Available Bismuth – sulphur quantum dots can be silver enhanced by autometallography (AMG. In the present study, autometallographic silver enhanced bismuth-sulphur nanocrystals were isolated from unfixed cryo-sections of kidneys and livers of rats exposed to bismuth (Bi207 subnitrate. After being subjected to AMG all the organic material was removed by sonication and enzymatic digestion and the silver enhanced Bi- S quantum dots spun down by an ultracentrifuge and analyzed by scintillation. The analysis showed that the autometallographic technique traces approximately 94% of the total bismuth. This implies that the injected bismuth is ultimately captured in bismuthsulphur quantum dots, i.e., that Bi-S nanocrystals are the end product of bismuth metabolism

  11. 32 CFR 196.540 - Advertising. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Advertising. 196.540 Section 196.540 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS... Advertising. A recipient shall not in any advertising related to employment indicate preference, limitation...

  12. 34 CFR 300.196 - Filing requirements. (United States)


    ... 34 Education 2 2010-07-01 2010-07-01 false Filing requirements. 300.196 Section 300.196 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION ASSISTANCE TO STATES FOR THE EDUCATION OF CHILDREN WITH...

  13. Radio-sensitization of animals by bismuth

    International Nuclear Information System (INIS)

    Pierotti, T.; Verain, A.


    Digestive absorption of bismuth by animals leads to radio-sensitization. This effect is very marked when the X-rays used are centered on the absorption line of bismuth. This work has involved the use of more than 2000 C3H/JAX mice, and has shown that a maximum lethal effect, with respect to the standard, occurs for bismuth sub-nitrate doses of the order of 3 g/kg and for exposures of 700 R. For stronger or weaker doses, the sensitization effect is less marked. (authors) [fr

  14. Transmucosal penetration of bismuth particles in the human stomach. (United States)

    Nwokolo, C U; Lewin, J F; Hudson, M; Pounder, R E


    Electron microscopic examination of upper gastrointestinal biopsies with x-ray microanalysis was used to detect electron-dense particles of bismuth in the mucosa of the upper gastrointestinal tract, 30-60 minutes after oral dosing with either tripotassium dicitrato bismuthate [De-Noltab; Brocades (Great Britain) Ltd., Weybridge, UK; five patients] or bismuth salicylate (Pepto-Bismol; Richardson Vicks Ltd., Egham, UK; five patients), or without dosing (two patients). Transmucosal penetration of bismuth particles was observed in the gastric antral mucosa of all patients who had been dosed with tripotassium dicitrato bismuthate, but there was no penetration after oral dosing with bismuth salicylate. Persorption of bismuth particles through the gastric mucosa to the vascular endothelium provides an explanation for the rapid rise of plasma bismuth concentration observed only after oral dosing with tripotassium dicitrato bismuthate.

  15. Bismuth-based electrochemical stripping analysis (United States)

    Wang, Joseph


    Method and apparatus for trace metal detection and analysis using bismuth-coated electrodes and electrochemical stripping analysis. Both anodic stripping voltammetry and adsorptive stripping analysis may be employed.

  16. Electrical resistivity of fast neutron irradiated bismuth

    International Nuclear Information System (INIS)

    Quelard, G.


    The production and recovery of fast neutron radiation damage in bismuth, at 20K has been studied by means of electrical resistivity. Results are independent of crystallographic orientation and indicate a creation of carriers during irradiation [fr

  17. Crystallization of bismuth borate glasses

    International Nuclear Information System (INIS)

    Bajaj, Anu; Khanna, Atul


    Bismuth borate glasses with Bi 2 O 3 concentration of 20-66 mol% were prepared by melt quenching and devitrified by heat treatment above their glass transition temperatures. All glasses show a strong tendency towards crystallization on annealing that increases with Bi 2 O 3 concentration. The crystalline phases formed on devitrification were characterized by FTIR absorption spectroscopy and DSC measurements. Our studies reveal that phases produced in glasses are strongly determined by initial glass composition and the two most stable crystalline phases are: Bi 3 B 5 O 12 and Bi 4 B 2 O 9 . The metastable BiBO 3 phase can also be formed by devitrification of glass with 50 mol% of Bi 2 O 3 . This phase is, however, unstable and decomposes into Bi 3 B 5 O 12 and Bi 4 B 2 O 9 on prolonged heat treatment.

  18. Gravimetric Analysis of Bismuth in Bismuth Subsalicylate Tablets: A Versatile Quantitative Experiment for Undergraduate Laboratories (United States)

    Davis, Eric; Cheung, Ken; Pauls, Steve; Dick, Jonathan; Roth, Elijah; Zalewski, Nicole; Veldhuizen, Christopher; Coeler, Joel


    In this laboratory experiment, lower- and upper-division students dissolved bismuth subsalicylate tablets in acid and precipitated the resultant Bi[superscript 3+] in solution with sodium phosphate for a gravimetric determination of bismuth subsalicylate in the tablets. With a labeled concentration of 262 mg/tablet, the combined data from three…

  19. Bismuth alloy potting seals aluminum connector in cryogenic application (United States)

    Flower, J. F.; Stafford, R. L.


    Bismuth alloy potting seals feedthrough electrical connector for instrumentation within a pressurized vessel filled with cryogenic liquids. The seal combines the transformation of high-bismuth content alloys with the thermal contraction of an external aluminum tube.

  20. Liquid Bismuth Propellant Flow Sensor (United States)

    Polzin, Kurt A.; Stanojev, B. J.; Korman, V.


    Quantifying the propellant mass flow rate in liquid bismuth-fed electric propulsion systems has two challenging facets. First, the flow sensors must be capable of providing a resolvable measurement at propellant mass flow rates on the order of 10 mg/see with and uncertainty of less that 5%. The second challenge has to do with the fact that the materials from which the flow sensors are fabricated must be capable of resisting any of the corrosive effects associated with the high-temperature propellant. The measurement itself is necessary in order to properly assess the performance (thrust efficiency, Isp) of thruster systems in the laboratory environment. The hotspot sensor[I] has been designed to provide the bismuth propellant mass flow rate measurement. In the hotspot sensor, a pulse of thermal energy (derived from a current pulse and associated joule heating) is applied near the inlet of the sensor. The flow is "tagged" with a thermal feature that is convected downstream by the flowing liquid metal. Downstream, a temperature measurement is performed to detect a "ripple" in the local temperature associated with the passing "hotspot" in the propellant. By measuring the time between the upstream generation and downstream detection of the thermal feature, the flow speed can be calculated using a "time of flight" analysis. In addition, the system can be calibrated by measuring the accumulated mass exiting the system as a-function of time and correlating this with the time it takes the hotspot to convect through the sensor. The primary advantage of this technique is that it doesn't depend on an absolute measurement of temperature but, instead, relies on the observation of thermal features. This makes the technique insensitive to other externally generated thermal fluctuations. In this paper, we describe experiments performed using the hotspot flow sensor aimed at quantifying the resolution of the sensor technology. Propellant is expelled onto an electronic scale to

  1. Studies on bismuth carboxylates—synthesis and characterization of ...

    Indian Academy of Sciences (India)

    1. Introduction. A large number of bismuth compounds are clinically active against Helicobacter pylori and other gastroin- testinal disorders.1–2 Prominent among these are bis- muth subsalicylate (trade name Pepto-Bismol), col- loidal bismuth subcitrate (CBS, trade name De-Nol) and ranitidine bismuth citrate (trade name ...

  2. Short report: evaluation of Helicobacter pylori eradication with bismuth sucralfate

    NARCIS (Netherlands)

    Reijers, M. H.; Noach, L. A.; Tytgat, G. N.


    In a pilot study we have evaluated the clinical efficacy of bismuth sucralfate to eradicate H. pylori. Ten consecutive patients with chronic dyspepsia and H. pylori associated gastritis were treated with bismuth sucralfate (220 mg bismuth per tablet, 4 tablets per day for 4 weeks). If a 14C urea

  3. 21 CFR 520.1204 - Kanamycin, bismuth subcarbonate, activated attapulgite. (United States)


    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Kanamycin, bismuth subcarbonate, activated... § 520.1204 Kanamycin, bismuth subcarbonate, activated attapulgite. (a) Specifications—(1) Each 5 milliliters (mL) of suspension contains 100 milligrams (mg) kanamycin (as the sulfate), 250 mg bismuth...

  4. Dicty_cDB: VSK196 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSK196 (Link to dictyBase) - - - Contig-U10274-1 VSK196P (Link... to Original site) VSK196F 423 VSK196Z 453 VSK196P 876 - - Show VSK196 Library VS (Link to library) Clone ID VSK196 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10274-1 Original site URL http://dict...TTATNAACAATTAAAAAAAA sequence update 2001. 3.22 Translated Amino Acid sequence kdgklvslkdfikdqkpivlyfypkdetsict...*NKIX--- ---KLKVGDQAPDFTCPDKDGKLVSLKDFIKDQKPIVLYFYPKDETSICTKEACEFRDKY QKFIEAGADVI

  5. Liquid Bismuth Feed System for Electric Propulsion (United States)

    Markusic, T. E.; Polzin, K. A.; Stanojev, B. J.


    Operation of Hall thrusters with bismuth propellant has been shown to be a promising path toward high-power, high-performance, long-lifetime electric propulsion for spaceflight missions. For example, the VHITAL project aims td accurately, experimentally assess the performance characteristics of 10 kW-class bismuth-fed Hall thrusters - in order to validate earlier results and resuscitate a promising technology that has been relatively dormant for about two decades. A critical element of these tests will be the precise metering of propellant to the thruster, since performance cannot be accurately assessed without an accurate accounting of mass flow rate. Earlier work used a pre/post-test propellant weighing scheme that did not provide any real-time measurement of mass flow rate while the thruster was firing, and makes subsequent performance calculations difficult. The motivation of the present work was to develop a precision liquid bismuth Propellant Management System (PMS) that provides real-time propellant mass flow rate measurement and control, enabling accurate thruster performance measurements. Additionally, our approach emphasizes the development of new liquid metal flow control components and, hence, will establish a basis for the future development of components for application in spaceflight. The design of various critical components in a bismuth PMS are described - reservoir, electromagnetic pump, hotspot flow sensor, and automated control system. Particular emphasis is given to material selection and high-temperature sealing techniques. Open loop calibration test results are reported, which validate the systems capability to deliver bismuth at mass flow rates ranging from 10 to 100 mg/sec with an uncertainty of less than +/- 5%. Results of integrated vaporizer/liquid PMS tests demonstrate all of the necessary elements of a complete bismuth feed system for electric propulsion.

  6. Hyperfine splitting in lithium-like bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Lochmann, Matthias; Froemmgen, Nadja; Hammen, Michael; Will, Elisa [Universitaet Mainz (Germany); Andelkovic, Zoran; Kuehl, Thomas; Litvinov, Yuri; Winters, Danyal; Sanchez, Rodolfo [GSI Helmholtzzentrum, Darmstadt (Germany); Botermann, Benjamin; Noertershaeuser, Wilfried [Technische Universitaet Darmstadt (Germany); Bussmann, Michael [Helmholtzzentrum Dresden-Rossendorf (Germany); Dax, Andreas [CERN, Genf (Switzerland); Hannen, Volker; Joehren, Raphael; Vollbrecht, Jonas; Weinheimer, Christian [Universitaet Muenster (Germany); Geppert, Christopher [Universitaet Mainz (Germany); GSI Helmholtzzentrum, Darmstadt (Germany); Stoehlker, Thomas [GSI Helmholtzzentrum, Darmstadt (Germany); Universitaet Heidelberg (Germany); Thompson, Richard [Imperial College, London (United Kingdom); Volotka, Andrey [Technische Universitaet Dresden (Germany); Wen, Weiqiang [IMP Lanzhou (China)


    High-precision measurements of the hyperfine splitting values on Li- and H-like bismuth ions, combined with precise atomic structure calculations allow us to test QED-effects in the regime of the strongest magnetic fields that are available in the laboratory. Performing laser spectroscopy at the experimental storage ring (ESR) at GSI Darmstadt, we have now succeeded in measuring the hyperfine splitting in Li-like bismuth. Probing this transition has not been easy because of its extremely low fluorescence rate. Details about this challenging experiment will be given and the achieved experimental accuracy are presented.

  7. Bismuth salicylate for diarrhea in children (United States)

    Goldman, Ran D.


    Abstract Question Recently, I had a visit from a 5-year-old patient who had been given bismuth subsalicylate for a diarrheal illness by a local family physician during a trip to South America. Is this a practice we should encourage? Answer Research from developing countries has found the use of bismuth subsalicylate to be effective in shortening the duration of diarrheal illness. Despite these findings, its limited effectiveness and concerns about it potentially causing Reye syndrome, compliance, and cost are the key reasons it is not routinely recommended for children. PMID:23946025

  8. Bismuth Subgallate Toxicity in the Age of Online Supplement Use. (United States)

    Sampognaro, Paul; Vo, Kathy T; Richie, Megan; Blanc, Paul D; Keenan, Kevin


    Bismuth salts have been used to treat gastroenterological disorders and are readily available over-the-counter and via the internet. Even though generally considered safe, bismuth compounds can cause a syndrome of subacute, progressive encephalopathy when taken in large quantities. We present the case of woman who developed progressive encephalopathy, aphasia, myoclonus, and gait instability after chronically ingesting large amounts of bismuth subgallate purchased from a major online marketing website to control symptoms of irritable bowel syndrome. After extensive neurological work-up, elevated bismuth levels in her blood, urine, and cerebrospinal fluid confirmed the diagnosis of bismuth-related neurotoxicity. She improved slowly following cessation of exposure. This case highlights bismuth subgallate as a neurotoxic bismuth formulation and reminds providers of the potential for safety misconceptions of positively reviewed online supplements.

  9. A scanning electron microscopy study of bismuth and phosphate phases in bismuth phosphate process waste at Hanford

    International Nuclear Information System (INIS)

    Reynolds, J.G.; Page, J.S.; Cooke, G.A.; John Pestovich


    This study characterizes major bismuth and phosphate-bearing phases in Hanford radioactive waste from the bismuth phosphate process using scanning electron microscopy with energy dispersive spectroscopy. Large bismuth phases displayed lath morphology and consisted of sodium, iron, bismuth, and phosphorus. The majority of the bismuth and phosphate observed was in small particulate (<2 µm in diameter) containing sodium, phosphorus, iron, and nickel. Additionally, phosphorus was included in a sodium-aluminum-phosphate lath-shaped species. Characterization of these waste types is of particular importance since they may have the bounding particle properties for designing waste mixing and transport processes used during treatment. (author)

  10. 32 CFR 196.510 - Recruitment. (United States)


    ... NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Discrimination on the Basis of Sex in Employment in Education Programs or Activities Prohibited § 196.510... members of one sex if such actions have the effect of discriminating on the basis of sex in violation of...

  11. Magnetoreflection studies of ion implanted bismuth

    International Nuclear Information System (INIS)

    Nicolini, C.; Chieu, T.C.; Dresselhaus, M.S.; Massachusetts Inst. of Tech., Cambridge; Dresselhaus, G.


    The effect of the implantation of Sb ions on the electronic structure of the semimetal bismuth is studied by the magnetoreflection technique. The results show long electronic mean free paths and large implantation-induced increases in the band overlap and L-point band gap. These effects are opposite to those observed for Bi chemically doped with Sb. (author)

  12. On excitation of acoustic plasmons in bismuth

    International Nuclear Information System (INIS)

    Babkin, G.I.; Kravchenko, V.Ya.


    The amplitude of the transverse electromagnetic wave penetrating through a bismuth plate under conditions of existence of an acoustic plasma wave is calculated. Two wave coupling mechanisms due to the anisotropy of the carrier spectrum and the carrier drift in the magnetic field of the wave are considered. In the latter case, a wave of double frequency penetrates through the plate

  13. 21 CFR 73.2110 - Bismuth citrate. (United States)


    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Bismuth citrate. 73.2110 Section 73.2110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL LISTING OF COLOR... paragraph (c)(1), effective April 27, 2010. For the convenience of the user, the revised text is set forth...

  14. Preparation and characterization of nanostructured copper bismuth ...

    Indian Academy of Sciences (India)

    Thin films of copper bismuth diselenide were prepared by chemical bath deposition technique onto glass substrate below 60°C. The deposition parameters such as time, temperature of deposition and pH of the solution, were optimized. The set of films having different elemental compositions was prepared by varying Cu/Bi ...

  15. Bismuth phosphates as intermediate temperature proton conductors

    DEFF Research Database (Denmark)

    Huang, Yunjie; Christensen, Erik; Shuai, Qin


    Proton conducting electrolyte materials operational in the intermediate temperature range of 200-400 °C are of special interest for applications in fuel cells and water electrolysers. Bismuth phosphates in forms of polycrystalline powders and amorphous glasses are synthesized and investigated...

  16. Photosensitive bismuth ions in lead tungstate

    Czech Academy of Sciences Publication Activity Database

    Vazhenin, V.A.; Potapov, A.P.; Asatryan, G.R.; Nikl, Martin


    Roč. 55, č. 4 (2013), s. 803-806 ISSN 1063-7834 Institutional support: RVO:68378271 Keywords : PbWO 4 * single crystal * bismuth * electron paramagnetic resonance Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.782, year: 2013

  17. Bismuth pyrochlore thin films for dielectric energy storage

    International Nuclear Information System (INIS)

    Michael, Elizabeth K.; Trolier-McKinstry, Susan


    Thin films of cubic pyrochlore bismuth zinc niobate, bismuth zinc tantalate, and bismuth zinc niobate tantalate were fabricated using chemical solution deposition. This family of materials exhibited moderate relative permittivities between 55 ± 2 and 145 ± 5 for bismuth zinc tantalate and bismuth zinc niobate, respectively, and low loss tangents on the order of 0.0008 ± 0.0001. Increases in the concentration of the tantalum end member increased the dielectric breakdown strength. For example, at 10 kHz, the room temperature breakdown strength of bismuth zinc niobate was 5.1 MV/cm, while that of bismuth zinc tantalate was 6.1 MV/cm. This combination of a high breakdown strength and a moderate permittivity led to a high discharged energy storage density for all film compositions. For example, at a measurement frequency of 10 kHz, bismuth zinc niobate exhibited a maximum recoverable energy storage density of 60.8 ± 2.0 J/cm 3 , while bismuth zinc tantalate exhibited a recoverable energy storage density of 60.7 ± 2.0 J/cm 3 . Intermediate compositions of bismuth zinc niobate tantalate offered higher energy storage densities; at 10 mol. % tantalum, the maximum recoverable energy storage density was ∼66.9 ± 2.4 J/cm 3

  18. Current and potential applications of bismuth-based drugs. (United States)

    Keogan, Donal M; Griffith, Darren M


    : Bismuth compounds have been used extensively as medicines and in particular for the treatment of gastrointestinal ailments. In addition to bismuth's well known gastroprotective effects and efficacy in treating H. pylori infection it also has broad anti-microbial, anti-leishmanial and anti-cancer properties. Aspects of the biological chemistry of bismuth are discussed and biomolecular targets associated with bismuth treatment are highlighted. This review strives to provide the reader with an up to date account of bismuth-based drugs currently used to treat patients and discuss potential medicinal applications of bismuth drugs with reference to recent developments in the literature. Ultimately this review aims to encourage original contributions to this exciting and important field.

  19. Bismuth(III) dialkyldithiophosphates: Facile single source precursors for the preparation of bismuth sulfide nanorods and bismuth phosphate thin films

    International Nuclear Information System (INIS)

    Biswal, Jasmine B.; Garje, Shivram S.; Nuwad, Jitendra; Pillai, C.G.S.


    Two different phase pure materials (Bi 2 S 3 and Bi 2 P 4 O 13 ) have been prepared under different conditions using the same single source precursors. Solvothermal decomposition of the complexes, Bi(S 2 P(OR) 2 ) 3 [where, R=Methyl (Me) (1), Ethyl (Et) (2), n-Propyl (Pr n ) (3) and iso-Propyl (Pr i ) (4)] in ethylene glycol gave orthorhombic bismuth sulfide nanorods, whereas aerosol assisted chemical vapor deposition (AACVD) of the same precursors deposited monoclinic bismuth tetraphosphate (Bi 2 P 4 O 13 ) thin films on glass substrates. Surface study of the thin films using SEM illustrated the formation of variety of nanoscale morphologies (spherical-, wire-, pendent-, doughnut- and flower-like) at different temperatures. AFM studies were carried out to evaluate quality of the films in terms of uniformity and roughness. Thin films of average roughness as low as 1.4 nm were deposited using these precursors. Photoluminescence studies of Bi 2 P 4 O 13 thin films were also carried out. - Graphical abstract: Solvothermal decomposition of bismuth(III) dialkyldithiophosphates in ethylene glycol gave Bi 2 S 3 nanoparticles, whereas aerosol assisted chemical vapor deposition of these single source precursors deposited Bi 2 P 4 O 13 thin films. Display Omitted - Highlights: • Preparation of phase pure orthorhombic Bi 2 S 3 nanorods and monoclinic Bi 2 P 4 O 13 thin films. • Use of single source precursors for deposition of bismuth phosphate thin films. • Use of solvothermal decomposition and AACVD methods. • Morphology controlled synthesis of Bi 2 P 4 O 13 thin films. • Bi 2 S 3 nanorods and Bi 2 P 4 O 13 thin films using same single source precursors

  20. Combined isovalent alloying gallium arsenide with bismuth and indium

    International Nuclear Information System (INIS)

    Vorob'eva, V.V.; Zushinskaya, O.V.; Novikov, S.V.; Savel'ev, I.G.; Chaldyshev, V.V.


    Electric conductivity and the Hall effect at 77 and 300K of gallium arsenide epitaxial films grown from the melted solution with bismuth and indium additions at 77 and 300K. Different mechanisms of bismuth and indium effect on the ensamble of defects and background addition in gallium arsenide, are established. Bismuth effect is conditioned by the change of liquid phase properties, and indium effect is conditioned by the processes taking place in a crystal. The experimental results have shown that the mutual alloying of gallium arsenide with indium and bismuth in the process of liquid-phase epitaxy ensures high electrophysical film properties

  1. 49 CFR 572.196 - Thorax without arm. (United States)


    ... 49 Transportation 7 2010-10-01 2010-10-01 false Thorax without arm. 572.196 Section 572.196... Dummy, Small Adult Female § 572.196 Thorax without arm. (a) The thorax is part of the upper torso... (drawing 180-0000) with the arm (180-6000) on the impacted side removed. The dummy's thorax is equipped...

  2. 46 CFR 196.30-5 - Accidents to machinery. (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Accidents to machinery. 196.30-5 Section 196.30-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS OPERATIONS Reports of Accidents, Repairs, and Unsafe Equipment § 196.30-5 Accidents to machinery. (a) In the event of an accident to a boiler, unfired pressur...

  3. 46 CFR 196.95-1 - Pilot boarding operations. (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Pilot boarding operations. 196.95-1 Section 196.95-1... Pilot Boarding Operations § 196.95-1 Pilot boarding operations. (a) The master shall ensure that pilot boarding equipment is maintained as follows: (1) The equipment must be kept clean and in good working order...

  4. 22 CFR 19.6 - Court orders and divorce decrees. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Court orders and divorce decrees. 19.6 Section 19.6 Foreign Relations DEPARTMENT OF STATE PERSONNEL BENEFITS FOR SPOUSES AND FORMER SPOUSES OF PARTICIPANTS IN THE FOREIGN SERVICE RETIREMENT AND DISABILITY SYSTEM § 19.6 Court orders and divorce decrees. ...

  5. 46 CFR 196.37-47 - Portable magazine chests. (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Portable magazine chests. 196.37-47 Section 196.37-47... Markings for Fire and Emergency Equipment, etc. § 196.37-47 Portable magazine chests. (a) Portable magazine chests shall be marked in letters at least 3 inches high: PORTABLE MAGAZINE CHEST — FLAMMABLE — KEEP...

  6. 46 CFR 196.85-1 - Magazine operation and control. (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Magazine operation and control. 196.85-1 Section 196.85... OPERATIONS Magazine Control § 196.85-1 Magazine operation and control. (a) Keys to magazine spaces and magazine chests shall be kept in the sole control or custody of the Master or one delegated qualified...

  7. 27 CFR 28.196 - Consignment, shipment, and delivery. (United States)


    ... delivery. 28.196 Section 28.196 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Benefit of Drawback Filing of Notice and Removal § 28.196 Consignment, shipment, and delivery. The consignment, shipment, and delivery of distilled spirits removed under this subpart for export, use on vessels...

  8. Coating compositions comprising bismuth-alloyed zinc

    DEFF Research Database (Denmark)


    The present application discloses (i) a coating composition comprising a particulate zinc-based alloyed material, said material comprising 0.05-0.7% by weight of bismuth (Bi), the D50 of the particulate material being in the range of 2.5-30 µm; (ii) a coated structure comprising a metal structure......, wherein the material comprises 0.05-0.7%(w/w) of bismuth (Bi), and wherein the D50 of the particulate material is in the range of 2.5-30 µm; (iv) a composite powder consisting of at least 25%(w/w) of the particulate zinc-based alloyed material, the rest being a particulate material consisting of zinc...

  9. Electrocatalytic activity of bismuth doped silver electrodes

    CERN Document Server

    Amjad, M


    Investigation of redox reactions on silver, and bismuth doped silver electrodes in aqueous KOH solutions, by using potentiostatic steady-state polarization technique, has been carried out. The redox wave potential and current displacements along with multiplicity of the latter have been examined. These electrodes were employed for the oxidation of organic molecules such as ethylamine in alkaline media. Subsequently, these electrodes were ranked with respect to their activity for the redox reactions. (author)

  10. "Chemical contraction" in rubidium-bismuth melts (United States)

    Khairulin, R. A.; Abdullaev, R. N.; Stankus, S. V.


    The density and thermal expansion of liquid rubidium and rubidium-bismuth alloy containing 25.0 at % Bi were measured by the gamma-ray attenuation technique at temperatures from liquidus to 1000 K. The results of this study were compared with the data obtained by other authors. The molar volume of the Rb75Bi25 melt strongly deviates from the additivity rule for ideal solutions.

  11. Optical Properties of Chemical Bath Deposited Bismuth Fluoride (Bif ...

    African Journals Online (AJOL)

    Thin films of bismuth fluoride (Bif3) were deposited using chemical bath deposition technique from chemical baths containing solutions of bismuth nitrate (EDTA) and potassium bromide with EDTA as complexing agent in slightly acidic medium. The films were characterized using Fourier transform infrared (FTIR) ...

  12. Bismuth-silver mineralization in the Sergozerskoe gold occurrence

    Directory of Open Access Journals (Sweden)

    Kalinin A. A.


    Full Text Available Bismuth-silver mineralization attendant to gold mineralization in the Sergozerskoe gold occurrence has been studied in detail. Bi-Ag mineralization is connected with diorite porphyry dykes, which cut volcanic-sedimentary Lopian complexes of the Strel'ninsky greenstone belt – hornblendite and actinolite-chlorite amphibolites, biotite and bi-micaceous gneisses. Distribution of Bi-Ag mineralization similar to gold mineralization is controlled by 80 m thick zone of silicification. Bi minerals are found in brecciated diorite porphyry. Bismuth-silver mineralization includes native metals (bismuth, electrum, silver, tellurides (hedleyite, hessite, selenides (ikunolite, sulfides and sulfosalts of Bi and Ag (matildite, lillianite, eckerite, jalpaite, prustite, acanthite, a few undiagnosed minerals. All Bi and Ag minerals associate with galena. Composition of mineralization evolved from early to late stages of development, depending on intensity of rock alteration. The earliest Bi-Ag minerals were native bismuth and hedleyite formed dissemination in galena, and electrum with 30-45 mass.% Au. Later native bismuth was partly substituted by silver and bismuth sulfosalts and bismuth sulfides. The latest minerals were low-temperature silver sulfides eckerite, jalpaite, and acanthite, which were noted only in the most intensively altered rocks. As soon as the process of formation of Bi-Ag mineralization is the same as formation of gold, findings of bismuth-silver mineralization can serve as a positive exploration sign for gold in the region.

  13. Effectiveness of ranitidine bismuth citrate and proton pump inhibitor ...

    African Journals Online (AJOL)

    Effectiveness of ranitidine bismuth citrate and proton pump inhibitor based triple therapies of Helicobacter pylori in Turkey. ... Results: When we look at the eradication rates of the treatment groups, only two groups (ranitidine bismuth citrate and rabeprazole groups) had eradication rates greater than 80%, both at intention to ...

  14. Heat capacity, enthalpy and entropy of bismuth niobate and bismuth tantalate

    Czech Academy of Sciences Publication Activity Database

    Hampl, M.; Strejc, A.; Sedmidubský, D.; Růžička, K.; Hejtmánek, Jiří; Leitner, J.


    Roč. 179, - (2006), s. 77-80 ISSN 0022-4596 Institutional research plan: CEZ:AV0Z10100521 Keywords : heat capacity * heat of formation * heat content * bismuth perovskite Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.107, year: 2006

  15. Bismuth-Based Quadruple Therapy with Bismuth Subcitrate, Metronidazole, Tetracycline and Omeprazole in the Eradication of Helicobacter pylori

    Directory of Open Access Journals (Sweden)

    Raymond Lahaie


    Full Text Available BACKGROUND: A previous study showed that 14 days of qid bismuth-based triple therapy with tetracycline 500 mg, metronidazole 250 mg and colloidal bismuth subcitrate 120 mg resulted in excellent Helicobacter pylori eradication rates (89.5%. The present study looked at a shorter treatment period by adding omeprazole and by reducing the dose of tetracycline.

  16. An evaluated neutronic data file for bismuth

    International Nuclear Information System (INIS)

    Guenther, P.T.; Lawson, R.D.; Meadows, J.W.; Smith, A.B.; Smith, D.L.; Sugimoto, M.; Howerton, R.J.


    A comprehensive evaluated neutronic data file for bismuth, extending from 10 -5 eV to 20.0 MeV, is described. The experimental database, the application of the theoretical models, and the evaluation rationale are outlined. Attention is given to uncertainty specification, and comparisons are made with the prior ENDF/B-V evaluation. The corresponding numerical file, in ENDF/B-VI format, has been transmitted to the National Nuclear Data Center, Brookhaven National Laboratory. 106 refs., 10 figs., 6 tabs

  17. An evaluated neutronic data file for bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Guenther, P.T.; Lawson, R.D.; Meadows, J.W.; Smith, A.B.; Smith, D.L.; Sugimoto, M. (Argonne National Lab., IL (USA)); Howerton, R.J. (Lawrence Livermore National Lab., CA (USA))


    A comprehensive evaluated neutronic data file for bismuth, extending from 10{sup {minus}5} eV to 20.0 MeV, is described. The experimental database, the application of the theoretical models, and the evaluation rationale are outlined. Attention is given to uncertainty specification, and comparisons are made with the prior ENDF/B-V evaluation. The corresponding numerical file, in ENDF/B-VI format, has been transmitted to the National Nuclear Data Center, Brookhaven National Laboratory. 106 refs., 10 figs., 6 tabs.

  18. Quantum oscillations of conductivity in bismuth wires

    International Nuclear Information System (INIS)

    Condrea, Elena


    Measurements of the resistance of bismuth nanowires with several diameters and different quality reveal oscillations on the dependence of resistance under uniaxial strain at T = 4.2 K. Amplitude of oscillations is significant (38 %) at helium temperature and becomes smearing at T = 77 K. Observed oscillations originate from quantum size effect. A simple evaluation of period of oscillations allows us to identify the groups of carriers involved in transport. Calculated periods of 42.2 and 25.9 nm satisfy approximately the ratio 2:1 for two experimentally observed sets of oscillations from light and heavy electrons.

  19. Optical Properties of Bismuth Tellurite Based Glass (United States)

    Oo, Hooi Ming; Mohamed-Kamari, Halimah; Wan-Yusoff, Wan Mohd Daud


    A series of binary tellurite based glasses (Bi2O3)x (TeO2)100−x was prepared by melt quenching method. The density, molar volume and refractive index increase when bismuth ions Bi3+ increase, this is due to the increased polarization of the ions Bi3+ and the enhanced formation of non-bridging oxygen (NBO). The Fourier transform infrared spectroscopy (FTIR) results show the bonding of the glass sample and the optical band gap, Eopt decreases while the refractive index increases when the ion Bi3+ content increases. PMID:22605999

  20. Optical Properties of Bismuth Tellurite Based Glass

    Directory of Open Access Journals (Sweden)

    Hooi Ming Oo


    Full Text Available A series of binary tellurite based glasses (Bi2O3x (TeO2100−x was prepared by melt quenching method. The density, molar volume and refractive index increase when bismuth ions Bi3+ increase, this is due to the increased polarization of the ions Bi3+ and the enhanced formation of non-bridging oxygen (NBO. The Fourier transform infrared spectroscopy (FTIR results show the bonding of the glass sample and the optical band gap, Eopt decreases while the refractive index increases when the ion Bi3+ content increases.

  1. 46 CFR 196.15-55 - Requirements for fuel oil. (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Requirements for fuel oil. 196.15-55 Section 196.15-55... Test, Drills, and Inspections § 196.15-55 Requirements for fuel oil. (a) It shall be the duty of the chief engineer to cause an entry in the log to be made of each supply of fuel oil received on board...

  2. Development of lead-bismuth coolant technology for nuclear device

    International Nuclear Information System (INIS)

    Kamata, Kin-ya; Kitano, Teruaki; Ono, Mikinori


    Liquid lead-bismuth is a promising material as a future fast reactor coolant or an intensive neutron source material for accelerator driven transmutation system (ADS). To develop nuclear plants and their installations using lead-bismuth coolant for practical use, both coolant technologies, inhabitation process of steels and quality control of coolant, and total operation system for liquid lead-bismuth plants are required. Based on the experience of liquid metal coolant, Mitsui Engineering and Shipbuilding Co., Ltd. (MES) has completed the liquid lead-bismuth forced circulation loop and has acquired various engineering data on main components including economizer. As a result of tis operation, MES has developed key technologies of lead-bismuth coolant such as controlling of oxygen content in lead-bismuth and a purification of lead-bismuth coolant. MES participated in the national project, ''The Development of Accelerator Driven Transmutation System'', together with JAERI (Japan Atomic Energy Research Institute) and started corrosion test for beam window of ADS. (author)

  3. Study of point defects in bismuth

    International Nuclear Information System (INIS)

    Bois, P.


    Single crystalline samples of bismuth, pure and n or p - doped by adding tellurium or tin, were electron irradiated at low temperature (4.2 K and 20 K). In the energy range 0.7 - 2.5 MeV, a displacement threshold energy of 13 eV and an athermal recombination volume of 150 atomic volumes were determined. Joint measurements of resistivity, magnetotransport and positron annihilation enabled to precised the nature of the annealing stages: 40-50 K, free migration of interstitials; 90-120 K long range migration of vacancy. Point defects have according to their nature a different effect on the electronic properties of bismuth: isolated Frenkel pairs are globally donnors with a charge of + 0.16 e- and the vacancy is donnor, which seems to attribute to it a negative formation volume. A simple model with non-deformating bands is no longer sufficient to explain the behaviour under irradiation: one has to take into account an acceptor level with a charge of - 0,27 e-, linked to the cascade-type defects and resonating with the valence band. It's position in the band overlap and it's width (8 meV) could be precised. In first approximation this coupling with less mobile carriers does not affect the simple additive rule which exists for relaxation times. Some yet obscure magnetic properties seem to be linked to this defect level [fr

  4. Determining the background levels of bismuth in tissues of wild game birds: a first step in addressing the environmental consequences of using bismuth shotshells

    International Nuclear Information System (INIS)

    Jayasinghe, R.; Tsuji, L.J.S.; Gough, W.A.; Karagatzides, J.D.; Perera, D.; Nieboer, E.


    Bismuth shotshells have been approved as a 'nontoxic' alternative to lead in North America. Approval was based on a limited number of studies; even background levels of bismuth in wildfowl were unknown. We report on the concentration of bismuth (and lead) in muscle and liver tissues of wildfowl (Anas platyrhynchos, Anas acuta, Anas crecca, Branta canadensis, Chen caerulescens) harvested with lead shotshell. Average liver-bismuth levels detected in the present study (e.g., teal, 0.05 μg/g dw; mallard, 0.09 μg/g dw) suggest analytical error in other studies examining the effects of bismuth in birds. Significant positive relationships between bismuth- and lead-tissue levels for muscle when all species were combined (and for B. canadensis and C. caerulescens separately) can be explained by noting that bismuth is a contaminant of lead. Thus, more research is recommended to confirm the appropriateness of bismuth as a 'nontoxic' shot alternative

  5. 32 CFR 196.305 - Preference in admission. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Preference in admission. 196.305 Section 196.305 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED... applicants for admission, on the basis of attendance at any educational institution or other school or entity...

  6. 32 CFR 196.435 - Employment assistance to students. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Employment assistance to students. 196.435... Prohibited § 196.435 Employment assistance to students. (a) Assistance by recipient in making available... available to any of its students: (1) Shall assure itself that such employment is made available without...

  7. 46 CFR 196.37-13 - Fire extinguishing system controls. (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Fire extinguishing system controls. 196.37-13 Section... VESSELS OPERATIONS Markings for Fire and Emergency Equipment, etc. § 196.37-13 Fire extinguishing system controls. (a) The control cabinets or spaces containing valves or manifolds for the various fire...

  8. 16 CFR 1.96 - Compromise of penalty. (United States)


    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Compromise of penalty. 1.96 Section 1.96 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE GENERAL... may compromise any penalty or proposed penalty at any time, with leave of court when necessary, taking...

  9. Grain boundary effects on the mechanical properties of bismuth nanostructures

    Energy Technology Data Exchange (ETDEWEB)

    Burek, Michael J.; Jin, Sumin; Leung, Michael C.; Jahed, Zeinab; Wu, Janet [Waterloo Institute for Nanotechnology, University of Waterloo, 200 University Avenue West, Waterloo, ON, N2L 3G1 (Canada); Budiman, Arief Suriadi [Center for Integrated Nanotechnologies, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Tamura, Nobumichi; Kunz, Martin [Advanced Light Source, Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, CA 94720 (United States); Tsui, Ting Y., E-mail: [Waterloo Institute for Nanotechnology, University of Waterloo, 200 University Avenue West, Waterloo, ON, N2L 3G1 (Canada)


    Cylindrical bismuth nanopillars with diameters between 130 and 1100 nm were fabricated by electron beam lithography and electroplating. The microstructure of the electrodeposited bismuth was established to be polycrystalline with a wide distribution of grains from {approx}0.1 to 1 {mu}m in size. A clear transition in the mechanism governing the plastic deformation of bismuth nanopillars is observed as the nanopillar size becomes comparable with the average grain size of 280 nm. In larger nanopillar specimens, where the average grain size is much smaller than the nanopillar diameter, deformation is dominated by grain boundary-mediated mechanisms. When the bismuth nanopillar diameter approaches the average grain size the deformation behavior transitions to a mechanism dominated by dislocation dynamics. This transition is identified by post-compression scanning electron microscopy, strain rate sensitivity, and average flow stresses.

  10. Studies on bismuth carboxylates—synthesis and characterization of ...

    Indian Academy of Sciences (India)

    synthesis and characterization of a new structural form of bismuth(III) dipicolinate ... Synthesis and X-ray structure of a new bismuth dipicolinate cooordination polymer, {[Bi((2,6-O2C)2C5H3N)((2-HO2C-6-O2C)C5H3N)(H2O)]2.5H2O} (7) are ...

  11. Synthesis, structural and property studies of bismuth containing perovskites


    Chen, Wei-tin


    Several bismuth-containing transition metal perovskites that are of interest as potential multiferroic materials have been synthesised and studied. These materials have been structurally characterised and their physical properties have been examined at varying temperatures and pressures. The new series of substituted bismuth ferrite perovskites BixCa1-xFeO3, where x = 0.4 - 1.0, has been prepared. A disordered cubic phase (x = 0.4 - 0.67) and the coexistence of rhombohedral ...

  12. Synthesis and characterization of superconducting bismuthates

    International Nuclear Information System (INIS)

    Tang, Horngyi.


    A new electrosynthetic technique for low-temperature crystal growth of superconducting bismuthates was developed, and its utility demonstrated by growing various high-quality BiO 3 crystals. The crystals of Ba 1-x K x BiO 3 and Ba 1-x Rb x BiO 3 display their T c onset at 31.8k and 28k, respectively, using SQUID magnetometry. The structure of a KBiO 3 x H 2 O single crystal determined by single crystal x-ray diffraction confirms previous results from powder samples that it is isostructural with KSbO 3 . The crystals of Ba 1-x Cs x BiO 3 do not show superconductivity to 4k. Chemical vapor-transport experiments leading to the fabrication of MoS 2 /WSe 2 junctions were also performed and are described in detail

  13. Aggregation and hydrolysis reactions of bismuth alkoxides

    International Nuclear Information System (INIS)

    Whitmire, K.H.; Jones, C.M.; Burkart, M.D.; Hutchinson, J.C.; McKnight, A.L.


    This paper reports that new bismuth alkoxide and oxo-alkoxide complexes have been prepared from the salt metathesis reaction of NaOR with BiCl 3 . When R = CH(CF 3 ) 2 , the product is [Bi(μ-OR)(OR) 2 (THF)] 2 . similar work with R = C 6 F 5 has not yielded a simple alkoxide, but complexes of formulation NaBi 3 (μ 3 -O)(OR) 8 (THF), NaBi 4 (μ 3 -O) 2 (OR) 9 (THF) 2 , Na 2 Bi 4 (μ 3 -O) 2 (OR) 10 and Bi 6 (μ 3 -OR)(μ 3 -O) 4 [μ 3 -OBI(OR) 4 ] 3 have been observed. The reaction of BiPh 3 with HOC 6 F 5 , however, did produce the desired alkoxide which has been characterized as [Bi(OR) 2 (μ-OR)(toluene)] 2 and [Bi(OR) 2 (μ-OR)(toluene)] 2 · 2 toluene. The reaction of this alkoxide with NaOC 6 F 5 led to the production of Bi 6 (μ 3 -O) 2 (μ 4 -O)(OR) 12 and NaBi 3 (μ 3 -O)(OR) 8 (THF) 3 . Reaction of BiPh 3 with HOC 6 F 5 in THF led to the formation of Bi 6 (μ 3 -OR)(μ 3 -O) 4 [μ 3 -OBi(OR) 4 ] 3 (THF) 2 . Surprisingly the reaction of BiEt 3 and HOR (R = C 6 F 5 or Ph) displaced only one Et group to give [Et 2 Bi(μ-OR)] oo which exist as infinite chain polymers with alternating Bi-O-Bi backbones. These spiral chains form chiral helices in the crystal lattice. The discovery of high T C superconducting copper oxide phases containing bismuth, lead and thallium has led to this investigation

  14. In situ electron beam irradiated rapid growth of bismuth nanoparticles in bismuth-based glass dielectrics at room temperature

    International Nuclear Information System (INIS)

    Singh, Shiv Prakash; Karmakar, Basudeb


    In this study, in situ control growth of bismuth nanoparticles (Bi 0 NPs) was demonstrated in bismuth-based glass dielectrics under an electron beam (EB) irradiation at room temperature. The effects of EB irradiation were investigated in situ using transmission electron microscopy (TEM), selected-area electron diffraction and high-resolution transmission electron microscopy. The EB irradiation for 2–8 min enhanced the construction of bismuth nanoparticles with a rhombohedral structure and diameter of 4–9 nm. The average particle size was found to increase with the irradiation time. Bismuth metal has a melting point of 271 °C and this low melting temperature makes easy the progress of energy induced structural changes during in situ TEM observations. This is a very useful technique in nano-patterning for integrated optics and other applications.

  15. Bismuth(III) volatilization and immobilization by filamentous fungus Aspergillus clavatus during aerobic incubation. (United States)

    Boriová, Katarína; Urík, Martin; Bujdoš, Marek; Matúš, Peter


    As with many metals, bismuth can be accumulated or transformed by microorganisms. These interactions affect microbial consortia and bismuth environmental behaviour, mobility, and toxicity. Recent research focused specifically on bismuth anaerobic transformation by bacteria and archaea has inspired the evaluation of the mutual interactions between bismuth and filamentous fungi as presented in this article. The Aspergillus clavatus fungus proved resistant to adverse effects from bismuth contamination in culture medium with up to a concentration of 195 µmol L(-1) during static 15- and 30-day cultivation. The examined resistance mechanism includes biosorption to the fungal surface and biovolatilization. Pelletized fungal biomass has shown high affinity for dissolved bismuth(III). Bismuth biosorption was rapid, reaching equilibrium after 50 min with a 0.35 mmol g(-1) maximum sorption capacity as calculated from the Langmuir isotherm. A. clavatus accumulated ≤70 µmol g(-1) of bismuth after 30 days. Preceding isotherm study implications that most accumulated bismuth binds to cell wall suggests that biosorption is the main detoxification mechanism. Accumulated bismuth was also partly volatilized (≤1 µmol) or sequestrated in the cytosol or vacuoles. Concurrently, ≤1.6 µmol of bismuth remaining in solution was precipitated by fungal activity. These observations indicate that complex mutual interactions between bismuth and filamentous fungi are environmentally significant regarding bismuth mobility and transformation.

  16. Use of Russian technology of ship reactors with lead-bismuth coolant in nuclear power

    International Nuclear Information System (INIS)

    Zrodnikov, A.V.; Chitaykin, V.I.; Gromov, B.F.; Grigoryv, O.G.; Dedoul, A.V.; Toshinsky, G.I.; Dragunov, Yu.G.; Stepanov, V.S.


    The experience of using lead-bismuth coolant in Russian nuclear submarine reactors has been presented. The fundamental statements of the concept of using the reactors cooled by lead-bismuth alloy in nuclear power have been substantiated. The results of developments for using lead bismuth coolant in nuclear power have been presented. (author)

  17. Prognostic Value of Bismuth Typing and Modified T-stage in Hilar Cholangiocarcinoma

    Directory of Open Access Journals (Sweden)

    Shengen Yi


    Conclusion: The majority of our patients with HCC were characterized as Subtype IV in Bismuth typing and Stage T3 in modified T-stage. Both Bismuth typing and modified T-stage showed prognostic value in HCC. Compared with Bismuth typing, modified T-stage is a better indicator of the resectability of HCC.

  18. 75 FR 34360 - Listing of Color Additives Exempt From Certification; Bismuth Citrate; Confirmation of Effective... (United States)


    .... FDA-2008-C-0098] Listing of Color Additives Exempt From Certification; Bismuth Citrate; Confirmation... final rule amended the color additive regulations by increasing the permitted use level of bismuth... permitted use level of bismuth citrate as a color additive in cosmetics intended for coloring hair on the...

  19. 40 CFR 471.10 - Applicability; description of the lead-tin-bismuth forming subcategory. (United States)


    ...-tin-bismuth forming subcategory. 471.10 Section 471.10 Protection of Environment ENVIRONMENTAL... POINT SOURCE CATEGORY Lead-Tin-Bismuth Forming Subcategory § 471.10 Applicability; description of the lead-tin-bismuth forming subcategory. This subpart applies to discharges of pollutants to waters of the...

  20. 75 FR 14491 - Listing of Color Additives Exempt From Certification; Bismuth Citrate (United States)


    .... FDA-2008-C-0098] Listing of Color Additives Exempt From Certification; Bismuth Citrate AGENCY: Food... amending the color additive regulations to increase the permitted use level of bismuth citrate as a color..., Alexandria, VA 22314. The petition proposed to amend the color additive regulations in Sec. 73.2110 Bismuth...

  1. Bismuth X-ray absorber studies for TES microcalorimeters

    Energy Technology Data Exchange (ETDEWEB)

    Sadleir, J.E. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States) and University of Illinois Physics Department, Urbana, IL 61801 (United States)]. E-mail:; Bandler, S.R. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Brekosky, R.P. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Chervenak, J. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Figueroa-Feliciano, E. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Finkbeiner, F. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Iyomoto, N. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Kelley, R.L. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Kilbourne, C.A. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); King, J.M. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Porter, F.S. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Robinson, I.K. [University of Illinois Physics Department, Urbana, IL 61801 (United States); Saab, T. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Talley, D.J. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States)


    Bismuth's large atomic number and low carrier density makes it an attractive X-ray absorber material for microcalorimeters. Bismuth's long Fermi wavelength and long mean free paths have motivated much interest in the fabrication of high quality bismuth films to study quantum size effects. Despite such incentives, fabrication of high quality bismuth films has proven difficult, and measured properties of such films are highly variable in the literature. Implementing a bismuth deposition process for TES (superconducting Transition Edge Sensor) device fabrication presents additional challenges particularly at interfaces due to the inherent granularity and surface roughness of its films, its low melting point, and its tendency to diffuse and form undesired intermetallic phases. We report observations of Bi-Cu and Bi-Au diffusion in our devices correlating with large shifts in T{sub c} (superconducting transition temperature). Using SEM and in situ R vs T annealing experiments we have been able to study these diffusion processes and identify their activation temperatures.

  2. Controlled synthesis of bismuth oxyiodide toward optimization of photocatalytic performance

    International Nuclear Information System (INIS)

    Liao, Chenxing; Ma, Zhijun; Chen, Xiaofeng; He, Xin; Qiu, Jianrong


    Highlights: • Different bismuth oxyiodide was synthesized. • The hollow Bi 4 O 5 I 2 microspheres was obtained. • Formation mechanism of the hollow structure was discussed in detail. - Abstract: A new investigation on the variation rule of the structure, morphology, chemical composition and photocatalytic performance of bismuth oxyiodide synthesized by solvothermal method as a function of reaction conditions was performed here. The composition and morphology of the product could be determined by X-ray diffraction, thermogravimetric analysis and scanning electron microscopy. The results revealed that the particle size together with content of iodide in bismuth oxyiodide decrease with the increase of the concentration of reaction precursors. Hollow Bi 4 O 5 I 2 microsphere with specific surface area as high as 120.88 m 2 g −1 can be easily synthesized when the concentration of the reaction precursors finally increased to 62.5 mM. Photocatalytic water purification performance of the as-prepared samples was evaluated by using Rhodamine B (RhB) as a model contaminant. The results revealed that the hollow Bi 4 O 5 I 2 exhibited the best performance among all the bismuth oxyodide synthesized here for the degradation of RhB under visible light irradiation. Meanwhile, the formation mechanism of the hierarchical hollow structure of bismuth oxyiodide was investigated by the dissolution-recrystallization mechanism.

  3. Laser Spectroscopy of Neutron Rich Bismuth Isotopes

    CERN Multimedia


    %IS344 :\\\\ \\\\ The aim of the experiment is to measure the optical isotope shifts and hyperfine structures of bismuth isotopes across the N=126 shell closure in order to extract the change in mean square charge radii ($\\delta\\langle r^{2}\\rangle$) and static moments. These include the first isotones of lead to be measured directly above the shell closure and will provide new information on the systematics of the kink ($\\delta\\langle r^{2}\\rangle)$ seen in the lead isotopic chain. After two very successful runs the programme has been extended to include the neutron deficient isotopes below $^{201}$Bi to study the systematics across the $i_{13/2}$ neutron sub-shell closure at N=118.\\\\ \\\\ During the initial 2 runs (9 shifts) the isotope shifts and hyperfine structures of three new isotopes, $ ^{210,212,213}$Bi and the 9$^{-}$ isomer of $^{210}$Bi have been measured. The accuracy of the previous measurements of $^{205,206,208}$Bi have been greatly improved. The samples of $ ^{208,210,210^{m}}$Bi were prepared by c...

  4. Oxygen holes and hybridization in the bismuthates (United States)

    Khazraie, Arash; Foyevtsova, Kateryna; Elfimov, Ilya; Sawatzky, George A.


    Motivated by the recently renewed interest in the superconducting bismuth perovskites, we investigate the electronic structure of the parent compounds A BiO3 (A = Sr, Ba) using ab initio methods and tight-binding (TB) modeling. We use the density functional theory (DFT) in the local density approximation (LDA) to understand the role of various interactions in shaping the A BiO3 band structure near the Fermi level. It is established that interatomic hybridization involving Bi-6 s and O-2 p orbitals plays the most important role. Based on our DFT calculations, we derive a minimal TB model and demonstrate that it can describe the properties of the band structure as a function of lattice distortions, such as the opening of a charge gap with the onset of the breathing distortion and the associated condensation of holes onto a1 g-symmetric molecular orbitals formed by the O-2 pσ orbitals on collapsed octahedra. We also derive a single band model involving the hopping of an extended molecular orbital involving both Bi-6 s and a linear combination of six O-2 p orbitals which provides a very good description of the dispersion and band gaps of the low energy scale bands straddling the chemical potential.

  5. Microstructure and electrical properties of bismuth and bismuth oxide deposited by magnetron sputtering UBM

    International Nuclear Information System (INIS)

    Otalora B, D. M.; Dussan, A.; Olaya F, J. J.


    In this work, bismuth (Bi) and bismuth oxide (Bi 2 O 3 ) thin films were prepared, at room temperature, by Sputtering Unbalanced Magnetron (UBM - Unbalance Magnetron) technique under glass substrates. Microstructural and electrical properties of the samples were studied by X-ray diffraction (XRD) and System for Measuring Physical Properties - PPMS (Physical Property Measurement System). Dark resistivity of the material was measured for a temperature range between 100 and 400 K. From the XRD measurements it was observed a polycrystalline character of the Bi associated to the presence of phases above the main peak, 2θ = 26.42 grades and a growth governed by a rhombohedral structure. Crystal parameters were obtained for both compounds, Bi and Bi 2 O 3 . From the analysis of the spectra of the conductivity as a function of temperature, it was established that the transport mechanism that governs the region of high temperature (T>300 K) is thermally activated carriers. From conductivity measurements the activation energies were obtained of 0.0094 eV and 0.015 eV for Bi 2 O 3 and Bi, respectively. (Author)

  6. Photoreductive generation of amorphous bismuth nanoparticles using polysaccharides--bismuth-cellulose nanocomposites. (United States)

    Breitwieser, Doris; Kriechbaum, Margit; Ehmann, Heike M A; Monkowius, Uwe; Coseri, Sergiu; Sacarescu, Liviu; Spirk, Stefan


    A simple and highly reproducible synthesis of amorphous bismuth nanoparticles incorporated into a polysaccharide matrix using a photoreduction process is presented. As precursor for the generation of the Bi nanoparticles, organosoluble triphenylbismuth is used. The precursor is dissolved in toluene and mixed with a hydrophobic organosoluble polysaccharide, namely trimethylsilyl cellulose (TMSC) with high DSSi. The solution is subjected to UV exposure, which induces the homolytic cleavage of the bismuth-carbon bond in BiPh3 resulting in the formation of Bi(0) and phenyl radicals. The aggregation of the Bi atoms can be controlled in the TMSC matrix and yields nanoparticles of around 20 nm size as proven by TEM. The phenyl radicals undergo recombination to form small organic molecules like benzene and biphenyl, which can be removed from the nanocomposite after lyophilization and exposure to high vacuum. Finally, the TMSC matrix is converted to cellulose after exposure to HCl vapors, which remove the trimethylsilyl groups from the TMSC derivative. Although TMSC is converted to cellulose, the formed TMS-OH is not leaving the nanocomposite but reacts instead with surface oxide layer of the Bi nanoparticles to form silylated Bi nanoparticles as proven by TEM/EDX. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. Characterization of bismuth nanospheres deposited by plasma focus device

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, M., E-mail: [IBA Laboratory, Chemistry Department, Atomic Energy Commission of Syria, P.O. Box 6091, Damascus (Syrian Arab Republic); Al-Hawat, Sh.; Akel, M. [Physics Department, Atomic Energy Commission of Syria, P.O. Box 6091, Damascus (Syrian Arab Republic); Mrad, O. [Chemistry Department, Atomic Energy Commission of Syria, P.O. Box 6091, Damascus (Syrian Arab Republic)


    A new method for producing thin layer of bismuth nanospheres based on the use of low energy plasma focus device is demonstrated. Various techniques such as scanning electron microscopy, Rutherford backscattering spectroscopy, X-ray diffraction, X-ray photoelectron spectroscopy, and Raman spectroscopy have been used to characterize the morphology and the composition of the nanospheres. Experimental parameters may be adjusted to favour the formation of bismuth nanospheres instead of microspheres. Therefore, the formation of large surface of homogeneous layer of bismuth nanospheres with sizes of below 100 nm can be obtained. The natural snowball phenomenon is observed to be reproduced in nanoscale where spheres roll over the small nanospheres and grow up to bigger sizes that can reach micro dimensions. The comet-like structure, a reverse phenomenon to snowball is also observed.

  8. Inexpensive laser-induced surface modification in bismuth thin films

    Energy Technology Data Exchange (ETDEWEB)

    Contreras, A. Reyes [Facultad de Ciencias, Universidad Autónoma del Estado de México, Carretera Toluca, Ixtlahuaca Kilómetro 15.5, C.P. 50200 Edo. de México (Mexico); Hautefeuille, M., E-mail: [Facultad de Ciencias, Universidad Nacional Autónoma de México, Avenida Universidad 3000, Circuito Exterior S/N, Coyoacán, Ciudad Universitaria, C.P. 04510 D.F. Mexico (Mexico); García, A. Esparza [Fotofísica y Películas Delgadas, Departamento de Tecnociencias, CCADET-UNAM, Circuito exterior s/n C.P. 04510 Cd. Universitaria, D.F. Mexico (Mexico); Mejia, O. Olea [Centro Conjunto de Investigación en Química Sustentable UAEM-UNAM, Carretera Toluca-Atlacomulco, Km 14.5, Unidad El Rosedal, 50200 San Cayetano, Estado de México (Mexico); López, M.A. Camacho [Facultad de Química, Universidad Autónoma del Estado de México, Tollocan s/n, esq. Paseo Colón, Toluca, Estado de México 50110 (Mexico)


    Highlights: • Laser-induced microbumps were formed on bismuth films using a simple, low-cost, laser setup. • The patterns, similar to those typically obtained with high-power lasers, were characterized. • Control of laser ablation conditions is critical in the fabrication of surface microbumps. - Abstract: In this work, we present results on texturing a 500 nm thick bismuth film, deposited by sputtering onto a glass slide using a low-cost homemade, near-infrared pulsed laser platform. A 785 nm laser diode of a CD–DVD pickup head was precisely focused on the sample mounted on a motorized two-axis translation stage to generate localized surface microbumps on the bismuth films. This simple method successfully transferred desired micropatterns on the films in a computer-numerical control fashion. Irradiated zones were characterized by atomic force microscopy and scanning electron microscopy. It was observed that final results are strongly dependent on irradiation parameters.

  9. Melting and solidification of bismuth inclusions in aluminium

    DEFF Research Database (Denmark)

    Thoft, N.B.; Bohr, J.; Buras, B.


    Supercooling of crystalline bismuth inclusions in aluminium crystals has been observed and studied with different techniques: x-ray diffraction, in situ Rutherford backscattering/channelling spectrometry and transmission electron microscopy. The results of the measurements with different experime......Supercooling of crystalline bismuth inclusions in aluminium crystals has been observed and studied with different techniques: x-ray diffraction, in situ Rutherford backscattering/channelling spectrometry and transmission electron microscopy. The results of the measurements with different...... experimental methods (and on different samples) agree remarkably well. The inclusions melt at temperatures at or below the bismuth bulk melting point, and the solid/liquid phase transition exhibits a hysteresis of 100-150 K. Average inclusion sizes ranged from a few nm to some tens of nm. The x-ray diffraction...

  10. Seedless Growth of Bismuth Nanowire Array via Vacuum Thermal Evaporation (United States)

    Liu, Mingzhao; Nam, Chang-Yong; Zhang, Lihua


    Here a seedless and template-free technique is demonstrated to scalably grow bismuth nanowires, through thermal evaporation in high vacuum at RT. Conventionally reserved for the fabrication of metal thin films, thermal evaporation deposits bismuth into an array of vertical single crystalline nanowires over a flat thin film of vanadium held at RT, which is freshly deposited by magnetron sputtering or thermal evaporation. By controlling the temperature of the growth substrate the length and width of the nanowires can be tuned over a wide range. Responsible for this novel technique is a previously unknown nanowire growth mechanism that roots in the mild porosity of the vanadium thin film. Infiltrated into the vanadium pores, the bismuth domains (~ 1 nm) carry excessive surface energy that suppresses their melting point and continuously expels them out of the vanadium matrix to form nanowires. This discovery demonstrates the feasibility of scalable vapor phase synthesis of high purity nanomaterials without using any catalysts. PMID:26709727

  11. Bismuth distribution in InSb/Bi epitaxial layers

    International Nuclear Information System (INIS)

    Lantsov, A.F.; Akchurin, R.Kh.; Zinov'ev, V.G.


    Bismuth distribution in epitaxial layers of InSb/Bi, prepared by liquid-phase epitaxy (LPE) on InSb sublayers, is studied. The solution-melt, crystallization is carried out from the compositions corresponded to the cross sections InSb-Bi, InSb-InBi and InSb-In 2 Bi of ternary system In-Sb-Bi and changed in the limits, determined by the state diagram liquidus in the temperature range from 220 to 450 deg C. The temperature dependence of the coefficients of bismuth distribution in epitaxial layers of InSb(Bi) is specified. The dependence of bismuth concentration on the composition of initial liquid phase is established [ru

  12. Bismuth onion thin film in situ grown on silicon wafer synthesized through a hydrothermal approach

    International Nuclear Information System (INIS)

    Zhao Yue; Liu Hong; Liu Jin; Hu Chenguo; Wang Jiyang


    Bismuth onion structured nanospheres with the same structure as carbon onions have been synthesized and observed. The nanospheres were synthesized through a hydrothermal method using bismuth hydroxide and silicon wafer as reactants. By controlling the heating temperature, heating time, and the pressure, nanoscale bismuth spheres can be in situ synthesized on silicon wafer, and forms a bismuth onion film on the substrate. The electronic property of the films was investigated. A formation mechanism of the formation of bismuth onions and the onion film has been proposed on the basis of experimental observations.

  13. Optical properties of bismuth-doped silica fibres in the temperature range 300 — 1500 K

    International Nuclear Information System (INIS)

    Dvoretskii, D A; Bufetov, Igor' A; Vel'miskin, V V; Zlenko, Alexander S; Khopin, V F; Semjonov, S L; Guryanov, Aleksei N; Denisov, L K; Dianov, Evgenii M


    The visible and near-IR absorption and luminescence bands of bismuth-doped silica and germanosilicate fibres have been measured for the first time as a function of temperature. The temperature-dependent IR luminescence lifetime of a bismuth-related active centre associated with silicon in the germanosilicate fibre has been determined. The Bi 3+ profile across the silica fibre preform is shown to differ markedly from the distribution of IR-emitting bismuth centres associated with silicon. The present results strongly suggest that the IR-emitting bismuth centre comprises a lowvalence bismuth ion and an oxygen-deficient glass network defect. (optical fibres, lasers and amplifiers. properties and applications)

  14. Microscopic and voltammetric properties of lustrous bismuth deposits


    Krolicka, Agnieszka; Bobrowski, Andrzej; Pamuła, Elżbieta


    A comparison of lustrous bismuth films, plated at glassy carbon, platinum and gold supports, is presented. The voltammetric performance of preplated bismuth film electrodes was tested using 50 μg/L In(III) and 50 μg/L Pb(II) solutions in 0.1 M acetic buffer in square wave and differential pulse modes. The influence of support material, plating solution concentration and storing conditions on the voltammetric response of BiFEs is discussed. The results of microscopic examination...

  15. Influence of bismuth loading in polystyrene-based plastic scintillators for low energy gamma spectroscopy

    International Nuclear Information System (INIS)

    Bertrand, G.H.V.; Sguerra, F.; Dehe-Pittance, C.; Carrel, F.; Coulon, R.; Normand, S.; Barat, E.; Dautremer, T.; Montagu, T.; Hamel, M.


    This article presents the synthesis and the blend of bismuth complexes in polystyrene based plastic scintillators. A specific design has enabled the fabrication of a scintillator loaded with up to 17 wt% of bismuth. Tri-carboxylate and tri-aryl bismuth compounds were used to explore and understand the influence of bismuth loading on the two main criteria of plastic scintillation: light yield and detection efficiency of γ-rays. For gamma radiation with an energy ≤200 keV, bismuth loaded scintillators demonstrate the ability to produce a photoelectric peak (total absorption peak) in pulse height spectra. The increase of interactions due to bismuth doping was quantified and fitted with standard models. Finally the performance of our bismuth loaded scintillators was evaluated to be better than that of a commercial lead loaded counterpart. (authors)

  16. Bismuth centred magnetic perovskite: A projected multiferroic

    International Nuclear Information System (INIS)

    Kundu, Asish K.; Seikh, Md. Motin; Nautiyal, Pranjal


    In recent time substantial attention has been initiated to understand the physics behind multiferroism and to design new multiferroic materials. BiMnO 3 and BiFeO 3 are the well-studied Bi-centred multiferroic oxides. BiMnO 3 is a ferromagnetic–ferroelectric (metastable) phase and require drastic conditions to synthesize. However, lanthanum substituted BiMnO 3 phases stabilized at ambient pressure. It is thus of major importance to increase the number of ferromagnetic perovskites with Bi cations that could be designed under ambient conditions. In this article, we have presented an up to date report of investigations on Bi-centred magnetic perovskites, a prospective material for multiferroic application. Central focus is concentrated on La 0.5 Bi 0.5 MnO 3 perovskite with various substitutions at different levels. A few of these perovskites are found to be of practical importance e.g. La 0.5 Bi 0.5 Mn 0.67 Co 0.33 O 3 with high dielectric permittivity coupled with ferromagnetism. A comprehensive analysis of different physical functionalities and their interrelation for a wide range of compositions of these Bi-centred perovskites is presented. It has been found that the complex magnetic behaviour originates from mixed valence metal ions. The ferroelectricity is associated with the 6s 2 lone pair of Bi 3+ cations. The magnetic ground state influences the dielectric properties reflecting the multiferroism in a single material. - Highlights: • Multiferroics have attracted increasing attention due to their possible device applications. • Bismuth centred magnetic perovskite is one kind of such promising multiferroic materials. • Ferromagnetic Bi-perovskites, which are synthesized at ambient conditions, have been discussed

  17. Temperature gradient compatibility tests of some refractory metals and alloys in bismuth and bismuth--lithium solutions

    International Nuclear Information System (INIS)

    DiStefano, J.R.; Cavin, O.B.


    Quartz, T-111, and Mo thermal-convection loop tests were conducted at temperatures up to 700 0 C (100 0 C ΔT) to determine the compatibility of several refractory metals/alloys with bismuth and bismuth-lithium solutions for molten salt breeder reactor applications. Methods of evaluation included weight change measurements, metallographic examination, chemical and electron microprobe analysis, and mechanical properties tests. Molybdenum, T-111, and TA--10 percent W appear to be the most promising containment materials, while niobium and iron-based alloys are unacceptable

  18. Combined Elevation of microRNA-196a and microRNA-196b in Sera Predicts Unfavorable Prognosis in Patients with Osteosarcomas

    Directory of Open Access Journals (Sweden)

    Chun Zhang


    Full Text Available Aim: To investigate whether the aberrant expression of microRNA (miR-196a and miR-196b can be used as potential prognostic markers of human osteosarcoma. Methods: Quantitative real-time reverse transcriptase-polymerase chain reaction (qRT-PCR analysis was performed to detect the expression levels of miR-196a and miR-196b in osteosarcoma tissues and patients’ sera. Results: Expression levels of miR-196a and miR-196b in osteosarcoma tissues were both significantly higher than those in noncancerous bone tissues (both p < 0.001, in line with which, the serum levels of the two miRNAs were also markedly upregulated in patients with osteosarcomas compared with healthy controls (both p < 0.001. Then, the elevation of serum miR-196a and miR-196b levels both more frequently occurred in osteosarcoma patients with high tumor grade (p = 0.008 and 0.01, respectively, positive metastasis (p = 0.001 and 0.006, respectively and recurrence (p = 0.001 and 0.006, respectively. Moreover, high serum miR-196a, high serum miR-196b and conjoined expression of miR-196a/miR-196b were all independent prognostic factors for OS (overall survival and DFS (disease-free survival of osteosarcoma patients. Conclusion: Our present data indicate the involvement of miR-196a and miR-196b upregulation in the pathogenesis of osteosarcoma. More importantly, the altered levels of circulating miR-196a and miR-196b might have great potential to serve as novel and non-invasive prognostic factors for this malignancy.

  19. Acalabrutinib (ACP-196): a selective second-generation BTK inhibitor. (United States)

    Wu, Jingjing; Zhang, Mingzhi; Liu, Delong


    More and more targeted agents become available for B cell malignancies with increasing precision and potency. The first-in-class Bruton's tyrosine kinase (BTK) inhibitor, ibrutinib, has been in clinical use for the treatment of chronic lymphocytic leukemia, mantle cell lymphoma, and Waldenstrom's macroglobulinemia. More selective BTK inhibitors (ACP-196, ONO/GS-4059, BGB-3111, CC-292) are being explored. Acalabrutinib (ACP-196) is a novel irreversible second-generation BTK inhibitor that was shown to be more potent and selective than ibrutinib. This review summarized the preclinical research and clinical data of acalabrutinib.

  20. Acalabrutinib (ACP-196: a selective second-generation BTK inhibitor

    Directory of Open Access Journals (Sweden)

    Jingjing Wu


    Full Text Available Abstract More and more targeted agents become available for B cell malignancies with increasing precision and potency. The first-in-class Bruton’s tyrosine kinase (BTK inhibitor, ibrutinib, has been in clinical use for the treatment of chronic lymphocytic leukemia, mantle cell lymphoma, and Waldenstrom’s macroglobulinemia. More selective BTK inhibitors (ACP-196, ONO/GS-4059, BGB-3111, CC-292 are being explored. Acalabrutinib (ACP-196 is a novel irreversible second-generation BTK inhibitor that was shown to be more potent and selective than ibrutinib. This review summarized the preclinical research and clinical data of acalabrutinib.

  1. 78 FR 2657 - Foreign-Trade Zone 196-Fort Worth, TX, Foreign-Trade Subzone 196A-TTI, Inc.; Application for... (United States)


    ... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [S-2-2013] Foreign-Trade Zone 196--Fort Worth, TX, Foreign-Trade Subzone 196A--TTI, Inc.; Application for Additional Subzone Site An application has been submitted to the Foreign-Trade Zones Board (the Board) by Alliance Corridor, Inc., grantee of FTZ 196...

  2. Phase transition of bismuth telluride thin films grown by MBE

    DEFF Research Database (Denmark)

    Fülöp, Attila; Song, Yuxin; Charpentier, Sophie


    A previously unreported phase transition between Bi2Te3 and Bi4Te3 in bismuth telluride grown by molecular beam epitaxy is recorded via XRD, AFM, and SIMS observations. This transition is found to be related to the Te/Bi beam equivalent pressure (BEP) ratio. BEP ratios below 17 favor the formation...

  3. Ultrafast electron diffraction studies of optically excited thin bismuth films

    International Nuclear Information System (INIS)

    Rajkovic, Ivan


    This thesis contains work on the design and the realization of an experimental setup capable of providing sub-picosecond electron pulses for ultrafast electron diffraction experiments, and performing the study of ultrafast dynamics in bismuth after optical excitation using this setup. (orig.)

  4. Melting behaviour of lead and bismuth nano-particles in ...

    Indian Academy of Sciences (India)

    Melting behaviour of nanocrystalline interfaces, created by embedding lead and bismuth nanoparticles in quasicrystalline matrices, was studied. Sharply faceted and coherent interfaces can be related to sharper melting transitions, while irregularly shaped and incoherent interfaces can be directly correlated with lowering of ...

  5. A study on structural stability of bismuth titanate with lanthanum ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 40; Issue 3. A study on structural stability of bismuth titanate with lanthanum ... In addition, the enlarged region of Bi 4f, Bi 4d, Ti 2p, La 3d and O 1s of doping sample was clearly seen after deconvolution. Based on binding energy position, it can be unambiguously stated ...

  6. Tailoring the Bandgap and magnetic properties by Bismuth ...

    Indian Academy of Sciences (India)


    refined with the single phase orthorhombic Pnma symmetry along with minor amount (< 2%) of Bi2O3. (nonmagnetic) impurity .The observations suggests that the solubility of Bismuth (Bi) in Nd site is lower than 15 at. % through our sol-gel processing technique. Single phase of NBiCO and the minimal change of lattice ...

  7. Crystal structure and ionic conductivity of a new bismuth tungstate,

    Indian Academy of Sciences (India)


    43. Dedicated to Prof J Gopalakrishnan on his 62nd birthday. *For correspondence. Crystal structure and ionic conductivity of a new bismuth tungstate,. Bi3W2O10⋅5. B MUKTHA and T N GURU ROW*. Solid State and Structural Chemistry Unit, Indian Institute of Science, Bangalore 560 012 e-mail:

  8. Poisoning effect of bismuth on modification behaviour of strontium in ...

    Indian Academy of Sciences (India)

    also be added to aluminum–magnesium alloys to counteract. ∗. Author for correspondence (, the detrimental effect of sodium on hot cracking (Talbot and. Ransley 1997). Pillai and Anantharaman (1968) reported that bismuth could play a role as silicon modifier whereas ...

  9. Ultrafast electron diffraction studies of optically excited thin bismuth films

    Energy Technology Data Exchange (ETDEWEB)

    Rajkovic, Ivan


    This thesis contains work on the design and the realization of an experimental setup capable of providing sub-picosecond electron pulses for ultrafast electron diffraction experiments, and performing the study of ultrafast dynamics in bismuth after optical excitation using this setup. (orig.)

  10. Oxygen surface exchange kinetics of erbia-stabilized bismuth oxide

    NARCIS (Netherlands)

    Yoo, C.-Y.; Boukamp, Bernard A.; Bouwmeester, Henricus J.M.


    The surface oxygen exchange kinetics of bismuth oxide stabilized with 25 mol% erbia (BE25) has been studied in the temperature and pO2 ranges 773–1,023 K and 0.1– 0.95 atm, respectively, using pulse-response 18O–16O isotope exchange measurements. The results indicate that BE25 exhibits a

  11. Formic Acid Oxidation at Platinum-Bismuth Clusters

    DEFF Research Database (Denmark)

    Lovic, J. D.; Stevanovic, S. I.; Tripkovic, D. V.


    Formic acid oxidation was studied on platinum-bismuth deposits on glassy carbon (GC) substrate. The catalysts of equimolar ratio were prepared by potentiostatic deposition using chronocoulometry. Bimetallic structures obtained by two-step process, comprising deposition of Bi followed by deposition...

  12. Colloidal bismuth subcitrate in peptic ulcer--a review

    NARCIS (Netherlands)

    Tytgat, G. N.


    De-Nol (colloidal bismuth subcitrate, CBS) precipitates in an acid environment and adheres to the exudate layer covering an ulcer crater; moreover, CBS blocks pepsin activity, retards hydrogen-ion back-diffusion and stimulates prostaglandin synthesis. The average healing rate in duodenal ulcer (DU)

  13. Ultrafast electronic dynamics in laser-excited crystalline bismuth

    Directory of Open Access Journals (Sweden)

    Chekalin S.


    Full Text Available Femtosecond spectroscopy was applied to capture complex dynamics of non equilibrium electrons in bismuth. Data analysis reveals significant wavevector dependence of electron-hole and electron-phonon coupling strength along the Γ-T direction of the Brillouin zone

  14. Bismuth Ferrite for Active Control of Surface Plasmon Polariton Modes

    DEFF Research Database (Denmark)

    Babicheva, Viktoriia; Zhukovsky, Sergei; Lavrinenko, Andrei


    We propose and investigate several layouts of m etal-insulator-metal waveguide with active core which can be utilized for dynamic switching in photonic integrated circuits. The active material, bismuth ferrite (BiFeO3), is sandwiched between metal plates and changes i ts refractive index through...

  15. Phenotype-gene: 196 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 196 decreased sensitivity under influence... decreased sensitivity under influence o

  16. 196Hg and 202Hg isotopic ratios in chondrites: revisited

    International Nuclear Information System (INIS)

    Jovanovic, S.; Reed, G.W. Jr.


    Additional evidence for an isotopically anomalous Hg fraction in unequilibrated meteorites has been obtained using neutron activation to produce 196 Hg and 202 Hg followed by stepwise heating to extract the Hg. In the latest experiments Allende matrix samples released the anomalous Hg but various high-temperature inclusions did not. Nucleogenetic processes are suggested as the probable cause of the anomaly. (Auth.)

  17. 38 CFR 17.196 - Aid for hospital care. (United States)


    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Aid for hospital care. 17... to States for Care of Veterans in State Homes § 17.196 Aid for hospital care. Aid may be paid to the designated State official for hospital care furnished in a recognized State home for any veteran if: (a) The...

  18. The onset of collectivity in {sup 196}Po

    Energy Technology Data Exchange (ETDEWEB)

    Bernstein, L.A.; Cizewski, J.A.; Jin, H.Q.; Henry, R.G.; Farris, L.P. [Rutgers--the State Univ., New Brunswick, NJ (United States); Khoo, T.L.; Carpenter, M.P.; Janssens, R.V.F.; Lauritsen, T. [Argonne National Lab., IL (United States); Bearden, I.G. [Argonne National Lab., IL (United States)]|[Purdue Univ., Lafayette, IN (United States); Ye, D. [Notre Dame Univ., IN (United States)


    We have studied the in-beam {gamma}-ray spectroscopy of {sup 196}Po, which is the first Po isotope to exhibit collective vibrational structure. The onset of collective motion occurs in this isotope because of the large overlap between valence protons in h{sub 9/2} and valence neutrons in i{sub 13/2} orbitals.

  19. The onset of collectivity in sup 196 Po

    Energy Technology Data Exchange (ETDEWEB)

    Bernstein, L.A.; Cizewski, J.A.; Jin, H.Q.; Henry, R.G.; Farris, L.P. (Rutgers--the State Univ., New Brunswick, NJ (United States)); Khoo, T.L.; Carpenter, M.P.; Janssens, R.V.F.; Lauritsen, T. (Argonne National Lab., IL (United States)); Bearden, I.G. (Argonne National Lab., IL (United States) Purdue Univ., Lafayette, IN (United States)); Ye, D. (Notre Dame Univ., IN (United States))


    We have studied the in-beam {gamma}-ray spectroscopy of {sup 196}Po, which is the first Po isotope to exhibit collective vibrational structure. The onset of collective motion occurs in this isotope because of the large overlap between valence protons in h{sub 9/2} and valence neutrons in i{sub 13/2} orbitals.

  20. Rapid semi-quantitative determination of bismuth in minerals using ascending paper chromatography (1961)

    International Nuclear Information System (INIS)

    Agrinier, H.


    The bismuth is separated by a solvent made up of acetone, water, and hydrofluoric and hydrochloric acids. The bismuth is developed with dimercapto-2.5 thio-diazole-1.3.4 and ammonium sulphide. The use of this method for the detection of bismuth in minerals makes it possible to determine the metal at a concentration of 5 x 10 -6 . (author) [fr


    Wiswall, R.H.


    A process is described for removing metal selectively from liquid metal compositions. The method effects separation of flssion product metals selectively from dilute solution in fused bismuth, which contains uraniunn in solution without removal of more than 1% of the uranium. The process comprises contacting the fused bismuth with a fused salt composition consisting of sodium, potassium and lithium chlorides, adding to fused bismuth and molten salt a quantity of bismuth chloride which is stoichiometrically required to convert the flssion product metals to be removed to their chlorides which are more stable in the fused salt than in the molten metal and are, therefore, preferentially taken up in the fused salt phase.

  2. Bismuth(III) deferiprone effectively inhibits growth of Desulfovibrio desulfuricans ATCC 27774. (United States)

    Barton, Larry L; Lyle, Daniel A; Ritz, Nathaniel L; Granat, Alex S; Khurshid, Ali N; Kherbik, Nada; Hider, Robert; Lin, Henry C


    Sulfate-reducing bacteria have been implicated in inflammatory bowel diseases and ulcerative colitis in humans and there is an interest in inhibiting the growth of these sulfide-producing bacteria. This research explores the use of several chelators of bismuth to determine the most effective chelator to inhibit the growth of sulfate-reducing bacteria. For our studies, Desulfovibrio desulfuricans ATCC 27774 was grown with nitrate as the electron acceptor and chelated bismuth compounds were added to test for inhibition of growth. Varying levels of inhibition were attributed to bismuth chelated with subsalicylate or citrate but the most effective inhibition of growth by D. desulfuricans was with bismuth chelated by deferiprone, 3-hydroxy-1,2-dimethyl-4(1H)-pyridone. Growth of D. desulfuricans was inhibited by 10 μM bismuth as deferiprone:bismuth with either nitrate or sulfate respiration. Our studies indicate deferiprone:bismuth has bacteriostatic activity on D. desulfuricans because the inhibition can be reversed following exposure to 1 mM bismuth for 1 h at 32 °C. We suggest that deferiprone is an appropriate chelator for bismuth to control growth of sulfate-reducing bacteria because deferiprone is relatively nontoxic to animals, including humans, and has been used for many years to bind Fe(III) in the treatment of β-thalassemia.

  3. Bismuth uptake in the kidney as a test of absorption from the gastrointestinal tract in mice

    International Nuclear Information System (INIS)

    Renault, Henri; Rapin, J.R.; Bralet, A.-M.


    The absorption of bismuth administered per os as an insoluble salt: basic nitrate and phosphate, labeled with 206 Bi was studied. The bismuth amounts in blood and most tissues were too small to be detected. However kidneys took up a significant bismuth quantity which allowed to measure the absorption of the metal through digestive wall. Bismuth absorption from phosphate, a very insoluble salt, was much less than that which was obtained from basic nitrate; this latter is an example of partially soluble salt in the stomach [fr

  4. Nanophotonic Modulator with Bismuth Ferrite as Low-loss Switchable Material

    DEFF Research Database (Denmark)

    Babicheva, Viktoriia; Zhukovsky, Sergei; Lavrinenko, Andrei


    We propose a nanophotonic waveguide modulator with bismuth ferrite as a tunable material. Due to near-zero losses in bismuth ferrite, modulation with up to 20 dB/μm extinction ratio and 12 μm propagation length is achieved.......We propose a nanophotonic waveguide modulator with bismuth ferrite as a tunable material. Due to near-zero losses in bismuth ferrite, modulation with up to 20 dB/μm extinction ratio and 12 μm propagation length is achieved....

  5. Influence of bismuth on structural, elastic and spectroscopic properties of Nd{sup 3+} doped Zinc–Boro-Bismuthate glasses

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, Gaurav; Sontakke, Atul D.; Karmakar, P.; Biswas, K.; Balaji, S.; Saha, R.; Sen, R.; Annapurna, K., E-mail:


    The present investigation reports, influence of bismuth addition on structural, elastic and spectral properties of [(99.5−x) {4ZnO−3B_2O_3}−0.5Nd{sub 2}O{sub 3}−x Bi{sub 2}O{sub 3} where x=0, 5, 10, 20, 30, 40, 50 and 60] glasses. The measured FTIR reflectance spectra facilitated a thorough insight of methodical modifications that are arising in the glass structure from borate (build by BO{sub 3} and BO{sub 4} units) to bismuthate (BiO{sub 3} and BiO{sub 6} units) network due to the increase of bismuth content ensuing with a steady decrease in host phonon energy (ν{sub ph}). The elastic properties estimated from measured longitudinal and shear ultrasonic velocities (U{sub L} and U{sub s}) demonstrated the reduction in network rigidity of glasses on Bi{sub 2}O{sub 3} inclusion. The three phenomenological Judd–Ofelt intensity parameters (Ω{sub 2,4,6}) were obtained from recorded absorption spectra of Nd{sup 3+} ions in these glasses and have been used to predict radiative properties as a function of variation in bismuth content. The reduced host phonon energy and high optical basicity effect due to Bi{sub 2}O{sub 3} incorporation remarkably improved the Nd{sup 3+} luminescence properties such as emission intensity, quantum yield and emission cross-section. The quantum yield showed a strong increase from mere 16% in Zinc–Borate glass to almost 73% in 60 mol% Bi{sub 2}O{sub 3} containing glass. Similarly, the emission cross-section for Nd{sup 3+4}F{sub 3/2}→{sup 4}I{sub 11/2} laser transition raised from 2.43×10{sup −20} cm{sup 2} to 3.95×10{sup −20} cm{sup 2} in studied concentration suggesting a strong improvement in Nd{sup 3+} laser spectroscopic properties in Zinc–Boro-Bismuthate glass. These materials may be promising for compact solid state infrared lasers. - Highlights: • Continuous structural changes associated with reduction in host phonon energy by Bi{sub 2}O{sub 3} inclusion. • Ultrasonic velocity study revealed reduced Debye

  6. Colloidal bismuth subcitrate in non-ulcer dyspepsia.

    Directory of Open Access Journals (Sweden)

    Khanna M


    Full Text Available The effect of colloidal bismuth subcitrate (De-Nol on symptoms, Helicobacter pylori status and histological features was studied in 35 patients with non-ulcer dyspepsia. Pain (34 cases and gas bloat (18 were the predominant symptoms. H pylori was present in 26 (74.3% patients. Gastritis and duodenitis were present in 29 of 32 and 22 of 31 cases respectively in whom biopsies were available. Relief in symptoms after treatment was seen in 29 (82.8% cases. Improvement in gastritis and duodenitis was noted in 60.8% and 58.8% respectively; over 70% of H pylori positive patients cleared the organism. These changes did not correlate with the relief in symptoms. We conclude that colloidal bismuth subcitrate is effective in the short term treatment of non-ulcer dyspepsia. It also clears H pylori infection and results in improvement of histological features.

  7. Chrysanthemum-like bismuth sulfide microcrystals: Synthesis, characterization, and properties (United States)

    Jiang, Jinghui; Gao, Guanhua; Yu, Runnan; Qiu, Guanzhou; Liu, Xiaohe


    Uniform chrysanthemum-like bismuth sulfide (Bi 2S 3) microcrystals assembled from nanosheet building blocks were successfully synthesized via a convenient hydrothermal synthetic route under mild conditions in which hydrated bismuth nitrate and L-cysteine were employed to supply Bi and S source and ethylenediaminetetraacetic acid disodium salt (EDTA-Na 2) was employed as chelating agent. The influences of reaction temperatures and time on the morphologies of final products were investigated. The phase structures, morphologies, and properties of as-prepared products were investigated by X-ray diffraction, scanning electron microscopy, transmission electron microscopy, high-resolution transmission electron microscope, and photoluminescence spectra. The possible growth mechanism for the formation of chrysanthemum-like Bi 2S 3 microcrystals was discussed on the basis of the experimental results.

  8. X-ray Investigations of Liquid Bismuth-Copper Alloys (United States)

    Nzali, J. Nomssi; Hoyer, W.


    Liquid copper, bismuth, and eleven bismuth-copper alloys were investigated at temperatures above the liquidus with X-ray diffraction. The experimental procedure was adjusted to reduce the effects of evaporation. The Faber-Ziman total structure factors S(Q) feature a splitting of the first maximum and negative values for Q around 1 Å -1 in a large concentration range. The results are compared to previous neutron diffraction results by Zaiss and Steeb, to square-well potential model calculations by Gopala Rao and Satpathy and to a simple segregation model. The segregation model reproduces the features qualitatively. Partial structure factors are assessed by fitting both neutron and X-ray scattering results with reverse Monte-Carlo simulation

  9. Bismuth Telluride and Its Alloys as Materials for Thermoelectric Generation

    Directory of Open Access Journals (Sweden)

    H. Julian Goldsmid


    Full Text Available Bismuth telluride and its alloys are widely used as materials for thermoelectric refrigeration. They are also the best materials for use in thermoelectric generators when the temperature of the heat source is moderate. The dimensionless figure of merit, ZT, usually rises with temperature, as long as there is only one type of charge carrier. Eventually, though, minority carrier conduction becomes significant and ZT decreases above a certain temperature. There is also the possibility of chemical decomposition due to the vaporization of tellurium. Here we discuss the likely temperature dependence of the thermoelectric parameters and the means by which the composition may be optimized for applications above room temperature. The results of these theoretical predictions are compared with the observed properties of bismuth telluride-based thermoelements at elevated temperatures. Compositional changes are suggested for materials that are destined for generator modules.

  10. Quantum nernst effect in a bismuth single crystal

    International Nuclear Information System (INIS)

    Matsuo, M.; Endo, A.; Hatano, N.; Nakamura, H.; Shirasaki, R.; Sugihara, K.


    We calculate the phonon-drag contribution to the transverse (Nernst) thermoelectric power S yx in a bismuth single crystal subjected to a quantizing magnetic field. The calculated heights of the Nernst peaks originating from the hole Landau levels and their temperature dependence reproduce the right order of magnitude for those of the pronounced magneto-oscillations recently reported by Behnia et al. A striking experimental finding that S yx is much larger than the longitudinal (Seebeck) thermoelectric power S xx can be naturally explained as the effect of the phonon drag, combined with the well-known relation between the longitudinal and the Hall resistivity ρ xx >> |ρ yx | in a semi-metal bismuth. The calculation that includes the contribution of both holes and electrons suggests that some of the hitherto unexplained minor peaks located roughly at the fractional filling of the hole Landau levels are attributable to the electron Landau levels. (author)

  11. Dose reduction using Bismuth protectors in chest computed tomography

    International Nuclear Information System (INIS)

    Anaya, R.


    This monography is about the Dose reduction using Bismuth protectors in chest CT. The radiation protection of specific areas is necessary when the tissues or radiosensitive organs are near the path of light beam. The correct use of protection represents a challenge for the radiologist because of the time and materials required. The method used was a prospective investigatio in CHPR (TC service) and the doses was measured with TLD dosimeters. It is important to use these protectors in children hospitals.

  12. Preparation of Bismuth- and Thallium-Based Cuprate Superconductors (United States)


    erage work period (29); early symptoms of thallium - poisoning include hair loss. Safety considerations in handling thallium compounds should include... Thallium -Based Cuprate Superconductors by S. A. Sunshine and T. A. Vanderah Chemistry Division, Research Department Naval Weapons Center, China Lake, CA...Technical Report #2 10/90-9/91 4. TITLE AND SUBTITLE 5. FUNDING NUMBERS Preparation of Bismuth- and Thallium -Based Cuprate Suoerconductors NOOO14-91 WX

  13. Modular Lead-Bismuth Fast Reactors in Nuclear Power


    Georgy Toshinsky; Vladimir Petrochenko


    On the basis of the unique experience of operating reactors with heavy liquid metal coolant–eutectic lead-bismuth alloy in nuclear submarines, the concept of modular small fast reactors SVBR-100 for civilian nuclear power has been developed and validated. The features of this innovative technology are as follows: a monoblock (integral) design of the reactor with fast neutron spectrum, which can operate using different types of fuel in various fuel cycles including MOX fuel in a self-providing...

  14. Shape-controlled solvothermal synthesis of bismuth subcarbonate nanomaterials

    International Nuclear Information System (INIS)

    Cheng Gang; Yang Hanmin; Rong Kaifeng; Lu Zhong; Yu Xianglin; Chen Rong


    Much effort has been devoted to the synthesis of novel nanostructured materials because of their unique properties and potential applications. Bismuth subcarbonate ((BiO) 2 CO 3 ) is one of commonly used antibacterial agents against Helicobacter pylori (H. pylori). Different (BiO) 2 CO 3 nanostructures such as cube-like nanoparticles, nanobars and nanoplates, were fabricated from bismuth nitrate via a simple solvothermal method. The nanostructures were characterized by powder X-ray diffraction (XRD), scanning electron microscope (SEM), transmission electron microscopy (TEM) and high-resolution transmission electron microscopy (HRTEM). It was found that the solvents and precursors have an influence on the morphologies of (BiO) 2 CO 3 nanostructures. The possible formation mechanism of different (BiO) 2 CO 3 nanostructures fabricated under different conditions was also discussed. - Graphical abstract: Different bismuth subcarbonate ((BiO) 2 CO 3 ) nanostructures were successfully synthesized by a simple solvothermal method. It was found that the solvents and precursors have an influence on the morphologies of (BiO) 2 CO 3 nanostructures.

  15. Bismuth Oxysulfide and Its Polymer Nanocomposites for Efficient Purification

    Directory of Open Access Journals (Sweden)

    Yidong Luo


    Full Text Available The danger of toxic organic pollutants in both aquatic and air environments calls for high-efficiency purification material. Herein, layered bismuth copper oxychalcogenides, BiCuSO, nanosheets of high photocatalytic activity were introduced to the PVDF (Polyvinylidene Fluoride. The fibrous membranes provide an easy, efficient, and recyclable way to purify organic pollutant. The physical and photophysical properties of the BiCuSO and its polymer composite were characterized by scanning electron microscopy (SEM, X-ray diffraction (XRD, ultraviolet-visible diffuse reflection spectroscopy (DRS, X-ray photoelectron spectroscopy (XPS, electron spin resonance (EPR. Photocatalysis of Congo Red reveals that the BiCuSO/PVDF shows a superior photocatalytic activity of a 55% degradation rate in 70 min at visible light. The high photocatalytic activity is attributed to the exposed active {101} facets and the triple vacant associates V B i ‴ V O • • V B i ‴ . By engineering the intrinsic defects on the surface of bismuth oxysulfide, high solar-driven photocatalytic activity can be approached. The successful fabrication of the bismuth oxysulfide and its polymer nanocomposites provides an easy and general approach for high-performance purification materials for various applications.

  16. Theoretical study of bismuth-doped cadmium telluride (United States)

    Menendez-Proupin, E.; Rios-Gonzalez, J. A.; Pena, J. L.

    Cadmium telluride heavily doped with bismuth has been proposed as an absorber with an intermediate band for solar cells. Increase in the photocurrent has been shown recently, although the overall cell efficiency has not improved. In this work, we study the electronic structure and the formation energies of the defects associated to bismuth impurities. We have performed electronic structure calculations within generalized density functional theory, using the exchange-correlation functional HSE(w) , where the range-separation parameter w has been tuned to reproduce the CdTe bandgap. Improving upon previous reports, we have included the spin-orbit interaction, which modifies the structure of the valence band and the energy levels of bismuth. We have found that interstitial Bi (Bii) tends to occupy Cd vacancies, cadmium substitution (BiCd) creates single donor level, while tellurium substitution (BiTe) is a shallow single acceptor. We investigate the interaction between these point defects and how can they be combined to create a partially filled intermediate band. Supported by FONDECYT Grant 1130437, CONACYT-SENER SUSTENTABILIDAD ENERGETICA/project CeMIE-Sol PY-207450/25 and PY-207450/26. JARG acknowledges CONACYT fellowship for research visit. Powered@NLHPC (ECM-02).

  17. Superconductivity in the high-pressure phase of bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Philip A.C.; Semeniuk, Konstantin; Grosche, F. Malte [Department of Physics, Cavendish Laboratory, University of Cambridge (United Kingdom)


    At pressures above 27 kbar, elemental bismuth adopts a highly unusual incommensurate host-guest structure. This structure combines two distinct, interpenetrating crystal lattices and consequently lacks discrete translational symmetry. Although similar high pressure structures have been observed in other elements, their electronic properties have not been investigated in detail. The moderate pressure required to induce the host-guest phase in bismuth presents a favourable opportunity for comprehensive electrical transport studies. The high-pressure host-guest phase of bismuth, termed Bi-III, is known to be superconducting with a transition temperature of around 7 K, but the details of its superconducting and normal state properties are comparatively little explored. We report resistivity and magnetisation measurements in the Bi-III phase in fields up to 9 T and temperatures down to 120 mK. We find evidence for a strikingly high critical field and an unusual temperature dependence of the resistivity above the superconducting transition. We discuss our findings in the context of theoretical descriptions of host-guest materials.

  18. Soluble Lead and Bismuth Chalcogenidometallates: Versatile Solders for Thermoelectric Materials

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Hao [Department; Son, Jae Sung [Department; School; Dolzhnikov, Dmitriy S. [Department; Filatov, Alexander S. [Department; Hazarika, Abhijit [Department; Wang, Yuanyuan [Department; Hudson, Margaret H. [Department; Sun, Cheng-Jun [Advanced; Chattopadhyay, Soma [Physical; Talapin, Dmitri V. [Department; Center


    Here we report the syntheses of largely unexplored lead and bismuth chalcogenidometallates in the solution phase. Using N2H4 as the solvent, new compounds such as K6Pb3Te6·7N2H4 were obtained. These soluble molecular compounds underwent cation exchange processes using resin chemistry, replacing Na+ or K+ by decomposable N2H5+ or tetraethylammonium cations. They also transformed into stoichiometric lead and bismuth chalcogenide nanomaterials with the addition of metal salts. Such a versatile chemistry led to a variety of composition-matched solders to join lead and bismuth chalcogenides and tune their charge transport properties at the grain boundaries. Solution-processed thin films composed of Bi0.5Sb1.5Te3 microparticles soldered by (N2H5)6Bi0.5Sb1.5Te6 exhibited thermoelectric power factors (~28 μW/cm K2) comparable to those in vacuum-deposited Bi0.5Sb1.5Te3 films. The soldering effect can also be integrated with attractive fabrication techniques for thermoelectric modules, such as screen printing, suggesting the potential of these solders in the rational design of printable and moldable thermoelectrics.

  19. Study of barium bismuth titanate prepared by mechanochemical synthesis

    Directory of Open Access Journals (Sweden)

    Lazarević Z.Ž.


    Full Text Available Barium-bismuth titanate, BaBi4Ti4O15 (BBT, a member of Aurivillius bismuth-based layer-structure perovskites, was prepared from stoichiometric amounts of barium titanate and bismuth titanate obtained via mechanochemical synthesis. Mechanochemical synthesis was performed in air atmosphere in a planetary ball mill. The reaction mechanism of BaBi4Ti4O15 and the preparation and characteristics of BBT ceramic powders were studied using XRD, Raman spectroscopy, particle analysis and SEM. The Bi-layered perovskite structure of BaBi4Ti4O15 ceramic forms at 1100 °C for 4 h without a pre-calcination step. The microstructure of BaBi4Ti4O15 exhibits plate-like grains typical for the Bi-layered structured material and spherical and polygonal grains. The Ba2+ addition leads to changes in the microstructure development, particularly in the change of the average grain size.

  20. Atomic Layer Deposition of Bismuth Vanadates for Solar Energy Materials. (United States)

    Stefik, Morgan


    The fabrication of porous nanocomposites is key to the advancement of energy conversion and storage devices that interface with electrolytes. Bismuth vanadate, BiVO4 , is a promising oxide for solar water splitting where the controlled fabrication of BiVO4 layers within porous, conducting scaffolds has remained a challenge. Here, the atomic layer deposition of bismuth vanadates is reported from BiPh3 , vanadium(V) oxytriisopropoxide, and water. The resulting films have tunable stoichiometry and may be crystallized to form the photoactive scheelite structure of BiVO4 . A selective etching process was used with vanadium-rich depositions to enable the synthesis of phase-pure BiVO4 after spinodal decomposition. BiVO4 thin films were measured for photoelectrochemical performance under AM 1.5 illumination. The average photocurrents were 1.17 mA cm(-2) at 1.23 V versus the reversible hydrogen electrode using a hole-scavenging sulfite electrolyte. The capability to deposit conformal bismuth vanadates will enable a new generation of nanocomposite architectures for solar water splitting. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Octupole vibration in the superdeformed {sup 196}Pb nucleus; Vibration octupolaire dans le noyau superdeforme {sup 196}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Bouneau, S.; Azaiez, F.; Duprat, J. [Experimental Research Division, Inst. de Physique Nucleaire, Paris-11 Univ., 91 - Orsay (France)] [and others


    The study of the superdeformed (SD) {sup 196}Pb nucleus has been revisited using the EUROGAM phase 2 spectrometer. All the three observed excited SD bands were found to decay to the Yrast SD band through, presumably, E1 transitions, allowing relative spin and excited energy assignments. Comparisons with calculation using the random phase approximation suggests that all three excited bands can be interpreted as octupole vibrational structures. (authors) 5 refs., 1 fig.

  2. Study on corrosion test techniques in lead bismuth eutectic flow. Joint research report in JFY2002

    International Nuclear Information System (INIS)

    Takahashi, Minoru; Sekimoto, Hiroshi


    The evaluation of corrosion behaviors of core and structural materials in lead bismuth eutectic is one of the key issues for the utilization of lead bismuth eutectic as a coolant of the primary loops of lead bismuth cooled fast breeder reactors (FBRs) and the intermediate heat transport media of new-type steam generators of the sodium cooled FBRs. The purpose of the present study is to establish corrosion test techniques in lead bismuth eutectic flow. The techniques of steel corrosion test and oxygen control in flowing lead bismuth eutectic, and the technologies of a lead bismuth flow test at high temperature and high velocity were developed through corrosion test using a lead bismuth flow test loop of the Tokyo Institute of Technology in JFY2002. The major results are summarized as follows: (1) Techniques of fabrication, mount and rinse of corrosion specimens, measurement method of weight loss, and SEM/EDX analysis method have been established through lead bismuth corrosion test. (2) Weight losses were measured, corrosion and lead bismuth-adhered layers and eroded parts were observed in two 1000 hr-corrosion tests, and the results were compared with each other for twelve existing steels including ODS, F82H and SUH-3. (3) An oxygen sensor made of zirconia electrolyte structurally resistant to thermal stress and thermal shock was developed and tested in the lead bismuth flow loop. Good performance has been obtained. (4) An oxygen control method by injecting argon and hydrogen mixture gas containing steam into lead bismuth was applied to the lead bismuth flow loop, and technical issues for the development of the oxygen control method were extracted. (5) Technical measures for freezing and leakage of lead bismuth in the flow loop were accumulated. (6) Technical measures for flow rate decrease/blockage due to precipitation of oxide and corrosion products in a low temperature section of the lead bismuth flow loop were accumulated. (7) Electromagnetic flow meters with MI

  3. A guide to the influence of bismuth on lead/acid battery performance (United States)

    Koop, M. J.; Rand, D. A. J.; Culpin, B.

    A review is given of the literature that deals with the influence of bismuth on the microstructure, oxygen/hydrogen evolution kinetics and anodic corrosion of lead and lead alloys with regard to their performance in lead/acid batteries. Analysis shows that there is considerable disagreement as to the effect of bismuth on lead microstructure. For example, the various investigators report an increase, a decrease, or negligible change in grain size. In general, it is concluded that the oxygen overpotential on PbO 2 is lowered in the presence of bismuth. The effect is enhanced as the bismuth content is increased. It is postulated that the behaviour results from the formation of a mixed oxide, PbO 2·BiO x. By contrast, cathodic hydrogen evolution is reported widely to be largely unaffected by bismuth. Nevertheless, there is evidence that the reaction is particularly sensitive to the surface characteristics of electrodes and that these features can induce either a suppression or an enhancement of the hydrogen-gassing rate. Many studies have shown that bismuth accelerates the anodic corrosion of lead alloys, especially at high concentrations of bismuth. At 0.1 wt.% bismuth and below, the effect on the corrosion rate is negligible. The authors of this discussion are of the opinion that much of the conflicting evidence in the areas reported is caused by spurious differences in grain structure that are introduced by variations in sample preparation, rather than by the action of bismuth itself. In battery-related tests, bismuth has usually been found to exert little influence on performance, but there is some suggestion that cycle life is increased. The present body of knowledge is insufficient to confirm the correctness of any currently specified maximum level for bismuth with respect to a given battery design.

  4. 27 CFR 44.196a - To a foreign-trade zone. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false To a foreign-trade zone. 44.196a Section 44.196a Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Shipment § 44.196a To a foreign-trade zone. Where tobacco products, and cigarette papers and tubes are...

  5. 28 CFR 0.196 - Procedures for resolving disagreements concerning mail or case assignments. (United States)


    ... concerning mail or case assignments. 0.196 Section 0.196 Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION OF THE DEPARTMENT OF JUSTICE Jurisdictional Disagreements § 0.196 Procedures for resolving... assigned, the disagreement, together with a statement of the view of the unit or units involved, shall be...

  6. Efficient enhancement of bismuth NIR luminescence by aluminum and its mechanism in bismuth doped germanate laser glass

    DEFF Research Database (Denmark)

    Wang, L.P.; Tan, L.L.; Yue, Yuanzheng


    As a new member of laser glass family, bismuth-doped glasses have received rising interests due to the application of fiber amplifiers and laser sources in the new spectral range for the next-generation optical communication system. For practical application of the glasses, it must be considered ......+ are not completely randomly distributed inside germanate glass and they prefer the residence around tetrahedral AlO4 sites....

  7. Properties of lead-bismuth coolant and perspectives of non-electric applications of lead-bismuth reactor

    International Nuclear Information System (INIS)

    Martynov, P.N.; Ivanov, K.D.


    Key physical and chemical properties of lead-bismuth eutectic alloy are reviewed. Based on the low chemical activity of the alloy to other work media, a new concept of direct contact heat exchangers is proposed. A series of experiments were performed to validate the concept, using water, model salt solutions of sodium chloride, and oil. Key experimental results are summarized in the report. (author)

  8. Bismuth Propellant Feed System Development at NASA-MSFC (United States)

    Polzin, Kurt A.


    NASA-MSFC has been developing liquid metal propellant feed systems capable of delivering molten bismuth at a prescribed mass flow rate to the vaporizer of an electric thruster. The first such system was delivered to NASA-JPL as part of the Very High Isp Thruster with Anode Layer (VHITAL) program. In this system, the components pictured were placed in a vacuum chamber and heated while the control electronics were located outside the chamber. The system was successfully operated at JPL in conjunction with a propellant vaporizer, and data was obtained demonstrating a new liquid bismuth flow sensing technique developed at MSFC. The present effort is aimed at producing a feed-system for use in conjunction with a bismuth-fed Hall thruster developed by Busek Co. Developing this system is more ambitious, however, in that it is designed to self-contain all the control electronics inside the same vacuum chamber as an operating bismuth-fed thruster. Consequently, the entire system, including an on-board computer, DC-output power supplies, and a gas-pressurization electro-pneumatic regulator, must be designed to survive a vacuum environment and shielded to keep bismuth plasma from intruding on the electronics and causing a shortcircuit. In addition, the hot portions of the feed system must be thermally isolated from the electronics to avoid failure due to high heat loads. This is accomplished using a thermal protection system (TPS) consisting of multiple layers of aluminum foil. The only penetrations into the vacuum chamber are an electrically isolated (floating) 48 VDC line and a fiberoptic line. The 48 VDC provides power for operation of the power supplies and electronics co-located with the system in the vacuum chamber. The fiberoptic Ethernet connection is used to communicate user-input control commands to the on-board computer and transmit real-time data back to the external computer. The partially assembled second-generation system is shown. Before testing at Busek, a

  9. Independent regulation of vertebral number and vertebral identity by microRNA-196 paralogs. (United States)

    Wong, Siew Fen Lisa; Agarwal, Vikram; Mansfield, Jennifer H; Denans, Nicolas; Schwartz, Matthew G; Prosser, Haydn M; Pourquié, Olivier; Bartel, David P; Tabin, Clifford J; McGlinn, Edwina


    The Hox genes play a central role in patterning the embryonic anterior-to-posterior axis. An important function of Hox activity in vertebrates is the specification of different vertebral morphologies, with an additional role in axis elongation emerging. The miR-196 family of microRNAs (miRNAs) are predicted to extensively target Hox 3' UTRs, although the full extent to which miR-196 regulates Hox expression dynamics and influences mammalian development remains to be elucidated. Here we used an extensive allelic series of mouse knockouts to show that the miR-196 family of miRNAs is essential both for properly patterning vertebral identity at different axial levels and for modulating the total number of vertebrae. All three miR-196 paralogs, 196a1, 196a2, and 196b, act redundantly to pattern the midthoracic region, whereas 196a2 and 196b have an additive role in controlling the number of rib-bearing vertebra and positioning of the sacrum. Independent of this, 196a1, 196a2, and 196b act redundantly to constrain total vertebral number. Loss of miR-196 leads to a collective up-regulation of numerous trunk Hox target genes with a concomitant delay in activation of caudal Hox genes, which are proposed to signal the end of axis extension. Additionally, we identified altered molecular signatures associated with the Wnt, Fgf, and Notch/segmentation pathways and demonstrate that miR-196 has the potential to regulate Wnt activity by multiple mechanisms. By feeding into, and thereby integrating, multiple genetic networks controlling vertebral number and identity, miR-196 is a critical player defining axial formulae.

  10. Selective oxidation of propylene to acrolein by silica-supported bismuth molybdate catalysts

    DEFF Research Database (Denmark)

    Duc, Duc Truong; Ha, Hanh Nguyen; Fehrmann, Rasmus


    Silica-supported bismuth molybdate catalysts have been prepared by impregnation, structurally characterized and examined as improved catalysts for the selective oxidation of propylene to acrolein. Catalysts with a wide range of loadings (from 10 to 90 wt%) of beta bismuth molybdate (β-Bi2Mo2O9...

  11. A first principle study on electronic property of bismuth nano tubes

    International Nuclear Information System (INIS)

    Su Changrong; Li Jiaming


    A first principle molecular dynamics with density functional theory and ultra-soft pseudopotential has been performed on the bismuth nano tubes. The strain energies are found to follow the classical 1/R 2 strain law. The bismuth nano tubes are expected as semi-conductor with the band gaps around 0.7-0.8 eV

  12. Effect of O-vacancies on magnetic properties of bismuth ferrite nanoparticles by solution evaporation method

    International Nuclear Information System (INIS)

    Afzal, A.M.; Umair, M.; Dastgeer, G.; Rizwan, M.; Yaqoob, M.Z.; Rashid, R.; Munir, H.S.


    Bismuth ferrite is a multiferroic material which shows high magnetization and polarization at room temperature. In present work, the effect of Oxygen (O) vacancies on magnetic properties of bismuth ferrite nanoparticles is studied. Bismuth ferrite nanoparticles (BiFeO 3 ) were synthesized by solution evaporation method (SEM) at room temperature. The sample was annealed under two different atmospheres such as in air and oxygen, to check the effect of O-vacancies on magnetic properties. The average crystallite size of Bismuth ferrite nanoparticles (NPs) as calculated by X-ray diffraction (XRD) falls in the range of 23–32 nm and 26–39 nm for the case of air and oxygen respectively. The crystallite size of bismuth ferrite nanoparticles increases as the temperature was varied from 450 °C to 650 °C. Further the influence of annealing temperature on the magnetic properties of the bismuth ferrite nanoparticles was also observed. It was concluded that the magnetic properties of Bismuth ferrite nanoparticles are directly interconnected to annealing atmosphere and annealing temperature. The magnetic properties were increased in the case of oxygen annealing, which actually leads in our case to an improvement of the crystallinity. - Highlights: • Bismuth ferrite was synthesized by solution evaporation method. • The effect of different annealing atmosphere on magnetic properties was studied. • The magnetic properties dramatically increased in case of Oxygen annealing. • The influence of crystalline size on magnetic properties was studied. • The magnetization was decreased as the temperature and crystallite size increased.

  13. Method of Creating Micro-scale Silver Telluride Grains Covered with Bismuth Nanoparticles (United States)

    Kim, Hyun-Jung (Inventor); Choi, Sang Hyouk (Inventor); King, Glen C. (Inventor); Park, Yeonjoon (Inventor); Lee, Kunik (Inventor)


    Provided is a method of enhancing thermoelectric performance by surrounding crystalline semiconductors with nanoparticles by contacting a bismuth telluride material with a silver salt under a substantially inert atmosphere and a temperature approximately near the silver salt decomposition temperature; and recovering a metallic bismuth decorated material comprising silver telluride crystal grains.

  14. Effects of In Vitro Antibiotic Resistance on Treatment: Bismuth-Containing Regimens

    Directory of Open Access Journals (Sweden)

    Naoki Chiba


    Full Text Available Bismuth compounds remain useful for Helicobacter pylori eradication therapy. These include colloidal bismuth subcitrate (CBS, bismuth subsalicylate (BSS and, most recently, ranitidine bismuth citrate (RBC. CBS appears to prevent the development of imidazole resistance when coadministered with nitroimidazoles. Traditional triple therapy with bismuth, metronidazole and tetracycline or amoxicillin (BMT/A only partially overcomes metronidazole resistance. However, the addition of a PPI to bismuth triple therapy largely overcomes established metronidazole resistance if treatment is given for at least one week or more. When RBC rather than PPI is used with clarithromycin, this dual regimen appears to be more effective in preventing the development of secondary clarithromycin resistance. The triple combination of RBC, metronidazole and clarithromycin appears to be effective against metronidazole resistant strains of H pylori. Thus, overall, there is some evidence that bismuth compounds may prevent the development of antibiotic resistance and that existing antibiotic resistance may at least be partially overcome in vitro and in vivo. With the growing emergence of H pylori resistance to metronidazole and clarithromycin, further research to clarify the role of bismuth compounds is required.

  15. Study of bismuth molybdenum oxidic catalysts for methanol oxidation to formaldehyde

    International Nuclear Information System (INIS)

    Khokhler, R.Ya.; Kurina, L.N.; Kudrina, N.V.


    Phase composition and catalytic properties of bismuth molybdenum oxidic system in reaction of methanol oxidation are studied at temperature of 280-350 deg. Increase of selectivity according to formaldehyde is connected with formation of MoO 3 solid solution in bismuth molybdate Bi 2 O 3 x3MoO 3

  16. Ultra-flat bismuth films for diamagnetic levitation by template-stripping

    NARCIS (Netherlands)

    Kokorian, J; Engelen, Johannes Bernardus Charles; de Vries, Jeroen; Nazeer, H.; Woldering, L.A.; Abelmann, Leon


    In this paper we present a method to deposit thin films of bismuth with sub-nanometer surface roughness for application to diamagnetic levitation. Evaporated films of bismuth have a high surface roughness with peak to peak values in excess of 100 nm and average values on the order of 20 nm. We

  17. Optical properties of bismuth-doped silica fibres in the temperature range 300 - 1500 K

    Energy Technology Data Exchange (ETDEWEB)

    Dvoretskii, D A; Bufetov, Igor' A; Vel' miskin, V V; Zlenko, Alexander S; Khopin, V F; Semjonov, S L; Guryanov, Aleksei N; Denisov, L K; Dianov, Evgenii M


    The visible and near-IR absorption and luminescence bands of bismuth-doped silica and germanosilicate fibres have been measured for the first time as a function of temperature. The temperature-dependent IR luminescence lifetime of a bismuth-related active centre associated with silicon in the germanosilicate fibre has been determined. The Bi{sup 3+} profile across the silica fibre preform is shown to differ markedly from the distribution of IR-emitting bismuth centres associated with silicon. The present results strongly suggest that the IR-emitting bismuth centre comprises a lowvalence bismuth ion and an oxygen-deficient glass network defect. (optical fibres, lasers and amplifiers. properties and applications)

  18. Electronic Properties of Tin and Bismuth from Angular Correlation of Annihilation Photons

    DEFF Research Database (Denmark)

    Mogensen, O.E.; Trumpy, Georg


    A linear slit setup has been used to obtain results of angular-correlation measurements in (a) tin single crystals in three orientations: [001], [100], and [110], (b) bismuth single crystals in four orientations: [111], [100], [1¯10], and [2¯1¯1], (c) solid and liquid tin and bismuth, and (d......) deformed bismuth. For both metals, the single-crystal angular-correlation curves lie near to the free-electron parabola. The tin curves show more anisotropy than the bismuth curves. An important result is the clear anisotropy found in the high-momentum part of the curves—the tails—for both metals. Little...... of the liquid-metal curves are smaller and of another form than the tails of polycrystalline curves; no Gaussian with only one adjustable constant factor can give a fit to both tails. No useful method for interpreting liquid-metal angular-correlation curves seems to exist. Two deformed bismuth samples gave...

  19. Bioavailability and chronic toxicity of bismuth citrate to earthworm Eisenia andrei exposed to natural sandy soil. (United States)

    Omouri, Zohra; Hawari, Jalal; Fournier, Michel; Robidoux, Pierre Yves


    The present study describes bioavailability and chronic effects of bismuth to earthworms Eisenia andrei using OECD reproduction test. Adult earthworms were exposed to natural sandy soil contaminated artificially by bismuth citrate. Average total concentrations of bismuth in soil recovered by HNO 3 digestion ranged from 75 to 289mg/kg. Results indicate that bismuth decreased significantly all reproduction parameters of Eisenia andrei at concentrations ≥ 116mg/kg. However, number of hatched cocoons and number of juveniles seem to be more sensitive than total number of cocoons, as determined by IC 50 ; i.e., 182, 123 and > 289mg/kg, respectively. Bismuth did not affect Eisenia andrei growth and survival, and had little effect on phagocytic efficiency of coelomocytes. The low immunotoxicity effect might be explained by the involvement of other mechanisms i.e. bismuth sequestered by metal-binding compounds. After 28 days of exposure bismuth concentrations in earthworms tissue increased with increasing bismuth concentrations in soil reaching a stationary state of 21.37mg/kg dry tissue for 243mg Bi/kg dry soil total content. Data indicate also that after 56 days of incubation the average fractions of bismuth available extracted by KNO 3 aqueous solution in soil without earthworms varied from 0.0051 to 0.0229mg/kg, while in soil with earthworms bismuth concentration ranged between 0.310-1.347mg/kg dry soil. We presume that mucus and chelating agents produced by earthworms and by soil or/and earthworm gut microorganisms could explain this enhancement, as well as the role of dermal and ingestion routes of earthworms uptake to soil contaminant. Copyright © 2017 Elsevier Inc. All rights reserved.

  20. 78 FR 14512 - Foreign-Trade Zone 196-Fort Worth, TX, Foreign-Trade Subzone 196A-TTI, Inc., Approval of... (United States)


    ... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [S-2-2013] Foreign-Trade Zone 196--Fort Worth, TX, Foreign-Trade Subzone 196A--TTI, Inc., Approval of Additional Subzone Site, Fort Worth, TX On January 4, 2013, the Executive Secretary of the Foreign-Trade Zones (FTZ) Board docketed an application submitted...

  1. Yttrium bismuth titanate pyrochlore mixed oxides for photocatalytic hydrogen production

    Energy Technology Data Exchange (ETDEWEB)

    Merka, Oliver


    In this work, the sol-gel synthesis of new non-stoichiometric pyrochlore titanates and their application in photocatalytic hydrogen production is reported. Visible light response is achieved by introducing bismuth on the A site or by doping the B site by transition metal cations featuring partially filled d orbitals. This work clearly focusses on atomic scale structural changes induced by the systematical introduction of non-stoichiometry in pyrochlore mixed oxides and the resulting influence on the activity in photocatalytic hydrogen production. The materials were characterized in detail regarding their optical properties and their atomic structure. The pyrochlore structure tolerates tremendous stoichiometry variations. The non-stoichiometry in A{sub 2}O{sub 3} rich compositions is compensated by distortions in the cationic sub-lattice for the smaller Y{sup 3+} cation and by evolution of a secondary phase for the larger Bi{sup 3+} cation on the A site. For TiO{sub 2} rich compositions, the non-stoichiometry leads to a special vacancy formation in the A and optionally O' sites. It is shown that pyrochlore mixed oxides in the yttrium bismuth titanate system represent very active and promising materials for photocatalytic hydrogen production, if precisely and carefully tuned. Whereas Y{sub 2}Ti{sub 2}O{sub 7} yields stable hydrogen production rates over time, the bismuth richer compounds of YBiTi{sub 2}O{sub 7} and Bi{sub 2}Ti{sub 2}O{sub 7} are found to be not stable under irradiation. This drawback is overcome by applying a special co-catalyst system consisting of a precious metal core and a Cr{sub 2}O{sub 3} shell on the photocatalysts.

  2. Cytotoxic Effect of Lipophilic Bismuth Dimercaptopropanol Nanoparticles on Epithelial Cells. (United States)

    Rene, Hernandez-Delgadillo; Badireddy, Appala Raju; José, Martínez-Sanmiguel Juan; Francisco, Contreras-Cordero Juan; Israel, Martinez-Gonzalez Gustavo; Isela, Sánchez-Nájera Rosa; Chellam, Shankararaman; Claudio, Cabral-Romero


    Bismuth nanoparticles have many interesting properties to be applied in biomedical and medicinal sectors, however their safety in humans have not been comprehensively investigated. The objective of this research was to determine the cytotoxic effect of bismuth dimercaptopropanol nanoparticles (BisBAL NPs) on epithelial cells. The nanoparticles are composed of 18.7 nm crystallites on average and have a rhombohedral structure, agglomerating into chains-like or clusters of small nanoparticles. Based on MTT viability assay and fluorescence microscopy, cytotoxicity was not observed on monkey kidney cells after growing with 5 µM of BisBAL NPs for 24 h. Employing same techniques, identical results were obtained with human epithelial cells (HeLa), showing a not strain-dependent phenomenon. The absence of toxic effects on epithelial cells growing with BisBAL NPs was corroborated with long-time experiments (24-72 hrs.), showing no difference in comparison with growing control (cells without nanoparticles). Further, genotoxicity assays, comet assay and fluorescent microscopy and electrophoresis in bromide-stained agarose gel revealed no damage to genomic DNA of MA104 cells after 24 h. of exposition to BisBAL NPs. Finally, the effect of bismuth nanoparticles on protein synthesis was studied in cells growing with BisBAL NPs for 24 h. SDS-PAGE assays showed no difference between treated and untreated cells, suggesting that BisBAL NPs did not interfere with protein synthesis. Hence BisBAL NPs do not appear to exert cytotoxic effects suggesting their biological compatibility with epithelial cells.

  3. High ionic conductivity in confined bismuth oxide-based heterostructures

    DEFF Research Database (Denmark)

    Sanna, Simone; Esposito, Vincenzo; Christensen, Mogens


    Bismuth trioxide in the cubic fluorite phase (δ-Bi2O3) exhibits the highest oxygen ionic conductivity. In this study, we were able to stabilize the pure -Bi2O3 at low temperature with no addition of stabilizer but only by engineering the interface, using highly coherent heterostructures made...... of alternative layers of δ-Bi2O3 and Yttria Stabilized Zirconia (YSZ), deposited by pulsed laser deposition. The resulting [δ-Bi2O3=YSZ] heterostructures are found to be stable over a wide temperature range (500-750 °C) and exhibits stable high ionic conductivity over a long time comparable to the value...

  4. On radiation activation of industrial bismuth-molybdenum catalyst

    International Nuclear Information System (INIS)

    Spitsyn, V.I.; Nadykto, B.T.; Mikhajlenko, I.E.; Voronin, Yu.V.; Yushin, N.I.; Firsov, V.I.; Grodinskij, I.M.; Markevich, S.V.; Novopolotskij Politekhnicheskij Inst.; AN Belorusskoj SSR, Minsk. Inst. Fiziko-Organicheskoj Khimii)


    The radiation effect on an industrial catalyst for production of nitrile of acrylic acid (NAA) under the action of gamma radiation has been studied. The activity of the bismuth-molybdenum catalyst has been studied at 455 deg C and 0.7 kg/cm 2 . It has been established that change in catalytic activity depends on the absorbed dose. The maximum yield of NAA is observed for the absorbed dose 0.1 Mrad wheveas the selectivity, constant for mean dose values, decreases with the rise of the absorbed dose

  5. MicroRNA 196B regulates FAS-mediated apoptosis in colorectal cancer cells (United States)

    Kang, In-Hong; Park, Won Cheol; Seo, Geom-Seog; Choi, Suck-Chei; Kim, Hun-Soo; Moon, Hyung-Bae; Yun, Ki-Jung; Chae, Soo-Cheon


    Using miRNA microarray analysis, we identified 31 miRNAs that were significantly up-regulated or down-regulated in colon cancer tissues. We chose MIR196B, which was specifically up-regulated in colon cancer, for further study. We identified 18 putative MIR196B target genes by comparing between the mRNAs down-regulated in MIR196B-overexpressed cells and the assumed MIR196B target genes predicted by public bioinformatics tools. The association between MIR196B and FAS was verified in this study. FAS expression was constitutively elevated in normal human colorectal tissues. However, its expression was often reduced in human colorectal cancer. The decrease in FAS expression could be responsible for the reduction of apoptosis in colorectal cancer cells. In colorectal cancer tissue, we showed that MIR196B up-regulation was mutually followed by down regulation of FAS expression. We also showed that MIR196B directly repressed FAS expression in colorectal cells. Furthermore, anti-MIR196B up-regulated FAS expression and increased apoptosis in colorectal cancer cell lines. Our results suggest that the up-regulation of MIR196B modulates apoptosis in colorectal cancer cells by partially repressing FAS expression and that anti-MIR196B could be a potential candidate as an anti-cancer drug in colorectal cancer therapy. PMID:25605245

  6. Levofloxacin, bismuth, amoxicillin and esomeprazole as second-line Helicobacter pylori therapy after failure of non-bismuth quadruple therapy. (United States)

    Song, Zhiqiang; Zhou, Liya; Zhang, Jianzhong; He, Lihua; Bai, Peng; Xue, Yan


    The best rescue therapy for Helicobacter pylori (H. pylori) infection following failure of non-bismuth quadruple therapy (NBQT) remains unanswered. To determine the efficacy, safety and compliance of levofloxacin, bismuth, amoxicillin and esomeprazole (LBAE) regimen following failure of NBQT. 132 patients with H. pylori infection refractory to first-line NBQT received LBAE regimen (levofloxacin 500mg once/day, bismuth potassium citrate 220mg twice/day, amoxicillin 1000mg twice/day and esomeprazole 20mg twice/day for 14 days). Gastric mucosal biopsy was obtained for H. pylori culture, antimicrobial sensitivity test and cytochrome P450 isoenzyme 2C19 polymorphism analysis. LBAE therapy achieved eradication rates of 73.5% [95% confidence intervals (CI) 65.9-81.1%] in intention-to-treat and 78.5% (71.1-85.9%) in per-protocol analyses in patients with high antibiotic resistance (amoxicillin 8.3%, clarithromycin 55.6%, metronidazole 73.6% and levofloxacin 36.1%). Adverse effects were found in 19.2% and compliance in 96.1% of the treated patients. Multivariate analyses identified levofloxacin resistance [odds ratio (OR) 7.183, 95% CI 1.616-31.914, P=0.010] and history of quinolone intake (4.844, 1.174-19.983, P=0.029) as independent predictors of treatment failure. The eradication rate of patients with dual amoxicillin and levofloxacin resistance was significantly decreased (33.3%, P=0.006). In populations with high levofloxacin resistance, 14-day second-line LBAE regimen resulted in an unsatisfactory efficacy in patients resistant to NBQT despite good safety and compliance. Copyright © 2016 Editrice Gastroenterologica Italiana S.r.l. Published by Elsevier Ltd. All rights reserved.

  7. Bismuth oxide aqueous colloidal nanoparticles inhibit Candida albicans growth and biofilm formation (United States)

    Hernandez-Delgadillo, Rene; Velasco-Arias, Donaji; Martinez-Sanmiguel, Juan Jose; Diaz, David; Zumeta-Dube, Inti; Arevalo-Niño, Katiushka; Cabral-Romero, Claudio


    Multiresistance among microorganisms to common antimicrobials has become one of the most significant concerns in modern medicine. Nanomaterials are a new alternative to successfully treat the multiresistant microorganisms. Nanostructured materials are used in many fields, including biological sciences and medicine. Recently, it was demonstrated that the bactericidal activity of zero-valent bismuth colloidal nanoparticles inhibited the growth of Streptococcus mutans; however the antimycotic potential of bismuth nanostructured derivatives has not yet been studied. The main objective of this investigation was to analyze the fungicidal activity of bismuth oxide nanoparticles against Candida albicans, and their antibiofilm capabilities. Our results showed that aqueous colloidal bismuth oxide nanoparticles displayed antimicrobial activity against C. albicans growth (reducing colony size by 85%) and a complete inhibition of biofilm formation. These results are better than those obtained with chlorhexidine, nystatin, and terbinafine, the most effective oral antiseptic and commercial antifungal agents. In this work, we also compared the antimycotic activities of bulk bismuth oxide and bismuth nitrate, the precursor metallic salt. These results suggest that bismuth oxide colloidal nanoparticles could be a very interesting candidate as a fungicidal agent to be incorporated into an oral antiseptic. Additionally, we determined the minimum inhibitory concentration for the synthesized aqueous colloidal Bi2O3 nanoparticles. PMID:23637533

  8. Nano-scaled top-down of bismuth chalcogenides based on electrochemical lithium intercalation

    International Nuclear Information System (INIS)

    Chen Jikun; Zhu Yingjie; Chen Nuofu; Liu Xinling; Sun Zhengliang; Huang Zhenghong; Kang Feiyu; Gao Qiuming; Jiang Jun; Chen Lidong


    A two-step method has been used to fabricate nano-particles of layer-structured bismuth chalcogenide compounds, including Bi 2 Te 3 , Bi 2 Se 3 , and Bi 2 Se 0.3 Te 2.7 , through a nano-scaled top-down route. In the first step, lithium (Li) atoms are intercalated between the van der Waals bonded quintuple layers of bismuth chalcogenide compounds by controllable electrochemical process inside self-designed lithium ion batteries. And in the second step, the Li intercalated bismuth chalcogenides are subsequently exposed to ethanol, in which process the intercalated Li atoms would explode like atom-scaled bombs to exfoliate original microscaled powder into nano-scaled particles with size around 10 nm. The influence of lithium intercalation speed and amount to three types of bismuth chalcogenide compounds are compared and the optimized intercalation conditions are explored. As to maintain the phase purity of the final nano-particle product, the intercalation lithium amount should be well controlled in Se contained bismuth chalcogenide compounds. Besides, compared with binary bismuth chalcogenide compound, lower lithium intercalation speed should be applied in ternary bismuth chalcogenide compound.

  9. Bismuth-Induced Inactivation of Ferric Uptake Regulator from Helicobacter pylori. (United States)

    He, Xiaojun; Liao, Xiangwen; Li, Hongyan; Xia, Wei; Sun, Hongzhe


    Ferric uptake regulator (Fur) of Helicobacter pylori is a global regulator that is important for bacterial colonization and survival within the gastric mucosa. H. pylori Fur (HpFur) is unique in its ability to regulate gene expression in both metal-bound (holo-Fur) and metal-free (apo-Fur) forms. Bismuth-based drugs are widely used for the treatment of H. pylori infection. However, the mechanism of action of bismuth drug was not fully understood. Recently, it has been reported that bismuth drugs could interfere with the bacterial ferric uptake pathway and inhibit bacterial growth, implying intrinsic correlation between bismuth drug and bacterial iron metabolism. Herein, we demonstrate that Bi(III) binds to HpFur protein specifically at the physiologically important S1 site, which further leads to protein oligomerization and loss of DNA binding capability. The targeting of HpFur by bismuth drugs significantly reduced transcription levels of its regulated genes, which are crucial for bacterial physiology and metabolism. Our studies present direct evidence that perturbation of iron metabolism in H. pylori by bismuth might serve as one of the mechanisms for the antimicrobial activity of bismuth drugs.

  10. Study of the redox properties of bismuth-molybdate and uranium-antimonate catalysts

    International Nuclear Information System (INIS)

    Paz-Pujalt, G.R.


    The oxidation/reduction properties of various bismuth molybdates, molybdenum trioxide, bismuth oxide, uranium antimonate, and iron antimonate have been studied in an effort to correlate them to their catalytic properties. The temperature at which γ-phase bismuth molybdate is prereduced plays an important role in the behavior the catalyst exhibits under reoxidation conditions. The overall behavior of γ-phase bismuth molybdate under catalytic conditions may be divided into two temperature regimes: below 360 0 C the catalyst shows a higher rate of propylene adsorption than product desorption, and above 360 0 C where produced desorption is dominant. This temperature is the same at which the Arrhenius plot for the reaction has a break. Several reduction of γ-bismuth molybdate results in the formation of clusters of bismuth metal and crystallites of molybdenum dioxide. This is irreversible. The reoxidation of the bismuth molybdate catalysts shows the presence of two oxygen incorporation temperatures. The ratios of the areas under these peaks are not the same for the three catalysts. Uranium antimonate shows a lesser degree of lattice oxygen participation. During several reduction the catalyst decomposes partially and an excess of antimony is evident. The isothermal reduction profiles of the catalysts permitted their classification into either of two reduction models: (A) α-, β-, γ-phase bismuth molybdates, molybdenum trioxide, bismuth oxide, and the equimolar mixture follow the nucleation model, (B) uranium antimonate, and iron antimonate following the shrinking sphere model. These models have been correlated to certain characteristics of these catalysts. Group A catalysts show a high degree of lattice oxygen participation (migration of bulk oxygen to surface nuclei). In contrast in group B catalysts only a few layers of oxygen are peeled off during catalysis

  11. Layered bismuth oxyhalide nanomaterials for highly efficient tumor photodynamic therapy (United States)

    Xu, Yu; Shi, Zhenzhi; Zhang, Ling'e.; Brown, Eric Michael Bratsolias; Wu, Aiguo


    Layered bismuth oxyhalide nanomaterials have received much more interest as promising photocatalysts because of their unique layered structures and high photocatalytic performance, which can be used as potential inorganic photosensitizers in tumor photodynamic therapy (PDT). In recent years, photocatalytic materials have been widely used in PDT and photothermal therapy (PTT) as inorganic photosensitizers. This investigation focuses on applying layered bismuth oxyhalide nanomaterials toward cancer PDT, an application that has never been reported so far. The results of our study indicate that the efficiency of UV-triggered PDT was highest when using BiOCl nanoplates followed by BiOCl nanosheets, and then TiO2. Of particular interest is the fact that layered BiOCl nanomaterials showed excellent PDT effects under low nanomaterial dose (20 μg mL-1) and low UV dose (2.2 mW cm-2 for 10 min) conditions, while TiO2 showed almost no therapeutic effect under the same parameters. BiOCl nanoplates and nanosheets have shown excellent performance and an extensive range of applications in PDT.

  12. Phase transition of solid bismuth under high pressure (United States)

    Chen, Hai-Yan; Xiang, Shi-Kai; Yan, Xiao-Zhen; Zheng, Li-Rong; Zhang, Yi; Liu, Sheng-Gang; Bi, Yan


    As a widely used pressure calibrator, the structural phase transitions of bismuth from phase I, to phase II, to phase III, and then to phase V with increasing pressure at 300 K have been widely confirmed. However, there are different structural versions for phase III, most of which are determined by x-ray diffraction (XRD) technology. Using x-ray absorption fine structure (XAFS) measurements combined with ab initio calculations, we show that the proposed incommensurate composite structure of bismuth of the three configurations is the best option. An abnormal continuous increase of the nearest-neighbor distance of phase III with elevated pressure is also observed. The electronic structure transformation from semimetal to metal is responsible for the complex behavior of structure transformation. Project supported by the National Natural Science Foundation of China (Grant Nos. 10904133, 11304294, 11274281, 11404006, and U1230201), the Development Foundation of China Academy of Engineering Physics (Grant Nos. 2015B0101004, 2013B0401062, and 2012A0101001), the Research Foundation of the Laboratory of Shock Wave and Detonation, China (Grant No. 9140C670201140C67282).

  13. Magnetic anisotropies in ultrathin bismuth iron garnet films

    International Nuclear Information System (INIS)

    Popova, Elena; Franco Galeano, Andres Felipe; Deb, Marwan; Warot-Fonrose, Bénédicte; Kachkachi, Hamid; Gendron, François; Ott, Frédéric


    Ultrathin bismuth iron garnet Bi 3 Fe 5 O 12 films were grown epitaxially on (001)-oriented gadolinium gallium garnet substrates. Film thickness varied from two to three dozens of unit cells. Bi 3 Fe 5 O 12 films grow pseudomorphically on substrates up to a thickness of 20 nm, and then a lattice relaxation occurs. Magnetic properties of the films were studied as a function of bismuth iron garnet thickness. The magnetization and cubic anisotropy decrease with decreasing film thickness. The uniaxial magnetocrystalline anisotropy is constant for all film thicknesses. For two unit cell thick films, the easy magnetization axis changes from in-plane to perpendicular to the plane direction. Such a reorientation takes place as a result of the competition of constant uniaxial perpendicular anisotropy with weakening film magnetization. - Highlights: ► Ultrathin Bi 3 Fe 5 O 12 films were grown epitaxially on structure-matching substrates. ► Magnetic properties of Bi 3 Fe 5 O 12 were studied down to the thickness of 2.5 nm. ► Reorientation of easy magnetization axis as a function of film thickness was observed

  14. Magnetic anisotropies in ultrathin bismuth iron garnet films

    Energy Technology Data Exchange (ETDEWEB)

    Popova, Elena, E-mail: [Groupe d' Etude de la Matière Condensée (GEMaC), CNRS/Université de Versailles-Saint-Quentin, 45 Avenue des Etats-Unis, 78035 Versailles (France); Franco Galeano, Andres Felipe [Laboratoire PROcédés, Matériaux et Energie Solaire (PROMES), CNRS/Université de Perpignan Via Domitia, 52 Avenue Paul Alduy, 66860 Perpignan (France); Deb, Marwan [Groupe d' Etude de la Matière Condensée (GEMaC), CNRS/Université de Versailles-Saint-Quentin, 45 Avenue des Etats-Unis, 78035 Versailles (France); Warot-Fonrose, Bénédicte [Centre d' Elaboration de Matériaux et d' Etudes Structurales (CEMES), CNRS, 29 rue Jeanne Marvig, 31055 Toulouse (France); Transpyrenean Associated Laboratory for Electron Microscopy (TALEM), CEMES-INA, CNRS–Universidad de Zaragoza (Spain); Kachkachi, Hamid [Laboratoire PROcédés, Matériaux et Energie Solaire (PROMES), CNRS/Université de Perpignan Via Domitia, 52 Avenue Paul Alduy, 66860 Perpignan (France); Gendron, François [Institut des NanoSciences de Paris (INSP), CNRS/Université Pierre et Marie Curie-Paris 6, 4 place Jussieu, Boîte courrier 840, 75252 Paris Cedex 05 (France); Ott, Frédéric [Laboratoire Léon Brillouin (LLB), CNRS/CEA, Bâtiment 563, CEA Saclay, 91191 Gif sur Yvette Cedex (France); and others


    Ultrathin bismuth iron garnet Bi{sub 3}Fe{sub 5}O{sub 12} films were grown epitaxially on (001)-oriented gadolinium gallium garnet substrates. Film thickness varied from two to three dozens of unit cells. Bi{sub 3}Fe{sub 5}O{sub 12} films grow pseudomorphically on substrates up to a thickness of 20 nm, and then a lattice relaxation occurs. Magnetic properties of the films were studied as a function of bismuth iron garnet thickness. The magnetization and cubic anisotropy decrease with decreasing film thickness. The uniaxial magnetocrystalline anisotropy is constant for all film thicknesses. For two unit cell thick films, the easy magnetization axis changes from in-plane to perpendicular to the plane direction. Such a reorientation takes place as a result of the competition of constant uniaxial perpendicular anisotropy with weakening film magnetization. - Highlights: ► Ultrathin Bi{sub 3}Fe{sub 5}O{sub 12} films were grown epitaxially on structure-matching substrates. ► Magnetic properties of Bi{sub 3}Fe{sub 5}O{sub 12} were studied down to the thickness of 2.5 nm. ► Reorientation of easy magnetization axis as a function of film thickness was observed.

  15. Superconductivity in Bismuth. A New Look at an Old Problem.

    Directory of Open Access Journals (Sweden)

    Zaahel Mata-Pinzón

    Full Text Available To investigate the relationship between atomic topology, vibrational and electronic properties and superconductivity of bismuth, a 216-atom amorphous structure (a-Bi216 was computer-generated using our undermelt-quench approach. Its pair distribution function compares well with experiment. The calculated electronic and vibrational densities of states (eDOS and vDOS, respectively show that the amorphous eDOS is about 4 times the crystalline at the Fermi energy, whereas for the vDOS the energy range of the amorphous is roughly the same as the crystalline but the shapes are quite different. A simple BCS estimate of the possible crystalline superconducting transition temperature gives an upper limit of 1.3 mK. The e-ph coupling is more preponderant in a-Bi than in crystalline bismuth (x-Bi as indicated by the λ obtained via McMillan's formula, λc = 0.24 and experiment λa = 2.46. Therefore with respect to x-Bi, superconductivity in a-Bi is enhanced by the higher values of λ and of eDOS at the Fermi energy.

  16. Angle Dependence of the Orbital Magnetoresistance in Bismuth

    Directory of Open Access Journals (Sweden)

    Aurélie Collaudin


    Full Text Available We present an extensive study of angle-dependent transverse magnetoresistance in bismuth, with a magnetic field perpendicular to the applied electric current and rotating in three distinct crystallographic planes. The observed angular oscillations are confronted with the expectations of semiclassic transport theory for a multivalley system with anisotropic mobility and the agreement allows us to quantify the components of the mobility tensor for both electrons and holes. A quadratic temperature dependence is resolved. As Hartman argued long ago, this indicates that inelastic resistivity in bismuth is dominated by carrier-carrier scattering. At low temperature and high magnetic field, the threefold symmetry of the lattice is suddenly lost. Specifically, a 2π/3 rotation of magnetic field around the trigonal axis modifies the amplitude of the magnetoresistance below a field-dependent temperature. By following the evolution of this anomaly as a function of temperature and magnetic field, we map the boundary in the (field, temperature plane separating two electronic states. In the less symmetric state, confined to low temperature and high magnetic field, the three Dirac valleys cease to be rotationally invariant. We discuss the possible origins of this spontaneous valley polarization, including a valley-nematic scenario.

  17. Electrodeposition of bismuth alloys by the controlled potential method

    International Nuclear Information System (INIS)

    Lopez Alvarez, F.A.


    We worked with the electrodeposition of three bismuth alloys, the composition of the first electrolyte was: 0.3 g/l. Bi; 20 g/l. Ni; and the conditions were pH = 5.2 - 5.6; T = 25 Centigrade degrees; current density 0.3 A / dm 2 - 6.6 A / dm 2 . Following alloy was between Bi - Pb, composition of the electrolyte was 3.18 g/l. Bi (metallic); 31.81 g/l. Pb (Pb(NO 3 ) 2 ) pH : 1; T = 20 Centigrade degrees; current density 10.20 A/dm 2 . The third electrolyte was Bi-Cu, its composition was: 20.89 g/l. Bi; (metallic) 63.54 g/l Cu (Cu(NO 3 ) 2 ) pH : 1.5 - 1.8; T = 25-30 Centigrade degrees; current density 1-2 A/dm 2 . The best results were obtained with the third electrolyte. The purpose of this work was to experiment with different parameters like temperature, pH and the electrolyte concentration to obtain a bismuth alloy. (Author)

  18. Photoconductivity in Transition Metal Doped Bismuth Germanium Oxide (United States)

    Newkirk, Nolan M.; McCullough, J. S.; Martin, J. J.


    Bismuth germanium oxide (BGO) is a photorefractive material that has potential for a number of applications. We are investigating the possibility of tailoring it for specific uses by doping with 3d-ions. . Anti-site bismuth is a native defect in melt-grown BGO. This amphoteric defect dominates the photo-response of undoped BGO and plays a role in transition metal doped samples. The majority of the 3d-ions go into the tetrahedrally bonded Ge-site; thus, Cr would be expected to be in a 4+ state. Instead, it gives up an electron to the anti-site Bi and is in a 5+ state. Strongly persistent photorefractive gratings are observed in BGO:Cr. Photoconductivity measurements were performed on undoped BGO, BGO:V, and BGO:Cr before and after the samples were exposed to 442 nm light. The photoconductivity response roughly matched the optical absorption spectra of the samples. The exposed samples showed additional photo-induced absorption bands and much stronger photocurrents in the same spectral regions. The exposure to blue light appears to convert Cr from the 5+ state to the 4+state.

  19. Bismuth nanoparticles-carbon nanotubes modified sensor for sulfasalazine analysis. (United States)

    Nigović, Biljana; Jurić, Sandra; Mitrović, Iva


    Nanocomposite of bismuth nanoparticles and carbon nanotubes in Nafion matrix was used as modifier for glassy carbon electrode in analysis of anti-inflamatory drug sulfasalazine. The nanocomposite surface exhibited exceptional synergy and remarkable enhancement effect to the voltammetric response of drug. The surface morphology and structure characterization of the modified electrodes was characterized by scanning electron microscopy, energy dispersive X-ray spectroscopy and cyclic voltammetry. The sensor exhibited excellent electroanalytical performance for drug determination in comparison with bismuth film electrode. The adsorptive stripping square-wave voltammetric signal showed a good linear correlation to sulfasalazine concentration in a broad range from 5.0×10 -8 to 1.0×10 -5 M with low detection limit of 1.3×10 -8 M.The method was successfully utilised for drug quantification in human serum samples and good recoveries were obtained without interference from endogenous substances, 5-aminosalycilic acid and sulfapyridine formed after biotransformation of drug and folic acid co-administered as the supplement during sulfasalazine therapy. Additionally, the proposed sensor was successfully applied to analysis of sulfasalazine content in gastro-resistant pharmaceutical dosage forms. Copyright © 2016 Elsevier B.V. All rights reserved.

  20. Collective excitations and low temperature transport properties of bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Chudzinski, Piotr; Giamarchi, Thierry [DPMC-MaNEP, University of Geneva (Switzerland)


    We examine the influence of collective excitations on several transport coefficients (conductivity, magneto-optical conductivity, Nernst effect) for semimetal, bismuth. A longstanding problem of the transport coefficients in this material is the fact that their amplitude and temperature dependences do not obey naive Fermi liquid expectations. For the conductivity, we show that at high temperatures Baber scattering is able to explain quantitatively the DC resistivity experiments, while at low temperatures many-body effects need to be introduced to explain qualitative deviations from the standard T{sup 2} behavior. An atypical feature in magneto-optical conductivity is predicted. The Nernst effect in bismuth was recently the subject of several contradictory theoretical studies. We show that a plasmon physics allows to get a coherent picture and leads to very large values of the Nernst signal. We use two complementary methods- Feynmann diagrams and field theory (Hubbard-Stratonovich transformation). These methods, which go beyond the standard RPA study, allow to set a limit to the validity of our model and to make contact with the other family of semimetals, 1T-TiSe{sub 2}, also subject of recent experimental interest. To complete the discussion of semimetals, we also study the case of graphite.

  1. Genotoxic effects of bismuth (III oxide nanoparticles by comet assay

    Directory of Open Access Journals (Sweden)

    Reecep Liman


    Full Text Available Bismuth oxide is one of the important transition metal oxides and it has been intensively studied due to their peculiar characteristics (semiconductor band gap, high refractive index, high dielectric permittivity, high oxygen conductivity, resistivity, photoconductivity and photoluminescence etc.. Therefore, it is used such as microelectronics, sensor technology, optical coatings, transparent ceramic glass manufacturing, nanoenergetic gas generator, biosensor for DNA hybridization, potential immobilizing platforms for glucose oxidase and polyphenol oxidase, fuel cells, a additive in paints, an astringent in a variety of medical creams and topical ointments, and for the determination of heavy metal ions in drinking water, mineral water and urine. In addition this, Bismuth (III oxide nanoparticles (BONPs are favorable for the biomolecules adsorption than regular sized particles because of their greater advantages and novel characteristics (much higher specific surface, greater surface free energy, and good electrochemical stability etc.. Genotoxic effects of BONPs were investigated on the root cells of Allium cepa by Comet assay. A. cepa roots were treated with the aqueous dispersions of BONPs at 5 different concentrations (12.5, 25, 50, 75, and 100 ppm for 4 h. A significant increase in DNA damage was also observed at all concentrations of BONPs except 12.5 ppm by Comet assay. The results were also analyzed statistically by using SPSS for Windows; Duncan’s multiple range test was performed. These result indicate that BONPs exhibit genotoxic activity in A. cepa root meristematic cells.

  2. Nonproportionality in the scintillation light yield of bismuth germanate (United States)

    Gentile, T. R.; Bales, M. J.; Breuer, H.; Chupp, T. E.; Coakley, K. J.; Cooper, R. L.; Nico, J. S.; O`Neill, B.


    We present measurements of nonproportionality in the scintillation light yield of bismuth germanate (BGO) for gamma-rays with energies between 6 keV and 662 keV. The scintillation light was read out by avalanche photodiodes (APDs) with both the BGO crystals and APDs operated at a temperature of ≈ 90 K. Data were obtained using radioisotope sources to illuminate both a single BGO crystal in a small test cryostat and a 12-element detector in a neutron radiative beta-decay experiment. In addition one datum was obtained in a 4.6 T magnetic field based on the bismuth K x-ray escape peak produced by a continuum of background gamma rays in this apparatus. These measurements and comparison to prior results were motivated by an experiment to study the radiative decay mode of the free neutron. The combination of data taken under different conditions yields a reasonably consistent picture for BGO nonproportionality that should be useful for researchers employing BGO detectors at low gamma ray energies.

  3. Bismuth Silver Oxysulfide for Photoconversion Applications: Structural and Optoelectronic Properties

    KAUST Repository

    Baqais, Amal Ali Abdulallh


    Single-phase bismuth silver oxysulfide, BiAgOS, was prepared by a hydrothermal method. Its structural, morphological and optoelectronic properties were investigated and compared with bismuth copper oxysulfide (BiCuOS). Rietveld refinement of the powder X-ray diffraction (XRD) measurements revealed that the BiAgOS and BiCuOS crystals have the same structure as ZrSiCuAs: the tetragonal space group P4/nmm. X-ray photoelectron spectroscopy (XPS) analyses confirmed that the BiAgOS has a high purity, in contrast with BiCuOS, which tends to have Cu vacancies. The Ag has a monovalent oxidation state, whereas Cu is present in the oxidation states of +1 and +2 in the BiCuOS system. Combined with experimental measurements, density functional theory calculations employing the range-separated hybrid HSE06 exchange-correlation functional with spin-orbit coupling quantitatively elucidated photophysical properties such as ab-sorption coefficients, effective masses and dielectric constants. BiCuOS and BiAgOS were found to have indirect bandgaps of 1.1 and 1.5 eV, respectively. Both possess high dielectric constants and low electron and hole effective masses. Therefore, these materials are expected to have high exciton dissociation capabilities and excellent carrier diffusion properties. This study reveals that BiAgOS is a promising candidate for photoconversion applications.

  4. Superconductivity in Bismuth. A New Look at an Old Problem (United States)


    To investigate the relationship between atomic topology, vibrational and electronic properties and superconductivity of bismuth, a 216-atom amorphous structure (a-Bi216) was computer-generated using our undermelt-quench approach. Its pair distribution function compares well with experiment. The calculated electronic and vibrational densities of states (eDOS and vDOS, respectively) show that the amorphous eDOS is about 4 times the crystalline at the Fermi energy, whereas for the vDOS the energy range of the amorphous is roughly the same as the crystalline but the shapes are quite different. A simple BCS estimate of the possible crystalline superconducting transition temperature gives an upper limit of 1.3 mK. The e-ph coupling is more preponderant in a-Bi than in crystalline bismuth (x-Bi) as indicated by the λ obtained via McMillan’s formula, λc = 0.24 and experiment λa = 2.46. Therefore with respect to x-Bi, superconductivity in a-Bi is enhanced by the higher values of λ and of eDOS at the Fermi energy. PMID:26815431

  5. Helicobacter pylori second-line rescue therapy with levofloxacin- and bismuth-containing quadruple therapy, after failure of standard triple or non-bismuth quadruple treatments. (United States)

    Gisbert, J P; Romano, M; Gravina, A G; Solís-Muñoz, P; Bermejo, F; Molina-Infante, J; Castro-Fernández, M; Ortuño, J; Lucendo, A J; Herranz, M; Modolell, I; Del Castillo, F; Gómez, J; Barrio, J; Velayos, B; Gómez, B; Domínguez, J L; Miranda, A; Martorano, M; Algaba, A; Pabón, M; Angueira, T; Fernández-Salazar, L; Federico, A; Marín, A C; McNicholl, A G


    The most commonly used second-line Helicobacter pylori eradication regimens are bismuth-containing quadruple therapy and levofloxacin-containing triple therapy, both offering suboptimal results. Combining bismuth and levofloxacin may enhance the efficacy of rescue eradication regimens. To evaluate the efficacy and tolerability of a second-line quadruple regimen containing levofloxacin and bismuth in patients whose previous H. pylori eradication treatment failed. This was a prospective multicenter study including patients in whom a standard triple therapy (PPI-clarithromycin-amoxicillin) or a non-bismuth quadruple therapy (PPI-clarithromycin-amoxicillin-metronidazole, either sequential or concomitant) had failed. Esomeprazole (40 mg b.d.), amoxicillin (1 g b.d.), levofloxacin (500 mg o.d.) and bismuth (240 mg b.d.) was prescribed for 14 days. Eradication was confirmed by (13) C-urea breath test. Compliance was determined through questioning and recovery of empty medication envelopes. Incidence of adverse effects was evaluated by questionnaires. 200 patients were included consecutively (mean age 47 years, 67% women, 13% ulcer). Previous failed therapy included: standard clarithromycin triple therapy (131 patients), sequential (32) and concomitant (37). A total of 96% took all medications correctly. Per-protocol and intention-to-treat eradication rates were 91.1% (95%CI = 87-95%) and 90% (95%CI = 86-94%). Cure rates were similar regardless of previous (failed) treatment or country of origin. Adverse effects were reported in 46% of patients, most commonly nausea (17%) and diarrhoea (16%); 3% were intense but none was serious. Fourteen-day bismuth- and levofloxacin-containing quadruple therapy is an effective (≥90% cure rate), simple and safe second-line strategy in patients whose previous standard triple or non-bismuth quadruple (sequential or concomitant) therapies have failed. © 2015 John Wiley & Sons Ltd.

  6. Solar Water Splitting and Nitrogen Fixation with Layered Bismuth Oxyhalides. (United States)

    Li, Jie; Li, Hao; Zhan, Guangming; Zhang, Lizhi


    Hydrogen and ammonia are the chemical molecules that are vital to Earth's energy, environmental, and biological processes. Hydrogen with renewable, carbon-free, and high combustion-enthalpy hallmarks lays the foundation of next-generation energy source, while ammonia furnishes the building blocks of fertilizers and proteins to sustain the lives of plants and organisms. Such merits fascinate worldwide scientists in developing viable strategies to produce hydrogen and ammonia. Currently, at the forefronts of hydrogen and ammonia syntheses are solar water splitting and nitrogen fixation, because they go beyond the high temperature and pressure requirements of methane stream reforming and Haber-Bosch reaction, respectively, as the commercialized hydrogen and ammonia production routes, and inherit the natural photosynthesis virtues that are green and sustainable and operate at room temperature and atmospheric pressure. The key to propelling such photochemical reactions lies in searching photocatalysts that enable water splitting into hydrogen and nitrogen fixation to make ammonia efficiently. Although the past 40 years have witnessed significant breakthroughs using the most widely studied TiO 2 , SrTiO 3 , (Ga 1-x Zn x )(N 1-x O x ), CdS, and g-C 3 N 4 for solar chemical synthesis, two crucial yet still unsolved issues challenge their further progress toward robust solar water splitting and nitrogen fixation, including the inefficient steering of electron transportation from the bulk to the surface and the difficulty of activating the N≡N triple bond of N 2 . This Account details our endeavors that leverage layered bismuth oxyhalides as photocatalysts for efficient solar water splitting and nitrogen fixation, with a focus on addressing the above two problems. We first demonstrate that the layered structures of bismuth oxyhalides can stimulate an internal electric field (IEF) that is capable of efficiently separating electrons and holes after their formation and of

  7. A placebo controlled trial of bismuth salicylate in Helicobacter pylori associated gastritis. (United States)

    Kazi, J I; Jafarey, N A; Alam, S M; Zuberi, S J; Kazi, A M; Qureshi, H; Ahmed, W


    In a placebo controlled prospective clinical trial of bismuth salicylate in helicobacter pylori associated gastritis, 52 adult patients were randomly allocated to treatment with bismuth salicylate or placebo. Helicobacter pylori were totally cleared in 77% patients in bismuth group but none in placebo group (P less than 0.001). Resolution of gastritis (P less than 0.001) and improvement of symptoms (P less than 0.01) were significantly better in patients where H. pylori infection cleared as compared to patients where the infection persisted.

  8. Antimony(V) and Bismuth(V) Complexes of Lapachol: Synthesis, Crystal Structure and Cytotoxic Activity


    Cynthia Demicheli; Carlos A. de Simone; Frédéric Frézard; Eufrânio N. da Silva Júnior; Cláudio L. Donnici; Elene C. Pereira-Maia; Ludmila G. de Oliveira; Meiriane M. Silva; Flávia C. S. de Paula


    Antimony(V) and bismuth(V) complexes of lapachol have been synthesized by the reaction of Ph3SbCl2 or Ph3BiCl2 with lapachol (Lp) and characterized by several physicochemical techniques such as IR, and NMR spectroscopy and X-ray crystallography. The compounds contain six-coordinated antimony and bismuth atoms. The antimony(V) complex is a monomeric derivative, (Lp)(Ph3Sb)OH, and the bismuth(V) complex is a dinuclear compound bridged by an oxygen atom, (Lp)2(Ph3Bi)2O. Both compounds inhibited ...

  9. Complexometric consequent titration of bismuth-titanium mixtures in the μg-region

    International Nuclear Information System (INIS)

    Schaefer, H.


    A quantitative method is described for the determination of microquantities of bismuth and titanium. Both metals are determined complexometrically with EDTA and potentiometric equivalence point indication using a Cu-ion sensitive electrode in a consequent titration. The analysis is conducted as back-titration with standard Cu-solution. The relative error of the determination is 0.8% for bismuth (50-100 μg) and for titanium (10-30 μg) at 1.0%. Under the chosen conditions, it is possible to determine as little as 15 μg bismuth and 5 μg titanium by means of this procedure. (author)

  10. Topological Insulator State in Thin Bismuth Films Subjected to Plane Tensile Strain (United States)

    Demidov, E. V.; Grabov, V. M.; Komarov, V. A.; Kablukova, N. S.; Krushel'nitskii, A. N.


    The results of experimental examination of galvanomagnetic properties of thin bismuth films subjected to plane tensile strain resulting from the difference in thermal expansion coefficients of the substrate material and bismuth are presented. The resistivity, the magnetoresistance, and the Hall coefficient were studied at temperatures ranging from 5 to 300 K in magnetic fields as strong as 0.65 T. Carrier densities were calculated. A considerable increase in carrier density in films thinner than 30 nm was observed. This suggests that surface states are more prominent in thin bismuth films on mica substrates, while the films themselves may exhibit the properties of a topological insulator.

  11. Microwave-induced Bismuth Salts-mediated Synthesis of Molecules of Medicinal Interests. (United States)

    Bandyopadhyay, Debasish; Chavez, Ashlee; Banik, Bimal K


    Bismuth salts-mediated reactions have become a powerful tool for the synthesis of diverse medicinally-significant compounds because of their low-toxicity (non-toxic) and Lewis acidic capacity. In fact, LD50 of bismuth nitrate is lower than table salt. On the other hand, microwave-induced chemical synthesis is considered as a major greener route in modern chemistry. A total of 139 publications (including a few authentic web links) have been reviewed mainly to discuss bismuth salts-induced electrophilic aromatic substitution, protection-deprotection chemistry of carbonyl compounds, enamination, oxidation, carbohydrate chemistry, hydrolysis, addition-elimination route, Paal-Knorr reaction, Clauson-kaas synthesis, Michael addition, aza-Michael addition, Hantzsch reaction, Biginelli reaction, Ferrier rearrangement, Pechmann condensation, Diels-Alder and aza-Diels- Alder reactions, as well as effects of microwave irradiation in a wide range of chemical transformations. Bismuth salts-mediated reactions are developed for the synthesis of diverse organic molecules of medicinal significance. Reactions conducted with bismuth salts are environmentally benign, economical, rapid and high yielding. Microwave irradiation has accelerated these reactions significantly. It is believed that bismuth salts released corresponding acids in the media during the reaction. However, a coordination of bismuth salt to the electronegative atom is also observed in the NMR study. Bismuth has much less control (less attractive forces) over anions (for example, halides, nitrate, sulfate and triflates) compared to alkali metals. Therefore, it forms weak bond with electronegative atoms more readily and facilitates the reactions significantly. Many products obtained via bismuth salts-mediated reactions are medicinally active or intermediate for the synthesis of biologically active molecules including antifungal, anti-parasitic, anticancer and antibacterial agents, as well as agents to prevent

  12. Increased expression of microRNA-196a predicts poor prognosis in human ovarian carcinoma. (United States)

    Fan, Yi; Fan, Jin; Huang, Liu; Ye, Ming; Huang, Zheng; Wang, Yibin; Li, Qiufen; Huang, Jiezhen


    Overexpression of MicroRNA-196a (miR-196a) has recently been reported in different types of human cancers. However, the prognostic value of miR-196a in ovarian carcinoma remains unknown. In this study, we investigated the expression of miR-196a in ovarian carcinoma and its relationship with tumor progression and clinical prognosis. The expression level of miR-196a was examined by quantitative Real-time PCR (qRT-PCR) in surgically removed ovarian cancer tissues and ovarian cancer cell lines. The correlation between miR-196a expression and clinical features and prognosis were statistically analyzed. The results showed that the miR-196a expression was significantly upregulated in tumor tissues and ovarian cancer cell lines compared with that in normal ovarian surface tissues and normal ovarian epithelial cells. Moreover, miR-196a expression was positively correlated with FIGO stage (Povarian carcinoma. In conclusion, miR-196a may play an important role in the progression of ovarian carcinoma, and could be used as an independent prognostic biomarker for patients with ovarian carcinoma.

  13. Theoretical Investigation of Bismuth-Based Semiconductors for Photocatalytic Applications

    KAUST Repository

    Laradhi, Shaikhah


    Converting solar energy to clean fuel has gained remarkable attention as an emerged renewable energy resource but optimum efficiency in photocatalytic applications has not yet been reached. One of the dominant factors is designing efficient photocatalytic semiconductors. The research reveals a theoretical investigation of optoelectronic properties of bismuth-based metal oxide and oxysulfide semiconductors using highly accurate first-principles quantum method based on density functional theory along with the range-separated hybrid HSE06 exchange-correlation functional. First, bismuth titanate compounds including Bi12TiO20, Bi4Ti3O12, and Bi2Ti2O7 were studied in a combined experimental and theoretical approach to prove its photocatalytic activity under UV light. They have unique bismuth layered structure, tunable electronic properties, high dielectric constant and low electron and effective masses in one crystallographic direction allowing for good charge separation and carrier diffusion properties. The accuracy of the investigation was determined by the good agreement between experimental and theoretical values. Next, BiVO4 with the highest efficiency for oxygen evolution was investigated. A discrepancy between the experimental and theoretical bandgap was reported and inspired a systematic study of all intrinsic defects of the material and the corresponding effect on the optical and transport properties. A candidate defective structure was proposed for an efficient photocatalytic performance. To overcome the carrier transport limitation, a mild hydrogen treatment was also introduced. Carrier lifetime was enhanced due to a significant reduction of trap-assisted recombination, either via passivation of deep trap states or reduction of trap state density. Finally, an accurate theoretical approach to design a new family of semiconductors with enhanced optoelectronic properties for water splitting was proposed. We simulated the solid solutions Bi1−xRExCuOS (RE = Y, La

  14. An approach to analyzing synthesis, structure and properties of bismuth titanate ceramics

    Directory of Open Access Journals (Sweden)

    Lazarević Z.


    Full Text Available The family of bismuth titanate, Bi4Ti3O12 (BIT layered-structured ferroelectrics materials is attractive from the viewpoint of their application as electronic materials such as dielectrics, piezoelectrics and pyroelectrics, because they are characterized by good stability of piezoelectric properties, a high Curie temperature and a good resistance vs temperature. Bismuth titanate (Bi4Ti3O12 powders can be prepared using different methods, depending if the creation will be film coating or ceramics. The structure and properties of bismuth titanate materials show a significance dependence on the applied synthesis method. In this review paper, we made an attempt to give an approach to analyzing the structure, synthesis methods and properties of bismuth titanate ferroelectrics materials. .

  15. Amperometric Determination of Bismuth Using Gallacetophenone Phenylhydrazone with the Structural Elucidation of Complex

    Directory of Open Access Journals (Sweden)

    D. Venkataramana Reddy


    Full Text Available Gallacetophenone phenylhydrazone (GPPH has been used as an analytical reagent for amperometric determination of bismuth. Bismuth is quantitatively determined by GPPH at pH 3.0-6.0. After studying the polarographic behaviour of GPPH and bismuth(III at dropping mercury electrode (DME, applied potential was fixed at -0.4v vs. saturated calomel electrode (SCE. The method was applied for the determination of bismuth in wood’s alloy. The composition of the complex corresponds to the formula Bi(C14 H14 O3 N22. The structure of the complex was arrived from the micro analytical data of the solid complex, thermogravimetric and differential thermal analysis curves and also from the infrared spectra of the complex.

  16. Corrosion by liquid lead and lead-bismuth: experimental results review and analysis

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Jinsuo [Los Alamos National Laboratory


    Liquid metal technologies for liquid lead and lead-bismuth alloy are under wide investigation and development for advanced nuclear energy systems and waste transmutation systems. Material corrosion is one of the main issues studied a lot recently in the development of the liquid metal technology. This study reviews corrosion by liquid lead and lead bismuth, including the corrosion mechanisms, corrosion inhibitor and the formation of the protective oxide layer. The available experimental data are analyzed by using a corrosion model in which the oxidation and scale removal are coupled. Based on the model, long-term behaviors of steels in liquid lead and lead-bismuth are predictable. This report provides information for the selection of structural materials for typical nuclear reactor coolant systems when selecting liquid lead or lead bismuth as heat transfer media.

  17. Crystal structure of La2Mo2O9 single crystals doped with bismuth

    International Nuclear Information System (INIS)

    Alekseeva, O. A.; Verin, I. A.; Sorokina, N. I.; Krasil'nikova, A. E.; Voronkova, V. I.


    Precision X-ray diffraction studies of La 2-x Bi x Mo 2 O 9 (x = 0.04, 0.06, and 0.18) single crystals are performed. It is found that in the compounds doped with bismuth, analogously with the structure of the metastable β ms phase of pure La 2 Mo 2 O 9 (LM), the La, Mo1, and O1 atoms deviate from the threefold axis on which they are located in the high-temperature β phase. It is shown that bismuth atoms substitute for part of lanthanum atoms and occupy a position at the threefold axis in the neighborhood of the split lanthanum position. The implantation of bismuth atoms in the LM structure results in the return of a part of the molybdenum atoms to the position at the threefold axis. The occupancy of this position is equal to the occupancy of the bismuth atomic position.

  18. Bismuth ferrite as low-loss switchable material for plasmonic waveguide modulator

    DEFF Research Database (Denmark)

    Babicheva, Viktoriia; Zhukovsky, Sergei; Lavrinenko, Andrei


    We propose new designs of plasmonic modulators, which can beused for dynamic signal switching in photonic integrated circuits. We studyperformance of a plasmonic waveguide modulator with bismuth ferrite as atunable material. The bismuth ferrite core is sandwiched between metalplates (metal......-insulator-metal configuration), which also serve as electrodes.The core changes its refractive index by means of partial in-plane to out-of-plane reorientation of ferroelectric domains in bismuth ferrite under appliedvoltage. As a result, guided modes change their propagation constant andabsorption coefficient, allowing light...... modulation in both phase andamplitude control schemes. Due to high field confinement between themetal layers, existence of mode cut-offs for certain values of the corethickness, and near-zero material losses in bismuth ferrite, efficientmodulation performance is achieved. For the phase control scheme...

  19. A comparison of core perturbation by coolant loss between sodium and lead-bismuth cooled reactor

    International Nuclear Information System (INIS)

    Kim, Yong Nam; Kim, Jong Kyung; Park, Won Seok


    This study performs a comparative analysis of the core perturbation caused by coolant loss between sodium and lead-bismuth eutectic. Considering the Zr-based and the U-based fuel in a 1,000MWth class reactor for TRU incineration, we investigate which coolant shows better performance for negative coolant loss reactivity in each case of fuel type. The calculation results show that in the case of U-based fuel, sodium gives rise to more positive coolant loss reactivity than lead-bismuth. However, when the Zr-based (U-free) fuel is considered, sodium offers negative coolant loss reactivity, whereas lead-bismuth makes the coolant loss reactivity positive. It is recommended to employ sodium coolant for the fertile-free fueled core and lead-bismuth for the core with fertile nuclides

  20. Status and future application of pilot lead-bismuth target circuit TC-1 for ADS

    International Nuclear Information System (INIS)

    Ignatiev, S.; Leonchuk, M.; Orlov, Y.; Pankratov, D.; Reshetnikova, O.; Suvorov, G.; Zabudko, A.; Stepanov, V.; Klimov, N.; Hechanova, A.; Ma, J.; Li, N.; Gudowski, W.


    A complicated evolution, status and future application of the pilot molten lead-bismuth target circuit of 1 MW proton beam power (TC-1) as an important part of a target-blanket accelerator driven system (ADS), that has been developed, created and twice tested under the auspice of the International Science and Technology Center (ISTC), is analyzed. The target complex TC-1 is a circulation lead-bismuth loop whose beam window is made of ferritic steel EP-823 (this steel was used in the past as material of fuel rods cladding in reactors cooled with lead-bismuth). At present TC-1 is operating at coolant temperature up to 300 C degrees and will be used to study different issues linked to the use of lead-bismuth: -) interaction with air, water and hydrogen, -) different regimes of flow, -) corrosion, -) filtering, or -) slag formation

  1. Optical properties of thermally reduced bismuth-doped sodium aluminosilicate glasses

    DEFF Research Database (Denmark)

    Nielsen, K.H.; Smedskjær, Morten Mattrup; Yue, Yuanzheng

    Heat-treatment of multivalent ion containing glasses in a hydrogen atmosphere may cause both reduction of the multivalent ions and ionic inward diffusion, resulting in improved glass properties. Bismuth-doped glasses are also interesting objects not only concerning the reduction induced diffusion...... pressure of hydrogen. Here, we present results on the effect of the heat-treatment on the optical properties of bismuth-doped sodium aluminosilicate glasses....

  2. Study of bismuth minerals belonging to the mineralogical collection from the National Museum

    International Nuclear Information System (INIS)

    Baptista, A.; Baptista, N.R.


    With the purpose of searching the presence of Tellurium minerals in the Ouro Preto-Mariana country, Minas Gerais State, and considering the existence of a great number of minerals in which this element come across allied with Bismuth, samples of the mineralogical collection of the Museu Nacional, proceeding that region and classified as Bismuth minerals were studied by X-ray fluorescence analysis and diffractometric analysis. In this report the results of this research are presented. (Author)

  3. Aluminium bismuthate nanorods and the electrochemical performance for detection of tartaric acid

    Energy Technology Data Exchange (ETDEWEB)

    Pei, L.Z., E-mail: [Key Lab of Materials Science and Processing of Anhui Province, School of Materials Science and Engineering, Anhui University of Technology, Ma' anshan, Anhui 243002 (China); Wei, T.; Lin, N.; Fan, C.G. [Key Lab of Materials Science and Processing of Anhui Province, School of Materials Science and Engineering, Anhui University of Technology, Ma' anshan, Anhui 243002 (China); Yang, Zao, E-mail: [National Engineering Research Center for Biomaterials, Sichuan University, Chengdu, Sichuan 610064 (China)


    Aluminium bismuthate nanorods had been synthesized by a facile hydrothemral method. Scanning electron microscopy (SEM) and transmission electron microscopy (TEM) observations showed that the lengh and diameter were 2–10 μm and 50–200 nm, respectively. X-ray diffraction (XRD) and high-resolution TEM (HRTEM) showed that the nanorods were composed of single crystalline orthorhombic Al{sub 4}Bi{sub 2}O{sub 9} phase. The aluminium bismuthate nanorods could be explained by the nucleation and crystalline growth process based on the products obtained from different hydrothermal conditions. Aluminium bismuthate nanorods modified glassy carbon electrode (GCE) was fabricated for the electrochemical detection of tartaric acid (TA) in neutral solution. A pair of semi-reversible redox peaks located at −0.08 V and −0.53 V, respectively were observed. The current intensity of the cyclic voltammogram (CV) peak increased linearly obviously with increasing the scan rate and TA concentration. The detection limit and linear range were 0.64 μM and 0.001–2 mM, respectively with the correlation coefficient of 0.995. The aluminium bismuthate nanorods modified GCE had good reproducibility and stability for the detection of TA. - Highlights: • Aluminium bismuthate nanorods were synthesized by a facile hydrothermal process. • The size of aluminium bismuthate nanorods could be controlled by growth conditions. • Aluminium bismuthate nanorods showed good electrochemical performance for the detection of tartaric acid. • Aluminium bismuthate nanorods modified GCE had good reproducibility and stability.

  4. Microwave-assisted facile and rapid Friedel-Crafts benzoylation of arenes catalysed by bismuth trifluoromethanesulfonate

    DEFF Research Database (Denmark)

    Tran, Phoung Hoang; Hansen, Poul Erik; Pham, Thuy Than


    The catalytic activity of metal triflates was investigated in Friedel–Crafts benzoylation under microwave irradiation. Friedel–Crafts benzoylation with benzoyl chloride of a variety of arenes containing electron-rich and electron-poor rings using bismuth triflate under microwave irradiation is de...... is described. This method allows the preparation of aryl ketones under solventless conditions in good to excellent yields and short reaction time. Bismuth triflate was easily recovered and reused five times without significant loss of the catalytic activity....

  5. About thermo-electric properties of bismuth telluride doped by gadolinium

    International Nuclear Information System (INIS)

    Akperov, M.M.; Ismailov, Sh.S.; Shukyurova, A.A.


    Results of study of the Gd impurities effect on the bismuth telluride thermo-electric properties are presented. The experiment was carried out within the temperature range T=300-700 K. It is determined, that at temperature increase the energy level is appreciably closing up to bismuth telluride forbidden zone which makes up 0.16-0.24 eV. Such anomalous energy properties of gadolinium in telluride affect on material thermoelectric properties

  6. An acclerator-based installation of small power with the lead-bismuth coolant

    Energy Technology Data Exchange (ETDEWEB)

    Gorshkov, V.T.; Yefimov, E.I.; Novikova, N.N. [Research and Development Bereau, Podolsk (Russian Federation)] [and others


    The structure of the accelerator-based installation is described that includes the subcritical reactor-blanket with power 15 MW(h) cooled with lead-bismuth, the lead-bismuth flow target where a beam of {alpha}-particle is injected, the equipment of a primary and secondary curcuits. Some results of calculations and estimations are discussed that have been carried out to justify the target and blanket constructions. Some main characteristics of the installation are presented.

  7. A double-blind gastroscopic study of a Bismuth-peptide complex in ...

    African Journals Online (AJOL)

    Healing was judged gastroscopically after 4 weeks, at which time 79% of ulcers had healed on BCP and 35% on placebo (Pbismuth-protein complex, active at a pH of less than 4. A protective 'protein-bismuth complex' layer is said to be formed over the ulcer. S. Afr. Med.

  8. Evaluation of the usefulness of bismuth shields in PET/CT examination

    International Nuclear Information System (INIS)

    Park, Hoon Hee; Lyu, Kwang Yeul; Lee, Ju Young; Kim, Ji Hyeon; Kung, Sik Nam; Lee, Tae Soo


    Recently with CT developed, various studies for reduction of exposure dose is underway. Study of bismuth shields in these studies is actively underway, and has already been applied in the clinical. However, the application of the PET/CT examination was not activated. Therefore, through this study, depending on the application of bismuth shields in the PET/CT examination, we identify the quality of the image and the impact on the Standard Uptake Value (SUV). In this study, to apply to the shielding of the breast, by using the bismuth shields that contains 0.06 mm Pb ingredients, was applied to the PET/CT GEMINI TF 64 (Philips Healthcare, Cleveland, USA). Phantom experiments using the NEMA IEC Body Phantom, images were acquired according to the presence or absence of bismuth shields apply. Also, When applying, images were obtained by varying the spacing 0, 1, 2 cm each image set to the interest range in the depth of the phantom by using EBW-NM ver.1.0. When image of the PET Emission acquires, the SUV was in increased depending on the use of bismuth shields, difference in the depth to the surface from deep in the phantom increasingly SUV increased (P<0.005). Also, when using shields, as the more gab decreased, SUV is more increased (P<0.005). Through this study, PET/CT examination by using of bismuth shields which is used as purpose of reduction dose. When using shields, the difference of SUV resulting from the application of bismuth shields exist and that difference when gab is decrease and surface is wider. Therefore, setting spacing of shield should be considered, if considering the reduction of the variation of SUV and image quality, disease of deep organs should be a priority rather than superficial organ disease. Use of bismuth shielding factor considering the standard clinical examination, decrease unnecessary exposure can be expected to be considered

  9. Bismuth Sodium Titanate Based Materials for Piezoelectric Actuators (United States)

    Reichmann, Klaus; Feteira, Antonio; Li, Ming


    The ban of lead in many electronic products and the expectation that, sooner or later, this ban will include the currently exempt piezoelectric ceramics based on Lead-Zirconate-Titanate has motivated many research groups to look for lead-free substitutes. After a short overview on different classes of lead-free piezoelectric ceramics with large strain, this review will focus on Bismuth-Sodium-Titanate and its solid solutions. These compounds exhibit extraordinarily high strain, due to a field induced phase transition, which makes them attractive for actuator applications. The structural features of these materials and the origin of the field-induced strain will be revised. Technologies for texturing, which increases the useable strain, will be introduced. Finally, the features that are relevant for the application of these materials in a multilayer design will be summarized. PMID:28793724

  10. Bismuth Sodium Titanate Based Materials for Piezoelectric Actuators

    Directory of Open Access Journals (Sweden)

    Klaus Reichmann


    Full Text Available The ban of lead in many electronic products and the expectation that, sooner or later, this ban will include the currently exempt piezoelectric ceramics based on Lead-Zirconate-Titanate has motivated many research groups to look for lead-free substitutes. After a short overview on different classes of lead-free piezoelectric ceramics with large strain, this review will focus on Bismuth-Sodium-Titanate and its solid solutions. These compounds exhibit extraordinarily high strain, due to a field induced phase transition, which makes them attractive for actuator applications. The structural features of these materials and the origin of the field-induced strain will be revised. Technologies for texturing, which increases the useable strain, will be introduced. Finally, the features that are relevant for the application of these materials in a multilayer design will be summarized.

  11. Bismuth Sodium Titanate Based Materials for Piezoelectric Actuators. (United States)

    Reichmann, Klaus; Feteira, Antonio; Li, Ming


    The ban of lead in many electronic products and the expectation that, sooner or later, this ban will include the currently exempt piezoelectric ceramics based on Lead-Zirconate-Titanate has motivated many research groups to look for lead-free substitutes. After a short overview on different classes of lead-free piezoelectric ceramics with large strain, this review will focus on Bismuth-Sodium-Titanate and its solid solutions. These compounds exhibit extraordinarily high strain, due to a field induced phase transition, which makes them attractive for actuator applications. The structural features of these materials and the origin of the field-induced strain will be revised. Technologies for texturing, which increases the useable strain, will be introduced. Finally, the features that are relevant for the application of these materials in a multilayer design will be summarized.

  12. Single event upset immunity of strontium bismuth tantalate ferroelectric memories

    International Nuclear Information System (INIS)

    Benedetto, J.M.; Derbenwick, G.F.; Cuchiaro, J.D.


    An embedded 1Kbit non-volatile (NV) serial memory manufactured with strontium bismuth tantalate (SBT) ferroelectric (FE) technology was shown to be immune to effects of heavy ion irradiation. The memories did not lose any data in the non-volatile mode when exposed to xenon (maximum effective LET of 128 MeV-cm 2 /mg and a total fluence of 1.5 x 10 7 ions/cm 2 ). The ferroelectric memories also did not exhibit any loss in the ability to rewrite new data into the memory bits, indicating that no significant degradation of the FE dipoles occurred as a result of the heavy ion exposure. The fast read/write times of FE memories also means that single event gate rupture is unlikely to occur in this technology

  13. Study of irradiation defects in bismuth by electric transport measurements

    International Nuclear Information System (INIS)

    Le Goff, M.


    Pure monocrystalline bismuth is irradiated near 4K by electrons of different energies. Irradiation effects are measured by galvanomagnetic properties at low temperature. Frenkel pairs created during irradiation have a strong effect on carrier mobilities. The data are quantitatively analyzed assuming a rigid band model. After irradiation with 1 MeV electrons, each Frankel pair created corresponds to a total charge of 0.14 electrons. This result obtained by magnetoresistance and Hall effect is confirmed by Shubnikov-de Haas experiments. There is a linear variation between the excess carrier density (p-n) and the Frenkel pair concentration. The more important step of annealing is observed around 40-50 K. This step is attributed to interstitial migration. Resistivity presents a minimum at low temperature after irradiation with electrons of energy over 1.3 MeV. This is explained by virtual bound levels near the Fermi level. The Kondo effect bound to magnetic defects is discussed [fr

  14. A novel synthesis of perovskite bismuth ferrite nanoparticles

    Directory of Open Access Journals (Sweden)

    Alexandre Z. Simões


    Full Text Available Microwave assisted hydrothermal (MAH method was used to synthesize crystalline bismuth ferrite (BiFeO3 nanoparticles (BFO at temperature of 180°C with times ranging from 5 min to 1 h. For comparison, BFO powders were also crystallized by the soft chemistry route in a conventional furnace at a temperature of 850°C for 4 h. X-ray diffraction (XRD results verified the formation of perovskite BFO crystallites while infrared data showed no traces of carbonate. Field emission scanning microcopy (FE/SEM revealed a homogeneous size distribution of nanometric BFO powders. MAH method produced nanoparticles of 96% pure perovskite, with a size of 130 nm. These results are in agreement with Raman scattering values which show that the MAH synthesis route is rapid and cost effective. This method could be used as an alternative to other chemical methods in order to obtain BFO nanoparticles.

  15. Spark plasma sintering of hydrothermally synthesized bismuth ferrite

    Directory of Open Access Journals (Sweden)

    Zorica Branković


    Full Text Available Bismuth ferrite, BiFeO3 (BFO, powder was synthesized by hydrothermal method from Bi(NO33·5 H2O and Fe(NO33·9 H2O as precursors. The synthesized powder was further sintered using spark plasma sintering (SPS. The sintering conditions were optimized in order to achieve high density, minimal amount of secondary phases and improved ferroelectric and magnetic properties. The optimal structure and properties were achieved after spark plasma sintering at 630 °C for 20 min, under uniaxial pressure of 90 MPa. The composition, microstructure, ferroelectric and magnetic properties of the SPS samples were characterized and compared to those of conventionally sintered ceramics obtained from the same powder. Although the samples sintered using conventional method showed slightly lower amount of secondary phases, the spark plasma sintered samples exhibited favourable microstructure and better ferroelectric properties.

  16. High ionic conductivity in confined bismuth oxide-based heterostructures

    Directory of Open Access Journals (Sweden)

    Simone Sanna


    Full Text Available Bismuth trioxide in the cubic fluorite phase (δ-Bi2O3 exhibits the highest oxygen ionic conductivity. In this study, we were able to stabilize the pure δ-Bi2O3 at low temperature with no addition of stabilizer but only by engineering the interface, using highly coherent heterostructures made of alternative layers of δ-Bi2O3 and Yttria Stabilized Zirconia (YSZ, deposited by pulsed laser deposition. The resulting [δ-Bi2O3/YSZ] heterostructures are found to be stable over a wide temperature range (500-750 °C and exhibits stable high ionic conductivity over a long time comparable to the value of the pure δ-Bi2O3, which is approximately two orders of magnitude higher than the conductivity of YSZ bulk.

  17. Characterization of Bismuth Germanate Detectors for Reaction Studies (United States)

    Carls, A.; Kozub, R. L.; Chipps, K. A.; Pain, S. D.; Hertz-Kintish, D.; Thompson, P.; Waddell, D.


    Nuclear reactions utilizing radioactive ion beams emit particles and electromagnetic radiation that can provide useful information about reaction mechanisms, nuclear structure, and nuclear astrophysics. Owing to their high density and high Z, Bismuth Germanate (BGO) detectors are used in γ-ray decay studies where high efficiency is required. An array of such detectors will be used for future γ-ray studies with the new gas jet target JENSA (Jet Experiments in Nuclear Structure and Astrophysics), and the properties of each detector must be well known to better understand the data collected with them. Using the γ-ray sources 137Cs and 60Co along with background radiation, several BGO detectors were characterized by measuring their resolutions and efficiencies as functions of distance between source and detector. A detailed description of the procedure and results will be presented. This work is supported in part by the U.S. Department of Energy and the National Science Foundation.

  18. High ionic conductivity in confined bismuth oxide-based heterostructures

    DEFF Research Database (Denmark)

    Sanna, Simone; Esposito, Vincenzo; Christensen, Mogens


    Bismuth trioxide in the cubic fluorite phase (δ-Bi2O3) exhibits the highest oxygen ionic conductivity. In this study, we were able to stabilize the pure -Bi2O3 at low temperature with no addition of stabilizer but only by engineering the interface, using highly coherent heterostructures made...... of alternative layers of δ-Bi2O3 and Yttria Stabilized Zirconia (YSZ), deposited by pulsed laser deposition. The resulting [δ-Bi2O3=YSZ] heterostructures are found to be stable over a wide temperature range (500-750 °C) and exhibits stable high ionic conductivity over a long time comparable to the value...... of the pure δ-Bi2O3, which is approximately two orders of magnitude higher than the conductivity of YSZ bulk....

  19. Radiopacity and histological assessment of Portland cement plus bismuth oxide. (United States)

    Coutinho-Filho, Tauby; De-Deus, Gustavo; Klein, Leila; Manera, Gisele; Peixoto, Carla; Gurgel-Filho, Eduardo Diogo


    The present study evaluated the subcutaneous connective tissue reactions and the radiopacity of MTA, Portland cement (PC), and Portland cement plus bismuth oxide (BO). Forty rats were divided into 5 groups (n = 8 per group): A1: Control (empty capsule); A2: Pro-Root MTA; A3: PC; A4: PC + BO 1:1; and A5: PC + BO 2:1. Polyethylene tubes were filled with the test materials and standardized radiographic images were taken. Histological evaluation was done after 7 and 60 days. Student t test and Fisher's test were used in the statistical analysis (P A4 > A5 > A3. No differences were found for the tissue response in the 2 experimental periods. A positive correlation between BO concentration and radiopacity of PC was determined. The histological evaluation suggests that all studied materials were biocompatible at 7 and 60 days.

  20. Viability of Bismuth as a Green Substitute for Lead in Jacketed .357 Magnum Revolver Bullets (United States)

    Jenkins, Joel

    In seeking to develop environmentally friendly lead-free non-toxic bullets, the research ballistically evaluated the performance of copper-jacketed handgun bullets containing a pure bismuth core. The lead was first removed from 140 grain Hornady(TM) XTPRTM bullets of 38 caliber (.357 diameter) by melting. The empty jackets were then refilled with pure bismuth, including the forming of a correctly sized hollow-point cavity. Due to the lower density of bismuth as compared to lead, the bismuth-cored bullets consistently weighed 125 gains. Conveniently this allowed direct comparison to commercially available 125 grain Hornady(TM) XTPRTM lead-cored bullets of 38 caliber. Both bismuth-cored and lead-cored versions of the 125 grain bullets had identical nose dimensions and jacket material, the only dimensional difference being the bullet length below the cannelure. Shooting took place at an outdoor range using a 357 Magnum Ruger(TM) SP101RTM revolver with 3" barrel as the test weapon. FBI protocols were followed when firing through clothing, wallboard, plywood, steel plates and laminated glass. Wound paths and bullets were captured in ballistic gelatin, with data collected for velocity, penetration, expansion, and weight retention. Bismuth compared favorably with lead in all but the laminated glass test, where it under penetrated due to jacket separation.

  1. Evaluation of the strength and radiopacity of Portland cement with varying additions of bismuth oxide. (United States)

    Saliba, E; Abbassi-Ghadi, S; Vowles, R; Camilleri, J; Hooper, S; Camilleri, J


    To study the effect of addition of various proportions of bismuth oxide on compressive strength and radiopacity of Portland cement. The compressive strength of white Portland cement and cement replaced with 10, 15, 20, 25 and 30% bismuth oxide was evaluated by testing cylinders 6 mm in diameter and 12 mm high. Twelve cylinders were tested for each material under study. The radiopacity of the cements tested was evaluated using an aluminium step-wedge and densitometer. The optical density was compared with the relevant thickness of aluminium (Al). Statistical analysis was performed using Analysis of Variance (ANOVA) with P = 0.05 and Tukey test to perform multiple comparison tests. Various additions of bismuth oxide had no significant effect on the strength of the material when compared with the unmodified Portland cement (P > 0.05). The radiopacity of the cements tested ranged from 2.02 mm Al for Portland cement to 9.79 mm Al for the highest bismuth replacement. Addition of bismuth oxide did not affect the compressive strength of Portland cement. All the bismuth oxide cement mixtures had radio-opacities higher than 3 mm thickness of aluminium.

  2. Simultaneous solution-based generation and characterization of crystalline bismuth thin film by femtosecond laser spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Liangdong; Keszler, Douglas A.; Fang, Chong, E-mail: [Department of Chemistry, Oregon State University, 153 Gilbert Hall, Corvallis, Oregon 97331-4003 (United States); Department of Physics, Oregon State University, 301 Weniger Hall, Corvallis, Oregon 97331-6507 (United States); Saha, Sumit; Liu, Weimin; Wang, Yanli [Department of Chemistry, Oregon State University, 153 Gilbert Hall, Corvallis, Oregon 97331-4003 (United States)


    We demonstrate generation and characterization of crystalline bismuth thin film from triphenyl bismuth in methanol. Upon ultraviolet (267 nm) femtosecond laser irradiation of the solution, a thin film of elemental bismuth forms on the inner side of the sample cuvette, confirmed by detection of the coherent A{sub 1g} optical phonon mode of crystalline bismuth at ∼90 cm{sup −1}. Probe pulses at 267 and 400 nm are used to elucidate the excited state potential energy surface and photochemical reaction coordinate of triphenyl bismuth in solution with femtosecond resolution. The observed phonon mode blueshifts with increasing irradiation time, likely due to the gradual thickening of nascent bismuth thin film to ∼80 nm in 90 min. From transient absorption with the 400 nm probe, we observe a dominant ∼4 ps decay time constant of the excited-state absorption signal, which is attributed to a characteristic metal-ligand bond-weakening/breaking intermediate enroute to crystalline metallic thin film from the solution precursor molecules. Our versatile optical setup thus opens an appealing avenue to characterize the laser-induced crystallization process in situ and prepare high-quality thin films and nanopatterns directly from solution phase.

  3. Effect of the administration of bismuth nitrate on radiogenic thymoma induction in mice

    Energy Technology Data Exchange (ETDEWEB)

    Kagimoto, Osamu; Toge, Tetsuya; Niwa, Ohtsura (Hiroshima Univ. (Japan). Research Inst. for Nuclear Medicine and Biology); Naganuma, Akira; Imura, Nobumasa; Yokoro, Kenjiro


    Metallothionein functions as a radical scavenger protecting cells from the indirect effect of radiation. We investigated the effect of bismuth nitrate, an efficient inducer of metallothionein, on acute and late effects of radiation in mice. Metallothionein contents were examined in several organs after the administration of bismuth nitrate. The content in bone marrow increased 2-fold in the treated as compared to the control mice. This treatment protected irradiated mice from bone marrow death and increased the number of endogenous spleen colonies. The metallothionein content in the ileum did not change after treatment with bismuth nitrate. Mice were not protected by bismuth nitrate when exposed to 9 Gy of X-rays. This suggests that this agent does not protect from gastrointestinal death. The incidence of X-ray-induced thymic lymphomas was lowered by the administration of bismuth nitrate in mice exposed to four fractionated doses of 1.3 Gy of X-rays. These results indicate that bismuth nitrate effectively modified both acute and late effects of X-rays by inducing metallothionein in the target tissues. (author).

  4. Nano sized bismuth oxy chloride by metal organic chemical vapour deposition

    Energy Technology Data Exchange (ETDEWEB)

    Jagdale, Pravin, E-mail: [Department of Applied Science and Technology (DISAT), Politecnico di Torino, 10129 (Italy); Castellino, Micaela [Center for Space Human Robotics, Istituto Italiano di Tecnologia, Corso Trento 21, 10129 Torino (Italy); Marrec, Françoise [Laboratory of Condensed Matter Physics, University of Picardie Jules Verne (UPJV), Amiens 80039 (France); Rodil, Sandra E. [Instituto de Investigaciones en Materiales, Universidad Nacional Autonoma de Mexicom (UNAM), Mexico D.F. 04510 (Mexico); Tagliaferro, Alberto [Department of Applied Science and Technology (DISAT), Politecnico di Torino, 10129 (Italy)


    Metal organic chemical vapour deposition (MOCVD) method was used to prepare thin films of bismuth based nano particles starting from bismuth salts. Nano sized bismuth oxy chloride (BiOCl) crystals were synthesized from solution containing bismuth chloride (BiCl{sub 3}) in acetone (CH{sub 3}-CO-CH{sub 3}). Self-assembly of nano sized BiOCl crystals were observed on the surface of silicon, fused silica, copper, carbon nanotubes and aluminium substrates. Various synthesis parameters and their significant impact onto the formation of self-assembled nano-crystalline BiOCl were investigated. BiOCl nano particles were characterized by X-ray diffraction, X-ray photoelectron spectroscopy, field emission scanning electron microscopy, energy-dispersive X-ray spectroscopy and Micro-Raman spectroscopy. These analyses confirm that bismuth nanometer-sized crystal structures showing a single tetragonal phase were indeed bismuth oxy chloride (BiOCl) square platelets 18–250 nm thick and a few micrometres wide.

  5. Autophagy associated cytotoxicity and cellular uptake mechanisms of bismuth nanoparticles in human kidney cells. (United States)

    Liu, Yongming; Zhuang, Jing; Zhang, Xihui; Yue, Cong; Zhu, Ning; Yang, Liecheng; Wang, Yong; Chen, Tao; Wang, Yangyun; Zhang, Leshuai W


    Bismuth compounds have been used for treatment of bacterial infection, and recently bismuth nanoparticles (BiNP) were synthesized for imaging and diagnostic purpose, while safety concern of bismuth cannot be ignored. Here, we prepared ultrasmall BiNP and showed an enhanced tumor imaging, but BiNP revealed a differentiated cytotoxicity in human embryonic kidney 293 cells (HEK293) compared to other cell types. For the first time, we found that BiNP can induce autophagy, shown as the increase of monodansylcadaverine fluorescence staining and the amount of LC3II that can be inhibited by 3-MA. BiNP were capable of entering cells in a dose and time dependent manner by fluorescence and element detection methods BiNP were found to be localized in the cytoplasm observed by transmission electron microscopy and intracellular bismuth element confirmed by energy dispersive X-ray analysis. Using endocytic inhibitors, BiNP were found to require ATP and endosomal trafficking pathways for their cellular uptake. Internalized BiNP did not co-localize with EEA1, but co-localized with Lysotracker/LAMP1/LAMP2 at late time points, indicating BiNP may be retained in the non-early endosomal vacuoles and late endosomes. With our novel finding of bismuth induced autophagy and endocytic mechanisms, potential approaches may be applied to reduce the toxicity by bismuth. Copyright © 2017 Elsevier B.V. All rights reserved.

  6. Synthesis and characterization of Bismuth ferrite (BiFeO3) nanoparticles by solution evaporation method

    International Nuclear Information System (INIS)

    Manzoor, A.; Afzal, A.M.; Umair, M.; Ali, Adnan; Rizwan, M.; Yaqoob, M.Z.


    Single phase Bismuth ferrite (BiFeO 3 ) with high magnetization and polarization was synthesized by solution evaporation method (SEM) at room temperature. The influence of temperature and size of nanoparticles on magnetic properties was studied. The prepared Bismuth ferrite (BiFeO 3 ) was characterized by X-ray diffraction (XRD) to investigate the structure and size of crystal. The average crystallite size of nanoparticles (NPs) as calculated by X-ray diffraction (XRD) falls in the range of 22–31 nm. The crystallite size of Bismuth ferrite increased as the temperature varied from 450 °C to 650 °C. Magnetic properties were studied by using physical properties measurement system (PPMS). It was also observed that the magnetic properties were directly related to the size and temperature of Bismuth ferrite nanoparticles. It has been investigated that the magnetization was decreased as the temperature and crystallite size increased. - Highlights: • Bismuth ferrite magnetic material was synthesized by solution evaporation method. • Bismuth ferrite shows ferromagnetic properties at room temperature. • Influence of temperature and crystallite size on magnetic properties was observed. • The magnetization was decreased as the temperature and crystallite size increased. • The magnetic moments were found larger in the smaller crystalline size

  7. Different bismuth-based therapies for eradicating Helicobacter pylori: Randomized clinical trial of efficacy and safety. (United States)

    Gokcan, Hale; Oztas, Erkin; Onal, Ibrahim Koral


    Bismuth salts are used for treating dyspepsia, and they exert antibacterial effects on Helicobacter pylori. This study aimed to compare the efficacy and safety of three bismuth-containing combination regimens for H. pylori eradication in a Turkish population. In this single-center study, 149 patients, who were diagnosed with H. pylori infection with urea breath test and histopathological examination, were randomized to receive the following therapies for 14 days: (1) bismuth-containing clarithromycin-based triple therapy (CBS-LAC), (2) bismuth-containing levofloxacin-based triple therapy (CBS-LAL), and (3) bismuth-containing quadruple therapy (BCQT). Eradication rates were evaluated six weeks after the treatment by performing intention to treat (ITT) and per protocol (PP) analyses. In addition, data on side effect profiles and patient compliance were collected. PP and ITT analyses showed that eradication rates were 86% and 81.1%, respectively, with BCQT; 68.3% and 66.7%, respectively, with CBS-LAL therapy; and 65.3% and 59.3%, respectively, with CBS-LAC therapy. Eradication rates obtained using PP and ITT analyses were statistically significant for all the regimens. Addition of bismuth to standard triple and levofloxacin-based regimen did not show an acceptable increase in eradication rates. Therefore, BCQT may be preferred for the first-line treatment of H. pylori infection. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  8. Operator Dose Measurements and Image Quality Assessment in Computed Tomography Fluoroscopy Using Bismuth Sheet. (United States)

    Takiguchi, Keisuke; Urikura, Atsushi; Yoshida, Tsukasa; Hirosawa, Kenichi; Ito, Takahiro; Nakaya, Yoshihiro


    The purpose of this study was to assess the dose reduction and the image quality using bismuth sheets during the computed tomography fluoroscopy (CTF). The bismuth sheets of 1-mm thick were put on the upper mylar ring to reduce the frontal X-ray. The dose rates of an operator were measured using a torso phantom in the patient position during the CTF. The torso phantom was set on the gantry rotation center (center) and the lower position from the center (off-center). The image quality of the CTF image was assessed using an original phantom that mimics the normal liver parenchyma and the low attenuation lesions. The image contrast and contrast-to-noise ratio (CNR) were compared with and without the bismuth sheets. The bismuth sheets reduced the dose rate of the operator, regardless of whether the torso phantom was set at the center or the off-center. The reduction rate of exposure at the center and the off-center were 42.3% and 34.5%, respectively. There were no significant differences in the image contrast and the CNR, although the bismuth sheets increased the CT values of the liver parenchyma and the low attenuation lesions. The bismuth sheets were effective for the reduction of exposure to the operator without degrading the image quality of CTF images.

  9. Intrinsic stress of bismuth oxide thin films: effect of vapour chopping and air ageing

    International Nuclear Information System (INIS)

    Patil, R B; Puri, R K; Puri, V


    Bismuth oxide thin films of thickness 1000 A 0 have been prepared by thermal oxidation (in air) of vacuum evaporated bismuth thin films (on glass substrate) at different oxidation temperatures and duration. Both the vapour chopped and nonchopped bismuth oxide thin films showed polycrystalline and polymorphic structure. The monoclinic bismuth oxide was found to be predominant in both the cases. The effect of vapour chopping and air exposure for 40 days on the intrinsic stress of bismuth oxide thin films has been studied. The vapour chopped films showed low (3.92 - 4.80 x 10 9 N/m 2 ) intrinsic stress than those of nonchopped bismuth oxide thin films (5.77 - 6.74 x 10 9 N/m 2 ). Intrinsic stress was found to increase due to air ageing. The effect of air ageing on the vapour chopped films was found low. The vapour chopped films showed higher packing density. Higher the packing density, lower the film will age. The process of chopping vapour flow creates films with less inhomogenety i.e. a low concentration of flaws and non-planar defects which results in lower intrinsic stress

  10. Zerovalent bismuth nanoparticles inhibit Streptococcus mutans growth and formation of biofilm (United States)

    Hernandez-Delgadillo, Rene; Velasco-Arias, Donaji; Diaz, David; Arevalo-Niño, Katiushka; Garza-Enriquez, Marianela; De la Garza-Ramos, Myriam A; Cabral-Romero, Claudio


    Background and methods Despite continuous efforts, the increasing prevalence of resistance among pathogenic bacteria to common antibiotics has become one of the most significant concerns in modern medicine. Nanostructured materials are used in many fields, including biological sciences and medicine. While some bismuth derivatives has been used in medicine to treat vomiting, nausea, diarrhea, and stomach pain, the biocidal activity of zerovalent bismuth nanoparticles has not yet been studied. The objective of this investigation was to analyze the antimicrobial activity of bismuth nanoparticles against oral bacteria and their antibiofilm capabilities. Results Our results showed that stable colloidal bismuth nanoparticles had 69% antimicrobial activity against Streptococcus mutans growth and achieved complete inhibition of biofilm formation. These results are similar to those obtained with chlorhexidine, the most commonly used oral antiseptic agent. The minimal inhibitory concentration of bismuth nanoparticles that interfered with S. mutans growth was 0.5 mM. Conclusion These results suggest that zerovalent bismuth nanoparticles could be an interesting antimicrobial agent to be incorporated into an oral antiseptic preparation. PMID:22619547

  11. Enhanced detection of quantum dots labeled protein by simultaneous bismuth electrodeposition into microfluidic channel. (United States)

    Medina-Sánchez, Mariana; Miserere, Sandrine; Cadevall, Miquell; Merkoçi, Arben


    In this study, we propose an electrochemical immunoassay into a disposable microfluidic platform, using quantum dots (QDs) as labels and their enhanced detection using bismuth as an alternative to mercury electrodes. CdSe@ZnS QDs were used to tag human IgG as a model protein and detected through highly sensitive stripping voltammetry of the dissolved metallic component (cadmium in our case). The modification of the screen printed carbon electrodes (SPCEs) was done by a simple electrodeposition of bismuth that was previously mixed with the sample containing QDs. A magneto-immunosandwich assay was performed using a micromixer. A magnet placed at its outlet in order to capture the magnetic beads used as solid support for the immunoassay. SPCEs were integrated at the end of the channel as detector. Different parameters such as bismuth concentration, flow rate, and incubation times, were optimized. The LOD for HIgG in presence of bismuth was 3.5 ng/mL with a RSD of 13.2%. This LOD was about 3.3-fold lower than the one obtained without bismuth. Furthermore, the sensitivity of the system was increased 100-fold respect to experiments carried out with classical screen-printed electrodes, both in presence of bismuth. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  12. Nano sized bismuth oxy chloride by metal organic chemical vapour deposition

    International Nuclear Information System (INIS)

    Jagdale, Pravin; Castellino, Micaela; Marrec, Françoise; Rodil, Sandra E.; Tagliaferro, Alberto


    Metal organic chemical vapour deposition (MOCVD) method was used to prepare thin films of bismuth based nano particles starting from bismuth salts. Nano sized bismuth oxy chloride (BiOCl) crystals were synthesized from solution containing bismuth chloride (BiCl 3 ) in acetone (CH 3 -CO-CH 3 ). Self-assembly of nano sized BiOCl crystals were observed on the surface of silicon, fused silica, copper, carbon nanotubes and aluminium substrates. Various synthesis parameters and their significant impact onto the formation of self-assembled nano-crystalline BiOCl were investigated. BiOCl nano particles were characterized by X-ray diffraction, X-ray photoelectron spectroscopy, field emission scanning electron microscopy, energy-dispersive X-ray spectroscopy and Micro-Raman spectroscopy. These analyses confirm that bismuth nanometer-sized crystal structures showing a single tetragonal phase were indeed bismuth oxy chloride (BiOCl) square platelets 18–250 nm thick and a few micrometres wide.

  13. Magnetic properties of the binary Nickel/Bismuth alloy

    Energy Technology Data Exchange (ETDEWEB)

    Keskin, Mustafa; Şarlı, Numan, E-mail:


    Highlights: • We model and investigate the magnetic properties of the Ni/Bi alloy within the EFT. • Magnetizations of the Ni/Bi alloy are observed as Bi1 > Bi2 > Ni/Bi > Ni at T < Tc. • Magnetization of the Bi1 is dominant and Ni is at least dominant T < Tc. • Total magnetization of the Ni/Bi alloy is close to those of Ni at T < Tc. • Hysteresis curves are overlap at T < 0.1 and they behave separately at T > 0.1. - Abstract: Magnetic properties of the binary Nickel/Bismuth alloy (Ni/Bi) are investigated within the effective field theory. The Ni/Bi alloy has been modeled that the rhombohedral Bi lattice is surrounded by the hexagonal Ni lattice. According to lattice locations, Bi atoms have two different magnetic properties. Bi1 atoms are in the center of the hexagonal Ni atoms (Ni/Bi1 single layer) and Bi2 atoms are between two Ni/Bi1 bilayers. The Ni, Bi1, Bi2 and Ni/Bi undergo a second-order phase transition from the ferromagnetic phase to paramagnetic phase at Tc = 1.14. The magnetizations of the Ni/Bi alloy are observed as Bi1 > Bi2 > Ni/Bi > Ni at T < Tc; hence the magnetization of the Bi1 is dominant and Ni is at least dominant. However, the total magnetization of the Ni/Bi alloy is close to magnetization of the Ni at T < Tc. The corcivities of the Ni, Bi1, Bi2 and Ni/Bi alloy are the same with each others, but the remanence magnetizations are different. Our theoretical results of M(T) and M(H) of the Ni/Bi alloy are in quantitatively good agreement with the some experimental results of binary Nickel/Bismuth systems.

  14. 75 FR 30372 - Foreign-Trade Zone 196 Temporary/Interim Manufacturing Authority ATC Logistics & Electronics... (United States)


    ... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Docket T-2-2010] Foreign-Trade Zone 196 Temporary/Interim Manufacturing Authority ATC Logistics & Electronics (Cell Phone Kitting and Distribution... filed an application submitted by the ATC Logistics & Electronics, operator of Site 2, FTZ 196...

  15. 46 CFR 196.45-1 - Master and chief engineer responsible. (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Master and chief engineer responsible. 196.45-1 Section... VESSELS OPERATIONS Carrying of Excess Steam § 196.45-1 Master and chief engineer responsible. (a) It shall be the duty of the master and the engineer in charge of the boilers of any vessel to require that a...

  16. 46 CFR 196.15-3 - Steering gear, whistle, and means of communication. (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Steering gear, whistle, and means of communication. 196... whistle, and the means of communication between the bridge or pilothouse and engineroom shall be examined... RESEARCH VESSELS OPERATIONS Test, Drills, and Inspections § 196.15-3 Steering gear, whistle, and means of...

  17. 46 CFR 196.15-15 - Examination of boilers and machinery. (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Examination of boilers and machinery. 196.15-15 Section... VESSELS OPERATIONS Test, Drills, and Inspections § 196.15-15 Examination of boilers and machinery. (a) It shall be the duty of the chief engineer when he assumes charge of the boilers and machinery of a vessel...

  18. 46 CFR 196.30-1 - Repairs to boilers and pressure vessels. (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Repairs to boilers and pressure vessels. 196.30-1... VESSELS OPERATIONS Reports of Accidents, Repairs, and Unsafe Equipment § 196.30-1 Repairs to boilers and pressure vessels. (a) Before making any repairs to boilers or unfired pressure vessels, the Chief Engineer...

  19. 32 CFR 196.210 - Military and merchant marine educational institutions. (United States)


    ... educational institutions. These Title IX regulations do not apply to an educational institution whose primary... 32 National Defense 2 2010-07-01 2010-07-01 false Military and merchant marine educational institutions. 196.210 Section 196.210 National Defense Department of Defense (Continued) OFFICE OF THE...

  20. Pharmacokinetics of metronidazole, tetracycline and bismuth in healthy volunteers after oral administration of compound tablets containing a combination of metronidazole, tetracycline hydrochloride and bismuth oxide. (United States)

    Wu, Y; Ding, L; Huang, N-Y; Wen, A-D; Liu, B; Li, W-B


    To eradicate Helicobacter pylori in human pylorus and to heal duodenal ulcers, recently, a new formulation of combination tablets containing metronidazole 125 mg, tetracycline hydrochloride 125 mg and bismuth oxide 40 mg has been developed. To investigate the pharmacokinetics of metronidazole, tetracycline and bismuth in healthy Chinese volunteers after oral administration of the test formulation. A one-sequence, 3-period study was conducted in 12 Chinese healthy volunteers (6 male, 6 female). Volunteers each received single low dose (1 tablet) under fed condition in period 1, single high dose (3 tablets) under fasted condition in period 2, and single high dose (3 tablets) and multiple doses (3 tablets at once, 4 times daily for 7 consecutive days) under fed condition in period 3. Blood samples were collected and determined over 48 h in every period. After single high dose administration under fed condition, the C max of metronidazole, tetracycline and bismuth were 6.833 ± 0.742 μg/mL, 0.8513 ± 0.1253 μg/mL and 3.32 ± 1.89 ng/mL, respectively. The C max and AUC 0-48 of metronidazole increased in proportion to the doses within the tested dose range, but tetracycline and bismuth did not. Food caused 10% and 80% decrease of the C max for metronidazole and bismuth, respectively, but did not affect tetracycline. No gender effect was found on the pharmacokinetics of the 3 ingredients. In the steady state, the C av of metronidazole, tetracycline and bismuth were 20.75 ± 3.52 μg/mL, 1.900 ± 0.243 μg/mL and 5.61 ± 1.34 ng/mL, respectively. © Georg Thieme Verlag KG Stuttgart · New York.

  1. Extraction of lanthanide elements and bismuth in molten lithium chloride-liquid bismuth-lithium alloy system

    International Nuclear Information System (INIS)

    Harada, Makoto; Adachi, Motonari; Kai, Yuichi; Koike, Kenichi


    The equilibrium distributions of neodymium and samarium between molten LiCl and liquid Bi-Li alloy were measured in a wide range of Li-mole fraction in the alloy phase, X Li . These lanthanide elements were extracted through redox reactions. In high X Li range, X Li > 0.03, the distributions of neodymium and bismuth in the salt phase increased markedly. The anomalous increase is attributed to the formation of the compound comprized of Nd, Li, Bi and oxygen in the salt phase. The reaction processes in samarium and neodymium were very fast and the extraction rates are controlled by the diffusion processes of the solutes and metallic lithium. (author)

  2. The network modifier and former role of the bismuth ions in the bismuth-lead-germanate glasses. (United States)

    Rada, M; Rus, L; Rada, S; Culea, E; Rusu, T


    The present work is focused on the enhancement of network former environment in lead-germanate glasses by bismuth ions doping. A series of bismuth-lead-germanate glasses with the xBi2O3·(100-x)[7GeO2·3PbO] composition glass where 0≤x≤30 mol% Bi2O3 were synthesized by melt-quenching method. The FTIR, UV-VIS spectroscopy and cyclic voltammetry were conducted on these samples to evaluate the doping effect of structure of the host matrix network. Our results indicate that direct incorporation of Bi2O3 into the lead-germanate network modifies the lead-germanate network and the internal structure of glass network is rearranged. The structural flexibility of the lead-germanate network is possible due to its incapacity to accommodate with the excess of oxygen atoms and the creation of bridging oxygen ions. Optical gap energy and refractive index were obtained as a function of Bi2O3 content. Gap energy values decrease as Bi2O3 content increased from 0 to 10 mol%. Further increase of Bi2O3 concentration beyond 10 mol% increased the gap energy values. These behaviors of the glass system can be explained by two mechanisms: (i) for x≤10 mol% Bi2O3--increase of degree of disorder of the host matrix because Bi2O3 is network modifier and (ii) for x>10 mol%--Bi2O3 acts as a network former. Cyclic voltammetry measurements using the glass system with 10Bi2O3·90[7GeO2·3PbO] composition as working electrode show the mobility of the lead ions, in agreement with UV-VIS data. Copyright © 2014 Elsevier B.V. All rights reserved.

  3. Spectroscopic Characterization of Extracellular Polymeric Substances from Escherichia coli and Serratia marcescens: Suppression using Sub-Inhibitory Concentrations of Bismuth Thiols

    Energy Technology Data Exchange (ETDEWEB)

    Badireddy, Appala R.; Korpol, Bhoom Reddy; Chellam, Shankararaman; Gassman, Paul L.; Engelhard, Mark H.; Lea, Alan S.; Rosso, Kevin M.


    Free and capsular EPS produced by Escherichia coli and Serratia marcescens were characterized in detail using Fourier transform infrared spectroscopy (FTIR), X-ray photoelectron spectroscopy (XPS), and Auger electron spectroscopy (AES). Total EPS production decreased upon treatment with sub-inhibitory concentrations of lipophilic bismuth thiols (bismuth dimercaptopropanol, BisBAL; bismuth ethanedithiol, BisEDT; and bismuth pyrithione, BisPYR), BisBAL being most effective. Bismuth thiols also influenced acetylation and carboxylation of polysaccharides in EPS from S. marcescens. Extensive homology between EPS samples in the presence and absence of bismuth was observed with proteins, polysaccharides, and nucleic acids varying predominantly only in the total amount expressed. Second derivative analysis of the amide I region of FTIR spectra revealed decreases in protein secondary structures in the presence of bismuth thiols. Hence, anti-fouling properties of bismuth thiols appear to originate in their ability to suppress O-acetylation and protein secondary structures in addition to total EPS secretion.

  4. Zerovalent bismuth nanoparticles inhibit Streptococcus mutans growth and formation of biofilm

    Directory of Open Access Journals (Sweden)

    Hernandez-Delgadillo R


    Full Text Available Rene Hernandez-Delgadillo1, Donaji Velasco-Arias2, David Diaz2, Katiushka Arevalo-Niño1, Marianela Garza-Enriquez1, Myriam A De la Garza-Ramos1, Claudio Cabral-Romero11Instituto de Biotecnologia, Centro de Investigacion y Desarrollo en Ciencias de la Salud, CIDICS, Facultad de Odontologia, Universidad Autonoma de Nuevo Leon, UANL, Monterrey, Nuevo Leon, 2Facultad de Quimica, Universidad Nacional Autonoma de Mexico, Distrito Federal, MexicoBackground and methods: Despite continuous efforts, the increasing prevalence of resistance among pathogenic bacteria to common antibiotics has become one of the most significant concerns in modern medicine. Nanostructured materials are used in many fields, including biological sciences and medicine. While some bismuth derivatives has been used in medicine to treat vomiting, nausea, diarrhea, and stomach pain, the biocidal activity of zerovalent bismuth nanoparticles has not yet been studied. The objective of this investigation was to analyze the antimicrobial activity of bismuth nanoparticles against oral bacteria and their antibiofilm capabilities.Results: Our results showed that stable colloidal bismuth nanoparticles had 69% antimicrobial activity against Streptococcus mutans growth and achieved complete inhibition of biofilm formation. These results are similar to those obtained with chlorhexidine, the most commonly used oral antiseptic agent. The minimal inhibitory concentration of bismuth nanoparticles that interfered with S. mutans growth was 0.5 mM.Conclusion: These results suggest that zerovalent bismuth nanoparticles could be an interesting antimicrobial agent to be incorporated into an oral antiseptic preparation.Keywords: zerovalent bismuth nanoparticles, antimicrobial agent, biofilm, Streptococcus mutans

  5. Sulfate-reducing bacteria slow intestinal transit in a bismuth-reversible fashion in mice. (United States)

    Ritz, N L; Lin, D M; Wilson, M R; Barton, L L; Lin, H C


    Hydrogen sulfide (H 2 S) serves as a mammalian cell-derived gaseous neurotransmitter. The intestines are exposed to a second source of this gas by sulfate-reducing bacteria (SRB). Bismuth subsalicylate binds H 2 S rendering it insoluble. The aim of this study was to test the hypothesis that SRB may slow intestinal transit in a bismuth-reversible fashion. Eighty mice were randomized to five groups consisting of Live SRB, Killed SRB, SRB+Bismuth, Bismuth, and Saline. Desulfovibrio vulgaris, a common strain of SRB, was administered by gavage at the dose of 1.0 × 10 9 cells along with rhodamine, a fluorescent dye. Intestinal transit was measured 50 minutes after gavage by euthanizing the animals, removing the small intestine between the pyloric sphincter and the ileocecal valve and visualizing the distribution of rhodamine across the intestine using an imaging system (IVIS, Perkin-Elmer). Intestinal transit (n=50) was compared using geometric center (1=minimal movement, 100=maximal movement). H 2 S concentration (n=30) was also measured when small intestinal luminal content was allowed to generate this gas. The Live SRB group had slower intestinal transit as represented by a geometric center score of 40.2 ± 5.7 when compared to Saline: 73.6 ± 5.7, Killed SRB: 77.9 ± 6.9, SRB+Bismuth: 81.0 ± 2.0, and Bismuth: 73.3 ± 4.2 (Pfashion in mice. Our results demonstrate that intestinal transit is slowed by SRB and this effect could be abolished by H 2 S-binding bismuth. © 2016 John Wiley & Sons Ltd.

  6. [Geochemical distribution of dissolved bismuth in the Yellow Sea and East China Sea]. (United States)

    Wu, Xiao-Dan; Song, Jin-Ming; Wu, Bin; Li, Xue-Gang


    Occurrence level, geochemical distribution of dissolved bismuth and its coupling relationship to eco-environment were investigated in the Yellow Sea and East China Sea to explore the source and influencing factors. The results showed that the concentration of dissolved bismuth was within the range of 0-0. 029 microg x L(-1) at the surface and 0.001-0.189 microg x L(-1) at the bottom, with the averages of 0.008 and 0.016 microg x L(-1), respectively. Horizontally, low value of dissolved bismuth exhibited the bidirectional extension feature, indicating that it could trace the path of Changjiang Diluted Water. High value of dissolved bismuth was observed where the Subei Costal Current and Yellow Sea Warm Current flowed and the Changjiang Diluted Water and Zhejiang-Fujian Coastal Current met, suggesting that it was controlled by the cycle of current system. Vertically, the coastal water was fully mixed by water convection and eddy mixing, and was divided from the stratified water by strong tidal front, which blocked the transport of dissolved bismuth to the open sea. Thus, the concentration in front area was significantly higher than that in the open sea. Diurnal variation of dissolved bismuth was related to the hydrodynamic conditions (tide, suspension and thermocline) instead of the environmental factors (temperature and salinity). Positive relationship to SPM (suspended particulate matter) clarified that bismuth was prone to release from solid phase to liquid phase. Furthermore, conditions with temperature ranging 22-27 degrees C, salinity ranging 28-31 and pH ranging 7.9-8.1 were shown to be optimal for the release process.

  7. New bismuth borophosphate Bi4BPO10: Synthesis, crystal structure, optical and band structure analysis

    International Nuclear Information System (INIS)

    Babitsky, Nicolay A.; Leshok, Darya Y.; Mikhaleva, Natalia S.; Kuzubov, Aleksandr A.; Zhereb, Vladimir P.; Kirik, Sergei D.


    New bismuth borophosphate Bi 4 BPO 10 was obtained by spontaneous crystallization from the melt of correspondent composition at 804 °C. Crystal structure with orthorhombic lattice parameters: a = 22.5731(3) Å, b = 14.0523(2) Å, c = 5.5149(1) Å, V = 1749.34(4), Z = 8, SG Pcab was determined by X-ray powder diffraction technique. The [Bi 2 O 2 ] 2+ -layers, which are typical for bismuth oxide compounds, transform into cationic endless strips of 4 bismuth atoms width directed along the c-axis in Bi 4 BPO 10 . The strips combining stacks are separated by flat triangle [BO 3 ] 3− -anions within stacks. Neighboring stacks are separated by tetrahedral [PO 4 ] 3− -anions and shifted relatively to each other. Bismuth atoms are placed in 5–7 vertex oxygen irregular polyhedra. Bi 4 BPO 10 is stable up to 812 °C, then melts according to the peritectic law. The absorption spectrum in the range 350–700 nm was obtained and the width of the forbidden band was estimated as 3.46 eV. The band electronic structure of Bi 4 BPO 10 was modeled using DFT approach. The calculated band gap (3.56 eV) is in good agreement with the experimentally obtained data. - Graphical abstract: Display Omitted - Highlights: • New bismuth borophosphate with composition Bi 4 BPO 10 was synthesized. • The crystal structure was determined by X-ray powder diffraction technique. • Bismuth-oxygen part [Bi 4 O 3 ] 6+ forms endless strips of 4 bismuth atoms width. • Electronic structure was modeled by DFT method. • The calculated band gap (3.56 eV) is very close to the experimental one (3.46 eV)

  8. MicroRNA-196b promotes cell proliferation and suppress cell differentiation in vitro

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Donglin, E-mail:; Hu, Liangshan; Lei, Da; Fang, Xiaolin; Zhang, Zhihong; Wang, Ting; Lin, Maorui; Huang, Jiwei; Yang, Huawen; Zhou, Xuan; Zhong, Limei


    Highlights: • miRNA-196b increases proliferation and blocks differentiation of progenitor cell. • miRNA-196b inhibits apoptosis and increases viability of cells lines. • Forced expression of miR-196b blocks the differentiation of THP1 induced by PMA. - Abstract: MicroRNA-196b (miR-196b) is frequently amplified and aberrantly overexpressed in acute leukemias. To investigate the role of miR-196b in acute leukemias, it has been observed that forced expression of this miRNA increases proliferation and inhibits apoptosis in human cell lines. More importantly, we show that this miRNA can significantly increase the colony-forming capacity of mouse normal bone marrow progenitor cells alone, as well as partially blocking the cells from differentiation. Taken together, our studies suggest that miRNA-196b may play an essential role in the development of MLL-associated leukemias through inhibiting cell differentiation and apoptosis, while promoting cell proliferation.

  9. Photoinduced switchable wettability of bismuth coating with hierarchical dendritic structure between superhydrophobicity and superhydrophilicity

    Energy Technology Data Exchange (ETDEWEB)

    Su, Chunping; Lu, Zhong; Zhao, Huiping; Yang, Hao, E-mail:; Chen, Rong, E-mail:


    Graphical abstract: - Highlights: • Hierarchical bismuth nanostructures were synthesized by galvanic replacement reaction. • The bismuth coating shows superhydrophobicity after being modified by stearic acid. • Wetting transition could be realized by alternation of irradiation and modification. - Abstract: Special wettability such as superhydrophobicity and superhydrophilicity has aroused considerable attention in recent years, especially for the surface that can be switched between superhydrophobicity and superhydrophilicity. In this work, hierarchical bismuth nanostructures with hyperbranched dendritic architectures were synthesized via the galvanic replacement reaction between zinc plate and BiCl{sub 3} in ethylene glycol solution, which was composed of a trunk, branches (secondary branch), and leaves (tertiary branch). After being modified by stearic acid, the as-prepared bismuth coating shows superhydrophobicity with a high water contact angle of 164.8° and a low sliding angle of 3°. More importantly, a remarkable surface wettability transition between superhydrophobicity and superhydrophilicity could be easily realized by the alternation of UV–vis irradiation and modification with stearic acid. The tunable wetting behavior of bismuth coating could be used as smart materials to make a great application in practice.

  10. Bismuth Modified Carbon-Based Electrodes for the Determination of Selected Neonicotinoid Insecticides

    Directory of Open Access Journals (Sweden)

    Marko Rodić


    Full Text Available Two types of bismuth modified electrodes, a bismuth-film modified glassy carbon (BiF-GCE and a bismuth bulk modified carbon paste, were applied for the determination of selected nitroguanidine neonicotinoid insecticides. The method based on an ex situ prepared BiF-GCE operated in the differential pulse voltammetric (DPV mode was applied to determine clothianidin in the concentration range from 2.5 to 23 μg cm−3 with a relative standard deviation (RSD not exceeding 1.5%. The tricresyl phosphate-based carbon paste electrodes (TCP-CPEs, bulk modified with 5 and 20 w/w% of bismuth, showed a different analytical performance in the determination of imidacloprid, regarding the peak shape, potential window, and noise level. The TCP-CPE with 5% Bi was advantageous, and the developed DPV method based on it allowed the determination in the concentration range from 1.7 to 60 μg cm−3 with an RSD of 2.4%. To get a deeper insight into the morphology of the bismuth-based sensor surfaces, scanning electron microscopic measurements were performed of both the surface film and the bulk modified electrodes.

  11. Bismuth nanoparticles synthesized by laser ablation in lubricant oils for tribological tests

    Energy Technology Data Exchange (ETDEWEB)

    Flores-Castañeda, M., E-mail: [Universidad Autónoma del Estado de México, Av. Instituto Literario No. 100, Oriente Col. Centro, Toluca, Estado de México C.P. 50000, México (Mexico); Instituto Nacional de Investigaciones Nucleares, Carretera México-Toluca s/n, La Marquesa, Ocoyoacac, Edo. de México C.P. 52750, México (Mexico); Camps, E. [Instituto Nacional de Investigaciones Nucleares, Carretera México-Toluca s/n, La Marquesa, Ocoyoacac, Edo. de México C.P. 52750, México (Mexico); Camacho-López, M. [Universidad Autónoma del Estado de México, Av. Instituto Literario No. 100, Oriente Col. Centro, Toluca, Estado de México C.P. 50000, México (Mexico); Muhl, S. [Instituto de Investigación en Materiales (UNAM), Circuito Exterior, Ciudad Universitaria, Coyoacán, 04510 México, D.F., México (Mexico); and others


    Highlights: • Bismuth nanoparticles have been obtained by laser ablation of solids in liquids. • The technique allows controlling the size and concentration of the samples. • Bi np’s in base oils can improve the tribological characteristics of the lubricant. - Abstract: The improvement of the tribological properties of mineral base oils through the addition of bismuth nanoparticles as an additive, together with the idea of obtaining lubricants free of heavy metals, was evaluated. Bismuth nanoparticles were produced directly in the heavy and light viscosity mineral base oils (BS900 and BS6500) using the technique of laser ablation of solids immersed in liquids. Transmission electron microscopy measurements showed the presence of pure bismuth nanoparticles. Small Angle X-ray Scattering (SAXS) measurements showed that the average size of the nanoparticles was between 7 and 65 nm depending on the experimental conditions used. The tribological properties of the base oil with the bismuth nanoparticles additives were evaluated using a four-ball tester. Tests were performed using the base oil with and without Bi nanoparticles. It was observed that the coefficient of friction of the oil decrease with an increasing concentration of the nanoparticles. The results also showed that the wear rate was reduced when the Bi nanoparticle additives were used.

  12. Facile solvothermal synthesis of a graphene nanosheet-bismuth oxide composite and its electrochemical characteristics

    Energy Technology Data Exchange (ETDEWEB)

    Wang Huanwen [Key Laboratory of Eco-Environment-Related Polymer Materials of Ministry of Education, Key Laboratory of Polymer Materials of Gansu Province, College of Chemistry and Chemical Engineering, Northwest Normal University, Lanzhou 730070 (China); Hu Zhongai, E-mail: [Key Laboratory of Eco-Environment-Related Polymer Materials of Ministry of Education, Key Laboratory of Polymer Materials of Gansu Province, College of Chemistry and Chemical Engineering, Northwest Normal University, Lanzhou 730070 (China); Chang Yanqin; Chen Yanli; Lei Ziqiang; Zhang Ziyu; Yang Yuying [Key Laboratory of Eco-Environment-Related Polymer Materials of Ministry of Education, Key Laboratory of Polymer Materials of Gansu Province, College of Chemistry and Chemical Engineering, Northwest Normal University, Lanzhou 730070 (China)


    This work demonstrates a novel and facile route for preparing graphene-based composites comprising of metal oxide nanoparticles and graphene. A graphene nanosheet-bismuth oxide composite as electrode materials of supercapacitors was firstly synthesized by thermally treating the graphene-bismuth composite, which was obtained through simultaneous solvothermal reduction of the colloidal dispersions of negatively charged graphene oxide sheets in N,N-dimethyl formamide (DMF) solution of bismuth cations at 180 {sup o}C. The morphology, composition, and microstructure of the composites together with pure graphite oxide, and graphene were characterized using powder X-ray diffraction (XRD), FT-IR, field emission scanning electron microscopy (FESEM), transmission electron microscope (TEM), thermogravimetry and differential thermogravimetry (TG-DTG). The electrochemical behaviors were measured by cyclic voltammogram (CV), galvanostatic charge-discharge and electrochemical impedance spectroscopy (EIS). The specific capacitance of 255 F g{sup -1} (based on composite) is obtained at a specific current of 1 A g{sup -1} as compared with 71 F g{sup -1} for pure graphene. The loaded-bismuth oxide achieves a specific capacitance as high as 757 F g{sup -1} even at 10 A g{sup -1}. In addition, the graphene nanosheet-bismuth oxide composite electrode exhibits the excellent rate capability and well reversibility.

  13. How reliable are environmental data on 'orphan' elements? The case of bismuth concentrations in surface waters. (United States)

    Filella, Montserrat


    Like all elements of the periodic table, bismuth is ubiquitously distributed throughout the environment as a result of natural processes and human activities. It is present as Bi(III) in environmental, biological and geochemical samples. Although bismuth and its compounds are considered to be non-toxic to humans, its increasing use as a replacement for lead has highlighted how little is known about its environmental and ecotoxicological behaviour. In this first critical review paper on the existing information on bismuth occurrence in natural waters, 125 papers on fresh and marine waters have been collated. Although the initial objective of this study was to establish the range of the typical concentrations of total dissolved bismuth in natural waters, this proved impossible to achieve due to the wide, and hitherto unexplained, dispersion of published data. Since analytical limitations might be one of the reasons underlying value dispersion, new analytical methods published since 2000--intended to be applied to natural waters--have also been reviewed. Disappointingly, the detection limits of the bulk of them are well above those required; they are thus of limited usefulness. Analysis of the existing information on bismuth in secondary references (i.e., books, review chapters) and on its chemical speciation in seawater revealed that the uncritical reproduction of old data is a widespread practice.

  14. Emulsion liquid membrane for selective extraction of bismuth from nitrate medium

    International Nuclear Information System (INIS)

    Mokhtari, Bahram; Pourabdollah, Kobra


    The novelty of this work is the selective extraction of bismuth ions from nitrate medium by emulsion liquid membrane. Di(2-ethylhexyl)phosphoric acid was used as extractant of bismuth ions from nitrate medium by emulsion liquid membrane, and Triton X-100 was used as the biodegradable surfactant in n-pentanol n-pentanol bulk membrane. The extraction of bismuth ions was evaluated by the yield of extraction. The experimental parameters were evaluated and were optimized. They included the ratio of di(2-ethylhexyl)phosphoric acid concentration to the concentration of /Triton X-100 concentration (1.0 : 0.5% w/w), nature of diluents (n-pentanol), nature and concentration of the stripping solution (sulfuric acid, 0.5M), stirring speed (1,800 rpm) and equilibrium time of extraction (20min), initial feed solution of bismuth (350 ppm) and the volume ratio of the internal stripping phase to the membrane phase (14 times). The experimental parameters of kinetic extraction revealed that the bismuth ions were extracted at 100% 97%

  15. Emulsion liquid membrane for selective extraction of bismuth from nitrate medium

    Energy Technology Data Exchange (ETDEWEB)

    Mokhtari, Bahram; Pourabdollah, Kobra [Islamic Azad University, Shahreza (Iran, Islamic Republic of)


    The novelty of this work is the selective extraction of bismuth ions from nitrate medium by emulsion liquid membrane. Di(2-ethylhexyl)phosphoric acid was used as extractant of bismuth ions from nitrate medium by emulsion liquid membrane, and Triton X-100 was used as the biodegradable surfactant in n-pentanol n-pentanol bulk membrane. The extraction of bismuth ions was evaluated by the yield of extraction. The experimental parameters were evaluated and were optimized. They included the ratio of di(2-ethylhexyl)phosphoric acid concentration to the concentration of /Triton X-100 concentration (1.0 : 0.5% w/w), nature of diluents (n-pentanol), nature and concentration of the stripping solution (sulfuric acid, 0.5M), stirring speed (1,800 rpm) and equilibrium time of extraction (20min), initial feed solution of bismuth (350 ppm) and the volume ratio of the internal stripping phase to the membrane phase (14 times). The experimental parameters of kinetic extraction revealed that the bismuth ions were extracted at 100% 97%.

  16. Recent Advances in Bismuth-Based Nanomaterials for Photoelectrochemical Water Splitting. (United States)

    Bhat, Swetha S M; Jang, Ho Won


    In recent years, bismuth-based nanomaterials have drawn considerable interest as potential candidates for photoelectrochemical (PEC) water splitting owing to their narrow band gaps, nontoxicity, and low costs. The unique electronic structure of bismuth-based materials with a well-dispersed valence band comprising Bi 6s and O 2p orbitals offers a suitable band gap to harvest visible light. This Review presents significant advancements in exploiting bismuth-based nanomaterials for solar water splitting. An overview of the different strategies employed and the new ideas adopted to improve the PEC performance of bismuth-based nanomaterials are discussed. Morphology control, the construction of heterojunctions, doping, and co-catalyst loading are several approaches that are implemented to improve the efficiency of solar water splitting. Key issues are identified and guidelines are suggested to rationalize the design of efficient bismuth-based materials for sunlight-driven water splitting. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. Electrochemical study on determination of diffusivity, activity and solubility of oxygen in liquid bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Ganesan, Rajesh [Liquid Metals and Structural Chemistry Division, Chemistry Group, Indira Gandhi Centre for Atomic Research, Kalpakkam 603 102 (India); Gnanasekaran, T. [Liquid Metals and Structural Chemistry Division, Chemistry Group, Indira Gandhi Centre for Atomic Research, Kalpakkam 603 102 (India)]. E-mail:; Srinivasa, Raman S. [Department of Metallurgical Engineering and Materials Science, Indian Institute of Technology Bombay, Mumbai 400 076 (India)


    Diffusivity of oxygen in liquid bismuth was measured by potentiostatic method and is given bylg(D{sub O}{sup Bi}/cm{sup 2}.s{sup -1})(+/-0.042)=-3.706-1377/(TK{sup -1})(804bismuth was determined by coulometric titrations and using the measured data standard free energy of dissolution of oxygen in liquid bismuth was derived for the reaction:1/2O{sub 2}(g)=[O]{sub Bi}(at.%)and is given by{delta}G{sub O(Bi)}{sup o}/(J.g-atomO{sup -1})(+/-720)=-108784+20.356TK{sup -1}(753bismuth was derived as a function of temperature and is given by the following expressions:lg(S/at%O)(+/-0.05)=-4476/TK{sup -1}+4.05(753bismuth is compared with the literature data.

  18. Characterization and re-activation of oxygen sensors for use in liquid lead-bismuth

    International Nuclear Information System (INIS)

    Kurata, Yuji; Abe, Yuji; Futakawa, Masatoshi; Oigawa, Hiroyuki


    Control of oxygen concentration in liquid lead-bismuth is one of the most important tasks to develop accelerator driven systems. In order to improve the reliability of oxygen sensors, re-activation treatments were investigated as well as characterization of oxygen sensors for use in liquid lead-bismuth. The oxygen sensor with a solid electrolyte of yttria-stabilized zirconia and a Pt/gas reference electrode showed almost the same electromotive force values in gas and liquid lead-bismuth, respectively, as the theoretical ones at temperatures above 400 deg. C or 450 deg. C. After long-term use of 6500 h, the outputs of the sensor became incorrect in liquid lead-bismuth. The state of the sensor that indicated incorrect outputs could not be recovered by cleaning with a nitric acid. However, it was found that the oxygen sensor became a correct sensor indicating theoretical values in liquid lead-bismuth after re-activation by the Pt-treatment of the outer surface of the sensor.

  19. Crystallinity and electrical properties of neodymium-substituted bismuth titanate thin films

    International Nuclear Information System (INIS)

    Chen, Y.-C.; Hsiung, C.-P.; Chen, C.-Y.; Gan, J.-Y.; Sun, Y.-M.; Lin, C.-P.


    We report on the properties of Nd-substituted bismuth titanate Bi 4-x Nd x Ti 3 O 12 (BNdT) thin films for ferroelectric non-volatile memory applications. The Nd-substituted bismuth titanate thin films fabricated by modified chemical solution deposition technique showed much improved properties compared to pure bismuth titanate. A pyrochlore free crystalline phase was obtained at a low annealing temperature of 640 deg. C and grain size was found to be considerably increased as the annealing temperature increased. The film properties were found to be strongly dependent on the Nd content and annealing temperatures. The measured dielectric constant of BNdT thin films was in the range 172-130 for Bi 4-x Nd x Ti 3 O 12 with x 0.0-0.75. Ferroelectric properties of Nd-substituted bismuth titanate thin films were significantly improved compared to pure bismuth titanate. For example, the observed 2P r and E c for Bi 3.25 Nd 0.75 Ti 3 O 12 , annealed at 680 deg. C, were 38 μC/cm 2 and 98 kV/cm, respectively. The improved microstructural and ferroelectric properties of BNdT thin films suggest their suitability for high density ferroelectric random access memory applications

  20. Bismuth nanoparticles synthesized by laser ablation in lubricant oils for tribological tests

    International Nuclear Information System (INIS)

    Flores-Castañeda, M.; Camps, E.; Camacho-López, M.; Muhl, S.


    Highlights: • Bismuth nanoparticles have been obtained by laser ablation of solids in liquids. • The technique allows controlling the size and concentration of the samples. • Bi np’s in base oils can improve the tribological characteristics of the lubricant. - Abstract: The improvement of the tribological properties of mineral base oils through the addition of bismuth nanoparticles as an additive, together with the idea of obtaining lubricants free of heavy metals, was evaluated. Bismuth nanoparticles were produced directly in the heavy and light viscosity mineral base oils (BS900 and BS6500) using the technique of laser ablation of solids immersed in liquids. Transmission electron microscopy measurements showed the presence of pure bismuth nanoparticles. Small Angle X-ray Scattering (SAXS) measurements showed that the average size of the nanoparticles was between 7 and 65 nm depending on the experimental conditions used. The tribological properties of the base oil with the bismuth nanoparticles additives were evaluated using a four-ball tester. Tests were performed using the base oil with and without Bi nanoparticles. It was observed that the coefficient of friction of the oil decrease with an increasing concentration of the nanoparticles. The results also showed that the wear rate was reduced when the Bi nanoparticle additives were used

  1. Tailored versus Triple plus Bismuth or Concomitant Therapy as Initial Helicobacter pylori Treatment: A Randomized Trial. (United States)

    Zhou, Liya; Zhang, Jianzhong; Song, Zhiqiang; He, Lihua; Li, Yanqing; Qian, Jiaming; Bai, Peng; Xue, Yan; Wang, Ye; Lin, Sanren


    With markedly increased antibiotic resistance and unsatisfactory efficacies of common empiric eradication regimens in the mainland of China, tailored therapy may be the best choice to achieve good efficacy. This study compared the eradication rates, safety, and compliance of tailored therapy to those of triple therapy plus bismuth and concomitant therapy in the naïve patients with Helicobacter pylori infection. Between September 2013 and April 2014, 1050 patients with H. pylori infection at three tertiary hospitals were randomly assigned to 10-day treatment with tailored, triple plus bismuth, or concomitant regimens. In tailored therapy, medications were adjusted according to clarithromycin sensitivity and cytochrome P450 isoenzyme 2C19 genotype. The antimicrobial susceptibility testing (E test) was performed. Eradication status was assessed 4-12 weeks after treatment. The eradication rate was significantly higher in tailored group than in triple plus bismuth and concomitant groups in both intention-to-treat (88.7 vs 77.4 vs 78.3%, p bismuth and 75.9, 87.2, 92.9, and 95.2% in concomitant therapy, respectively. First-line tailored therapy achieves significantly higher eradication rates and fewer side effects, compared to triple therapy plus bismuth and concomitant therapy in a setting with high rates of clarithromycin and metronidazole resistance. © 2015 John Wiley & Sons Ltd.

  2. Comparison of Second-Line Quadruple Therapies with or without Bismuth for Helicobacter pylori Infection. (United States)

    Jheng, Guang-Hong; Wu, I-Chen; Shih, Hsiang-Yao; Wu, Meng-Chieh; Kuo, Fu-Chen; Hu, Huang-Ming; Liu, Chung-Jung; Hsu, Wen-Hung; Hu, Chi-Tan; Bair, Ming-Jong; Kuo, Chao-Hung; Wu, Deng-Chyang; Hsu, Ping-I


    The bismuth-based quadruple regimen has been applied in Helicobacter pylori rescue therapy worldwide. The non-bismuth-based quadruple therapy or "concomitant therapy" is an alternative option in first-line eradication but has not been used in second-line therapy. Discovering a valid regimen for rescue therapy in bismuth-unavailable countries is important. We conducted a randomized controlled trial to compare the efficacies of the standard quadruple therapy and a modified concomitant regimen. One hundred and twenty-four patients were randomly assigned into two groups: RBTM (rabeprozole 20 mg bid., bismuth subcitrate 120 mg qid, tetracycline 500 mg qid, and metronidazole 250 mg qid) and RATM (rabeprozole 20 mg bid., amoxicillin 1 g bid., tetracycline 500 mg qid, and metronidazole 250 mg qid) for 10 days. The eradication rate of the RBTM and RATM regimen was 92.1% and 90.2%, respectively, in intention-to-treat analysis. Patients in both groups had good compliance (~96%). The overall incidence of adverse events was higher in the RATM group (42.6% versus 22.2%, P = 0.02), but only seven patients (11.5%) experienced grades 2-3 events. In conclusion, both regimens had good efficacy, compliance, and acceptable side effects. The 10-day RATM treatment could be an alternative rescue therapy in bismuth-unavailable countries.

  3. Role of bismuth in improving Helicobacter pylori eradication with triple therapy. (United States)

    Dore, Maria Pina; Lu, Hong; Graham, David Y


    In most regions of the world, antimicrobial resistance has increased to the point where empirical standard triple therapy for Helicobacter pylorieradication is no longer recommended. The treatment outcome in a population is calculated as the sum of the treatment success in the subpopulation with susceptible infections plus treatment success in the subpopulation with resistant infections. The addition of bismuth (i.e., 14-day triple therapy plus bismuth) can improve cure rates despite a high prevalence of antimicrobial resistance. The major bismuth effect is to add an additional 30%-40% to the success with resistant infections. The overall result is therefore dependent on the prevalence of resistance and the treatment success in the subpopulation with resistant infections (eg, with proton-pump inhibitor-amoxicillin dual therapy). Here, we explore the contribution of each component and the mechanisms of how bismuth might enhance the effectiveness of triple therapy. We also discuss the limitations of this approach and provide suggestions how triple therapy plus bismuth might be further improved. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to

  4. Composition dependence of the ferroelectric properties of lanthanum-modified bismuth titanate thin films grown by using pulsed-laser deposition

    CERN Document Server

    Bu, S D; Park, B H; Noh, T W


    Lanthanum-modified bismuth titanate, Bi sub 4 sub - sub x La sub x Ti sub 3 O sub 1 sub 2 (BLT), thin films with a La concentration of 0.25<=x<=1.00 were grown on Pt/Ti/SiO sub 2 /Si substrates by using pulsed-laser deposition. The BLT films showed well-saturated polarization-electric field curves whose remnant polarizations were 16.1 mu C/cm sup 2 , 27.8 mu C/cm sup 2 , 19.6 mu C/cm sup 2 , and 2.7 mu C/cm sup 2 , respectively, for x=0.25, 0.05, 0.75, and 1.00. The fatigue characteristics became better with increasing x up to 0.75. The Au/BLT/Pt capacitor with a La concentration of 0.50 showed an interesting dependence of the remanent polarization on the number of repetitive read/write cycles. On the other hand, the capacitor with a La concentration of 0.75 showed fatigue-free characteristics.

  5. The development of a bismuth feed system for the very high Isp thruster with anode layer VHITAL program (United States)

    Marrese-Reading, Colleen; Markusic, Tom; Polzin, Kurt; Knowles, Timothy; Mueller, Juergen


    A bismuth feed system was developed for the VHITAL Program to deliver 8-12 mg/s of bismuth vapor at a few Torr to the VHITAL-160. A carbon vaporizer developed to control vapor flow rates to the thruster.

  6. The safety and efficacy of ranitidine bismuth citrate in combination with antibiotics for the eradication of Helicobacter pylori

    NARCIS (Netherlands)

    Wyeth, J. W.; Pounder, R. E.; Duggan, A. E.; O'Morain, C. A.; Schaufelberger, H. D.; de Koster, E. H.; Rauws, E. A.; Bardhan, K. D.; Gilvarry, J.; Buckley, M. J.; Gummett, P. A.; Logan, R. P.


    Ranitidine bismuth citrate is a novel salt of ranitidine and a bismuth citrate complex. It has intrinsic antisecretory and anti-Helicobacter pylori activity, but monotherapy rarely eradicates H. pylori infection in man. A pilot study to investigate rates of H. pylori eradication achieved by

  7. Enhancement of the thermoelectric performance of oxygen substituted bismuth telluride (United States)

    Van Quang, Tran; Kim, Miyoung


    We carried out first-principles calculations based on density functional theory and the semi-classical Boltzmann transport theory to study the effect of oxygen substitution on the electronic structure and thermoelectric properties of bismuth telluride. The newly formed compound, Bi2O2Te, is found to be a narrow bandgap semiconductor with the bandgap of Eg = 0.13 eV. The presence of a flat band close to the valence band maximum gives rise to a steep slope of density of states near Fermi energy, leading to a significant enhancement of the Seebeck coefficient. As a result, the thermoelectric power factor of Bi2O2Te is significantly improved by controlling the carrier concentration, and the maximum power factor increased with temperature. Assuming the experiment-thermal conductivity, Bi2O2Te exhibits a high figure of merit of ZT ˜1.27 around 600 K for the p-type doping, which matches or exceeds ZT of the state-of-the-art thermoelectric materials in this temperature range. This suggests that Bi2O2Te with p-type doping is a new promising material for use in the moderate-temperature thermoelectric energy conversion.

  8. Structural investigation of Zn doped sodium bismuth borate glasses

    Energy Technology Data Exchange (ETDEWEB)

    Bhatia, V., E-mail:; Kumar, D. [Department of Physics, Punjabi University Patiala (India); Singh, D.; Singh, S. P. [Department of Physics, SGGSW University, Fatehgarh Sahib (India)


    A series of Bismuth Borate Oxide Glass samples with composition x(ZnO):(15-x)Na{sub 2}O:15Bi{sub 2}O{sub 3}:70B{sub 2}O{sub 3} (variation in x is from 6 to 12 mole %) have been prepared by conventional melt quenching technique. All the chemicals used were of Analytical Grade. In order to verify the amorphous nature of the prepared samples the X-Ray Diffraction (XRD) was done. The physical and structural properties have been explored by using the techniques such as density, molar volume and FTIR in order to understand the effect of alkali and transition metal ions on the structure of these glasses. The results obtained by these techniques are in good agreement to one another and with literature as well. With the increase in the content of ZnO, the increase in density and some variations in structural coordination (ratio of BO{sub 3} & BO{sub 4} structural units) have been observed.

  9. Synthesis and characterization of bismuth zinc niobate pyrochlore nanopowders

    Directory of Open Access Journals (Sweden)

    Sonia Maria Zanetti


    Full Text Available Bismuth zinc niobate pyrochlores Bi1.5ZnNb1.5O7 (alpha-BZN, and Bi2(Zn1/3Nb2/32O 7 (beta-BZN have been synthesized by chemical method based on the polymeric precursors. The pyrochlore phase was investigated by differential scanning calorimetry, infrared spectroscopy, and X ray diffraction. Powder and sintered pellets morphology was examined by scanning electron microscopy. The study of alpha-BZN phase formation reveals that, at 500 °C, the pyrochlore phase was already present while a single-phased nanopowder was obtained after calcination at 700 °C. The crystallization mechanism of the beta-BZN is quite different, occurring through the crystallization of alpha-BZN and BiNbO4 intermediary phases. Both compositions yielded soft agglomerated powders. alpha-BZN pellets, sintered at 800 °C for 2 hours, presented a relative density of 97.3% while those of beta-BZN, sintered at 900 °C for 2 hours, reached only 91.8%. Dielectric constant and dielectric loss, measured at 1 MHz, were 150 and 4 x/10-4 for a-BZN, and 97 and 8 x 10-4 for beta-BZN.

  10. Ferroelectric and photocatalytic behavior of bismuth ferrite nano wire (United States)

    William, R. V.; Marikani, A.; Madhavan, D.


    Multiferroic bismuth ferrite nanowires are prepared through polyol method with an average diameter of 35 nm with a narrow size distribution. The band gap was determined to be 2.10 eV, indicating their potential application as visible-light-response photo catalyst. The magnificent photocatalytic behaviors of BiFeO3 nanowires are understood from the methyl violet degradation under visible light irradiation. Moreover, the nano-wire takes only a lesser time for the diffusion of electron-hole pair from the surface of the sample. Further the BiFeO3 nano-wire was characterized using XRD, SEM, and U-V. The ferroelectric studies of BiFeO3 nano-wire show a frequency dependent property and maximum coercivity of 2.7 V/cm were achieved with a remanent polarization at 0.5 µC/cm2 at the frequency 4 kHz. The coercivity of BiFeO3 nano wire changes with variation of frequency from 1 kHz to 4 kHz.

  11. Ferroelectric and photocatalytic behavior of bismuth ferrite nano wire

    Energy Technology Data Exchange (ETDEWEB)

    William, R. V.; Marikani, A., E-mail: [Department of Physics, Mepco Schlenk Engineering College, Sivakasi – 626 005, Tamil Nadu (India); Madhavan, D. [Department of Chemistry, Mepco Schlenk Engineering College, Sivakasi – 626 005, Tamil Nadu (India)


    Multiferroic bismuth ferrite nanowires are prepared through polyol method with an average diameter of 35 nm with a narrow size distribution. The band gap was determined to be 2.10 eV, indicating their potential application as visible-light-response photo catalyst. The magnificent photocatalytic behaviors of BiFeO{sub 3} nanowires are understood from the methyl violet degradation under visible light irradiation. Moreover, the nano-wire takes only a lesser time for the diffusion of electron-hole pair from the surface of the sample. Further the BiFeO{sub 3} nano-wire was characterized using XRD, SEM, and U-V. The ferroelectric studies of BiFeO{sub 3} nano-wire show a frequency dependent property and maximum coercivity of 2.7 V/cm were achieved with a remanent polarization at 0.5 µC/cm{sup 2} at the frequency 4 kHz. The coercivity of BiFeO{sub 3} nano wire changes with variation of frequency from 1 kHz to 4 kHz.

  12. Process dependent thermoelectric properties of EDTA assisted bismuth telluride

    Energy Technology Data Exchange (ETDEWEB)

    Kulsi, Chiranjit; Banerjee, Dipali, E-mail: [Department of Physics, Indian Institute of Engineering Science and Technology, Shibpur, Howrah-711103, West Bengal (India); Kargupta, Kajari [Chemical Engineering Department, Jadavpur University, Kolkata-700032, West Bengal (India)


    Comparison between the structure and thermoelectric properties of EDTA (Ethylene-diamine-tetra-acetic acid) assisted bismuth telluride prepared by electrochemical deposition and hydrothermal route is reported in the present work. The prepared samples have been structurally characterized by high resolution X-ray diffraction spectra (HRXRD), field emission scanning electron microscopy (FESEM) and high resolution transmission electron microscopic images (HRTEM). Crystallite size and strain have been determined from Williamson-Hall plot of XRD which is in conformity with TEM images. Measurement of transport properties show sample in the pellet form (S{sub 1}) prepared via hydrothermal route has higher value of thermoelectric power (S) than the electrodeposited film (S{sub 2}). But due to a substantial increase in the electrical conductivity (σ) of the film (S{sub 2}) over the pellet (S{sub 1}), the power factor and the figure of merit is higher for sample S{sub 2} than the sample S{sub 1} at room temperature.

  13. Characterization of electrodeposited bismuth-tellurium nanowires and nanotubes

    Energy Technology Data Exchange (ETDEWEB)

    Pinisetty, D. [Department of Mechanical Engineering, Louisiana State University, Baton Rouge, LA 70803 (United States); Davis, D. [Department of Chemical Engineering, Louisiana Tech University, Ruston, LA 71272 (United States); Podlaha-Murphy, E.J. [Department of Chemical Engineering, Northeastern University, Boston, MA 02115 (United States); Murphy, M.C. [Department of Mechanical Engineering, Louisiana State University, Baton Rouge, LA 70803 (United States); Karki, A.B.; Young, D.P. [Department of Physics and Astronomy, Louisiana State University, Baton Rouge, LA 70803 (United States); Devireddy, R.V., E-mail: [Department of Mechanical Engineering, Louisiana State University, Baton Rouge, LA 70803 (United States)


    Arrays of nanowires and nanotubes of bismuth-tellurium (Bi-Te) were fabricated by electrodeposition techniques. Scanning electron microscopy was employed to characterize the morphology of the fabricated BiTe nanowires and nanotubes. The fabricated BiTe nanowire and nanotube arrays are shown to be polycrystalline with no preferred orientation. Wavelength dispersive spectroscopy analysis shows that either p-type (Bi rich) or n-type (Te rich) nanowires or nanotubes can be obtained by changing the electrodeposition potentials. The lamellar thickness of the nanowires and nanotube crystallites were determined using the Scherrer equation and found to be {approx}17-24 nm. The Seebeck coefficient measurements at room temperature obtained for the nanowires and nanotubes deposited at -400 mV were +11.5 and +17 {mu}V K{sup -1}, respectively, whereas those obtained at -65 mV were -48 and -63 {mu}V K{sup -1}, respectively. The electrical resistance measurements indicated that the resistance of the nanowires and nanotubes decreased with increasing temperature, suggesting that these nanostructures behave like semiconductors.

  14. Modular Lead-Bismuth Fast Reactors in Nuclear Power

    Directory of Open Access Journals (Sweden)

    Vladimir Petrochenko


    Full Text Available On the basis of the unique experience of operating reactors with heavy liquid metal coolant–eutectic lead-bismuth alloy in nuclear submarines, the concept of modular small fast reactors SVBR-100 for civilian nuclear power has been developed and validated. The features of this innovative technology are as follows: a monoblock (integral design of the reactor with fast neutron spectrum, which can operate using different types of fuel in various fuel cycles including MOX fuel in a self-providing mode. The reactor is distinct in that it has a high level of self-protection and passive safety, it is factory manufactured and the assembled reactor can be transported by railway. Multipurpose application of the reactor is presumed, primarily, it can be used for regional power to produce electricity, heat and for water desalination. The Project is being realized within the framework of state-private partnership with joint venture OJSC “AKME-Engineering” established on a parity basis by the State Atomic Energy Corporation “Rosatom” and the Limited Liability Company “EuroSibEnergo”.

  15. Antibacterial effect of bismuth subsalicylate nanoparticles synthesized by laser ablation

    Energy Technology Data Exchange (ETDEWEB)

    Flores-Castañeda, Mariela [Instituto Nacional de Investigaciones Nucleares (Mexico); Vega-Jiménez, Alejandro L., E-mail:; Almaguer-Flores, Argelia [Universidad Nacional Autónoma de México, Facultad de Odontología, DEPeI, I (Mexico); Camps, Enrique; Pérez, Mario [Instituto Nacional de Investigaciones Nucleares (Mexico); Silva-Bermudez, Phaedra [Instituto Nacional de Rehabilitación, Unidad de Ingeniería de Tejidos, Terapia Celular y Medicina Regenerativa (Mexico); Berea, Edgardo [FarmaQuimia SA de CV. (Mexico); Rodil, Sandra E. [Universidad Nacional Autónoma de México, Instituto de Investigaciones en Materiales (Mexico)


    The antimicrobial properties of bismuth subsalicylate (BSS) nanoparticles against four opportunistic pathogens; E. coli, P. aeruginosa, S. aureus, and S. epidermidis were determined. BSS nanoparticles were synthesized by pulse laser ablation of a solid target in distilled water under different conditions. The nanoparticles were characterized using high-resolution transmission electron microscopy and absorption spectra and small angle X-ray scattering. The analysis shows that the colloids maintained the BSS structure and presented average particle size between 20 and 60 nm, while the concentration ranges from 95 to 195 mg/L. The antibacterial effect was reported as the inhibition ratio of the bacterial growth after 24 h and the cell viability was measured using the XTT assay. The results showed that the inhibition ratio of E. coli and S. epidermidis was dependant on the NPs size and/or concentration, meanwhile P. aeruginosa and S. aureus were more sensitive to the BSS nanoparticles independently of both the size and the concentration. In general, the BSS colloids with average particle size of 20 nm were the most effective, attaining inhibition ratios >80 %, similar or larger than those obtained with the antibiotic used as control. The results suggest that the BSS colloids could be used as effective antibacterial agents with potential applications in the medical area.

  16. Antibacterial effect of bismuth subsalicylate nanoparticles synthesized by laser ablation (United States)

    Flores-Castañeda, Mariela; Vega-Jiménez, Alejandro L.; Almaguer-Flores, Argelia; Camps, Enrique; Pérez, Mario; Silva-Bermudez, Phaedra; Berea, Edgardo; Rodil, Sandra E.


    The antimicrobial properties of bismuth subsalicylate (BSS) nanoparticles against four opportunistic pathogens; E. coli, P. aeruginosa, S. aureus, and S. epidermidis were determined. BSS nanoparticles were synthesized by pulse laser ablation of a solid target in distilled water under different conditions. The nanoparticles were characterized using high-resolution transmission electron microscopy and absorption spectra and small angle X-ray scattering. The analysis shows that the colloids maintained the BSS structure and presented average particle size between 20 and 60 nm, while the concentration ranges from 95 to 195 mg/L. The antibacterial effect was reported as the inhibition ratio of the bacterial growth after 24 h and the cell viability was measured using the XTT assay. The results showed that the inhibition ratio of E. coli and S. epidermidis was dependant on the NPs size and/or concentration, meanwhile P. aeruginosa and S. aureus were more sensitive to the BSS nanoparticles independently of both the size and the concentration. In general, the BSS colloids with average particle size of 20 nm were the most effective, attaining inhibition ratios >80 %, similar or larger than those obtained with the antibiotic used as control. The results suggest that the BSS colloids could be used as effective antibacterial agents with potential applications in the medical area.

  17. Bismuth oxide nanorods based immunosensor for mycotoxin detection. (United States)

    Solanki, Pratima R; Singh, Jay; Rupavali, Bharti; Tiwari, Sachchidanand; Malhotra, Bansi D


    We report results of the studies relating to fabrication of an efficient immunosensor based on bismuth oxide nanorods (nBi 2 O 3 ), electrophoretically deposited onto indium-tin-oxide (ITO) coated glass substrate. This immunosensor was fabricated by immobilization of anti-aflatoxin monoclonal antibodies (Ab-AFB1) and bovine serum albumin (BSA) for aflatoxin B1 detection. The structural and morphological studies of n-Bi 2 O 3 have been carried out by XRD, UV-vis spectrophotometer; SEM, AFM and FTIR. It was found that the nBi 2 O 3 provided improved sensing characteristics to the electrode interface in terms of electroactive surface area, diffusion coefficient, charge transfer rate constant and electron transfer kinetics. The results of electrochemical response studies of this BSA/Ab-AFB1/nBi 2 O 3 /ITO immunosensor revealed good linearity in the range of 1-70ngdL -1 with low detection limit of 8.715ng/dL, improved sensitivity of 1.132μA/(ng/dLcm -2 ), regression coefficient R 2 of 0.918 and reproducibility of >11 times. The association constant for the BSA/Ab-AFB1/nBi 2 O 3 /ITO immunosensor was determined as 7.318ng/dL. Copyright © 2016 Elsevier B.V. All rights reserved.

  18. Overview of the use of ATHENA for thermal-hydraulic analysis of systems with lead-bismuth coolant

    International Nuclear Information System (INIS)

    Davis, C.B.; Shieh, A. S.


    The INEEL and MIT are investigating the suitability of lead-bismuth cooled fast reactor for producing low-cost electricity as well as for actinide burning. This paper is concerned with the general area of thermal-hydraulics of lead-bismuth cooled reactors. The ATHENA code is being used in the thermal-hydraulic design and analysis of lead-bismuth cooled reactors. The ATHENA code was reviewed to determine its applicability for simulating lead-bismuth cooled reactors. Two modifications were made to the code as a result of this review. Specifically, a correlation to represent heat transfer from rod bundles to a liquid metal and a void correlation based on data taken in a mixture of lead-bismuth and steam were added the code. The paper also summarizes the analytical work that is being performed with the code and plans for future analytical work

  19. Fabrication of crystal-oriented barium-bismuth titanate ceramics in high magnetic field and subsequent reaction sintering. (United States)

    Tanaka, Satoshi; Tomita, Yusuke; Furushima, Ryoichi; Shimizu, Hiroyuki; Doshida, Yutaka; Uematsu, Keizo


    High magnetic field was applied to fabricate novel lead-free piezoelectric ceramics with a textured structure. A compact of crystallographically oriented grains was prepared by dry forming in a high magnetic field from a mixed slurry of bismuth titanate and barium titanate powders. Bismuth titanate particles with a size of about 1 μ m were used as the host material. In the forming process, the slurry was poured into a mold and set in a magnetic field of 10 T until completely dried. Bismuth titanate particles were highly oriented in the slurry under the magnetic field. The dried powder compact consisted of highly oriented bismuth titanate particles and randomly oriented barium titanate particles. Barium bismuth titanate ceramics with a - and b -axis orientations were successfully produced from the dried compact by sintering at temperatures above 1100 ° C.

  20. Review - Fabrication of crystal-oriented barium-bismuth titanate ceramics in high magnetic field and subsequent reaction sintering

    Directory of Open Access Journals (Sweden)

    Satoshi Tanaka, Yusuke Tomita, Ryoichi Furushima, Hiroyuki Shimizu, Yutaka Doshida and Keizo Uematsu


    Full Text Available High magnetic field was applied to fabricate novel lead-free piezoelectric ceramics with a textured structure. A compact of crystallographically oriented grains was prepared by dry forming in a high magnetic field from a mixed slurry of bismuth titanate and barium titanate powders. Bismuth titanate particles with a size of about 1 μ m were used as the host material. In the forming process, the slurry was poured into a mold and set in a magnetic field of 10 T until completely dried. Bismuth titanate particles were highly oriented in the slurry under the magnetic field. The dried powder compact consisted of highly oriented bismuth titanate particles and randomly oriented barium titanate particles. Barium bismuth titanate ceramics with a- and b-axis orientations were successfully produced from the dried compact by sintering at temperatures above 1100 ° C.

  1. Potentiation of the action of metronidazole on Helicobacter pylori by omeprazole and bismuth subcitrate

    DEFF Research Database (Denmark)

    Andersen, L P; Colding, H; Kristiansen, J E


    test (Etest). With 0.5 MIC of either of the two drugs, the susceptibility of all H. pylori4 mg/l) reverted to being metronidazole sensitive. These results suggested that either bismuth salts or proton pump inhibitors may be effective in the treatment of some infections with metronidazole-resistant H...... to regimens that include proton pump inhibitors. In the present study, the synergistic effect of subinhibitory concentrations (0.25-0.5 MIC) of either bismuth subcitrate or omeprazole with metronidazole on the susceptibility of 42 H. pylori strains was investigated by agar dilution method and the Epsilometer......Treatment failures using triple therapy that include metronidazole, are common in patients infected with metronidazole-resistant Helicobacter pylori in the gastric mucosa. Higher eradication rates in such patients have been described when treatment regimens include bismuth salts compared...

  2. Advanced bismuth-doped lead-germanate glass for broadband optical gain devices

    International Nuclear Information System (INIS)

    Hughes, M.; Suzuki, T.; Ohishi, Y.


    We fabricated a series of glasses with the composition 94.7-χGeO 2 -5Al 2 O 3 -0.3Bi 2 O 3 -χPbO (χ=0-24 mol. %). Characteristic absorption bands of bismuth centered at 500, 700, 800, and 1000 nm were observed. Adding PbO was found to decrease the strength of bismuth absorption. The addition of 3%-4% PbO resulted in a 50% increase in lifetime, a 20-fold increase in quantum efficiency, and a 28-fold increase in the product of emission cross section and lifetime on the 0% PbO composition. We propose that the 800 nm absorption band relates a different bismuth center than the other absorption bands

  3. Peculiarities of the interaction of indium-tin and indium-bismuth alloys with ammonium halides

    International Nuclear Information System (INIS)

    Red'kin, A.N.; Smirnov, V.A.; Sokolova, E.A.; Makovej, Z.I.; Telegin, G.F.


    Peculiarities of fusible metal alloys interaction with ammonium halogenides in vertical reactor are considered using indium-tin and indium-bismuth binary alloys. It is shown that at the end of the process the composition of metal and salt phases is determined by the equilibrium type and constant characteristic of the given salt-metal system. As a result the interaction of indium-tin and indium-bismuth alloys with ammonium halogenides leads to preferential halogenation of indium-bismuth alloys with ammonium halogenides leads to preferential halogenation of indium which may be used in the processes of separation or purification. A model is suggested to calculate the final concentration of salt and metal phase components

  4. Synthesis of binary bismuth-cadmium oxide nanorods with sensitive electrochemical sensing performance

    International Nuclear Information System (INIS)

    Wen, Yong; Pei, Lizhai; Wei, Tian


    Binary bismuth-cadmium oxide nanorods have been synthesized by a simple hydrothermal process without templates and additives. X-ray diffraction and high-resolution transmission electron microscopy reveal that the nanorods possess single crystalline tetragonal Bi 2 CdO 4 phase. Scanning electron microscopy and transmission electron microscopy images show that the length and diameter of the nanorods are 20-300 nm and 5-10 μm, respectively. The formation of the binary bismuth-cadmium oxide nanorods is closely related to the hydrothermal parameters. The electrochemical sensing performance of the binary bismuth-cadmium oxide nanorods has been investigated using the nanorods as glassy carbon electrode modifiers. The detection limit is 0.19 μM with a linear range of 0.0005-2 mM. The nanorod-modified glassy carbon electrode exhibits good electrocatalytic activity toward L-cysteine and great application potential for electrochemical sensors.

  5. Glass-like carbon, pyrolytic graphite or nanostructured carbon for electrochemical sensing of bismuth ion?

    Directory of Open Access Journals (Sweden)

    Jadranka Milikić


    Full Text Available Different carbon electrodes were explored for application in electroanalysis, namely for sensing of bismuth ion as model analyte. Carbon materials tested included glassy carbon, basal and edge plane pyrolytic graphite, as well as nanostructured carbonized polyaniline prepared in the presence of 3,5-dinitrosalicylic acid. Bismuth ion was chosen as model analyte as protocol for its detection and quantifications is still to be determined. Herein, anodic stripping voltammetry was used with study of effect of several parameters such as scan rate and deposition time. Electrode based on carbonized polyaniline showed the highest activity for bismuth ion sensing in terms of the highest current densities recorded both in a laboratory and in real sample, while basal plane pyrolytic graphite electrode gave the lowest limit of detection.

  6. Antimony(V) and bismuth(V) complexes of lapachol: synthesis, crystal structure and cytotoxic activity. (United States)

    Oliveira, Ludmila G de; Silva, Meiriane M; Paula, Flávia C S de; Pereira-Maia, Elene C; Donnici, Cláudio L; Simone, Carlos A de; Frézard, Frédéric; Silva, Eufrânio N da; Demicheli, Cynthia


    Antimony(V) and bismuth(V) complexes of lapachol have been synthesized by the reaction of Ph₃SbCl₂ or Ph₃BiCl₂ with lapachol (Lp) and characterized by several physicochemical techniques such as IR, and NMR spectroscopy and X-ray crystallography. The compounds contain six-coordinated antimony and bismuth atoms. The antimony(V) complex is a monomeric derivative, (Lp)(Ph₃Sb)OH, and the bismuth(V) complex is a dinuclear compound bridged by an oxygen atom, (Lp)₂(Ph₃Bi)₂O. Both compounds inhibited the growth of a chronic myelogenous leukemia cell line and the complex of Bi(V) was about five times more active than free lapachol. This work provides a rare example of an organo-Bi(V) complex showing significant cytotoxic activity.

  7. Antimony(V and Bismuth(V Complexes of Lapachol: Synthesis, Crystal Structure and Cytotoxic Activity

    Directory of Open Access Journals (Sweden)

    Cynthia Demicheli


    Full Text Available Antimony(V and bismuth(V complexes of lapachol have been synthesized by the reaction of Ph3SbCl2 or Ph3BiCl2 with lapachol (Lp and characterized by several physicochemical techniques such as IR, and NMR spectroscopy and X-ray crystallography. The compounds contain six-coordinated antimony and bismuth atoms. The antimony(V complex is a monomeric derivative, (Lp(Ph3SbOH, and the bismuth(V complex is a dinuclear compound bridged by an oxygen atom, (Lp2(Ph3Bi2O. Both compounds inhibited the growth of a chronic myelogenous leukemia cell line and the complex of Bi(V was about five times more active than free lapachol. This work provides a rare example of an organo-Bi(V complex showing significant cytotoxic activity.

  8. Genotoxicity studies of heavy metals: lead, bismuth, indium, silver and antimony. (United States)

    Asakura, Keiko; Satoh, Hiroshi; Chiba, Momoko; Okamoto, Masahide; Serizawa, Koji; Nakano, Makiko; Omae, Kazuyuki


    Many kinds of heavy metals are used in industry; thus, it is important for us to clarify their toxicity. For example, lead, which is a component of solder, is notorious for its neurotoxicity, and substitute materials have been sought for many years. Therefore, we examined the genotoxicity of lead and also those of metallic bismuth, indium, silver and antimony which are possible substitutes for lead in solder. Bacterial reverse mutation tests and chromosomal aberration tests in cultured mammalian cells were performed according to standard procedures. Antimony showed genotoxicity in both tests, and bismuth also showed positive results in the chromosomal aberration test. In contrast, lead, indium, and silver were considered to be inactive by the criteria of the present study. Although further studies are needed because of the difficulty of genotoxicity evaluation using an in vitro system, sufficient precautions should be made when antimony and bismuth are used.

  9. Adsorption of arsenic, phosphorus and chromium by bismuth impregnated biochar: Adsorption mechanism and depleted adsorbent utilization. (United States)

    Zhu, Ningyuan; Yan, Tingmei; Qiao, Jun; Cao, Honglei


    Bismuth impregnated biochar were synthesized to deal with wastewater pollution. Nitrogen adsorption-desorption isotherms, scanning electron microscopy (SEM), Fourier transform infrared spectroscopy (FTIR), X-ray diffraction (XRD) and X-ray photoelectron spectroscopy (XPS) were used to determine the characteristics of adsorbents and explore the main adsorption mechanism. Results showed that bismuth particle was carried successfully within the biochar matrix, making contributions to creating micropore and boost specific surface area. The loaded bismuth, served as the adsorption site, rather than the specific surface area played an important role in arsenic and phosphorus adsorption. Batch adsorption experiments demonstrated a fit Langmuir model for arsenic (As) and phosphorus (P) and a suitable Freundlich model for chromium (Cr). Thermodynamic parameters depicted the endothermic nature and the spontaneous process for phosphate and arsenic adsorption. Besides, this contaminant-loaded carbon adsorbent was further applied for the removal of methylene blue from aqueous solution. Copyright © 2016 Elsevier Ltd. All rights reserved.

  10. Potentiation of the action of metronidazole on Helicobacter pylori by omeprazole and bismuth subcitrate

    DEFF Research Database (Denmark)

    Andersen, L P; Colding, H; Kristiansen, J E


    Treatment failures using triple therapy that include metronidazole, are common in patients infected with metronidazole-resistant Helicobacter pylori in the gastric mucosa. Higher eradication rates in such patients have been described when treatment regimens include bismuth salts compared...... to regimens that include proton pump inhibitors. In the present study, the synergistic effect of subinhibitory concentrations (0.25-0.5 MIC) of either bismuth subcitrate or omeprazole with metronidazole on the susceptibility of 42 H. pylori strains was investigated by agar dilution method and the Epsilometer...... test (Etest). With 0.5 MIC of either of the two drugs, the susceptibility of all H. pylori4 mg/l) reverted to being metronidazole sensitive. These results suggested that either bismuth salts or proton pump inhibitors may be effective in the treatment of some infections with metronidazole-resistant H...

  11. Synthesis of binary bismuth-cadmium oxide nanorods with sensitive electrochemical sensing performance

    Energy Technology Data Exchange (ETDEWEB)

    Wen, Yong [Xinjiang Univ., Xinjiang (China). School of Civil Engineering and Architecture; Pei, Lizhai; Wei, Tian [Anhui Univ. of Technology, Anhui (China). School of Materials Science and Engineering


    Binary bismuth-cadmium oxide nanorods have been synthesized by a simple hydrothermal process without templates and additives. X-ray diffraction and high-resolution transmission electron microscopy reveal that the nanorods possess single crystalline tetragonal Bi{sub 2}CdO{sub 4} phase. Scanning electron microscopy and transmission electron microscopy images show that the length and diameter of the nanorods are 20-300 nm and 5-10 μm, respectively. The formation of the binary bismuth-cadmium oxide nanorods is closely related to the hydrothermal parameters. The electrochemical sensing performance of the binary bismuth-cadmium oxide nanorods has been investigated using the nanorods as glassy carbon electrode modifiers. The detection limit is 0.19 μM with a linear range of 0.0005-2 mM. The nanorod-modified glassy carbon electrode exhibits good electrocatalytic activity toward L-cysteine and great application potential for electrochemical sensors.

  12. Poisoning effect of bismuth on modification behaviour of strontium in LM25 alloy

    International Nuclear Information System (INIS)

    Farahany, S.; Ourdjini, A.; Idris, M.H.; Thai, L.T.


    Nucleation and growth, temperature measurements and microstructure observations of silicon phase are presented for strontium modified Al-7% Si (LM25) cast alloy treated with bismuth. The results show that addition of bismuth in strontium modified alloys may have a poisoning effect resulting in lost modification of the silicon phase. With increasing Bi/Sr ratio, thermal analysis measurements showed that the eutectic growth temperature increased remarkably to 573 deg C and recalescence decreased to 0.2 deg C and the morphology of silicon displayed the same flake-like structure as in the unmodified alloys. Microstructural observation showed that a minimum Bi/Sr ratio of 1.2 which is equivalent to a Sr/Bi ratio of 0.43 is required for effective strontium modification and neutralization of the poisoning effect of bismuth. (author)

  13. Amperometry with two polarisable electrodes-XI Determination of bismuth by EDTA titration. (United States)

    Vydra, F; Vorlícek, J


    Optimum conditions have been found for a highly selective determination of bismuth via EDTA titration with biamperometric indication of the end-point. The influence of the applied potential, pH and stirring on the accuracy and selectivity of the determination has been studied. In a medium of 0.4M nitric acid only high concentrations of iron(III) and copper(II) interfere with the determination of bismuth. Zirconium, thallium(III) and indium interfere even in small concentrations. The average error of the determination of 5-100 mg of bismuth (when titrated with 0.05M EDTA solution) is +/-0-1 % rel. and for the determination of 0.5-10 mg it is +/-0.3% rel. (0.005M EDTA). The method has been verified by the analysis of a Wood's metal of known composition.

  14. Basic principles of lead and lead-bismuth eutectic application in blanket of fusion reactors

    International Nuclear Information System (INIS)

    Beznosov, A.V.; Pinaev, S.S.; Muraviev, E.V.; Romanov, P.V.


    High magnetohydrodynamic pressure drop is an important issue for liquid metal blanket concepts. To decrease magnetohydrodynamic resistance authors propose to form insulating coatings on internal surface of blanket ducts at any moment of fusion reactor exploitation. It may be achieved easily if lead or lead-bismuth eutectic is used and technology of oxidative potential handling is applied. A number of experiments carried out in NNSTU show the availability of the proposed technology. It bases on formation of the insulating coatings that consist of the oxides of components of the structural materials and of the coolant components. In-situ value of the insulating coatings characteristics ρδ is ∼ 10 -5 Ohm·m 2 for steels and 5,0x10 -6 - 5,0x10 -5 Ohm·m 2 for vanadium alloys. Thermal cycling is possible during exploitation of a blanket. The experimental research of the insulating coatings properties during thermal cycling have shown that the coatings formed into the lead and lead-bismuth coolants save there insulating properties. Experience of many years is an undoubted advantage of the lead-bismuth coolant and less of the lead coolant in comparison with lithium. Russian Federation possesses of experience of exploitation of the research and industrial facilities, of experience of creation of the pumps, steamgenerators and equipment with heavy liquid metal coolants. The unique experience of designing, assembling and exploitation of the fission reactors with lead-bismuth coolant is also available. The problem of technology of lead and lead-bismuth coolants for power high temperature radioactive facilities has been solved. Accidents, emergency situations such as leakage of steamgenerators or depressurization of gas system in facilities with lead and lead-bismuth coolants have been explored and suppressed. (author)

  15. Bismuth Passivation Technique for High-Resolution X-Ray Detectors (United States)

    Chervenak, James; Hess, Larry


    The Athena-plus team requires X-ray sensors with energy resolution of better than one part in 3,000 at 6 keV X-rays. While bismuth is an excellent material for high X-ray stopping power and low heat capacity (for large signal when an X-ray is stopped by the absorber), oxidation of the bismuth surface can lead to electron traps and other effects that degrade the energy resolution. Bismuth oxide reduction and nitride passivation techniques analogous to those used in indium passivation are being applied in a new technique. The technique will enable improved energy resolution and resistance to aging in bismuth-absorber-coupled X-ray sensors. Elemental bismuth is lithographically integrated into X-ray detector circuits. It encounters several steps where the Bi oxidizes. The technology discussed here will remove oxide from the surface of the Bi and replace it with nitridized surface. Removal of the native oxide and passivating to prevent the growth of the oxide will improve detector performance and insulate the detector against future degradation from oxide growth. Placing the Bi coated sensor in a vacuum system, a reduction chemistry in a plasma (nitrogen/hydrogen (N2/H2) + argon) is used to remove the oxide and promote nitridization of the cleaned Bi surface. Once passivated, the Bi will perform as a better X-ray thermalizer since energy will not be trapped in the bismuth oxides on the surface. A simple additional step, which can be added at various stages of the current fabrication process, can then be applied to encapsulate the Bi film. After plasma passivation, the Bi can be capped with a non-diffusive layer of metal or dielectric. A non-superconducting layer is required such as tungsten or tungsten nitride (WNx).

  16. Equilibrium distribution of lanthanum, neodymium, and thorium between lithium chloride melt and liquid bismuth (United States)

    Zagnit'ko, A. V.; Ignat'ev, V. V.


    The distribution of lanthanum, neodymium, and thorium between a lithium chloride melt and liquid bismuth with additions of lithium as a reducing agent are investigated at 650°C. Equilibrium values of their distribution constants are measured. It is shown that in contrast to neodymium and lanthanum, thorium cannot be extracted from bismuth into lithium chloride. This allows us to propose an efficient scheme for separating lanthanides and thorium in a system for the extraction of fuel salts in molten-salt nuclear reactors.

  17. Structural investigations of bismuth lead borosilicate glasses under the influence of gamma irradiation through ultrasonic studies (United States)

    Bootjomchai, Cherdsak; Laopaiboon, Jintana; Laopaiboon, Raewat


    The ultrasonic velocity measurements for different compositions of irradiated bismuth lead borosilicate glasses xBi2O3-(50-x)PbO-20B2O3-30SiO2 (x=2, 4, 6, 8, and 10 mol.%) were performed at room temperature using pulse-echo technique. Densities of glass samples were measured by Archimedes' principle using n-hexane as the immersion liquid. The results from the studies show that ultrasonic velocity, elastic moduli, Poisson's ratio, microhardness, and the Debye temperature increase with increasing bismuth oxide content and increasing gamma-radiation dose (3-12 Gy).

  18. Distribution of indium, thallium and bismuth in the environmental water of Japan. (United States)

    Miyazaki, A; Kimura, A; Tao, H


    Indium, thallium and bismuth are toxic and it is important to know the distribution of these elements in environmental water. The concentrations of these elements were measured in 50 sampling points in Japan and the reasons of high concentrations in several samples were discussed. The average concentrations (ng/L) of dissolved and particulate indium in river, lake and coastal seawater were 1.4-3.0 and 2.4-9.1, respectively. Those for thallium were 7.2-11.3 and 3.5-36.0. Those for bismuth were 12.7-24.0 and 12.1-52.7.

  19. Direct Electrochemical Synthesis of Bismuth(III Phenoxides and their Coordination Compounds

    Directory of Open Access Journals (Sweden)

    Harpreet Kaur


    Full Text Available Bismuth(III phenoxides have been synthesized by electrochemical reactions of 1-naphthol, 2-naphthol, 4-aminophenol, 2-nitrophenol, 4-nitrophenol, 2-hydroxybenzoic acid, p-cresol, phenol, resorcinol, 2-tert-butylphenol and 2-tert-butyl-4-methoxyphenol at sacrificial bismuth anode and inert platinum cathode using tetrabutylammonium chloride as supporting electrolyte. The coordination compounds of these phenols with 1, 10-phenanthroline and 2, 2ʼ-bipyridyl have also been synthesized electrochemically. The solid products separated in the anode compartment have been isolated and characterized by elemental analysis and infrared spectral studies. Current efficiencies of these reactions are quite high.

  20. Fabrication of Nanovoid-Imbedded Bismuth Telluride with Low Dimensional System (United States)

    Chu, Sang-Hyon (Inventor); Choi, Sang H. (Inventor); Kim, Jae-Woo (Inventor); Park, Yeonjoon (Inventor); Elliott, James R. (Inventor); King, Glen C. (Inventor); Stoakley, Diane M. (Inventor)


    A new fabrication method for nanovoids-imbedded bismuth telluride (Bi--Te) material with low dimensional (quantum-dots, quantum-wires, or quantum-wells) structure was conceived during the development of advanced thermoelectric (TE) materials. Bismuth telluride is currently the best-known candidate material for solid-state TE cooling devices because it possesses the highest TE figure of merit at room temperature. The innovative process described here allows nanometer-scale voids to be incorporated in Bi--Te material. The final nanovoid structure such as void size, size distribution, void location, etc. can be also controlled under various process conditions.

  1. Porous structure of oxide bismuth-molybdenum catalysts applied to silica gel

    International Nuclear Information System (INIS)

    Mikhajlenko, E.L.; Tarasova, D.V.; Razumova, N.V.


    A study was made on the formation of porous structure of oxide bismuth-molybdenum catalysts applied to silica gel. It has been shown that the structure and phase composition of the catalysts are determined by an initial state of a carrier. When a stabilized zol is used as a carrier its purification during the synthesis takes place as a result of the sodium ion interaction with molybdenum and bismuth ions with the formation of NaBi(MoO 4 ) 2 phase. The change in the catalyst structure during heat treatment is specified by the carrier caking in the presence of the Bi 2 (MoO 4 ) 3 fusible phase

  2. How to Effectively Use Bismuth Quadruple Therapy: The Good, the Bad, and the Ugly. (United States)

    Graham, David Y; Lee, Sun-Young


    Bismuth triple therapy was the first effective Helicobacter pylori eradication therapy. The addition of a proton pump inhibitor helped overcome metronidazole resistance. Its primary indication is penicillin allergy or when clarithromycin and metronidazole resistance are both common. Resistance to the primary first-line therapy have centered on complexity and difficulties with compliance. Understanding regional differences in effectiveness remains unexplained because of the lack of studies including susceptibility testing and adherence data. We discuss regimen variations including substitutions of doxycycline, amoxicillin, and twice a day therapy and provide suggestions regarding what is needed to rationally and effectively use bismuth quadruple therapy. Published by Elsevier Inc.

  3. Microwave-hydrothermal synthesis of perovskite bismuth ferrite nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Biasotto, G. [Laboratorio Interdisciplinar em Ceramica (LIEC), Departamento de Fisico-Quimica, Instituto de Quimica, UNESP, CEP 14800-900, Araraquara, SP (Brazil); Simoes, A.Z., E-mail: [Universidade Estadual Paulista-Unesp, Faculdade de Engenharia de Guaratingueta, Av. Dr. Ariberto Pereira da Cunha, 333, Bairro Pedregulho, CEP 12516-410, Guaratingueta, SP (Brazil); Foschini, C.R.; Zaghete, M.A.; Varela, J.A.; Longo, E. [Laboratorio Interdisciplinar em Ceramica (LIEC), Departamento de Fisico-Quimica, Instituto de Quimica, UNESP, CEP 14800-900, Araraquara, SP (Brazil)


    Highlights: Black-Right-Pointing-Pointer BiFeO{sub 3} (BFO) nanoparticles were grown by hydrothermal microwave method (HTMW). Black-Right-Pointing-Pointer The soaking time is effective in improving phase formation. Black-Right-Pointing-Pointer Rietveld refinement reveals an orthorhombic structure. Black-Right-Pointing-Pointer The observed magnetism of the BFO crystallites is a consequence of particle size. Black-Right-Pointing-Pointer The HTMW is a genuine technique for low temperatures and short times of synthesis. -- Abstract: Hydrothermal microwave method (HTMW) was used to synthesize crystalline bismuth ferrite (BiFeO{sub 3}) nanoparticles (BFO) in the temperature of 180 Degree-Sign C with times ranging from 5 min to 1 h. BFO nanoparticles were characterized by means of X-ray analyses, FT-IR, Raman spectroscopy, TG-DTA and FE-SEM. X-ray diffraction results indicated that longer soaking time was benefit to refraining the formation of any impurity phases and growing BFO crystallites into almost single-phase perovskites. Typical FT-IR spectra for BFO nanoparticles presented well defined bands, indicating a substantial short-range order in the system. TG-DTA analyses confirmed the presence of lattice OH{sup -} groups, commonly found in materials obtained by HTMW process. Compared with the conventional solid-state reaction process, submicron BFO crystallites with better homogeneity could be produced at the temperature as low as 180 Degree-Sign C. These results show that the HTMW synthesis route is rapid, cost effective, and could be used as an alternative to obtain BFO nanoparticles in the temperature of 180 Degree-Sign C for 1 h.

  4. Bismuth subsalicylate nanoparticles with anaerobic antibacterial activity for dental applications (United States)

    Vega-Jiménez, A. L.; Almaguer-Flores, A.; Flores-Castañeda, M.; Camps, E.; Uribe-Ramírez, M.; Aztatzi-Aguilar, O. G.; De Vizcaya-Ruiz, A.


    In recent years, nanomaterials have been used in the medical-dental field as new alternative antimicrobial agents. Bismuth subsalicylate (BSS) has been used as an antimicrobial agent, but the effect of BSS in the form of nanoparticles (BSS-nano) as a potential antimicrobial agent has not been tested, in specific against bacteria responsible for periodontal disease. The aim of this study was to evaluate the antibacterial effect of BSS-nano against oral anaerobic bacteria and to assess the safety of BSS-nano by evaluating their cytotoxicity in human gingival fibroblast (HGF-1) cells. BSS-nano were synthesized by laser ablation and were previously physico-chemically characterized using in vitro assays. The antibacterial activity was measured using the tetrazolium-based XTT assay, and cytotoxicity was determined using lactate dehydrogenase (LDH) and MTS assays in HGF-1 cells. Transmission electron microscopy of HGF-1 exposed to BSS-nano was also performed. BSS-nano was shown to have a primary size of 4-22 nm and a polygonal shape. Among the tested bacterial strains, those with a greater sensitivity to BSS-nano (highest concentration of 21.7 μg ml-1) were A. actinomycetemcomitans, C. gingivalis, and P. gingivalis. BSS-nano at a concentration of 60 μg ml-1 showed low cytotoxicity (6%) in HFG-1 cells and was mainly localized intracellularly in acidic vesicles. Our results indicate that the concentration of BSS-nano used as an effective antibacterial agent does not induce cytotoxicity in mammalian cells; thus, BSS-nano can be applied as an antibacterial agent in dental materials or antiseptic solutions.

  5. Improved proton CT imaging using a bismuth germanium oxide scintillator (United States)

    Tanaka, Sodai; Nishio, Teiji; Tsuneda, Masato; Matsushita, Keiichiro; Kabuki, Shigeto; Uesaka, Mitsuru


    Range uncertainty is among the most formidable challenges associated with the treatment planning of proton therapy. Proton imaging, which includes proton radiography and proton computed tomography (pCT), is a useful verification tool. We have developed a pCT detection system that uses a thick bismuth germanium oxide (BGO) scintillator and a CCD camera. The current method is based on a previous detection system that used a plastic scintillator, and implements improved image processing techniques. In the new system, the scintillation light intensity is integrated along the proton beam path by the BGO scintillator, and acquired as a two-dimensional distribution with the CCD camera. The range of a penetrating proton is derived from the integrated light intensity using a light-to-range conversion table, and a pCT image can be reconstructed. The proton range in the BGO scintillator is shorter than in the plastic scintillator, so errors due to extended proton ranges can be reduced. To demonstrate the feasibility of the pCT system, an experiment was performed using a 70 MeV proton beam created by the AVF930 cyclotron at the National Institute of Radiological Sciences. The accuracy of the light-to-range conversion table, which is susceptible to errors due to its spatial dependence, was investigated, and the errors in the acquired pixel values were less than 0.5 mm. Images of various materials were acquired, and the pixel-value errors were within 3.1%, which represents an improvement over previous results. We also obtained a pCT image of an edible chicken piece, the first of its kind for a biological material, and internal structures approximately one millimeter in size were clearly observed. This pCT imaging system is fast and simple, and based on these findings, we anticipate that we can acquire 200 MeV pCT images using the BGO scintillator system.

  6. Formic acid oxidation at platinum-bismuth catalysts

    Directory of Open Access Journals (Sweden)

    Popović Ksenija Đ.


    Full Text Available The field of heterogeneous catalysis, specifically catalysis on bimetallic surfaces, has seen many advances over the past few decades. Bimetallic catalysts, which often show electronic and chemical properties that are distinct from those of their parent metals, offer the opportunity to obtain new catalysts with enhanced selectivity, activity, and stability. The oxidation of formic acid is of permanent interest as a model reaction for the mechanistic understanding of the electrooxidation of small organic molecules and because of its technical relevance for fuel cell applications. Platinum is one of the most commonly used catalysts for this reaction, despite the fact that it shows a few significant disadvantages: high cost and extreme susceptibility to poisoning by CO. To solve this problem, several approaches have been used, but generally, they all consist in the modification of platinum with a second element. Especially, bismuth has received significant attention as Pt modifier. According to the results presented in this survey dealing with the effects influencing the formic acid oxidation it was found that two types of Pt-Bi bimetallic catalysts (bulk and low loading deposits on GC showed superior catalytic activity in terms of the lower onset potential and oxidation current density, as well as exceptional stability compared to Pt. The findings in this report are important for the understanding of mechanism of formic acid electrooxidation on a bulk alloy and decorated surface, for the development of advanced anode catalysts for direct formic acid fuel cells, as well as for the synthesis of novel low-loading bimetallic catalysts. The use of bimetallic compounds as the anode catalysts is an effective solution to overcoming the problems of the formic acid oxidation current stability for long term applications. In the future, the tolerance of both CO poisoning and electrochemical leaching should be considered as the key factors in the development

  7. Lead-Bismuth-Eutectic Spallation Neutron Source for Nuclear Transmuter

    International Nuclear Information System (INIS)

    Gohar, Y.; Herceg, J.; Krajtl, L.; Micklich, B.; Pointer, D.; Saiveau, J.; Sofu, T.; Finck, P.


    A lead-bismuth eutectic (LBE) spallation target design concept has been developed for the subcritical multiplier (SCM) design of the accelerator-driven test facility (ADTF). The design is based on a coaxial geometrical configuration, which has been carefully analyzed and designed to achieve an optimum performance. The target design description, the results from the parametric studies, and the design analyses including neutronics, heat transfer, and hydraulics analyses are given in this paper. A detailed MCNPX geometrical model for the target has been developed to generate heating rates and nuclear responses in the structural material for the design process. The beam has a uniform distribution of 600 MeV protons and 5-MW total power. A small LBE buffer is optimized to reduce the irradiation damage in the SCM fuel elements from the scatter protons and the high-energy neutrons, to maximize the neutron yield to the SCM operation, and to provide inlet and outlet manifolds for the LBE coolant. A special attention has been given to the target window design to enhance its lifetime. The window volumetric heating is 766 W/cm 3 relative to 750 W/cm 3 in LBE for a 40-μA/cm 2 current density. The results show that the nuclear heating from the proton beam diminishes at about 32 cm along the beam axis in the LBE target material. The neutron contribution to the atomic displacement is in the range of 94 to ∼100% for the structure material outside the proton beam path. In the beam window, the neutron contribution is ∼74% and the proton beam is responsible for more than 95% of the total gas production. The proton contribution to the gas production vanishes outside the beam path. The LBE average velocity is ∼2 m/s. The heat transfer and the hydraulics analyses have been iterated to reduce the maximum temperature and the thermal stress level in the target window to enhance its operating life. (authors)

  8. Glutathione and multidrug resistance protein transporter mediate a self-propelled disposal of bismuth in human cells. (United States)

    Hong, Yifan; Lai, Yau-Tsz; Chan, Godfrey Chi-Fung; Sun, Hongzhe


    Glutathione and multidrug resistance protein (MRP) play an important role on the metabolism of a variety of drugs. Bismuth drugs have been used to treat gastrointestinal disorder and Helicobacter pylori infection for decades without exerting acute toxicity. They were found to interact with a wide variety of biomolecules, but the major metabolic pathway remains unknown. For the first time (to our knowledge), we systematically and quantitatively studied the metabolism of bismuth in human cells. Our data demonstrated that over 90% of bismuth was passively absorbed, conjugated to glutathione, and transported into vesicles by MRP transporter. Mathematical modeling of the system reveals an interesting phenomenon. Passively absorbed bismuth consumes intracellular glutathione, which therefore activates de novo biosynthesis of glutathione. Reciprocally, sequestration by glutathione facilitates the passive uptake of bismuth and thus completes a self-sustaining positive feedback circle. This mechanism robustly removes bismuth from both intra- and extracellular space, protecting critical systems of human body from acute toxicity. It elucidates the selectivity of bismuth drugs between human and pathogens that lack of glutathione, such as Helicobacter pylori, opening new horizons for further drug development.

  9. Adsorption of volatile polonium and bismuth species on metals in various gas atmospheres. Pt. I. Adsorption of volatile polonium and bismuth on gold

    Energy Technology Data Exchange (ETDEWEB)

    Maugeri, Emilio Andrea; Neuhausen, Joerg; Dressler, Rugard; Piguet, David; Voegele, Alexander; Schumann, Dorothea [Paul Scherrer Institut (PSI), Villigen (Switzerland). Lab. for Radiochemistry; Eichler, Robert [Paul Scherrer Institut (PSI), Villigen (Switzerland). Lab. for Radiochemistry; Bern Univ. (Switzerland). Dept. for Chemistry and Biochemistry; Rijpstra, Kim [Ghent Univ., Zwijnaarde (Belgium). Center for Molecular Modeling (CMM); Cottenier, Stefaan [Ghent Univ., Zwijnaarde (Belgium). Center for Molecular Modeling (CMM); Ghent Univ., Zwijnaarde (Belgium). Dept. of Materials Science and Engineering


    Polonium isotopes are considered the most hazardous radionuclides produced during the operation of accelerator driven systems (ADS) when lead-bismuth eutectic (LBE) is used as the reactor coolant and as the spallation target material. In this work the use of gold surfaces for capturing polonium from the cover gas of the ADS reactor was studied by thermochromatography. The results show that gaseous monoatomic polonium, formed in dry hydrogen, is adsorbed on gold at 1058 K. Its adsorption enthalpy was calculated as -250±7 kJ mol{sup -1}, using a Monte Carlo simulation code. Highly volatile polonium species that were observed in similar experiments in fused silica columns in the presence of moisture in both inert and reducing gas were not detected in the experiments studying adsorption on gold surfaces. PoO{sub 2} is formed in both dry and moist oxygen, and its interaction with gold is characterized by transport reactions. The interaction of bismuth, present in large amounts in the atmosphere of the ADS, with gold was also evaluated. It was found that bismuth has a higher affinity for gold, compared to polonium, in an inert, reducing, and oxidizing atmosphere. This fact must be considered when using gold as a material for filtering polonium in the cover gas of ADS.

  10. Effects of crystallite structure and interface band alignment on the photocatalytic property of bismuth ferrite/ (N-doped) graphene composites

    International Nuclear Information System (INIS)

    Li, Pai; Chen, Qiang; Lin, Yinyin; Chang, Gang; He, Yunbin


    Bismuth ferrite/graphene (N-doped graphene) photocatalysts are successfully prepared by a facile and effective two-step hydrothermal method. Bismuth ferrite/graphene shows superior photocatalytic activity compared with bismuth ferrite/N-doped graphene and pure BiFeO 3 . X-ray diffraction, scanning electron microscopy and energy-dispersive spectroscopy analyses indicate that Bi 25 FeO 40 crystalline phase is obtained with the addition of graphene, while BiFeO 3 is formed under the same hydrothermal conditions in the presence of N-doped graphene. Core-level and valence-band X-ray photoelectron spectroscopy analyses reveal a downward band bending of bismuth ferrite (∼0.5 eV) at the interface of the bismuth ferrite/(N-doped) graphene composites, which facilitates the electron transfer from bismuth ferrite to (N-doped) graphene and suppresses the recombination of photo-generated electron–hole pairs. This downward bending band alignment at the interface supposes to be the main mechanism underlying the enhanced photocatalytic activity of the bismuth ferrite/graphene composites that are currently of great interest in the photocatalysis field. - Highlights: • Bismuth ferrite/(N-doped) graphene composites were prepared by a hydrothermal method. • Bi 25 FeO 40 and BiFeO 3 were obtained with presence of graphene and N-graphene, respectively. • Bi 25 FeO 40 /graphene shows superior photocatalytic activity over BiFeO 3 and BiFeO 3 /N-graphene. • A downward band bending (∼0.5 eV) of bismuth ferrite exists at the composites interface. • The downward band bending supposes to be the mechanism for the enhanced photocatalytic activity.



    Pankaj S. Chaudhari*, Dr. Shrikant S.Patil


    Bismuth(III)chloride is used as an efficient catalyst in the Von–Pachmann condensation of phenol with derivative of phenols with B–ketoesters leading to the formation of coumarine and their derivative with good yields, high purity and eco-friendly synthesis.

  12. Nanodomains and nanometer-scale disorder in multiferroic bismuth ferrite single crystals

    Czech Academy of Sciences Publication Activity Database

    Jia, C.L.; Jin, L.; Wang, D.; Mi, S.B.; Alexe, M.; Hesse, D.; Reichlová, Helena; Martí, Xavier; Bellaiche, L.; Urban, K.W.


    Roč. 82, Jan (2015), s. 356-368 ISSN 1359-6454 Institutional support: RVO:68378271 Keywords : bismuth ferrite * crystal growth * high-resolution electron microscopy * atomic structure * first- principles calculations Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 5.058, year: 2015

  13. Study of inclusive proton spectra from 20 MeV deuteron breakup by bismuth

    International Nuclear Information System (INIS)

    Badiger, N.M.; Hallur, B.R.; Madhusoodhanan, T.; Sathyavathiamma, M.P.; Puttaswamy, N.G.; Darshan, V.P.; Sharma, H.; Chintalapudi, S.N.


    The breakup of deuteron into proton and neutron has been studied earlier to understand the breakup mechanism. Inclusive measurements show the expected broad bumps near the beam velocity. In the present experiment, the breakup of 20 MeV deuterons by bismuth target has been investigated

  14. Effects of spark plasma sintering conditions on the anisotropic thermoelectric properties of bismuth antimony telluride

    DEFF Research Database (Denmark)

    Han, Li; Hegelund Spangsdorf, Steeven; Van Nong, Ngo


    Bismuth antimony telluride (BixSb2-xTe3, 0.4 room-temperature thermoelectric power generation. In this work, p-type Bi0.4Sb1.6Te3 samples were prepared under various conditions (temperature, holding time, and ramp...

  15. Effect of bismuth citrate, lactose, and organic acid on necrotic enteritis in broilers (United States)

    Clostridium perfringens – associated necrotic enteritis causes significant losses and increased morbidity in poultry. The objective of this study was to evaluate the effect of bismuth citrate and acidifiers on the development of necrotic enteritis in broilers. The first study was a dose response t...

  16. Mucosa protectives: sucralfate and colloidal bismuth subcitrate in peptic ulcer disease

    NARCIS (Netherlands)

    Tytgat, G. N.; Nio, C. Y.


    Mucosa protective drugs are thought to have an important role in the treatment of both duodenal (DU) and gastric ulcer (GU) disease by means of correcting the disturbed defensive factors. Sucralfate as well as colloidal bismuth subcitrate (CBS) form a layer on the ulcer base and in this way protect

  17. Dismantling and chemical characterization of spent Peltier thermoelectric devices for antimony, bismuth and tellurium recovery. (United States)

    Balva, Maxime; Legeai, Sophie; Garoux, Laetitia; Leclerc, Nathalie; Meux, Eric


    Major uses of thermoelectricity concern refrigeration purposes, using Peltier devices, mainly composed of antimony, bismuth and tellurium. Antimony was identified as a critical raw material by EU and resources of bismuth and tellurium are not inexhaustible, so it is necessary to imagine the recycling of thermoelectric devices. That for, a complete characterization is needed, which is the aim of this work. Peltier devices were manually dismantled in three parts: the thermoelectric legs, the alumina plates on which remain the electrical contacts and the silicone paste used to connect the plates. The characterization was performed using five Peltier devices. It includes mass balances of the components, X-ray diffraction analysis of the thermoelectric legs and elemental analysis of each part of the device. It appears that alumina represents 45% of a Peltier device in weight. The electrical contacts are mainly composed of copper and tin, and the thermoelectric legs of bismuth, tellurium and antimony. Thermoelectric legs appear to be Se-doped Bi 2 Te 3 and (Bi 0,5 Sb 1,5 )Te 3 for n type and p type semiconductors, respectively. This work shows that Peltier devices can be considered as a copper ore and that thermoelectric legs contain high amounts of bismuth, tellurium and antimony compared to their traditional resources.

  18. Dietary intake of barium, bismuth, chromium, lithium, and strontium in a Spanish population (Canary Islands, Spain). (United States)

    González-Weller, Dailos; Rubio, Carmen; Gutiérrez, Ángel José; González, Gara Luis; Caballero Mesa, José María; Revert Gironés, Consuelo; Burgos Ojeda, Antonio; Hardisson, Arturo


    The aim of this study was to analyze barium, bismuth, chromium, lithium, and strontium contents in food and beverages consumed by the population of the Canary Islands (Spain) as well as determine dietary intake of these metals in the archipelago as a whole and in its individual islands. To this end, 440 samples were analyzed by ICP-OES and GFAAS. Barium concentrations ranged from 5.210 ± 2.117 mg/kg in nuts to 0.035 ± 0.043 mg/L in water. Viscera exhibited the highest levels of bismuth (38.07 ± 36.80 mg/kg). The cold meat and sausages group stood out for its high chromium concentrations (0.494 ± 0.257 mg/kg). The highest concentration of lithium and strontium came out in nuts (8.761 ± 5.368 mg/kg and 9.759 ± 5.181 mg/kg, respectively). The total intakes of barium, bismuth, chromium, lithium, and strontium were 0.685, 1.274, 0.087, 3.674, and 1.923 mg/day, respectively. Cereals turned out to contribute most to the dietary intake of barium, bismuth, chromium, and lithium in the Canary Islands, while fruit contributes most to the strontium intake. We also performed a metal intake study by age and sex of the population and compared the outcome with data from other regions, both national and international.

  19. Influence of bismuth on properties and microstructures of Sr0⋅ 5Ba0 ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 29; Issue 5. Influence of bismuth on properties and microstructures of Sr0.5Ba0.5–Bi TiO3 thin films. Tao Wenhong Wang Yin Fu Xinghua Wei Qihong. Thin Films Volume 29 Issue 5 October 2006 pp 523-527 ...

  20. Evaluation of gamma-ray attenuation properties of bismuth borate glass systems using Monte Carlo method (United States)

    Tarim, Urkiye Akar; Ozmutlu, Emin N.; Yalcin, Sezai; Gundogdu, Ozcan; Bradley, D. A.; Gurler, Orhan


    A Monte Carlo method was developed to investigate radiation shielding properties of bismuth borate glass. The mass attenuation coefficients and half-value layer parameters were determined for different fractional amounts of Bi2O3 in the glass samples for the 356, 662, 1173 and 1332 keV photon energies. A comparison of the theoretical and experimental attenuation coefficients is presented.

  1. Synergism between clindamycin and colloidal bismuth subcitrate against Helicobacter (Campylobacter) pylori in vitro. (United States)

    Vogt, K; Hahn, H


    A combination of clindamycin and colloidal bismuth subcitrate was evaluated for synergistic inhibition of Helicobacter pylori employing the agar dilution method. A total of 47 clinical isolates of Helicobacter pylori were examined. Synergistic interaction was observed in 36%, additive behaviour in 64% of the strains. No antagonism could be detected.

  2. Improvements in the energy resolution and high-count-rate performance of bismuth germanate

    International Nuclear Information System (INIS)

    Koehler, P.E.; Wender, S.A.; Kapustinsky, J.S.


    Several methods for improving the energy resolution of bismuth germanate (BGO) have been investigated. It is shown that some of these methods resulted in a substantial improvement in the energy resolution. In addition, a method to improve the performance of BGO at high counting rates has been systematically studied. The results of this study are presented and discussed

  3. Structure-Composition-Property Relationships of Complex Bismuth Oxide Based Photocatalysts

    Energy Technology Data Exchange (ETDEWEB)

    Vogt, Thomas [Univ. of South Carolina, Columbia, SC (United States). Dept. of Chemistry and Biochemistry


    Development of a new family of up- and down-conversion materials based on oxtfluorides that can potentially increase photocatalytic activities of photocatalysts such as bismuth oxides and can also be used as phosphors in Al1-xGaxN-based devices and solar devices.

  4. Catalyst free, base free microwave irradiated synthesis of aryl nitrites from potassium aryltrifluoroborates and bismuth nitrate (United States)

    Al-Masum, Mohammad; Welch, Rebecca L.


    A mixture of bismuth nitrate pentahydrate and potassium aryltrifluoroborate in toluene under microwave heating at 120 °C for 20 min provides an interesting and mild reaction protocol for the synthesis of aryl nitrite. The conversion to aryl nitrites from aryltrifluoroborates without transition metal catalyst and base in high yields is remarkable. PMID:25242828

  5. Radioprotection to the Gonads in Pediatric Pelvic Radiography: Effectiveness of Developed Bismuth Shield

    Directory of Open Access Journals (Sweden)

    Vahid Karami


    Full Text Available Background: The use and effectiveness of traditional lead gonad shields in pediatric pelvic radiography has been challenged by several literatures over the past two decades. The aim of this study was to develop a new radioprotective gonad shields to be use in pediatric pelvic radiography. Materials and Methods: The commercially available 0.06 mm lead equivalent bismuth garment has cropped squarely and used as ovarian shield to cover the entire region of pelvis. In order to prevent deterioration of image quality due to beam hardening artifacts, a 1-cm foam as spacer was located between the shield and patients pelvis. Moreover, we added a lead piece at the cranial position of the bismuth garment to absorb the scatter radiations to the radiosensitive organs. In girls, 49 radiographs with shield and 46 radiographs without shield was taken. The radiation dose was measured using thermoluminescent dosimeters (TLDs. Image quality assessments were performed using the European guidelines. For boys, the lead testicular shields was developed using 2 cm bismuth garment, added to the sides. The prevalence and efficacy of testicular shields was assessed in clinical practice fromFebruary 2016 to June 2016. Results: Without increasing the dose to the breast, thyroid and the lens of the eyes, the use of bismuth shield has reduced the entrance skin dose(ESD of the pelvis and radiation dose to the ovaries by 62.2% and 61.7%, respectively (P

  6. Determination of trace amounts of lead and cadmium using a bismuth/glassy carbon composite electrode. (United States)

    Hwang, Gil-Ho; Han, Won-Kyu; Hong, Seok-Jun; Park, Joon-Shik; Kang, Sung-Goon


    We examined the use of a bismuth-glassy carbon (Bi/C) composite electrode for the determination of trace amounts of lead and cadmium. Incorporated bismuth powder in the composite electrode was electrochemically dissolved in 0.1M acetate buffer (pH 4.5) where nanosized bismuth particles were deposited on the glassy carbon at the reduction potential. The anodic stripping voltammetry on the Bi/C composite electrode exhibited well-defined, sharp and undistorted peaks with a favorable resolution for lead and cadmium. Comparing a non-oxidized Bi/C composite electrode with an in-situ plated bismuth film electrode, the Bi/C composite electrode exhibited superior performance due to its much larger surface area. The limit of detection was 0.41 microg/L for lead and 0.49 microg/L for cadmium. Based on this study, we are able to conclude that various types of composite electrodes for electroanalytical applications can be developed with a prudent combination of electrode materials.

  7. Renal pigmentation due to chronic bismuth administration in a rhesus macaque (Macaca mulatta). (United States)

    Johnson, A L; Blaine, E T; Lewis, A D


    Renal pigmentation due to the administration of exogenous compounds is an uncommon finding in most species. This report describes renal pigmentation and intranuclear inclusions of the proximal convoluted tubules due to chronic bismuth administration in a rhesus macaque. An 11-year-old Indian-origin rhesus macaque with a medical history of chronic intermittent vomiting had been treated with bismuth subsalicylate, famotidine, and omeprazole singly or in combination over the course of 8 years. At necropsy, the renal cortices were diffusely dark green to black. Light and electron microscopy revealed intranuclear inclusions within the majority of renal proximal tubular epithelial cells. These inclusions appeared magenta to brown when stained with hematoxylin and eosin and were negative by the Ziehl-Neelsen acid-fast stain. Elemental analysis performed on frozen kidney measured bismuth levels to be markedly elevated at 110.6 ppm, approximately 500 to 1000 times acceptable limits. To our knowledge, this is the first report of renal bismuth deposition in a rhesus macaque resulting in renal pigmentation and intranuclear inclusions. © The Author(s) 2014.

  8. First heats of cerium solution in liquid aluminium, gallium, indium, tin, lead and bismuth

    International Nuclear Information System (INIS)

    Yamshchikov, L.F.; Lebedev, V.A.; Nichkov, I.F.; Raspopin, S.P.; Shein, V.G.


    Cerium solution heats in liquid alluminium, gallium, indium, tin, lead and bismuth are determined in high temperature mixing calorimeter with an isothermal shell. The statistical analysis carried out proves that values of cerium solution heat in fusible metals obtained by the methods of electric motive forces and calorimety give a satisfactory agreement

  9. Ultrathin bismuth nanosheets from in situ topotactic transformation for selective electrocatalytic CO2 reduction to formate. (United States)

    Han, Na; Wang, Yu; Yang, Hui; Deng, Jun; Wu, Jinghua; Li, Yafei; Li, Yanguang


    Electrocatalytic carbon dioxide reduction to formate is desirable but challenging. Current attention is mostly focused on tin-based materials, which, unfortunately, often suffer from limited Faradaic efficiency. The potential of bismuth in carbon dioxide reduction has been suggested but remained understudied. Here, we report that ultrathin bismuth nanosheets are prepared from the in situ topotactic transformation of bismuth oxyiodide nanosheets. They process single crystallinity and enlarged surface areas. Such an advantageous nanostructure affords the material with excellent electrocatalytic performance for carbon dioxide reduction to formate. High selectivity (~100%) and large current density are measured over a broad potential, as well as excellent durability for >10 h. Its selectivity for formate is also understood by density functional theory calculations. In addition, bismuth nanosheets were coupled with an iridium-based oxygen evolution electrocatalyst to achieve efficient full-cell electrolysis. When powered by two AA-size alkaline batteries, the full cell exhibits impressive Faradaic efficiency and electricity-to-formate conversion efficiency.

  10. Bismuth ferrite as low-loss switchable material for plasmonic waveguide modulator. (United States)

    Babicheva, Viktoriia E; Zhukovsky, Sergei V; Lavrinenko, Andrei V


    We propose new designs of plasmonic modulators, which can be used for dynamic signal switching in photonic integrated circuits. We study performance of a plasmonic waveguide modulator with bismuth ferrite as a tunable material. The bismuth ferrite core is sandwiched between metal plates (metal-insulator-metal configuration), which also serve as electrodes. The core changes its refractive index by means of partial in-plane to out-of-plane reorientation of ferroelectric domains in bismuth ferrite under applied voltage. As a result, guided modes change their propagation constant and absorption coefficient, allowing light modulation in both phase and amplitude control schemes. Due to high field confinement between the metal layers, existence of mode cut-offs for certain values of the core thickness, and near-zero material losses in bismuth ferrite, efficient modulation performance is achieved. For the phase control scheme, the π phase shift is provided by a 0.8-μm long device with propagation losses 0.29 dB/μm. For the amplitude control scheme, up to 38 dB/μm extinction ratio with 1.2 dB/μm propagation loss is predicted.

  11. Preparation of Bismuth Oxide Photocatalyst and Its Application in White-light LEDs

    Directory of Open Access Journals (Sweden)

    Yen-Chang Chu


    Full Text Available Bismuth oxide photocatalysts were synthesized and coated on the front surface of phosphor-converted white light-emitting diodes to produce a safe and environmentally benign lighting source. Bismuth oxide photocatalyst powders were synthesized with a spray pyrolysis method at 500°C, 600°C, 700°C, and 800°C. Using the absorption spectrum in the blue and UV regions of the bismuth oxide photocatalysts, the blue light and UV leakage problems of phosphor-converted white LEDs can be significantly reduced. The experimental results showed that bismuth oxide photocatalyst synthesized at 700°C exhibited the most superior spectrum inhibiting ability. The suppressed ratio reached 52.33% in the blue and UV regions from 360 to 420 nm. Related colorimetric parameters and the photocatalyst decomposition ability of fabricated white-light LEDs were tested. The CIE chromaticity coordinates (x,y were (0.349, 0.393, and the correlated color temperature was 4991 K. In addition, the coating layer of photocatalyst can act as an air purifier and diffuser to reduce glare. A value of 66.2±0.60 ppmv of molecular formaldehyde gas can be decomposed in 120 mins.

  12. Fridel-Crafts acylation using bismuth triflate in [BMI][PF6

    DEFF Research Database (Denmark)

    Tran, Phuong Hoang; Duus, Fritz; Le, Thach Ngoc


    Bismuth trifluoromethanesulfonate was found to be a good catalyst for the Friedel–Craftsacylation. Bismuthtriflate immobilized in an ionic liquid was the most efficient catalytic system. Bismuthtriflate in [BMI][PF6] catalyzes this reaction under microwave irradiation allowing the rapid synthesis...

  13. Persistent conductive footprints of 109o domain walls in bismuth ferrite films

    NARCIS (Netherlands)

    Stolichnov, I.; Iwanowska, M.; Colla, E.; Ziegler, B.; Gaponenko, I.; Paruch, P.; Huijben, Mark; Rijnders, Augustinus J.H.M.; Setter, N.


    Using conductive and piezoforce microscopy, we reveal a complex picture of electronic transport at weakly conductive 109° domain walls in bismuth ferrite films. Even once initial ferroelectric stripe domains are changed/erased, persistent conductive paths signal the original domain wall position.

  14. Growth morphology and structure of bismuth thin films on GaSb(110)

    DEFF Research Database (Denmark)

    Gemmeren, T. van; Lottermoser, L.; Falkenberg, G.


    Photoelectron spectroscopy, low-energy electron diffraction, scanning tunneling microscopy and surface X-ray diffraction were used to investigate the growth of thin layers of bismuth on GaSb(110). At submonolayer coverages, growth of two-dimensional islands occurs. A uniform (1 x I)-reconstructio......Photoelectron spectroscopy, low-energy electron diffraction, scanning tunneling microscopy and surface X-ray diffraction were used to investigate the growth of thin layers of bismuth on GaSb(110). At submonolayer coverages, growth of two-dimensional islands occurs. A uniform (1 x I......)-reconstruction is formed at a coverage of one monolayer. A structural model derived from X-ray diffraction data is presented for this phase. The (1 x I)-phase consists of zigzag chains of bismuth atoms bonded alternately to the surface cations and anions of the bulk-terminated unrelaxed (110) surface. We propose...... that the (1 x 1)-phases formed by antimony and bismuth adsorbates on (110) surfaces of other III-V compound semiconductors are also described by the epitaxial continued layer model. (C) 1998 Elsevier Science B.V. All rights reserved....

  15. Growth and Low Temperature Transport Measurements of Pure and Doped Bismuth Selenide

    DEFF Research Database (Denmark)

    Mlack, Jerome Thomas

    pressure vapor-solid growth. The growth method yields a variety of nanostructures, and materials analysis shows ordered structures of bismuth selenide in all cases. Low-temperature measurements of as-grown nanostructures indicate tunable carrier density in all samples. By doping the nanostructures...

  16. Electrodeposition of bismuth telluride thermoelectric films from a nonaqueous electrolyte using ethylene glycol

    NARCIS (Netherlands)

    Nguyen, H.P.; Wu, M.; Su, J.; Vullers, R.J.M.; Vereecken, P.M.; Fransaer, J.


    Ethylene glycol was studied as an electrolyte for the electrodeposition of thermoelectric bismuth telluride films by cyclic voltammetry, rotating ring disk electrode and electrochemical quartz crystal microbalance (EQCM). The reduction of both Bi3+ and Te4+ ions proceeds in one step without the

  17. Studying Impact of Different Precipitating Agents on Crystal Structure, Morphology and Photocatalytic Activity of Bismuth Oxide

    Directory of Open Access Journals (Sweden)

    Yayuk Astuti


    How to Cite: Astuti, Y., Arnelli, Pardoyo, Fauziyah, A., Nurhayati, S., Wulansari, A.D., Andianingrum, R., Widiyandari, H., Bhaduri, G.A. (2017. Studying Impact of Different Precipitating Agents on Crystal Structure, Morphology and Photocatalytic Activity of Bismuth Oxide. Bulletin of Chemical Reaction Engineering & Catalysis, 12 (3: 478-484 (doi:10.9767/bcrec.12.3.1144.478-484

  18. Bio-assisted synthesis and characterization of nanostructured bismuth (III) sulphide using Clostridium acetobutylicum

    International Nuclear Information System (INIS)

    Kamaraj, Sathish Kumar; Venkatachalam, Ganesh; Arumugam, Palaniappan; Berchmans, Sheela


    Nanostructured bismuth (III) sulphide is synthesized at room temperature using a hydrogen sulphide producing microorganism namely Clostridium acetobutylicum. On contrary to chemical routes involving both the high and room temperature methods, the present experimental procedure involves a bio-assisted approach. This method is free from the usage of toxic and hazardous chemicals making it an environment friendly route. The synthesized bismuth sulphide is characterized using transmission electron microscope (TEM), powder X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and cyclic voltammetry (CV). From our experiments we find that bismuth sulphide produced using this bio-assisted approach exhibits a hexagonal shaped plate-like structures and is stabilized by the extracellular proteins present in the culture medium. - Graphical abstract: A green chemistry approach towards the synthesis of bismuth (III) sulphide nanostructures at room temperature using a hydrogen sulphide producing microorganism namely, Clostridium acetobutylicum is demonstrated. - Highlights: • Environmentally benign (greener) route towards synthesis of Bi 2 S 3 nanostructures. • Bio-assisted synthesis of Bi 2 S 3 at room temperature using Clostridium acetobutylicum. • Extracellular proteins in H 2 S producing microorganism as stabilizer for Bi 2 S 3 NPs. • Hexagonal platelets of Bi 2 S 3 possessing an orthorhombic crystalline structure

  19. Structural Engineering of Vacancy Defected Bismuth Tellurides for Thermo-electric Applications

    Directory of Open Access Journals (Sweden)

    Chumakov Y.


    Full Text Available Molecular Dynamics and ab-initio simulations are used to find the most stable stoichiometries of Bismuth Tellurides with vacancy defects. The interest is to decrease the thermal conductivity of these compounds a key point to achieve high figure of merits. A reduction of 70% of the thermal conductivity is observed with Te vacancies of only 5%.

  20. Dynamic spatial structure of spontaneous beams in photorefractive bismuth sillicon oxide

    DEFF Research Database (Denmark)

    Buchhave, Preben; Lyuksyutov, S.; Vasnetsov, M.


    We report the domain structure of spontaneously occurring beams (subharmonics) in photorefractive bismuth silicon oxide with an applied electric field from 1 to 6 kV/cm and a running grating. The subharmonic beams are generated in a pattern of domains that evolve dynamically as they move through...

  1. Improvements to a Flow Sensor for Liquid Bismuth-Fed Hall Thrusters (United States)

    Bonds, Kevin; Polzin, Kurt A.


    Recently, there has been significant interest in using bismuth metal as a propellant in Hall Thrusters [1, 2]. Bismuth offers some considerable cost, weight, and space savings over the traditional propellant--xenon. Quantifying the performance of liquid metal-fed Hall thrusters requires a very precise measure of the low propellant flow rates [1, 2]. The low flow rates (10 mg/sec) and the temperature at which free flowing liquid bismuth exists (above 300 C) preclude the use of off-the-shelf flow sensing equipment [3]. Therefore a new type of sensor is required. The hotspot bismuth flow sensor, described in Refs. [1-5] is designed to perform a flow rate measurement by measuring the velocity at which a thermal feature moves through a flow chamber. The mass flow rate can be determined from the time of flight of the thermal peak, [4, 5]. Previous research and testing has been concerned mainly with the generation of the thermal peak and it's subsequent detection. In this paper, we present design improvements to the sensor concept; and the results of testing conducted to verify the functionality of these improvements. A ceramic material is required for the sensor body (see Fig. 1), which must allow for active heating of the bismuth flow channel to keep the propellant in a liquid state. The material must be compatible with bismuth and must be bonded to conductive elements to allow for conduction of current into the liquid metal and measurement of the temperature in the flow. The new sensor requires fabrication techniques that will allow for a very small diameter flow chamber, which is required to produce useful measurements. Testing of various materials has revealed several that are potentially compatible with liquid bismuth. Of primary concern in the fabrication and testing of a robust, working prototype, is the compatibility of the selected materials with one another. Specifically, the thermal expansion rates of the materials relative to the ceramic body cannot expand so

  2. X-ray dose enhancement effects on N80C196KC20 chips

    International Nuclear Information System (INIS)

    Yang Huaimin; Xu Xi; Deng Jianhong; Zhan Junling; Zhao Juchao; Wang Xuli; Yuan Guohuo


    The characteristics' degradation and X-ray enhancement effects of N80C196KC20 chips were presented. The X-ray and 60 Co irradiations of N80C196KC20 chips from Intel Company were performed to investigate the response of operating currents I cc . The operation failure symbolizes the total dose response of the chips. The total dose failure level of the chips is very low, and the γ total dose failure is about 165 Gy(Si). The operating current of the chip increases significantly when failure of the chip happens. The X-ray enhanced factor of N80C196KC20 chip is measured and the X-ray enhancement mechanism is studied. (authors)

  3. Hall Plateaus at magic angles in ultraquantum Bismuth (United States)

    Benoît, Fauqué.


    The behaviour of a three-dimensional electron gas in the presence of a magnetic field strong enough to put all carriers in the first Landau level (i.e. beyond the quantum limit) is a longstanding question of theoretical condensed matter physics [1]. This issue has been recently explored by two high-field experiments on elemental semi-metal Bismuth. In a first study of transport coefficients (which are dominated by hole-like carriers), the Nernst coefficient presented three unexpected maxima that are concomitant with quasi-plateaux in the Hall coefficient [2]. In a second series of experiments, torque magnetometry (which mainly probes the three Dirac valley electron pockets) detected a field-induced phase transition [3]. The full understanding of the electron and hole behaviours above the quantum limit of pure Bi is therefore still under debate. In this talk, we will present our measurement of the Hall resistivity and torque magnetometry with magnetic field up to 31 T and rotating in the trigonal-bisectrix plane [4]. The Hall response is dominated by the hole pockets according to its sign as well as the period and the angular dependence of its quantum oscillations. In the vicinity of the quantum limit, it presents additional anomalies which are the fingerprints of the electron pockets. We found that for particular orientations of the magnetic field (namely ``magic angles''), the Hall response becomes field-independent within the experimental resolution around 20T. This drastic dependence of the plateaux on the field orientation provides strong constraints for theoretical scenarios. [4pt] [1] Bertrand I. Halperin, Japanese Journal of Applied Physics, 26, Supplement 26-3 (1987).[0pt] [2] Kamran Behnia, Luis Balicas, Yakov Kopelevich, Science, 317, 1729 (2008).[0pt] [3] Lu Li, J. G. Checkelsky, Y. S. Hor, C. Uher, A. F. Hebard, R. J. Cava, and N. P. Ong , Science, 321, 5888 (2008).[0pt] [4] Benoît Fauqu'e, Luis Balicas, Ilya Sheikin, Jean Paul Issi and Kamran Behnia

  4. Inadvertent exaggerated anticoagulation following use of bismuth subsalicylate in an enterally fed patient receiving warfarin therapy. (United States)

    Bingham, Angela L; Brown, Rex O; Dickerson, Roland N


    We report a case of an inadvertent increase in the international normalized ratio (INR) after the addition of bismuth subsalicylate for the treatment of diarrhea in an enterally fed patient receiving warfarin therapy. A 56-year-old Caucasian female presented to the trauma intensive care unit (ICU) with multiple lower extremity fractures. Warfarin was initiated for deep vein thrombosis prophylaxis due to the patient's inability to ambulate. The target INR was 2-3. Continuous intragastric enteral feeding was withheld 1 hour before and 1 hour after intragastric administration of warfarin. Bismuth subsalicylate 30 mL every 4 hours was prescribed for diarrhea. Within 3 days after starting bismuth subsalicylate therapy, the patient's INR increased from 2.56 to 3.54 and minor bleeding was noted from the patient's tracheostomy site. No significant change in warfarin dosage, variability in vitamin K intake, or medications that potentially alter warfarin metabolism were present during the unexpected rise in INR. When the bismuth subsalicylate was discontinued, the patient's INR stabilized into the target range on the same warfarin dose given at the time of the supratherapeutic INR. Salicylate displaces warfarin from plasma protein binding sites and may result in a significant increase in INR secondary to redistribution of warfarin to the free active form. Evaluation of this case report using the Drug Interaction Probability Scale and Naranjo Adverse Drug Reaction Probability Scale yielded scores consistent with a probable adverse drug interaction. Bismuth subsalicylate exaggerates warfarin's anticoagulant response and its concurrent use during warfarin therapy should be avoided.

  5. Second-line bismuth-containing quadruple therapy for Helicobacter pylori eradication and impact of diabetes. (United States)

    Kim, Sung Eun; Park, Moo In; Park, Seun Ja; Moon, Won; Kim, Jae Hyun; Jung, Kyoungwon; Kim, Hae Koo; Lee, Young Dal


    To investigate Helicobacter pylori ( H . pylori ) eradication rates using second-line bismuth-containing quadruple therapy and to identify predictors of eradication failure. This study included 636 patients who failed first-line triple therapy and received 7 d of bismuth-containing quadruple therapy between January 2005 and December 2015. We retrospectively demonstrated H . pylori eradication rates with respect to the year of therapy as well as demographic and clinical factors. H . pylori eradication was confirmed by a 13 C-urea breath test or a rapid urease test at least 4 wk after the completion of bismuth-based quadruple therapy: proton pump inhibitor, metronidazole, bismuth, and tetracycline. The overall eradication rates by intention-to-treat analysis and per-protocol analysis were 73.9% (95%CI: 70.1%-77.4%) and 94.5% (95%CI: 92.4%-96.5%), respectively. Annual eradication rates from 2005 to 2015 were 100.0%, 92.9%, 100.0%, 100.0%, 100.0%, 97.4%, 100.0%, 93.8%, 84.4%, 98.9%, and 92.5%, respectively, by per-protocol analysis. A multivariate analysis showed that diabetes mellitus (OR = 3.99, 95%CI: 1.56-10.20, P = 0.004) was associated with H . pylori eradication therapy failure. The second-line bismuth-containing quadruple therapy for H . pylori infection is still effective in Korea, and diabetes mellitus is suggested to be a risk factor for eradication failure.

  6. Quantitative 3D Determination of Radiosensitization by Bismuth-Based Nanoparticles. (United States)

    Alqathami, Mamdooh; Blencowe, Anton; Geso, Moshi; Ibbott, Geoffrey


    The nanoparticle-induced dose enhancement effect has been shown to improve the therapeutic efficacy of ionizing radiation in external beam radiotherapy. Whereas previous studies have focused on gold nanoparticles (AuNPs), no quantitative studies have been conducted to investigate the potential superiority of other high atomic number (Z) nanomaterials such as bismuth-based nanoparticles. The aims of this study were to experimentally validate and quantify the dose enhancement properties of commercially available bismuth-based nanoparticles (bismuth oxide (Bi2O3-NPs) and bismuth sulfide (Bi2S3-NPs)), and investigate their potential superiority over AuNPs in terms of radiation dose enhancement. Phantom cuvettes doped with and without nanoparticles where employed for measuring radiation dose enhancement produced from the interaction of radiation with metal nanoparticles. Novel 3D phantoms were employed to investigate the 3D spatial distribution of ionising radiation dose deposition. The phantoms were irradiated with kilovoltage and megavoltage X-ray beams and optical absorption changes were measured using a spectrophotometer and optical CT scanner. The radiation dose enhancement factors (DEFs) obtained for 50 nm diameter Bi2O3-NPs and AuNPs were 1.90 and 1.77, respectively, for 100 kV energy and a nanoparticle concentration of 0.5 mM. In addition, the DEFs of 5 nm diameter Bi2S3-NPs and AuNPs were determined to be 1.38 and 1.51, respectively, for 150 kV energy and a nanoparticle concentration of 0.25 mM. The results demonstrate that both bismuth-based nanoparticles can enhance the effects of radiation. For 6 MV energy the DEFs for all the investigated nanoparticles were lower (< 15%) than with kilovoltage energy.

  7. The impact of bismuth addition to sequential treatment on Helicobacter pylori eradication: A pilot study. (United States)

    Basyigit, Sebahat; Kefeli, Ayse; Sapmaz, Ferdane; Yeniova, Abdullah Ozgür; Asilturk, Zeliha; Hokkaomeroglu, Murat; Uzman, Metin; Nazligul, Yasar


    The success of the current anti-Helicobacter pylori (H. pylori) treatment protocols is reported to decrease by years, and research is needed to strengthen the H. pylori eradication treatment. Sequential treatment (ST), one of the treatment modalities for H. pylori eradication, includes amoxicillin 1 gr b.i.d and proton pump inhibitor b.i.d for first 5 days and then includes clarithromycin 500 mg b.i.d, metronidazole 500 mg b.i.d and a proton pump inhibitor b.i.d for remaining 5 days. In this study, we investigated efficacy and tolerability of bismuth addition in to ST. We included patients that underwent upper gastrointestinal endoscopy in which H. pylori infection was diagnosed by histological examination of antral and corporal gastric mucosa biopsy. Participants were randomly administered ST or bismuth containing ST (BST) protocols for the first-line H. pylori eradication therapy. Participants have been tested by urea breath test for eradication success 6 weeks after the completion of treatment. One hundred and fifty patients (93 female, 57 male) were enrolled. There were no significant differences in eradication rates for both intention to treat population (70.2%, 95% confidence interval [CI]: 66.3-74.1% vs. 71.8%, 95% CI: 61.8-81.7%, for ST and BST, respectively, p>0.05) and per protocol population (74.6%, 95% CI: 63.2-85.8% vs. 73.7%, 95% CI: 63.9-83.5% for ST and BST, respectively, p>0.05). Despite the undeniable effect of bismuth, there may be several possible reasons of unsatisfactory eradication success. Drug administration time, coadministration of other drugs, possible H. pylori resistance to bismuth may affect the eradication success. The addition of bismuth subcitrate to ST regimen does not provide significant increase in eradication rates.

  8. Efficacy and Safety of Wei Bi Mei, a Chinese Herb Compound, as an Alternative to Bismuth for Eradication of Helicobacter pylori

    Directory of Open Access Journals (Sweden)

    Lei Li


    Full Text Available Bismuth-containing quadruple therapy has been recommended as the first line of treatment in areas of high clarithromycin or metronidazole resistance. However, safety concerns of bismuth agents have long been raised. We first assessed the efficacy and safety of Wei Bi Mei granules, which are bismuth compounds consisting of three synthetic drugs and five medicinal herbs, compared to bismuth aluminate and colloidal bismuth subcitrate (CBS in H. pylori-infected mouse model. We then used atomic fluorescence spectroscopy and autometallography to measure the accumulation of three bismuth agents in the brain, heart, liver, and kidneys in adult Sprague-Dawley rats. We also evaluated the safety of bismuth agents by conducting clinical biochemistry tests in blood samples of experimental animals. Wei Bi Mei granules exhibited the highest efficacy of anti-H. pylori activity and yielded the lowest bismuth accumulation when compared to CBS and bismuth aluminate. Our findings show that Wei Bi Mei granules are a safe Chinese medicinal herb with potent anti-H. pylori activity and can be considered as an alternative to current bismuth compounds. Thus, Wei Bi Mei granules merit further evaluation, particularly with regard to efficacy and safety when they are combined with other H. pylori eradication medications in the clinical setting.

  9. The quadrupole moment of 196Pt - a crucial test of nuclear models

    International Nuclear Information System (INIS)

    Fewell, M.P.; Gyapong, G.J.; Spear, R.H.; Esat, M.T.; Baxter, A.M.; Burnett, S.M.


    The static electric quadrupole moment Q 2 + and the B(E2;0 + → 2 + ) of the first excited state of 196 Pt have been determined using Coulomb excitation. The results are Q 2 + = 0.79+-0.12 eb and B(E2;0 + → 2 + ) = 1.382+-0.006 e 2 b 2 . The Bohr-Mottelson model and the 0(6) limit of the interacting boson model fail to reproduce these values when constrained to fit other known properties of 196 Pt

  10. Alkali metal bismuth(III) chloride double salts

    Energy Technology Data Exchange (ETDEWEB)

    Kelly, Andrew W. [Department of Chemistry, College of William and Mary, Williamsburg, VA 23187 (United States); Nicholas, Aaron; Ahern, John C. [Department of Chemistry, University of Maine, Orono, ME 04469 (United States); Chan, Benny [Department of Chemistry, College of New Jersey, Ewing, NJ 08628-0718 (United States); Patterson, Howard H. [Department of Chemistry, University of Maine, Orono, ME 04469 (United States); Pike, Robert D., E-mail: [Department of Chemistry, College of William and Mary, Williamsburg, VA 23187 (United States)


    near 295, 340, and 380 nm and a broad emission near 440 nm. - Graphical abstract: The double salts Na2BiCl5·5H2O, K7Bi3Cl16, Rb3BiCl6·0.5H2O, Cs3BiCl6, and Cs3Bi2Cl9 were formed by co-crystallization of MCl (M = Na, K, Rb, Cs) with BiOCl in aqueous HCl. The crystal structures and solid state luminescence are reported. - Highlights: • New double salt phases are reported for NaCl/BiCl{sub 3}, KCl/BiCl{sub 3}, RbCl/BiCl{sub 3}, and CsCl/BiCl{sub 3}. • A variety of alkali chloride:bismuth chloride ratios are reported. • Chloride bridging produces oligomeric and/or polymeric bismuth chloride chains in several cases. • Convenient bulk synthesis from BiOCl is reported. • Four of the five reported double salts exhibit photoluminescence as a result of charge transfer.

  11. Experimental study on the effects of bismuth subgallate on the inflammatory process and angiogenesis of the oral mucosa

    Directory of Open Access Journals (Sweden)

    Eduardo Vieira Couto


    Full Text Available ABSTRACT INTRODUCTION: Bismuth subgallate is a salt derived from heavy metal. The aim of this study was to evaluate the effect of this salt on some phases of healing. OBJECTIVES: To assess the effect of subgallate on mucosa and to evaluate the association between the use of bismuth subgallate and neogenesis of vessels in oral mucosal wounds. METHODS: This was a prospective and experimental study. This study used sixty rats, which were divided into control and experimental groups. The animals were submitted to a surgical procedure, which caused oral mucosal injury. A saline solution was applied on the wound of the control group, and in the experimental group, a solution of bismuth subgallate was administrated. RESULTS: The experimental group showed greater inflammatory reaction with increasing monomorphic proliferation. There was increased vessel proliferation in the control group. CONCLUSION: Bismuth subgallate had a negative influence on the healing process, delaying the rate of new vessel formation and optimal wound healing.

  12. The VHITAL program to demonstrate the performance and lifetime of a bismuth-fueled very high isp hall thruster (United States)

    Marrese-Reading, Colleen; Sengupta, Anita; Frisbee, Robert; Polk, Jay; Capelli, Mark; Boyd, Iain; Keidar, Michael; Tverdokhlebov, Sergey; Semenkin, Sasha; Markusic, Tom; hide


    In the Very High Isp Thruster with Anode Layer (VHITAL) Program the performance, plume and lifetime capability of the radiatively-cooled two stage, bismuth-fueled VHITAL-160 will be characterized in the US and Russia.

  13. Correlation between near infrared emission and bismuth radical species of Bi2O3-containing aluminoborate glass

    International Nuclear Information System (INIS)

    Masai, Hirokazu; Takahashi, Yoshihiro; Fujiwara, Takumi; Suzuki, Takenobu; Ohishi, Yasutake


    A strong correlation between bismuth radical species and emission in the near infrared (NIR) region of SnO-doped bismuth-containing aluminoborate glass, (CaO-B 2 O 3 -Bi 2 O 3 -Al 2 O 3 -TiO 2 ) (CaBBAT), was observed. Since the activation energy of the NIR emission was similar to that of electron spin resonance signal, it is expected that bismuth radical species in the CaBBAT glass is an origin of the NIR emission. Compared to the observed emission spectra with energy diagram of previous data, we have confirmed that bismuth ion possessing low valence is the origin of broad emission in the NIR region.

  14. Determination of Lung-to-Blood Absorption Rates for Lead and Bismuth which are Appropriate for Radon Progeny

    International Nuclear Information System (INIS)

    Marsh, J.W.; Birchall, A.


    The ICRP Publication 66 Human Respiratory Tract Model (HRTM) treats clearance as a competitive process between absorption into blood and particle transport to the gastrointestinal tract and lymphatics. The ICRP recommends default absorption rates for lead and bismuth in ICRP Publication 71 but states that the values are not appropriate for short-lived radon progeny. This paper describes an evaluation of published data from volunteer experiments to estimate the absorption half-times of lead and bismuth that are appropriate for short-lived radon progeny. The absorption half-time for lead was determined to be 10±2 h, based on 212 Pb lung and blood retention data from several studies. The absorption half-time for bismuth was estimated to be about 13 h, based on 212 Bi urinary excretion data from one experiment and the ICRP biokinetic model for bismuth as a decay product of lead. (author)

  15. Assessment of patient dose reduction by bismuth shielding in CT using measurements, GEANT4 and MCNPX simulations. (United States)

    Mendes, M; Costa, F; Figueira, C; Madeira, P; Teles, P; Vaz, P


    This work reports on the use of two different Monte Carlo codes (GEANT4 and MCNPX) for assessing the dose reduction using bismuth shields in computer tomography (CT) procedures in order to protect radiosensitive organs such as eye lens, thyroid and breast. Measurements were performed using head and body PMMA phantoms and an ionisation chamber placed in five different positions of the phantom. Simulations were performed to estimate Computed Tomography Dose Index values using GEANT4 and MCNPX. The relative differences between measurements and simulations were bismuth shielding ranges from 2 to 45 %, depending on the position of the bismuth shield. The percentage of dose reduction was more significant for the area covered by the bismuth shielding (36 % for eye lens, 39 % for thyroid and 45 % for breast shields). © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions, please email:

  16. Copper(I)-catalyzed cycloaddition of bismuth(III) acetylides with organic azides: synthesis of stable triazole anion equivalents. (United States)

    Worrell, Brady T; Ellery, Shelby P; Fokin, Valery V


    Fully loaded: Readily accessible and shelf-stable 1-bismuth(III) acetylides react rapidly and regiospecifically with organic azides in the presence of a copper(I) catalyst. The reaction tolerates many functional groups and gives excellent yields of the previously unreported 5-bismuth triazolides. This uniquely reactive intermediate is functionalized under mild reaction conditions to give fully substituted 1,2,3-triazoles. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. Copper(I)-Catalyzed Cycloaddition of Bismuth(III) Acetylides with Organic Azides: Synthesis of Stable Triazole Anion Equivalents (United States)

    Worrell, Brady T.; Ellery, Shelby P.


    Readily accessible and shelf-stable 1-bismuth(III) acetylides react rapidly and regiospecifically with organic azides in the presence of a copper(I) catalyst. The reaction tolerates many functional groups and gives excellent yields of the previously unreported, bench-stable 5-bismuth triazolides. This uniquely reactive intermediates can be further functionalized under extremely mild conditions to give fully substituted 1,2,3-triazoles. PMID:24130150

  18. 75 FR 15413 - Approval for Processing Authority, Foreign-Trade Zone 196, ATC Logistics & Electronics (Personal... (United States)


    ... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Order No. 1671] Approval for Processing Authority, Foreign-Trade Zone 196, ATC Logistics & Electronics (Personal Navigation Devices), Fort Worth.... 81a-81u), the Foreign-Trade Zones Board (the Board) adopts the following Order: Whereas, ATC Logistics...

  19. 75 FR 64248 - Approval for Manufacturing Authority Foreign-Trade Zone 196 ATC Logistics & Electronics (Cell... (United States)


    ... Authority Foreign-Trade Zone 196 ATC Logistics & Electronics (Cell Phone Kitting) Fort Worth, TX Pursuant to... Foreign-Trade Zones Board (the Board) adopts the following Order: Whereas, ATC Logistics & Electronics... Logistics & Electronics, as described in the application and Federal Register notice, is approved, subject...

  20. 42 CFR 413.196 - Notification of changes in rate-setting methodologies and payment rates. (United States)


    ... 42 Public Health 2 2010-10-01 2010-10-01 false Notification of changes in rate-setting... NURSING FACILITIES Payment for End-Stage Renal Disease (ESRD) Services and Organ Procurement Costs § 413.196 Notification of changes in rate-setting methodologies and payment rates. Link to an amendment...

  1. 28 CFR 19.6 - Responsibility of DOJ organizational units for program implementation and implementation procedures. (United States)


    ... the Department of Justice, for a listing of DOJ principal organizational units designated as... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Responsibility of DOJ organizational... Administration DEPARTMENT OF JUSTICE USE OF PENALTY MAIL IN THE LOCATION AND RECOVERY OF MISSING CHILDREN § 19.6...

  2. 75 FR 17691 - Foreign-Trade Zone 196 - Fort Worth, Texas, Application for Manufacturing Authority, ATC... (United States)


    ... Worth, Texas, Application for Manufacturing Authority, ATC Logistics & Electronics (Cell Phone Kitting... Board (the Board) by ATC Logistics & Electronics (ATCLE), operator of Site 2, FTZ 196, Fort Worth, Texas.... Executive Secretary. [FR Doc. 2010-7886 Filed 4-6-10; 8:45 am] BILLING CODE 3510-DS-S ...

  3. 32 CFR 196.425 - Counseling and use of appraisal and counseling materials. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Counseling and use of appraisal and counseling... Programs or Activities Prohibited § 196.425 Counseling and use of appraisal and counseling materials. (a) Counseling. A recipient shall not discriminate against any person on the basis of sex in the counseling or...

  4. Zagadnienie uczuć religijnych w kontekście art. 196 Kodeksu karnego

    Directory of Open Access Journals (Sweden)

    Barbara Tryka


    Full Text Available The article analyzes religious feelings in the context of criminal offence against religious feelings in the face of philosophical, psychological and juridical interpretations. According to Article 196 of the Polish Criminal Code from 1997 religious feelings are regarded as protected goods. However, the mentioned term has not been clearly defined, which provokes controversies in legal circles. The paper indicates the exact nature of religious feelings and their relation to religious beliefs. The author argues that Article 196 unnecessarily focuses on the offence of feelings rather than the defence of religion in the public sphere. The application of the expression religious feelings to the Criminal Code grants vast possibilities of its understanding and causes numerous over interpretations of Article 196. To avoid that confusion the law ought to circumscribe the extent to which religion can be protected. The inquiry into specific cases of offence against religious feelings must not be based on the subjective experience of the offended victim because one will never find the ultimate criterion to assess whether someone has actually been hurt. After the prohibited activities/possible offences against religion are defined, the behavior of the offender should be the main point of reference. A propounded amendment might generate other problems such as, for example, the transgression/violation of the neutrality of the state; therefore, Article 196 in its current meaning is unacceptable. Consequently, the religious feelings term should be clarified or removed.

  5. 30 CFR 250.196 - Reimbursements for reproduction and processing costs. (United States)


    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Reimbursements for reproduction and processing... Reporting Requirements § 250.196 Reimbursements for reproduction and processing costs. (a) MMS will... retains the information. (c) When you request reimbursement, you must identify reproduction and processing...

  6. 32 CFR 196.225 - Educational institutions eligible to submit transition plans. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Educational institutions eligible to submit... OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 196.225 Educational institutions eligible to submit transition plans. (a) Application. This section applies to each educational institution...

  7. 32 CFR 196.535 - Effect of state or local law or other requirements. (United States)


    ... SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS... in Education Programs or Activities Prohibited § 196.535 Effect of state or local law or other... 32 National Defense 2 2010-07-01 2010-07-01 false Effect of state or local law or other...

  8. Bismuth-ceramic nanocomposites through ball milling and liquid crystal synthetic methods (United States)

    Dellinger, Timothy Michael

    Three methods were developed for the synthesis of bismuth-ceramic nanocomposites, which are of interest due to possible use as thermoelectric materials. In the first synthetic method, high energy ball milling of bismuth metal with either MgO or SiO2 was found to produce nanostructured bismuth dispersed on a ceramic material. The morphology of the resulting bismuth depended on its wetting behavior with respect to the ceramic: the metal wet the MgO, but did not wet on the SiO2. Differential Scanning Calorimetry measurements on these composites revealed unusual thermal stability, with nanostructure retained after multiple cycles of heating and cooling through the metal's melting point. The second synthesis methodology was based on the use of lyotropic liquid crystals. These mixtures of water and amphiphilic molecules self-assemble to form periodic structures with nanometer-scale hydrophilic and hydrophobic domains. A novel shear mixing methodology was developed for bringing together reactants which were added to the liquid crystals as dissolved salts. The liquid crystals served to mediate synthesis by acting as nanoreactors to confine chemical reactions within the nanoscale domains of the mesophase, and resulted in the production of nanoparticles. By synthesizing lead sulfide (PbS) and bismuth (Bi) particles as proof-of-concept, it was shown that nanoparticle size could be controlled by controlling the dimensionality of the nanoreactors through control of the liquid crystalline phase. Particle size was shown to decrease upon going from three-dimensionally percolating nanoreactors, to two dimensional sheet-like nanoreactors, to one dimensional rod-like nanoreactors. Additionally, particle size could be controlled by varying the precursor salt concentration. Since the nanoparticles did not agglomerate in the liquid crystal immediately after synthesis, bismuth-ceramic nanocomposites could be prepared by synthesizing Bi nanoparticles and mixing in SiO2 particles which

  9. Structure and properties of sodium bismuth titanate ferroelectric ceramics (United States)

    Aksel, Elena

    Piezoelectric materials are commonly used in sensor and actuator technologies due to their unique ability to couple electrical and mechanical displacements. Applications of piezoelectric materials range from diesel engine fuel injectors, sonar, ultrasound, and nanopositioners in scanning microscopes. Changing environmental regulations and policies have led to a recent surge in the research of lead-free piezoelectric materials. One such system currently under investigation is sodium bismuth titanate (Na0.5Bi0.5 TiO3) or NBT. It has recently been investigated with the addition of chemical modifiers as well as part of various solid solutions with other compounds. However, research into the structure and properties of NBT is still in its infancy. The aim of this dissertation was to develop a comprehensive understanding of the crystal structure and property relationships in NBT. First, the formation of the NBT phase during solid state processing was examined using in situ X-ray diffraction. It was determined that NBT forms through a particle conversion mechanism of the Bi2O 3 particle. The average and local room temperature structure of calcined and sintered NBT were examined using both high resolution synchrotron X-ray diffraction and neutron diffraction techniques. It was determined that the room temperature average structure of this material is best modeled using the monoclinic Cc space group rather than the previously accepted rhombohedral R3c space group. A combined high resolution XRD and neutron diffraction Rietveld refinement provided refined lattice parameters, atomic positions, and displacement parameters. The departure of the local structure of NBT from the average structure was examined through the Pair Distribution Function analysis. It was determined that Na+ and Bi3+, which share the A-site, have differing bonding environments with their surrounding O2- ions. In order to understand the origin of the piezoelectric depolarization behavior of NBT, crystal

  10. Characterization, Leaching, and Filtration Testing for Bismuth Phosphate Sludge (Group 1) and Bismuth Phosphate Saltcake (Group 2) Actual Waste Sample Composites

    International Nuclear Information System (INIS)

    Lumetta, Gregg J.; Buck, Edgar C.; Daniel, Richard C.; Draper, Kathryn; Edwards, Matthew K.; Fiskum, Sandra K.; Hallen, Richard T.; Jagoda, Lynette K.; Jenson, Evan D.; Kozelisky, Anne E.; MacFarlan, Paul J.; Peterson, Reid A.; Shimskey, Rick W.; Sinkov, Sergey I.; Snow, Lanee A.


    A testing program evaluating actual tank waste was developed in response to Task 4 from the M-12 External Flowsheet Review Team (EFRT) issue response plan.() The test program was subdivided into logical increments. The bulk water-insoluble solid wastes that are anticipated to be delivered to the Waste Treatment and Immobilization Plant (WTP) were identified according to type such that the actual waste testing could be targeted to the relevant categories. Eight broad waste groupings were defined. Samples available from the 222S archive were identified and obtained for testing. The actual waste-testing program included homogenizing the samples by group, characterizing the solids and aqueous phases, and performing parametric leaching tests. Two of the eight defined groups - bismuth phosphate sludge (Group 1) and bismuth phosphate saltcake (Group 2) - are the subjects of this report. The Group 1 waste was anticipated to be high in phosphorus and was implicitly assumed to be present as BiPO4 (however, results presented here indicate that the phosphate in Group 1 is actually present as amorphous iron(III) phosphate). The Group 2 waste was also anticipated to be high in phosphorus, but because of the relatively low bismuth content and higher aluminum content, it was anticipated that the Group 2 waste would contain a mixture of gibbsite, sodium phosphate, and aluminum phosphate. Thus, the focus of the Group 1 testing was on determining the behavior of P removal during caustic leaching, and the focus of the Group 2 testing was on the removal of both P and Al. The waste-type definition, archived sample conditions, homogenization activities, characterization (physical, chemical, radioisotope, and crystal habit), and caustic leaching behavior as functions of time, temperature, and hydroxide concentration are discussed in this report. Testing was conducted according to TP-RPP-WTP-467

  11. Characterization, Leaching, and Filtration Testing for Bismuth Phosphate Sludge (Group 1) and Bismuth Phosphate Saltcake (Group 2) Actual Waste Sample Composites

    Energy Technology Data Exchange (ETDEWEB)

    Lumetta, Gregg J.; Buck, Edgar C.; Daniel, Richard C.; Draper, Kathryn; Edwards, Matthew K.; Fiskum, Sandra K.; Hallen, Richard T.; Jagoda, Lynette K.; Jenson, Evan D.; Kozelisky, Anne E.; MacFarlan, Paul J.; Peterson, Reid A.; Shimskey, Rick W.; Sinkov, Sergey I.; Snow, Lanee A.


    A testing program evaluating actual tank waste was developed in response to Task 4 from the M-12 External Flowsheet Review Team (EFRT) issue response plan.() The test program was subdivided into logical increments. The bulk water-insoluble solid wastes that are anticipated to be delivered to the Waste Treatment and Immobilization Plant (WTP) were identified according to type such that the actual waste testing could be targeted to the relevant categories. Eight broad waste groupings were defined. Samples available from the 222S archive were identified and obtained for testing. The actual waste-testing program included homogenizing the samples by group, characterizing the solids and aqueous phases, and performing parametric leaching tests. Two of the eight defined groups—bismuth phosphate sludge (Group 1) and bismuth phosphate saltcake (Group 2)—are the subjects of this report. The Group 1 waste was anticipated to be high in phosphorus and was implicitly assumed to be present as BiPO4 (however, results presented here indicate that the phosphate in Group 1 is actually present as amorphous iron(III) phosphate). The Group 2 waste was also anticipated to be high in phosphorus, but because of the relatively low bismuth content and higher aluminum content, it was anticipated that the Group 2 waste would contain a mixture of gibbsite, sodium phosphate, and aluminum phosphate. Thus, the focus of the Group 1 testing was on determining the behavior of P removal during caustic leaching, and the focus of the Group 2 testing was on the removal of both P and Al. The waste-type definition, archived sample conditions, homogenization activities, characterization (physical, chemical, radioisotope, and crystal habit), and caustic leaching behavior as functions of time, temperature, and hydroxide concentration are discussed in this report. Testing was conducted according to TP-RPP-WTP-467.

  12. Down-regulation of microRNA-196a in the sera and involved skin of localized scleroderma patients. (United States)

    Makino, Takamitsu; Jinnin, Masatoshi; Etoh, Mitsuhiko; Yamane, Keitaro; Kajihara, Ikko; Makino, Katsunari; Ichihara, Asako; Igata, Toshikatsu; Sakai, Keisuke; Fukushima, Satoshi; Ihn, Hironobu


    Localized scleroderma (LSc) exhibits fibrosis of the skin and subcutaneous tissue. LSc shows an excessive deposition of type 1 collagen. To elucidate the mechanism of type 1 collagen overexpression in LSc, we investigated the epigenetics, focusing on microRNA (miRNA). miRNA expression profile was determined by PCR array analysis. The expression of microRNA-196a (miR-196a) in the skin tissue was examined by in situ hybridization or real-time PCR. The serum levels of miR-196a were measured by real-time PCR. PCR array analysis demonstrated that the miR-196a level was markedly decreased in LSc skin tissue in vivo. The transfection of specific inhibitor for miR-196a into normal cultured human dermal fibroblasts led to the up-regulation of type 1 collagen protein in vitro. Furthermore, the serum levels of miR-196a were significantly decreased in LSc patients. Down-regulation of miR-196a and subsequent overexpression of type 1 collagen in dermal fibroblasts may play a key role in the pathogenesis of LSc. The serum levels of miR-196a may be useful as a diagnostic marker of LSc.

  13. 19 CFR 10.196 - Cost or value of materials produced in a beneficiary country or countries. (United States)


    ... directly into the U.S. Because the operations performed in the beneficiary country involved both the... finished belt. Example 4. A raw, perishable skin of an animal grown in the U.S. Virgin Islands is sent to a... beneficiary country or countries. 10.196 Section 10.196 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION...

  14. High precision hyperfine measurements in Bismuth challenge bound-state strong-field QED. (United States)

    Ullmann, Johannes; Andelkovic, Zoran; Brandau, Carsten; Dax, Andreas; Geithner, Wolfgang; Geppert, Christopher; Gorges, Christian; Hammen, Michael; Hannen, Volker; Kaufmann, Simon; König, Kristian; Litvinov, Yuri A; Lochmann, Matthias; Maaß, Bernhard; Meisner, Johann; Murböck, Tobias; Sánchez, Rodolfo; Schmidt, Matthias; Schmidt, Stefan; Steck, Markus; Stöhlker, Thomas; Thompson, Richard C; Trageser, Christian; Vollbrecht, Jonas; Weinheimer, Christian; Nörtershäuser, Wilfried


    Electrons bound in highly charged heavy ions such as hydrogen-like bismuth 209 Bi 82+ experience electromagnetic fields that are a million times stronger than in light atoms. Measuring the wavelength of light emitted and absorbed by these ions is therefore a sensitive testing ground for quantum electrodynamical (QED) effects and especially the electron-nucleus interaction under such extreme conditions. However, insufficient knowledge of the nuclear structure has prevented a rigorous test of strong-field QED. Here we present a measurement of the so-called specific difference between the hyperfine splittings in hydrogen-like and lithium-like bismuth 209 Bi 82+,80+ with a precision that is improved by more than an order of magnitude. Even though this quantity is believed to be largely insensitive to nuclear structure and therefore the most decisive test of QED in the strong magnetic field regime, we find a 7-σ discrepancy compared with the theoretical prediction.

  15. Evaluation of bismuth shielding effectiveness in reducing breast absorbed dose during thoracic CT scan

    Energy Technology Data Exchange (ETDEWEB)

    Alonso, T. C.; Mourao, A. P.; Santana, P. C.; Silva, T. A. [Federal University of Minas Gerais, Program of Nuclear Science and Techniques, Av. Pte. Antonio Carlos 6627, 31270-901 Belo Horizonte, Minas Gerais (Brazil)


    Computed Tomography (CT) is an essential method for tracking neoplasia and efficiently diagnosing a wide variety of thoracic diseases. CT is generally considered the most accurate choice for lung examination. Due to the growing use of CT, breast and other superficial and radiosensitive organs are unnecessarily irradiated during radiological procedures, thus requiring the development of strategies appropriate to optimize and, if possible, to reduce the radiation dose. The use of bismuth shielding to reduce radiation dose absorbed by breast during thoracic CT examinations has been the subject of many studies recently published by Brazilian and foreign authors of various fields. The purpose of this paper is both to accurately determine the glandular dose when breast is exposed to radiation and to assess the reduction in absorbed dose during thoracic CT examinations, using a set of Thermoluminescent Dosimeters, an anthropomorphic phantom and bismuth shielding. (Author)

  16. Effect of Fe2O3 on the physical and structural properties of bismuth silicate glasses (United States)

    Parmar, Rajesh; Kundu, R. S.; Punia, R.; Aghamkar, P.; Kishore, N.


    Iron containing bismuth silicate glasses with compositions 70SiO2ṡ(100-x)Bi2O3ṡxFe2O3 have been prepared using conventional melt-quenching method and their amorphous nature has been investigated using XRD. Density has been measured using Archimedes' principle and molar volume (Vm) have also been estimated. With increase in Fe2O3 content, there is a decrease in density and molar volume of the glass samples. The glass transition temperature (Tg) have been determined using Differential Scanning Calorimetry (DSC) and are observed to increase with increase in Fe2O3 content. In the present glass system bismuth and iron plays the role of network modifier and the symmetry of silicate network goes on increasing with Fe2O3 content and it modifies the physical and structural properties of these glasses.

  17. The Role of Bismuth in the Treatment of Gastroduodenal Pathology (Literature Review and Own Researches

    Directory of Open Access Journals (Sweden)

    Yu.M. Stepanov


    Full Text Available The article presents the history of colloidal bismuth subcitrate and considers the basic mechanisms of its effects on the gastric mucosa, both cytoprotective and anti-helicobacter. The recent data of the worldwide researches are given on the use of the bismuth subcitrate as a component of antibacterial therapy in order to improve the effectiveness of the eradication, especially under the resistance to the basic drugs. The results of own researches are also shown, they are dedicated to the dynamics of structural adjustment of the gastric mucosa in patients with chronic atrophic gastritis for 3 years after the eradication of H.pylori. The use of first-line therapy with the addition of the drug De-Nol allowed to achieve eradication in 94.3 % of patients and positive microstructural changes of the gastric mucosa.

  18. MYRRHA ADS DATABASE: Part I. Thermophysical properties of molten lead-bismuth eutectic. Version 1

    International Nuclear Information System (INIS)

    Sobolev, V.


    This report is an update of the internal SCK-CEN report IR-18 'Database of thermal properties for the melted lead-bismuth eutectic' issued in 2002. This compilation takes into account larger amount of original sources and, partially, the work performed in the framework of the preparation of a 'zero' version of the HLMC Handbook by the OECD/NEA Working Group on LBE Technology. An analysis is performed of the previous recommendations using some general physical laws and referencing to the properties of lead and bismuth. The updated and extended version of the molten LBE thermal properties database is developed and the correlations are proposed for the design calculations of ADS MYRRHA. (author)

  19. Spectral investigation of highly ionized bismuth plasmas produced by subnanosecond Nd:YAG laser pulses (United States)

    Wu, Tao; Higashiguchi, Takeshi; Li, Bowen; Arai, Goki; Hara, Hiroyuki; Kondo, Yoshiki; Miyazaki, Takanori; Dinh, Thanh-Hung; Dunne, Padraig; O'Reilly, Fergal; Sokell, Emma; O'Sullivan, Gerry


    The unresolved transition arrays (UTAs) emitted from laser produced bismuth (Bi) plasma sources show potential for single-shot live cell imaging. We have measured extreme ultraviolet spectra from bismuth laser produced plasmas in the 1-7 nm region using a λ = 1064 nm Nd:YAG laser with a pulse duration of 150 ps. Comparison of spectra obtained under different laser power densities with calculations using the Hartree-Fock with configuration interaction Cowan suite of codes and the UTA formalism, as well as consideration of previous predictions of isoelectronic trends, are employed to identify lines and a number of new features in spectra from Bi XXIII to Bi XLVII. The results show that Δn = 0, n = 4-4 emission from highly charged ions merges to form intense UTAs in the 4 nm region and Δn = 1, n = 4-5 resonance transitions UTAs dominate the 1-3 nm region of the Bi spectrum.

  20. Synthesis of Bismuth Ferrite Nanoparticles via a Wet Chemical Route at Low Temperature

    Directory of Open Access Journals (Sweden)

    Yongming Hu


    Full Text Available Nanoparticles (NPs of multiferroic bismuth ferrite (BiFeO3 with narrow size distributions were synthesized via a wet chemical route using bismuth nitrate and iron nitrate as starting materials and excess tartaric acid and citric acid as chelating agent, respectively, followed by thermal treatment. It was found that BiFeO3 NPs crystallized at ∼350∘C when using citric acid as chelating agent. Such crystallization temperature is much lower than that of conventional chemical process in which other types of chelating agent are used. BiFeO3 NPs with different sizes distributions show obvious ferromagnetic properties, and the magnetization is increased with reducing the particle size.

  1. Rapid synthesis of single-phase bismuth ferrite by microwave-assisted hydrothermal method

    International Nuclear Information System (INIS)

    Cao, Wenqian; Chen, Zhi; Gao, Tong; Zhou, Dantong; Leng, Xiaonan; Niu, Feng; Zhu, Yuxiang; Qin, Laishun; Wang, Jiangying; Huang, Yuexiang


    This paper describes on the fast synthesis of bismuth ferrite by the simple microwave-assisted hydrothermal method. The phase transformation and the preferred growth facets during the synthetic process have been investigated by X-ray diffraction. Bismuth ferrite can be quickly prepared by microwave hydrothermal method by simply controlling the reaction time, which is further confirmed by Fourier Transform infrared spectroscopy and magnetic measurement. - Graphical abstract: Single-phase BiFeO 3 could be realized at a shortest reaction time of 65 min. The reaction time has strong influences on the phase transformation and the preferred growth facets. - Highlights: • Rapid synthesis (65 min) of BiFeO 3 by microwave-assisted hydrothermal method. • Reaction time has influence on the purity and preferred growth facets. • FTIR and magnetic measurement further confirm the pure phase.

  2. Evaluation of bismuth shielding effectiveness in reducing breast absorbed dose during thoracic CT scan

    International Nuclear Information System (INIS)

    Alonso, T. C.; Mourao, A. P.; Santana, P. C.; Silva, T. A.


    Computed Tomography (CT) is an essential method for tracking neoplasia and efficiently diagnosing a wide variety of thoracic diseases. CT is generally considered the most accurate choice for lung examination. Due to the growing use of CT, breast and other superficial and radiosensitive organs are unnecessarily irradiated during radiological procedures, thus requiring the development of strategies appropriate to optimize and, if possible, to reduce the radiation dose. The use of bismuth shielding to reduce radiation dose absorbed by breast during thoracic CT examinations has been the subject of many studies recently published by Brazilian and foreign authors of various fields. The purpose of this paper is both to accurately determine the glandular dose when breast is exposed to radiation and to assess the reduction in absorbed dose during thoracic CT examinations, using a set of Thermoluminescent Dosimeters, an anthropomorphic phantom and bismuth shielding. (Author)

  3. Methylene blue photocatalysis in the presence of bismuth oxide under UV and solar light irradiation

    Directory of Open Access Journals (Sweden)

    Vanessa Rocha Liberatti


    Full Text Available Bismuth oxide (Bi2O3, an n-type semiconductor has been satisfactorily investigated for photocatalytic organic contaminant remediation. The Bi2O3 was prepared by solution combustion synthesis (SCS using as the oxidizing bismuth nitrate in acidic medium and urea as fuel. The influence of the type of synthesis on the photocatalytic properties of the oxide formed was investigated by XRD. From the diffractograms was verified that the materials obtained are predominantly of Bi2O3 crystals, it is possible to identify a sample with two crystalline phases, monoclinic (α-Bi2O3 and tetragonal (β-Bi2O3, and the other with only the monoclinic (α-Bi2O3. The two-phase oxide showed higher photocatalytic activity for discoloration of methylene blue under UV irradiation (60.59% and under sunlight (61.64% in 664 nm, followed kinetic law of pseudo-first order.

  4. Compatibility tests on steels in molten lead and lead-bismuth

    International Nuclear Information System (INIS)

    Fazio, C.; Benamati, G.; Martini, C.; Palombarini, G.


    The compatibility of steels with liquid lead and liquid lead-bismuth is a critical issue for the development of accelerator-driven system (ADS). In this work the results of a set of preliminary tests carried out in stagnant molten lead at 737 K and in lead-bismuth at 573, 673 and 749 K are summarised. The tests were conducted for 700, 1200, 1500 and 5000 h. Three steels were tested: two martensitic steels (mod. F82H and MANET II) and one austenitic steel (AISI 316L). The martensitic steels underwent oxidation phenomena at the higher testing temperature, due to oxygen dissolved in the melts. At a lower test temperature (573 K) and higher exposure time (5000 h) the oxidation rate of the martensitic steel seems to be lower and the developed oxide layer protective against liquid metal corrosion. The austenitic steel, in turn, exhibited an acceptable resistance to corrosion-oxidation under the test conditions

  5. Bismuth oxide film: a promising room-temperature quantum spin Hall insulator (United States)

    Wang, Ya-Ping; Li, Sheng-Shi; Ji, Wei-Xiao; Zhang, Chang-Wen; Li, Ping; Wang, Pei-Ji


    Two-dimensional (2D) bismuth films have attracted extensive attention due to their nontrivial band topology and tunable electronic properties for achieving dissipationless transport devices. The experimental observation of quantum transport properties, however, are rather challenging, limiting their potential application in nanodevices. Here, we predict, based on first-principles calculations, an alternative 2D bismuth oxide, BiO, as an excellent topological insulator (TI), whose intrinsic bulk gap reaches up to 0.28 eV. Its nontrivial topology is confirmed by topological invariant Z 2 and time-reversal symmetry protected helical edge states. The appearance of topological phase is robust against mechanical strain and different levels of oxygen coverage in BiO. Since the BiO is naturally stable against surface oxidization and degradation, these results enrich the topological materials and present an alternative way to design topotronics devices at room temperature.

  6. Spectral investigation of highly ionized bismuth plasmas produced by subnanosecond Nd:YAG laser pulses

    International Nuclear Information System (INIS)

    Wu, Tao; Higashiguchi, Takeshi; Arai, Goki; Hara, Hiroyuki; Kondo, Yoshiki; Miyazaki, Takanori; Dinh, Thanh-Hung; Li, Bowen; Dunne, Padraig; O’Reilly, Fergal; Sokell, Emma; O’Sullivan, Gerry


    The unresolved transition arrays (UTAs) emitted from laser produced bismuth (Bi) plasma sources show potential for single-shot live cell imaging. We have measured extreme ultraviolet spectra from bismuth laser produced plasmas in the 1–7 nm region using a λ = 1064 nm Nd:YAG laser with a pulse duration of 150 ps. Comparison of spectra obtained under different laser power densities with calculations using the Hartree–Fock with configuration interaction Cowan suite of codes and the UTA formalism, as well as consideration of previous predictions of isoelectronic trends, are employed to identify lines and a number of new features in spectra from Bi XXIII to Bi XLVII. The results show that Δn = 0, n = 4–4 emission from highly charged ions merges to form intense UTAs in the 4 nm region and Δn = 1, n = 4–5 resonance transitions UTAs dominate the 1–3 nm region of the Bi spectrum. (paper)

  7. Hyperfine-structure measurements in bismuth using a Fourier-transform spectrometer

    International Nuclear Information System (INIS)

    George, S.; Munsee, J.H.; Verges, J.


    The spectrum of neutral bismuth has been studied in the infrared region by means of the Fourier-transform spectrometer at the Laboratoire Aime Cotton, Orsay, France. A microwave-excited discharge tube containing bismuth iodide was used as the light source. A total of 37 hyperfine structures was studied. Precise measurements of the center of gravity of the structures give energy levels with an error less than 0.005 m -1 . Complete analysis of these hyperfine structures resulted in the determination of the magnetic-dipole and the electric-quadrupole interaction constants for 10 even and 12 odd levels. The present results have increased the number of newly classified lines to 78, as compared with 28 reported in our earlier work [J. Opt. Soc. Am. 72, 589 (1982)]. The analysis has also resulted in the confirmation an the assignment of many J values, improved values of energy levels, and two new levels

  8. Joining of Half-Heusler and Bismuth Tellurides for Segmented Thermoelectric Generators

    DEFF Research Database (Denmark)

    Ngan, Pham Hoang; Han, Li; Christensen, Dennis Valbjørn


    Segmented generators where the p- or n-type legs are formed by joining materials in series enables each material to operate in their most efficient temperature range. Here, we have fabricated and characterized segmented thermoelectric p- and n-type legs based on bismuth tellurides and half......-Heusler alloys p-type Hf0.5Zr0.5CoSn0.2Sb0.8 and n-type Ti0.6Hf0.4NiSn. A two-step process was introduced to join the half-Heusler to the bismuth tellurides to form a segmented structure which was then characterized for its thermoelectric and structural properties. The output power generation was characterized...

  9. Mixed-layered bismuth-oxygen-iodine materials for capture and waste disposal of radioactive iodine (United States)

    Krumhansl, James L; Nenoff, Tina M


    Materials and methods of synthesizing mixed-layered bismuth oxy-iodine materials, which can be synthesized in the presence of aqueous radioactive iodine species found in caustic solutions (e.g. NaOH or KOH). This technology provides a one-step process for both iodine sequestration and storage from nuclear fuel cycles. It results in materials that will be durable for repository conditions much like those found in Waste Isolation Pilot Plant (WIPP) and estimated for Yucca Mountain (YMP). By controlled reactant concentrations, optimized compositions of these mixed-layered bismuth oxy-iodine inorganic materials are produced that have both a high iodine weight percentage and a low solubility in groundwater environments.

  10. Bismuth Basic Nitrate as a Novel Adsorbent for Azo Dye Removal

    Directory of Open Access Journals (Sweden)

    E. A. Abdullah


    Full Text Available Bismuth basic nitrate (BBN and its TiO2-Ag modified sorbent, PTBA were successfully synthesized via a precipitation method. The structural characteristics of prepared sorbents were determined through different analytical techniques. The potential use of prepared sorbents for organic compounds' removal was evaluated using Methyl Orange and Sunset Yellow dyes as model pollutants in aqueous solutions. The experimental results showed that the presence of TiO2 and Ag particles during the crystal growth of bismuth basic nitrate has an effect on the crystal structure, point of zero charge (pHpzc, pore volume and diameter. The lower binding energy of Ti 2p core level peak indicates the octahedral coordination of TiO2 particles on the PTBA surface. The alteration of hydrophilic-hydrophobic characteristics of sorbent's surface improves the adsorptive performance of the modified sorbent and provides an efficient route for organic contaminants' removal from aqueous solutions.

  11. Mixed-layered bismuth--oxygen--iodine materials for capture and waste disposal of radioactive iodine (United States)

    Krumhansl, James L; Nenoff, Tina M


    Materials and methods of synthesizing mixed-layered bismuth oxy-iodine materials, which can be synthesized in the presence of aqueous radioactive iodine species found in caustic solutions (e.g. NaOH or KOH). This technology provides a one-step process for both iodine sequestration and storage from nuclear fuel cycles. It results in materials that will be durable for repository conditions much like those found in Waste Isolation Pilot Plant (WIPP) and estimated for Yucca Mountain (YMP). By controlled reactant concentrations, optimized compositions of these mixed-layered bismuth oxy-iodine inorganic materials are produced that have both a high iodine weight percentage and a low solubility in groundwater environments.

  12. Electrochemical Synthesis of Bismuth Particles: Tuning Particle Shape through Substrate Type within a Narrow Potential Window


    Bilican, Doga; Fornell, Jordina; Sort, Jordi; Pellicer, Eva


    Bismuth (Bi) electrodeposition was studied on Si/Ti/Au, FTO-, and ITO-coated glasses from acidic nitrate solutions with and without gluconate within a narrow potential window (∆E = 80 mV). This potential range was sufficient to observe a change in particle shape, from polyhedrons (including hexagons) to dendrites, the trend being slightly different depending on substrate activity. In all cases, though, the formation of dendrites was favoured as the applied potential was made more negative. Bi...

  13. Ultrasonic and Thermal Properties of Borate and Phosphate Glasses Containing Bismuth and Lead

    International Nuclear Information System (INIS)

    Aziz, Sidek Hj. Abd.; Ahmad, Hamezan; Wahab, Zaidan A.; Sulaiman, Zainal Abidin; Talib, Zainal Abidin; Shaari, A. Halim; Senin, H. B.


    Systematic series of (B2O3,P2O5)-Bi2O3-PbO glasses have been successfully prepared by using the rapid quenching technique in which each oxide content changes for every series on the basis of its weight percentage. Their amorphous natures were confirmed earlier by the x-ray diffraction technique. The experimental results show that the density of both glasses, determined by using the Archimedes principle, increases with the glass modifier content. This is due to the replacement of Bi2O3 and PbO in the borate and phosphate glassy networks. The molar volume for borate glass increases with the addition of bismuth and lead oxides, but a reverse trend occurs for the phosphate glass. The longitudinal and shear ultrasound velocities, determined by the MBS 8000 system, of both lead bismuth borate and phosphate glasses show a decreasing trend as more PbO and Bi2O3 are added to the glass system. The increase in PbO/Bi2O3 content was probably related to the progressive increase in the concentration of non-bridging oxygen (NBOs). Thermal studies of the glass, using the Labsys DTA-Setaram machine, show that the value of the glass transition temperature (Tg) is closely related to the chemical bond in the system. In lead bismuth borate glasses, the addition of more Pb2+ and Bi3+ results in a more dominant ionic bond character in the system and hence decreases Tg of the sample. However, in lead bismuth phosphate glasses, the addition of Pb2+ and Bi3+ not only failed to weaken the covalent character in P-O-P bonds, but strengthened it further, leading to an increment in the values of Tg

  14. Eye-lens bismuth shielding in paediatric head CT: artefact evaluation and reduction

    International Nuclear Information System (INIS)

    Raissaki, Maria; Perisinakis, Kostas; Damilakis, John; Gourtsoyiannis, Nicholas


    CT scans of the brain, sinuses and petrous bones performed as the initial imaging test for a variety of indications have the potential to expose the eye-lens, considered among the most radiosensitive human tissues, to a radiation dose. There are several studies in adults discussing the reduction of orbital dose resulting from the use of commercially available bismuth-impregnated latex shields during CT examinations of the head. To evaluate bismuth shielding-induced artefacts and to provide suggestions for optimal eye-lens shielding in paediatric head CT. A bismuth shield was placed over the eyelids of 60 consecutive children undergoing head CT. Images were assessed for the presence and severity of artefacts with regard to eye-shield distance and shield wrinkling. An anthropomorphic paediatric phantom and thermoluminescence dosimeters (TLDs) were used to study the effect of eye lens-to-shield distance on shielding efficiency. Shields were tolerated by 56/60 children. Artefacts were absent in 45% of scans. Artefacts on orbits, not affecting and affecting orbit evaluation were noted in 39% and 14% of scans, respectively. Diagnostically insignificant artefacts on intracranial structures were noted in 1 case (2%) with shield misplacement. Mean eye-lens-to-shield distance was 8.8 mm in scans without artefacts, and 4.3 mm and 2.2 mm in scans with unimportant and diagnostically important artefacts, respectively. Artefacts occurred in 8 out of 9 cases with shield wrinkling. Dose reduction remained unchanged for different shield-to-eye distances. Bismuth shielding-related artefacts occurring in paediatric head CT are frequent, superficial and diagnostically insignificant when brain pathology is assessed. Shields should be placed 1 cm above the eyes when orbital pathology is addressed. Shield wrinkling should be avoided. (orig.)

  15. Donor impurity self-compensation by neutral complexes in bismuth doped lead telluride

    International Nuclear Information System (INIS)

    Ravich, Yu.I.; Nemov, S.A.; Proshin, V.I.


    Self-compensation is calculated of impurity doping action in semiconductors of the A 4 B 6 type by neutral complexes, consisting of a vacancy and two impurity atoms. Complexes entropy is estimated and the thermodynamic potential is minimized in the concentration of single two-charge vacancies and complexes. Calculation results are compared with experimental data, obtained when lead telluride doping by bismuth. Account for complex formation improves agreement theory with experiment. 4 refs., 1 fig

  16. Bismuth Infusion of ABS Enables Additive Manufacturing of Complex Radiological Phantoms and Shielding Equipment

    Directory of Open Access Journals (Sweden)

    Justin Ceh


    Full Text Available Radiopacity is a critical property of materials that are used for a range of radiological applications, including the development of phantom devices that emulate the radiodensity of native tissues and the production of protective equipment for personnel handling radioactive materials. Three-dimensional (3D printing is a fabrication platform that is well suited to creating complex anatomical replicas or custom labware to accomplish these radiological purposes. We created and tested multiple ABS (Acrylonitrile butadiene styrene filaments infused with varied concentrations of bismuth (1.2–2.7 g/cm3, a radiopaque metal that is compatible with plastic infusion, to address the poor gamma radiation attenuation of many mainstream 3D printing materials. X-ray computed tomography (CT experiments of these filaments indicated that a density of 1.2 g/cm3 of bismuth-infused ABS emulates bone radiopacity during X-ray CT imaging on preclinical and clinical scanners. ABS-bismuth filaments along with ABS were 3D printed to create an embedded human nasocranial anatomical phantom that mimicked radiological properties of native bone and soft tissue. Increasing the bismuth content in the filaments to 2.7 g/cm3 created a stable material that could attenuate 50% of 99mTechnetium gamma emission when printed with a 2.0 mm wall thickness. A shielded test tube rack was printed to attenuate source radiation as a protective measure for lab personnel. We demonstrated the utility of novel filaments to serve multiple radiological purposes, including the creation of anthropomorphic phantoms and safety labware, by tuning the level of radiation attenuation through material customization.

  17. Effect of bismuth addition to the triple therapy of Helicobacter pylori eradication

    Directory of Open Access Journals (Sweden)

    Ezel Taşdemir


    Full Text Available Objective: Success rates of amoxicillin, clarithromycin, and proton-pump inhibitor therapy in the Helicobacter pylori (Hp eradication have been decreasing. The aim of this study was to investigate the impact of bismuth subcitrate addition to triple therapy.Materials and methods: 148 patients diagnosed Hp infection with both histology and Hp stool antigen (HpSA tests were examined retrospectively. The patients were divided into 3 groups according to the eradication therapy. The first group received triple therapy with claritromycine 2x 500 mg, amoxicilline 2x1 g and PPI 2x1 for 14 days (n=40. The second group had bismuth subcitrate 4x120 mg with triple therapy for 14 days (n=73. The third group received 14 days pretreatment with bismuth subcitrate 4x1 together with PPI 2x1 then had triple therapy for 14 days (n=35. (14C urea breath and HpSA tests were used to detect posttreatment H.pylori status.Results: There were no statistical difference between the groups in terms of gender and age (p > 0.05. In group one 12 patients, in group two 20 patients and in group three 10 patients were identified as Hp positive after treatment. Eradication rates were 70% for group one, 72.6% for group two and 71.4% for group three respectively. There was no statistical difference between the groups in terms of eradication rates of treatment (p > 0.05.Conclusions: The addition of bismuth to conventional triple therapy did not affect treatment success rates.

  18. Report - Melter Testing of New High Bismuth HLW Formulations VSL-13R2770-1

    Energy Technology Data Exchange (ETDEWEB)

    Kruger, Albert A.; Pegg, I. L.; Kot, W. K.; Gan, H.; Matlack, K. S.


    The primary objective of the work described was to test two glasses formulated for a high bismuth waste stream on the DM100 melter system. Testing was designed to determine processing characteristics and production rates, assess the tendency for foaming, and confirm glass properties. The glass compositions tested were previously developed to maintain high waste loadings and processing rates while suppressing the foaming observed in previous tests

  19. Electroreduction of bismuth(3) and tellurium(4) from chloride and tartrate solutions of thiazine dyes

    International Nuclear Information System (INIS)

    Kiriyak, L.G.


    The influence of thionine, Azur 1 and Methylene Blue on the electroreduction of Bi(3) and Te(4) in chloride and tartrate solutions has been studied. The analytical signals of Bi(3) and Te(4) increase in chloride solutions of thiazine dyes, the signal of Bi(3) decreases and that of Te(4) increases in tartrate solutions. Optimal conditions were found and tellurium was determined in high-purity bismuth alloyes with tellurium

  20. Bismuth Oxychalcogenides: A New Class of Ferroelectric/Ferroelastic Materials with Ultra High Mobility. (United States)

    Wu, Menghao; Zeng, Xiao Cheng


    Atomically thin Bi 2 O 2 Se has been recently synthesized, and it possesses ultrahigh mobility (Nat. Nanotechnol. 2017, 12, 530; Nano Lett. 2017, 17, 3021). Herein, we show first-principles evidence that Bi 2 O 2 Se and a related class of bismuth oxychalcogenides, such as Bi 2 O 2 S and Bi 2 O 2 Te, not only are novel semiconductors with ultrahigh mobility but also possess previously unreported ferroelectricity/ferroelasticity. Such a unique combination of semiconducting with ferroelectric/ferroelastic properties enables bismuth oxychalcogenides to potentially meet a great challenge, that is, integration of room-temperature functional nonvolatile memories into future nanocircuits. Specifically, we predict that bulk Bi 2 O 2 S is both ferroelastic and antiferroelectric and that a thin film with odd number of layers can even be multiferroic with nonzero in-plane polarization, and this polarization can be switchable via ferroelasticity. Moreover, Bi 2 O 2 Te possesses intrinsic out-of-plane ferroelectricity, while Bi 2 O 2 Se possesses piezoelectricity and ferroelectricity upon an in-plane strain. The in-plane strain on Bi 2 O 2 Se can induce giant polarizations (56.1 μC/cm 2 upon 4.1% strain) with the piezoelectric coefficient being about 35 times higher than that of MoS 2 monolayer. The in-plane strain can also enhance the bandgap or even convert indirect to direct bandgap beyond a critical value. The good match among the lattice constants of bismuth oxychalcogenides is also desirable, rendering the epitaxial growth of heterostructure devices free of fabrication issues related to lattice mismatch, thereby allowing high-quality bismuth oxychalcogenide heterostructures tailored by design for a variety of applications.

  1. Technical tutorial: How to pack a nose with bismuth iodoform paraffin paste gauze safely and effectively. (United States)

    Amen, F; Pace-Balzan, A


    The current primary treatment for epistaxis in accident and emergency departments is the insertion of Merocel packs. If these are properly inserted, but fail to control bleeding, it is necessary to insert a bismuth iodoform paraffin paste (BIPP) pack. A BIPP pack, when properly inserted, has the potential to stop most bleeds, but books and journals suggest a method of insertion that limits its effectiveness. A safer and more effective way of packing a nose with BIPP than the traditional method is described.

  2. Study of some health physics parameters of bismuth-ground granulated blast furnace slag shielding concretes

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Sandeep, E-mail: [Department of Physics, Punjabi University, Patiala (India); Singh, Sukhpal, E-mail: [Department of Basic and Applied Sciences, Punjabi University, Patiala (India)


    The Bismuth-ground granulated blastfurnace slang (Bi-GGBFS) concrete samples were prepared. The weight percentage of different elements present in Bi-GGBFS Shielding concretewas evaluated by Energy Dispersive X-ray Microanalysis (EDX). The exposure rate and absorbed dose rate characteristics were calculated theoretically for radioactive sources namely {sup 241}Am and {sup 137}Cs. Our calculations reveal that the Bi-GGBFS concretes are effective in shielding material for gamma radiations.

  3. Analysis of the color alteration and radiopacity promoted by bismuth oxide in calcium silicate cement

    Directory of Open Access Journals (Sweden)

    Marina Angelica Marciano


    Full Text Available The aim of the study was to determine if the increase in radiopacity provided by bismuth oxide is related to the color alteration of calcium silicate-based cement. Calcium silicate cement (CSC was mixed with 0%, 15%, 20%, 30% and 50% of bismuth oxide (BO, determined by weight. Mineral trioxide aggregate (MTA was the control group. The radiopacity test was performed according to ISO 6876/2001. The color was evaluated using the CIE system. The assessments were performed after 24 hours, 7 and 30 days of setting time, using a spectrophotometer to obtain the ΔE, Δa, Δb and ΔL values. The statistical analyses were performed using the Kruskal-Wallis/Dunn and ANOVA/Tukey tests (p 3 mm equivalent of Al. The MTA group was statistically similar to the CSC / 30% BO group (p > 0.05. In regard to color, the increase of bismuth oxide resulted in a decrease in the ΔE value of the calcium silicate cement. The CSC group presented statistically higher ΔE values than the CSC / 50% BO group (p < 0.05. The comparison between 24 hours and 7 days showed higher ΔE for the MTA group, with statistical differences for the CSC / 15% BO and CSC / 50% BO groups (p < 0.05. After 30 days, CSC showed statistically higher ΔE values than CSC / 30% BO and CSC / 50% BO (p < 0.05. In conclusion, the increase in radiopacity provided by bismuth oxide has no relation to the color alteration of calcium silicate-based cements.

  4. Modulation of magnetic interaction in Bismuth ferrite through strain and spin cycloid engineering (United States)

    Yadav, Rama Shanker; Reshi, Hilal Ahmad; Pillai, Shreeja; Rana, D. S.; Shelke, Vilas


    Bismuth ferrite, a widely studied room temperature multiferroic, provides new horizons of multifunctional behavior in phase transited bulk and thin film forms. Bismuth ferrite thin films were deposited on lattice mismatched LaAlO3 substrate using pulsed laser deposition technique. X-ray diffraction confirmed nearly tetragonal (T-type) phase of thin film involving role of substrate induced strain. The film thickness of 56 nm was determined by X-ray reflectivity measurement. The perfect coherence and epitaxial nature of T- type film was observed through reciprocal space mapping. The room temperature Raman measurement of T-type bismuth ferrite thin film also verified phase transition with appearance of only few modes. In parallel, concomitant La and Al substituted Bi1-xLaxFe0.95Al0.05O3 (x = 0.1, 0.2, 0.3) bulk samples were synthesized using solid state reaction method. A structural phase transition into orthorhombic (Pnma) phase at x = 0.3 was observed. The structural distortion at x = 0.1, 0.2 and phase transition at x = 0.3 substituted samples were also confirmed by changes in Raman active modes. The remnant magnetization moment of 0.199 emu/gm and 0.28 emu/gm were observed for x = 0.2 and 0.3 bulk sample respectively. The T-type bismuth ferrite thin film also showed high remnant magnetization of around 20emu/cc. The parallelism in magnetic behavior between T-type thin film and concomitant La and Al substituted bulk samples is indication of modulation, frustration and break in continuity of spiral spin cycloid.

  5. Carbon paste electrode containing dispersed bismuth powder for pH measurements


    Metelka, Radovan; Žeravík, Marek; Vytřas, Karel


    The carbon paste electrode containing 17 % (w/w) of dispersed bismuth powder, despite its well-known performance in electroanalytical stripping methods, was also evaluated as a potential pH sensor. Potentiometric response to pH of solutions was ascertained under batch and flow conditions and compared to that of classical glass electrode. Continuous flow or flow injection modes of analysis together with buffers of different pH were employed to study the behavior of modified c...

  6. Systematics of c-axis phonons in the thallium- and bismuth-based cuprate superconductors

    NARCIS (Netherlands)

    Tsvetkov, A.A.; Dulic, Diana; Marel, D. van der; Damascelli, A.; Kaljushnaia, G.A.; Gorina, J.I.; Senturina, N.N.; Kolesnikov, N.N.; Ren, Z.F.; Wang, J.H.; Menovsky, A.A.; Palstra, T.T.M.


    We present grazing incidence reflectivity measurements in the far-infrared region at temperatures above and below Tc for a series of thallium- (Tl2Ba2CuO6, Tl2Ba2CaCu2O8) and bismuth- (Bi2Sr2CuO6, Bi2Sr2CaCu2O8, and Bi2-xPbxSr2CaCu2O8) based cuprate superconductors. From the spectra, which are

  7. Red light emission from europium doped zinc sodium bismuth borate glasses (United States)

    Hegde, Vinod; Viswanath, C. S. Dwaraka; Upadhyaya, Vyasa; Mahato, K. K.; Kamath, Sudha D.


    Zinc sodium bismuth borate (ZNBB) glasses doped with different concentrations of europium were prepared by conventional melt quenching method and characterized through the measurements of density, refractive index, X-ray diffraction (XRD), Fourier Transform Infrared (FTIR) spectra, optical absorption, luminescence and radiative lifetimes. FTIR spectra showed seven characteristic peaks of bismuth and borate functional groups in the range of 400-1600 cm-1. The optical band gap and bonding parameters have been calculated from absorption spectra. Photoluminescence spectra recorded in the visible region with 394 nm excitation are used to calculate the Judd-Ofelt (JO) intensity parameters (Ω2 and Ω4). The JO intensity parameters have been used to calculate the radiative parameters such as branching ratio (β), stimulated emission cross-section (σse), transition probability (A) for the fluorescent level of 5D0→7F2. Decay rates through single exponential are used to calculate the lifetime (τm) of the meta-stable state 5D0 of (Eu3+ ion) these glasses. The radiative parameters measured for all these glasses show 0.7 mol% europium doped zinc sodium bismuth borate glass 5D0→7F2 transition has the potential for red laser applications. The quality of the colour emitted by the present glasses are estimated quantitatively by CIE chromaticity coordinates, which confirms the suitability of these glasses as a red emitting material for field emission technologies and LEDs.

  8. Synthesis, structure and photoluminescence properties of amine-templated open-framework bismuth sulfates

    International Nuclear Information System (INIS)

    Marri, Subba R.; Behera, J.N.


    Two organically-templated bismuth sulfates of the compositions, [C 6 N 2 H 14 ] [Bi(SO 4 ) 2 (NO 3 )], (1) and [C 4 N 2 H 12 ] 4 [Bi 4 (SO 4 ) 10 (H 2 O) 4 ], (2), with open architecture have been synthesized and their structures determined by single crystal X-ray diffraction. 1 has a corrugated layered structure with 8-membered aperture wherein the SO 4 tetrahedra and the BiO 8 polyhedra join together to form (4, 4) net sheets of the metal centers while 2 has a three-dimensional structure possessing 8- and 12-membered channels. Both the compounds show good fluorescence properties exhibiting blue luminescence. Time-resolved fluorescence behavior of 1 and 2 shows mean fluorescence life time of 0.9 and 1.0 ns, respectively. - Graphical abstract: Two open-framework bismuth sulfates with the layered and three-dimensional structures have been synthesized and characterized. Both the compounds show good fluorescence properties exhibiting blue luminescence. Display Omitted - Highlights: • Two organically-templated bismuth sulfates with open architecture have been synthesized and characterized. • One has a corrugated layered structure while the other one has a three-dimensional structure possessing channels. • They are novel in that open-framework three-dimensional main group metal sulfates are first to be reported. • They show good fluorescence properties exhibiting blue luminescence

  9. Thermochemically evolved nanoplatelets of bismuth selenide with enhanced thermoelectric figure of merit

    Energy Technology Data Exchange (ETDEWEB)

    Ali, Zulfiqar; Cao, Chuanbao, E-mail:; Butt, Faheem K.; Tahir, Muhammad; Tanveer, M.; Aslam, Imran; Rizwan, Muhammad; Idrees, Faryal; Khalid, Syed [Research Centre of Materials Science, School of Materials Science and Engineering, Beijing Institute of Technology, Beijing 100081 (China); Butt, Sajid [State Key Laboratory of New Ceramics and Fine Processing, School of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China)


    We firstly present a simple thermochemical method to fabricate high-quality Bi{sub 2}Se{sub 3} nanoplatelets with enhanced figure of merit using elemental bismuth and selenium powders as precursors. The crystal structure of as synthesized products is characterized via X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and high resolution transmission electron microscopy (HRTEM) measurements. Morphological and chemical synthetic parameters are investigated through a series of experiments; thickness and composition of the platelets are well controlled in large scale production. Subsequently spark plasma sintering (SPS) is performed to fabricate n-type nanostructured bulk thermoelectric materials. Raman Spectroscopy of the two selected samples with approximately of 50 and 100 nm thicknesses shows three vibrational modes. The lower thickness sample exhibits the maximum red shift of about 2.17 cm{sup -1} and maximum broadening of about 10 cm{sup -1} by in-plane vibrational mode E{sup 2}{sub g}. The enhanced value of figure of merit ∼0.41 is obtained for pure phase bismuth selenide to the best of our knowledge. We observe metallic conduction behavior while semiconducting behavior for nanostructured bismuth selenide is reported elsewhere which could be due to different synthetic techniques adopted. These results clearly suggest that our adopted synthetic technique has profound effect on the electronic and thermoelectric transport properties of this material.

  10. Two-band induced superconductivity in single-layer graphene and topological insulator bismuth selenide (United States)

    Talantsev, E. F.; Crump, W. P.; Tallon, J. L.


    Proximity-induced superconductivity in single-layer graphene (SLG) and in topological insulators represent almost ideal examples of superconductivity in two dimensions. Fundamental mechanisms governing superconductivity in the 2D limit are of central interest for modern condensed-matter physics. To deduce fundamental parameters of superconductor/graphene/superconductor and superconductor/bismuth selenide/superconductor junctions we investigate the self-field critical currents in these devices using the formalism of the Ambegaokar–Baratoff model. Our central finding is that the induced superconducting state in SLG and bismuth selenide each exhibits gapping on two superconducting bands. Based on recent results obtained on ultra-thin films of natural superconductors, including single-atomic layer of iron selenide, double and triple atomic layers of gallium, and several atomic layer tantalum disulphide, we conclude that a two-band induced superconducting state in SLG and bismuth selenide is part of a wider, more general multiple-band phenomenology of currently unknown origin.

  11. Dental discoloration caused by bismuth oxide in MTA in the presence of sodium hypochlorite. (United States)

    Marciano, Marina Angélica; Duarte, Marco Antonio Hungaro; Camilleri, Josette


    The aim of this research was to analyse the dental discolouration caused by mineral trioxide aggregate (MTA) induced by bismuth oxide and also assess the colour stability of other dental cements. Bismuth oxide, calcium tungstate and zirconium oxide were placed in contact with sodium hypochlorite for 24 h after which they were dried and photographed. Phase analyses were performed by X-ray diffraction (XRD) of radiopacifiers before and after immersion in sodium hypochlorite. Furthermore, teeth previously immersed in water or sodium hypochlorite were filled with MTA Angelus, Portland cement (PC), PC with 20 % zirconium oxide, PC with 20 % calcium tungstate and Biodentine. Teeth were immersed for 28 days in Hank's balanced salt solution after which they were sectioned and characterized using scanning electron microscopy (SEM) with energy-dispersive mapping and stereomicroscopy. Bismuth oxide in contact with sodium hypochlorite exhibited a change in colour from light yellow to dark brown. XRD analysis demonstrated peaks for radiopacifier and sodium chloride in samples immersed in sodium hypochlorite. The SEM images of the dentine to material interface showed alteration in material microstructure for MTA Angelus and Biodentine with depletion in calcium content in the material. The energy-dispersive maps showed migration of radiopacifier and silicon in dentine. MTA Angelus in contact with a tooth previously immersed in sodium hypochlorite resulted in colour alteration at the cement/dentine interface. MTA Angelus should not be used after irrigation with sodium hypochlorite as this will result in tooth discoloration.

  12. Performance comparison of metallic, actinide burning fuel in lead-bismuth and sodium cooled fast reactors

    International Nuclear Information System (INIS)

    Weaver, K.D.; Herring, J.S.; Macdonald, P.E.


    Various methods have been proposed to ''incinerate'' or ''transmute'' the current inventory of transuranic waste (TRU) that exits in spent light-water-reactor (LWR) fuel, and weapons plutonium. These methods include both critical (e.g., fast reactors) and non-critical (e.g., accelerator transmutation) systems. The work discussed here is part of a larger effort at the Idaho National Engineering and Environmental Laboratory (INEEL) and at the Massachusetts Institute of Technology (MIT) to investigate the suitability of lead and lead-alloy cooled fast reactors for producing low-cost electricity as well as for actinide burning. The neutronics of non fertile fuel loaded with 20 or 30-wt% light water reactor (LWR) plutonium plus minor actinides for use in a lead-bismuth cooled fast reactor are discussed in this paper, with an emphasis on the fuel cycle life and isotopic content. Calculations show that the average actinide burn rate is similar for both the sodium and lead-bismuth cooled cases ranging from -1.02 to -1.16 g/MWd, compared to a typical LWR actinide generation rate of 0.303 g/MWd. However, when using the same parameters, the sodium-cooled case went subcritical after 0.2 to 0.8 effective full power years, and the lead-bismuth cooled case ranged from 1.5 to 4.5 effective full power years. (author)

  13. The fabrication and thermal properties of bismuth-aluminum oxide nanothermometers. (United States)

    Wang, Chiu-Yen; Chen, Shih-Hsun; Tsai, Ping-Hsin; Chiou, Chung-Han; Hsieh, Sheng-Jen


    Bismuth (Bi) nanowires, well controlled in length and diameter, were prepared by using an anodic aluminum oxide (AAO) template-assisted molding injection process with a high cooling rate. A high performance atomic layer deposition (ALD)-capped bismuth-aluminum oxide (Bi-Al 2 O 3 ) nanothermometer is demonstrated that was fabricated via a facile, low-cost and low-temperature method, including AAO templated-assisted molding injection and low-temperature ALD-capped processes. The thermal behaviors of Bi nanowires and Bi-Al 2 O 3 nanocables were studied by in situ heating transmission electron microscopy. Linear thermal expansion of liquid Bi within native bismuth oxide nanotubes and ALD-capped Bi-Al 2 O 3 nanocables were evaluated from 275 °C to 700 °C and 300 °C to 1000 °C, respectively. The results showed that the ALD-capped Bi-Al 2 O 3 nanocable possesses the highest working temperature, 1000 °C, and the broadest operation window, 300 °C-1000 °C, of a thermal-expanding type nanothermometer. Our innovative approach provides another way of fabricating core-shell nanocables and to further achieve sensing local temperature under an extreme high vacuum environment.

  14. Iron modified structural and optical spectral properties of bismuth silicate glasses (United States)

    Parmar, Rajesh; Kundu, R. S.; Punia, R.; Aghamkar, P.; Kishore, N.


    Iron bismuth silicate glasses have been successfully synthesized by melt quenching technique. The amorphous nature of the glass samples is ascertained by the XRD patterns. The values of density, molar volume and crystalline volume have been measured and are found to decrease with increase in iron content. The glass transition temperature measured using Differential Scanning Calorimetry (DSC) also varies with increase in Fe2O3 content. The Raman and FTIR spectra of the studied glass system taken at room temperature suggests that Fe2O3 modifies the structure of bismuth silicate glasses and it acts as both network modifier as well as network former. Bismuth also plays the role of both network modifier (BiO6 octahedra) as well as network former (BiO3 pyramids) and SiO2 exists in SiO4 tetrahedral structural units with two non-bridging oxygens. The Hydrogenic excitonic model is found to be applicable to the studied glass compositions. The variation in Urbach energy value observed for the studied glass samples suggests the possibility of increase in the number of glass defects. The metallization criterion for the synthesized glass samples is determined and found to be in the range 0.30-0.38.

  15. Electrodeposition and characterization of manganese-bismuth system from chloride based acidic bath

    Energy Technology Data Exchange (ETDEWEB)

    Benfedda, B., E-mail: baya_pg@yahoo.f [Laboratoire de Physique et Chimie des Materiaux (LPCM), Universite M. Mammeri de Tizi-Ouzou (Algeria); Benbrahim, N.; Kadri, A. [Laboratoire de Physique et Chimie des Materiaux (LPCM), Universite M. Mammeri de Tizi-Ouzou (Algeria); Chainet, E. [Laboratoire d' Electrochimie et de Physico-chimie des Materiaux et des Interfaces (LEPMI), ENSEEG, 1130 rue de la piscine, B.P. 75, 38402 Saint Martin d' Heres, Grenoble (France); Charlot, F.; Coindeau, S. [C.M.T.C., Grenoble I.N.P. Bat Phelma Campus, Domaine Universitaire, B.P. 75, 1260 rue de la piscine, 38402 Saint Martin d' Heres (France)


    In this work, Mn-Bi system has been successfully electrodeposited on Cu/Si substrates from aqueous ammonium chloride containing electrolyte. A thermodynamic study of the electrolysis bath highlights the possible formation of manganese complexes (MnCl{sup +}, MnCl{sub 2},MnCl{sub 3}{sup -}) and bismuth complexes (BiCl{sup 2+},BiCl{sub 2}{sup +}, BiCl{sub 3},BiCl{sub 4}{sup -},BiCl{sub 5}{sup 2-},BiCl{sub 6}{sup 3-}). The mechanism process involving Mn and Bi electrodeposition is investigated by cyclic voltammetry. Mn-Bi films can be grown under potentiostatic control. The physico-chemical, morphological and structural characterizations of the deposits were carried out by scanning electron microscopy (SEM) and X-rays analysis (XRD). The results reveal a granular surface quality and a heterogeneous chemical composition of the films. The energy dispersive spectroscopy (EDS) analysis reveals the presence of manganese and bismuth peaks whose relative intensities vary according to the imposed potential and the position on the sample. The X-rays diffraction analysis showed three different crystalline phases: {alpha}-manganese (body centred cubic system), {gamma}-manganese (body centred tetragonal system) and bismuth (rhombohedral system).

  16. Strongly Enhanced Photovoltaic Performance and Defect Physics of Air-Stable Bismuth Oxyiodide (BiOI). (United States)

    Hoye, Robert L Z; Lee, Lana C; Kurchin, Rachel C; Huq, Tahmida N; Zhang, Kelvin H L; Sponseller, Melany; Nienhaus, Lea; Brandt, Riley E; Jean, Joel; Polizzotti, James Alexander; Kursumović, Ahmed; Bawendi, Moungi G; Bulović, Vladimir; Stevanović, Vladan; Buonassisi, Tonio; MacManus-Driscoll, Judith L


    Bismuth-based compounds have recently gained increasing attention as potentially nontoxic and defect-tolerant solar absorbers. However, many of the new materials recently investigated show limited photovoltaic performance. Herein, one such compound is explored in detail through theory and experiment: bismuth oxyiodide (BiOI). BiOI thin films are grown by chemical vapor transport and found to maintain the same tetragonal phase in ambient air for at least 197 d. The computations suggest BiOI to be tolerant to antisite and vacancy defects. All-inorganic solar cells (ITO|NiO x |BiOI|ZnO|Al) with negligible hysteresis and up to 80% external quantum efficiency under select monochromatic excitation are demonstrated. The short-circuit current densities and power conversion efficiencies under AM 1.5G illumination are nearly double those of previously reported BiOI solar cells, as well as other bismuth halide and chalcohalide photovoltaics recently explored by many groups. Through a detailed loss analysis using optical characterization, photoemission spectroscopy, and device modeling, direction for future improvements in efficiency is provided. This work demonstrates that BiOI, previously considered to be a poor photocatalyst, is promising for photovoltaics. © 2017 The Authors. Published by WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. Study on the extraction of rare earth elements in liquid bismuth

    International Nuclear Information System (INIS)

    Harada, M.; Adachi, M.; Kai, Y.; Koike, K.


    Three factors, which are important for the extraction of rare earth elements in liquid bismuth - molten salt system, were studied, i. e., the equilibrium distribution of neodymium, samarium and bismuth between molten LiCl - liquid Bi-Li alloys, the extraction rate of rare earths, and the characteristics of the extractor with drop dispersion. The rare earth elements were extracted through redox reactions. In high range of Li-mole fraction in the alloy phase, X Li , the distribution of neodymium and bismuth in the salt phase markedly increased as X Li increased. The anomalous increase is attributed to the formation of the compound comprised of Nd, Li, Bi and oxygen in the salt phase. The redox reaction processes were very fast and the extraction rates for rare earths are controlled by the diffusion processes of the solute and the metallic lithium. The process for the formation of liquid metal drops in the continuous phase is predictable from semiempirical correlations reported for aqueous solution - organic solvent systems. The height of droplet bed being accumulated on drop settling portion is predictable from the coalescence time of single drop to a flat metal interface. The coalescence of metal drop to clean interface was very fast. The extractor type of liquid metal dispersion in molten salt is suitable for the extraction process in the fuel reprocessing of MSR or MSBR. (author)

  18. Use of a Soluble Anode in Electrodeposition of Thick Bismuth Telluride Layers (United States)

    Maas, M.; Diliberto, S.; de Vaulx, C.; Azzouz, K.; Boulanger, C.


    Integration of thermoelectric devices within an automotive heat exchanger could enable conversion of lost heat into electrical energy, contributing to improved total output from the engine. For this purpose, synthesis of thick bismuth telluride (Bi2Te3) films is required. Bismuth telluride has been produced by an electrochemical method in nitric acid with a sacrificial bismuth telluride anode as the source of cations. The binary layer grows on the working electrode while the counter-electrode, a Bi2Te3 disk obtained by high frequency melting, is oxidized to BiIII and TeIV. This process leads to auto-regeneration of the solution without modification of its composition. The thickness of films deposited by use of the Bi2Te3 anode was approximately 10 times that without. To demonstrate the utility of a soluble anode in electrochemical deposition, we report characterization of the composition and morphology of the films obtained under different experimental conditions. Perfectly dense and regular Bi2Te3 films (˜400 μm) with low internal stress and uniform composition across the cross-section were prepared. Their thermoelectric properties were assessed.

  19. Opto-electronic properties of bismuth oxide films presenting different crystallographic phases

    Energy Technology Data Exchange (ETDEWEB)

    Gomez, Celia L. [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico); Posgrado en Ciencia e Ingeniería de Materiales, UNAM, Unidad de Posgrado, Edificio C, Piso 1, Zona Cultural de CU, México, D.F. 04510 (Mexico); Depablos-Rivera, Osmary, E-mail: [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico); Posgrado en Ciencia e Ingeniería de Materiales, UNAM, Unidad de Posgrado, Edificio C, Piso 1, Zona Cultural de CU, México, D.F. 04510 (Mexico); Silva-Bermudez, Phaedra [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico); Instituto Nacional de Rehabilitación, Calz. México Xochimilco No. 289 Col. Arenal de Guadalupe, C.P.14389, Ciudad de México, D.F. (Mexico); Muhl, Stephen [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico); Zeinert, Andreas; Lejeune, Michael; Charvet, Stephane; Barroy, Pierre [Laboratoire de Physique de la Matière Condensée, Université de Picardie Jules Verne, 33 rue Saint Leu, 80039 Amiens Cedex 1 (France); Camps, Enrique [Instituto Nacional de Investigaciones Nucleares, Carretera México-Toluca S/N, kilómetro 36.5. La Marquesa, Municipio de Ocoyoacac, CP 52750, Estado de México (Mexico); Rodil, Sandra E. [Instituto de Investigaciones en Materiales, UNAM, Circuito Exterior s/n CU, México D.F. 04510 (Mexico)


    The optical, electrical and structural properties of bismuth oxide thin films deposited by radio frequency reactive magnetron sputtering were studied. The Bi{sub 2}O{sub 3} thin films were grown on Si and glass substrates under different power and substrate temperatures in an oxygen-enriched plasma leading to films with different crystalline phase as evidenced by X-ray diffraction and Raman spectroscopy. The optical properties of the films were measured using ellipsometric spectroscopy and optical transmission spectra. In order to parameterize the optical dispersion functions (n, k) of the films, the Tauc–Lorentz dispersion model was used. The optical bandgap was then assessed by different methods and the results are compared to the thermal variations of the electrical resistivity of the films. It was found that the refractive index, extinction coefficient and optical gap strongly depend on the deposition conditions and the crystalline phase; the fluorite defect cubic δ-Bi{sub 2}O{sub 3} phase showed the lowest optical gap and lower resistivity. - Highlights: • Different bismuth oxide phases were obtained by sputtering. • The power and substrate temperature were the two key parameters. • Room temperature delta-Bi{sub 2}O{sub 3} thin films were obtained. • The optical bandgap was around 1.5 and 2.2 eV, depending on the phase. • The bismuth oxide films presented activation energies around 1 eV.

  20. Effect of Bismuth Breast Shielding on Radiation Dose and Image Quality in Coronary CT Angiography (United States)

    Einstein, Andrew J.; Elliston, Carl D.; Groves, Daniel W.; Cheng, Bin; Wolff, Steven D.; Pearson, Gregory D. N.; Peters, M. Robert; Johnson, Lynne L.; Bokhari, Sabahat; Johnson, Gary W.; Bhatia, Ketan; Pozniakoff, Theodore; Brenner, David J.


    Background Coronary computed tomographic angiography (CCTA) is associated with high radiation dose to the female breasts. Bismuth breast shielding offers the potential to significantly reduce dose to the breasts and nearby organs, but the magnitude of this reduction and its impact on image quality and radiation dose have not been evaluated. Methods Radiation doses from CCTA to critical organs were determined using metal-oxide-semiconductor field-effect transistors positioned in a customized anthropomorphic whole-body dosimetry verification phantom. Image noise and signal were measured in regions of interest (ROIs) including the coronary arteries. Results With bismuth shielding, breast radiation dose was reduced 46–57% depending on breast size and scanning technique, with more moderate dose reduction to the heart, lungs, and esophagus. However, shielding significantly decreased image signal (by 14.6 HU) and contrast (by 28.4 HU), modestly but significantly increased image noise in ROIs in locations of coronary arteries, and decreased contrast-to-noise ratio by 20.9%.. Conclusions While bismuth breast shielding can significantly decrease radiation dose to critical organs, it is associated with an increase in image noise, decrease in contrast-to-noise, and changes tissue attenuation characteristics in the location of the coronary arteries. PMID:22068687

  1. The synthesis of bismuth vanadate powders and their photocatalytic properties under visible light irradiation

    International Nuclear Information System (INIS)

    Shen Yue; Huang Miaoliang; Huang Yi; Lin Jianming; Wu Jihuai


    Bismuth vanadate powders were prepared by hydrothermal method with NaVO 3 and Bi(NO 3 ) 3 as starting materials and with Na 2 CO 3 to adjust pH, and characterized by XRD, SEM, EDS and surface area analyzer. The results showed that the phase formation of bismuth vanadate depended on the adding amount of Na 2 CO 3 . The bismuth vanadate samples existed as monoclinic BiVO 4 by adding 0.019 and 0.038 mol of Na 2 CO 3 with corresponding pH value of 0.2 and 5.8, respectively, and as Bi 4 V 2 O 11 by adding 0.057 mol of Na 2 CO 3 with corresponding pH value of 9.7. The photocatalytic activities of the samples were evaluated by the decolorization of methylene blue (MB) under visible light irradiation. The sample with monoclinic form obtained by adding 0.019 mol of Na 2 CO 3 had the highest photocatalytic activity, the decolorization rate of MB reached to 96.4% under visible light irradiation in 200 min and the reaction rate constant was 0.015 min -1 .

  2. First proof of bismuth oxide nanoparticles as efficient radiosensitisers on highly radioresistant cancer cells. (United States)

    Stewart, Callum; Konstantinov, Konstantin; McKinnon, Sally; Guatelli, Susanna; Lerch, Michael; Rosenfeld, Anatoly; Tehei, Moeava; Corde, Stéphanie


    This study provides the first proof of the novel application of bismuth oxide as a radiosensitiser. It was shown that on the highly radioresistant 9L gliosarcoma cell line, bismuth oxide nanoparticles sensitise to both kilovoltage (kVp) or megavoltage (MV) X-rays radiation. 9L cells were exposed to a concentration of 50μg.mL -1 of nanoparticle before irradiation at 125kVp and 10MV. Sensitisation enhancement ratios of 1.48 and 1.25 for 125kVp and 10MV were obtained in vitro, respectively. The radiation enhancement of the nanoparticles is postulated to be a combination of the high Z nature of the bismuth (Z=83), and the surface chemistry. Monte Carlo simulations were performed to elucidate the physical interactions between the incident radiation and the nanoparticle. The results of this work show that Bi 2 O 3 nanoparticles increase the radiosensitivity of 9L gliosarcoma tumour cells for both kVp and MV energies. Monte Carlo simulations demonstrate the advantage of a platelet morphology. Copyright © 2016 Associazione Italiana di Fisica Medica. Published by Elsevier Ltd. All rights reserved.

  3. Functional disruption of peroxiredoxin by bismuth antiulcer drugs attenuates Helicobacter pylori survival. (United States)

    Chang, Yuen-Yan; Cheng, Tianfan; Yang, Xinming; Jin, Lijian; Sun, Hongzhe; Li, Hongyan


    Bismuth drugs have been used clinically to treat infections from Helicobacter pylori, a pathogen that is strongly related to gastrointestinal diseases even stomach cancer. Despite extensive studies, the mechanisms of action of bismuth drugs are not fully understood. Alkyl hydroperoxide reductase subunit C (AhpC) is the most abundant 2-cysteine peroxiredoxin, crucial for H. pylori survival in the host by defense of oxidative stress. Herein we show that a Bi(III) antiulcer drug (CBS) binds to the highly conserved cysteine residues (Cys49 and Cys169) with a dissociation constant (K d ) of Bi(III) to AhpC of 3.0 (±1.0) × 10 -24 M. Significantly the interaction of CBS with AhpC disrupts the peroxiredoxin and chaperone activities of the enzyme both in vitro and in bacterial cells, leading to attenuated bacterial survival. Moreover, using a home-made fluorescent probe, we demonstrate that Bi(III) also perturbs AhpC relocation between the cytoplasm and membrane region in decomposing the exogenous ROS. Our study suggests that disruption of redox homeostasis by bismuth drugs via interaction with key enzymes such as AhpC contributes to their antimicrobial activity.

  4. Landau spectrum and twin boundaries of bismuth in the extreme quantum limit (United States)

    Zhu, Zengwei; Fauqué, Benoît; Malone, Liam; Antunes, Arlei Borba; Fuseya, Yuki; Behnia, Kamran


    The Landau spectrum of bismuth is complex and includes many angle-dependent lines in the extreme quantum limit. The adequacy of single-particle theory to describe this spectrum in detail has been an open issue. Here, we present a study of angle-resolved Nernst effect in bismuth, which maps the angle-resolved Landau spectrum for the entire solid angle up to 28 T. The experimental map is in good agreement with the results of a theoretical model with parabolic dispersion for holes and an extended Dirac Hamiltonian for electrons. The angular dependence of additional lines in the Landau spectrum allows us to uncover the mystery of their origin. They correspond to the lines expected for the hole Landau levels in a secondary crystal tilted by 108°, the angle between twinned crystals in bismuth. According to our results, the electron reservoirs of the two identical tilted crystals have different chemical potentials, and carriers across the twin boundary have different concentrations. An exceptional feature of this junction is that it separates two electron-hole compensated reservoirs. The link between this edge singularity and the states wrapping a three-dimensional electron gas in the quantum limit emerges as an outstanding open question. PMID:22927380

  5. Assessment of color stability of white mineral trioxide aggregate angelus and bismuth oxide in contact with tooth structure. (United States)

    Marciano, Marina Angélica; Costa, Reginaldo Mendonça; Camilleri, Josette; Mondelli, Rafael Francisco Lia; Guimarães, Bruno Martini; Duarte, Marco Antonio Hungaro


    Dental discoloration with use of materials containing bismuth oxide has been reported. It is postulated that the discoloration is a result of chemical interaction of bismuth oxide with dentin. The aim of the study was to analyze dental color alteration and the chemical interaction of bismuth oxide with the main components present in composite (methacrylate) and in dentin (collagen). Fifty bovine teeth were prepared and filled with white mineral trioxide aggregate (MTA) Angelus, Portland cement (PC) with 20% zirconium oxide, or PC with 20% calcium tungstate and then sealed with composite. Triple antibiotic paste and unfilled samples were the positive and negative controls, respectively. The specimens were stored in separate flasks immersed in tap water at 37°C with ambient light blocked out. The color assessment was performed with a spectrophotometer at different intervals, namely before filling and 24 hours, 15 days, and 30 days after filling. The color change and the luminosity were calculated. The statistical analysis was performed by using nonparametric Kruskal-Wallis and Dunn tests (P bismuth oxide, zirconium oxide, and calcium tungstate with collagen and methacrylate was assessed by placing the materials in contact, followed by color assessment. The analysis of color change values showed that all the materials presented color alteration after the evaluated periods. Statistically higher luminosity was verified for PC/20% zirconium oxide in comparison with white MTA Angelus (P Bismuth oxide exhibited a color change when in contact with collagen. The color of white MTA Angelus was altered in contact with dental structures. Collagen, which is present in dentin matrix, reacted with bismuth oxide, resulting in a grayish discoloration. The use of an alternative radiopacifier to replace bismuth in white MTA is indicated. Copyright © 2014 American Association of Endodontists. Published by Elsevier Inc. All rights reserved.

  6. Ionic liquid-induced double regulation of carbon quantum dots modified bismuth oxychloride/bismuth oxybromide nanosheets with enhanced visible-light photocatalytic activity. (United States)

    Hu, Qingsong; Ji, Mengxia; Di, Jun; Wang, Bin; Xia, Jiexiang; Zhao, Yaping; Li, Huaming


    The efficient separation of photoexcited electron-hole pairs acts as a significant factor and challenge for the enhanced photocatalytic activity of the photocatalyst. To pursue higher photocatalytic activity, carbon quantum dots (CQDs) modified bismuth oxychloride (BiOCl)/bismuth oxybromide (BiOBr) nanosheet photocatalyst has first been synthesized via an in situ ionic liquid-induced strategy. The bridge function of the ionic liquid ensures the uniform dispersal of CQDs on the surface of the BiOCl/BiOBr material. After the introduction of CQDs, the CQDs/BiOCl/BiOBr composite photocatalyst displayed enhanced photocatalytic activity for the photodegradation of several different types of organic contaminants such as rhodamine B, tetracycline hydrochloride, ciprofloxacin, and bisphenol A under the irradiation of visible light, and the BiOCl/BiOBr material loading with 5 wt% CQDs showed the best photocatalytic performance. The characterization results revealed that the introduction of CQDs could simultaneously improve the visible light absorption properties and separation efficiency of photoexcited electron-hole pairs. The electron spin resonance and radical quenching experiments demonstrated that during the photocatalytic reactions, holes and superoxide radicals were the main active species involved in the degradation of the contaminants, and the possible photocatalytic mechanism is presented. Therefore, this work provides an efficient pathway for the improved activity of the photocatalyst. Copyright © 2018 Elsevier Inc. All rights reserved.

  7. Simultaneous removal of Cr(VI) and phenol contaminants using Z-scheme bismuth oxyiodide/reduced graphene oxide/bismuth sulfide system under visible-light irradiation. (United States)

    Chen, Acong; Bian, Zhaoyong; Xu, Jie; Xin, Xin; Wang, Hui


    An all-solid-state Z-scheme system containing Bi-based semiconductors bismuth oxyiodide (BiOI) and bismuth sulfide (Bi 2 S 3 ) was constructed on reduced graphene oxide (rGO) sheets through an electrostatic self-assembly method to simultaneously remove aqueous Cr(VI) and phenol. In this Z-scheme that mimicked natural photosynthesis, photoinduced electrons in the conduction band (CB) of BiOI were transferred through rGO and reacted with photoinduced holes in the valence band (VB) of Bi 2 S 3 , which significantly increased its photocatalytic activity. The reduction and oxidation reactions were performed on Bi 2 S 3 and BiOI photocatalysts, respectively. Furthermore, complex contaminants of coexisting heavy metal Cr(VI) and organic phenol were treated using the system under visible-light irradiation. Results showed that Cr(VI) reduction and phenol oxidation were achieved efficiently with optimum reductive and oxidative efficiencies up to 73% and 95% under visible-light irradiation, respectively. This work provided a promising method of simultaneously removing heavy metals and organic pollutants by using a Z-scheme system with enhanced photocatalytic activity. Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. Sputtered bismuth screen-printed electrode: a promising alternative to other bismuth modifications in the voltammetric determination of Cd(II) and Pb(II) ions in groundwater. (United States)

    Sosa, Velia; Serrano, Núria; Ariño, Cristina; Díaz-Cruz, José Manuel; Esteban, Miquel


    A commercially available sputtered bismuth screen-printed electrode (BispSPE) has been pioneeringly applied for the simultaneous determination of Cd(II) and Pb(II) ions in a certified groundwater sample by means of differential pulse anodic stripping voltammetry (DPASV) as an alternative to more conventional bismuth screen-printed carbon electrodes (BiSPCEs). BispSPEs can be used for a large set of measurements without any previous plating or activation. The obtained detection and quantification limits suggest that BispSPEs produce a better analytical performance as compared to In-situ BiSPCE for Pb(II) and Cd(II) determination, but also to Ex-situ BiSPCE for Cd(II) determination. The results confirm the applicability of these devices for the determination of low level concentrations of these metal ions in natural samples with very high reproducibility (0.7% and 2.5% for Pb(II) and Cd(II) respectively), and good trueness (0.3% and 2.4% for Pb(II) and Cd(II) respectively). © 2013 Published by Elsevier B.V.

  9. Bismuth, lansoprazole, amoxicillin and metronidazole or clarithromycin as first-line Helicobacter pylori therapy. (United States)

    Zhang, Wei; Chen, Qi; Liang, Xiao; Liu, Wenzhong; Xiao, Shudong; Graham, David Y; Lu, Hong


    To evaluate the efficacy and tolerability of replacing tetracycline with amoxicillin in bismuth quadruple therapy. Subjects who were infected with Helicobacter pylori and naïve to treatment were randomly (1:1) assigned to receive a 14-day modified bismuth quadruple therapy: lansoprazole 30 mg, amoxicillin 1 g, bismuth potassium citrate 220 mg (elemental bismuth), twice a day with metronidazole 400 mg four times a day (metronidazole group) or clarithromycin 500 mg twice a day (clarithromycin group). Six weeks after treatment, H. pylori eradication was assessed by 13C-urea breath test. Antimicrobial susceptibility was assessed by the twofold agar dilution method. This was a non-inferiority trial. Two hundred and fifteen subjects were randomised. Metronidazole and clarithromycin containing regimens achieved high cure rates: 94 of 97 (96.9%, 95% CI 93.5% to 100%) and 93 of 98 (94.9%, 95% CI 90.5% to 99.3%) by per-protocol and 88.9% (95% CI 83.0% to 94.8%) and 88.8% (95% CI 82.8% to 94.8%) by intention-to-treat, respectively. Amoxicillin, metronidazole and clarithromycin resistance rates were 1.5%, 45.5% and 26.5%, respectively. Only clarithromycin resistance reduced treatment success (e.g., susceptible 98.6%, resistant 76.9%, p=0.001). Adverse events were more common in the metronidazole group. These results suggest that amoxicillin can substitute for tetracycline in modified 14 day bismuth quadruple therapy as first-line treatment and still overcome metronidazole resistance in areas with high prevalence of metronidazole and clarithromycin resistance. Using clarithromycin instead of metronidazole was only effective in the presence of susceptible strains. NCT02175901. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to

  10. Crystal structures of a pentavalent bismuthate, SrBi2O6 and a lead bismuth oxide (Pb1/3Bi2/3O1.4

    Directory of Open Access Journals (Sweden)

    Nobuhiro Kumada


    Full Text Available The crystal structures of a pentavalent bismuthate, SrBi2O6 with the PbSb2O6-type structure and a lead bismuth oxide, (Pb1/3Bi2/3O1.4 with the fluorite-type structure were refined by using neutron diffraction data. The final R-factors were Rwp = 4.49, Rp = 3.46, RI = 4.50 and RF = 1.70% for SrBi2O6 and Rwp = 5.04, Rp = 3.93, RI = 5.47 and RF = 4.26% for (Pb1/3Bi2/3O1.4. SrBi2O6 prepared from NaBiO3·1.4H2O is the first example of the bismuthate with the PbSb2O6-type structure. The fluorite-type lead bismuth oxide, (Pb1/3Bi2/3O1.4 was obtained by heating the PbSb2O6-type lead bismuthate, PbBi2O5.9·H2O which was prepared also from NaBiO3·1.4H2O.

  11. Prevalence of Fabry disease and GLA c.196G>C variant in Japanese stroke patients. (United States)

    Nagamatsu, Kiyoshiro; Sekijima, Yoshiki; Nakamura, Katsuya; Nakamura, Kimitoshi; Hattori, Kiyoko; Ota, Masao; Shimizu, Yusaku; Endo, Fumio; Ikeda, Shu-Ichi


    Fabry disease is an important underlying disease in young cryptogenic stroke patients. However, little is known regarding the frequency of Fabry disease in the general stroke population, especially in elderly patients. A total of 588 stroke patients (61.7% men; average age 74.1±12.5 years) were enrolled in this prospective study. Blood samples were obtained to produce blood spots to determine α-galactosidase A (α-GalA) activity and for GLA gene analysis. One 65-year-old female patient had a known GLA gene mutation, c.2T>C (p.M1T), causing Fabry disease. Five male patients and two female patients had GLA c.196G>C (p.E66Q) variant, which is not associated with the full clinical manifestations of Fabry disease. The allele frequency of GLA c.196G>C was significantly higher in male patients with small-vessel occlusion (odds ratio 3.95, P=0.048) and non-cardioembolism (odds ratio 4.08, P=0.012) than that in the general Japanese population. Fabry disease is rare in the general Japanese stroke population. However, screening identified one elderly female patient with Fabry disease. GLA c.196G>C variant is a genetic risk factor for cerebral small-vessel occlusion and non-cardioembolism in Japanese males but not in females.

  12. Meta-Analysis of the Association between Mir-196a-2 Polymorphism and Cancer Susceptibility

    International Nuclear Information System (INIS)

    Zhang, Huan; Su, Yu-liang; Yu, Herbert; Qian, Bi-yun


    MicroRNA plays a vital role in gene expression, and microRNA dysregulation is involved in carcinogenesis. The miR-196a-2 polymorphism rs11614913 is reportedly associated with cancer susceptibility. This meta-analysis was performed to assess the overall association of miR-196a-2 with cancer risk. A total of 27 independent case-control studies involving 10,435 cases and 12,075 controls were analyzed for the rs11614913 polymorphism. A significant association was found between rs11614913 polymorphism and cancer risk in four genetic models (CT vs. TT, OR=1.15, 95%CI=1.05–1.27; CC vs. TT, OR=1.23, 95%CI=1.08–1.39; Dominant model, OR=1.17, 95%CI=1.06–1.30; Additive model, OR=1.08, 95%CI=1.01–1.14). In the subgroup analysis of different tumor types, the C allele was associated with increased risk of lung, breast, and colorectal cancer, but not with liver, gastric, or esophageal cancer. In the subgroup analysis by ethnicity, a significantly increased risk of cancer was found among Asians in all genetic models, but no associations were found in the Caucasian subgroup. The meta-analysis demonstrated that the miR-196a-2 polymorphism is associated with cancer susceptibility, especially lung cancer, colorectal cancer, and breast cancer among Asian populations

  13. Growth of Li doped bismuth oxide nanorods and its electrochemical performance for the determination of L-cysteine

    Energy Technology Data Exchange (ETDEWEB)

    Wen, Yong, E-mail: [School of Civil Engineering and Architecture, Xinjiang University (China); Pei, Li-zhai; Wei, Tian [chool of Materials Science and Engineering, Anhui University of Technology (China)


    Li doped bismuth oxide nanorods have been prepared using sodium bismuthate and Li acetate. X-ray diffraction (XRD) pattern shows that the nanorods are composed of monoclinic Bi{sub 2}O{sub 4} and cubic LiBi{sub 12}O{sub 18.50} phases. Scanning electron microscopy (SEM) observation shows that the nanorods have the length and diameter of 1-5 μm and 50-350 nm, respectively. The formation of the Li doped bismuth oxide nanorods is closely relative to the hydrothermal conditions. The electrochemical performance for the determination of L-cysteine based on a Li doped bismuth oxide nanorods modified glassy carbon electrode (GCE) has been developed. The CV peak current increases obviously and linearly with increasing the scan rate. Under the optimal conditions, Li doped bismuth oxide nanorods modified GCE exhibits good analytical performance with good reproducibility and stability. The linear range of L-cysteine is 0.0001-2 mM and the detection limit is 0.36 μM and 0.17 μM for cvp1 and cvp2, respectively. (author)

  14. Monte Carlo simulations for dose enhancement in cancer treatment using bismuth oxide nanoparticles implanted in brain soft tissue. (United States)

    Taha, Eslam; Djouider, Fathi; Banoqitah, Essam


    The objective of this work is to study the dosimetric performances of bismuth oxide nanoparticles implanted in tumors in cancer radiotherapy. GEANT4 based Monte Carlo numerical simulations were performed to assess dose enhancement distributions in and around a 1 × 1 × 1 cm 3 tumor implanted with different concentrations of bismuth oxide and irradiated with low energies 125 I, 131 Cs, and 103 Pd radioactive sources. Dose contributions were considered from photoelectrons, Auger electrons, and characteristic X-rays. Our results show the dose enhancement increased with increasing both bismuth oxide concentration in the target and photon energy. A dose enhancement factor up to 18.55 was obtained for a concentration of 70 mg/g of bismuth oxide in the tumor when irradiated with 131 Cs source. This study showed that bismuth oxide nanoparticles are innovative agents that could be potentially applicable to in vivo cancer radiotherapy due to the fact that they induce a highly localized energy deposition within the tumor.

  15. Structural, electrical and magnetic behaviour of undoped and nickel doped nanocrystalline bismuth ferrite by solution combustion route

    Directory of Open Access Journals (Sweden)

    Kakali Sarkar


    Full Text Available Multiferroic bismuth ferrite (BFO and Ni-doped bismuth ferrites, with perovskite structure, were synthesized by chemical route at the temperatures ranging from 500 to 600 °C in controlled atmosphere. The structural phase analysis of materials was identified by XRD and crystallite size was calculated from the half width measurement of the well defined major XRD diffraction peak. Average crystallite size was calculated by applying Scherrer’s formula and found to have values in the range from 14 to 35 nm. FESEM was used to evaluate the morphology and structural formation of nanocrystallite grains, while EDX confirmed elemental composition including the presence of dopant in the matrix. Dielectric properties and effect of electric field on polarization behaviour were studied for both undoped and Ni-doped BFO. Doping shows a clear change in ferroelectric behaviour. Antiferromagnetic nature of bulk bismuth ferrite transforms to superparamagnetic strong ferroelectric nature for both undoped and nickel doped nanocrystalline bismuth ferrite due to its close dimension of crystallite size with magnetic domains leading to break-down of frustrated spin cycloidal moment. The superparamagnetism behaviour is more pronounced for the nickel doped BFO though magnetic saturation is slightly higher for the undoped nanocrystalline bismuth ferrite.

  16. Study of the bismuth oxide concentration required to provide Portland cement with adequate radiopacity for endodontic use. (United States)

    Bueno, Carlos Eduardo da Silveira; Zeferino, Eduardo Gregatto; Manhães, Luiz Roberto Coutinho; Rocha, Daniel Guimarães Pedro; Cunha, Rodrigo Sanches; De Martin, Alexandre Sigrist


    The purpose of this study was to determine the ideal concentration of bismuth oxide in white Portland cement to provide it with sufficient radiopacity for use as an endodontic material (ADA specification #57). 2-mm thick standardized test specimens of white MTA and of white Portland cement, as controls, and of white Portland cement with the experimental addition of 5%, 10%, 15%, 20%, 25% or 30% of bismuth oxide were radiographed and compared with various thicknesses of pure aluminum, using optic density to determine the observed grayscale levels of radiopacity in a scale ranging from 0 to 255. The data was submitted to ANOVA (pPortland cement with 0%, 5%, 10%, 15%, 20%, 25% and 30% of bismuth oxide presented mean readings of 63.3, 95.7, 110.7, 142.7, 151.3, 161.0 and 180.0 respectively. MTA presented a mean reading of 157.3. The readings of MTA and white Portland cement with 15% bismuth oxide did not differ significantly from the reading observed for a thickness of 4 mm of aluminum (145.3), which is considered ideal for a test specimen by ADA specification #57 (2 mm above the thickness of the test specimen). White MTA and white Portland cement with 15% bismuth oxide presented the radiopacity required for an endodontic cement.

  17. Growth of Li doped bismuth oxide nanorods and its electrochemical performance for the determination of L-cysteine

    International Nuclear Information System (INIS)

    Wen, Yong; Pei, Li-zhai; Wei, Tian


    Li doped bismuth oxide nanorods have been prepared using sodium bismuthate and Li acetate. X-ray diffraction (XRD) pattern shows that the nanorods are composed of monoclinic Bi 2 O 4 and cubic LiBi 12 O 18.50 phases. Scanning electron microscopy (SEM) observation shows that the nanorods have the length and diameter of 1-5 μm and 50-350 nm, respectively. The formation of the Li doped bismuth oxide nanorods is closely relative to the hydrothermal conditions. The electrochemical performance for the determination of L-cysteine based on a Li doped bismuth oxide nanorods modified glassy carbon electrode (GCE) has been developed. The CV peak current increases obviously and linearly with increasing the scan rate. Under the optimal conditions, Li doped bismuth oxide nanorods modified GCE exhibits good analytical performance with good reproducibility and stability. The linear range of L-cysteine is 0.0001-2 mM and the detection limit is 0.36 μM and 0.17 μM for cvp1 and cvp2, respectively. (author)

  18. Structure and resistivity of bismuth nanobelts in situ synthesized on silicon wafer through an ethanol-thermal method

    International Nuclear Information System (INIS)

    Gao Zheng; Qin Haiming; Yan Tao; Liu Hong; Wang Jiyang


    Bismuth nanobelts in situ grown on a silicon wafer were synthesized through an ethanol-thermal method without any capping agent. The structure of the bismuth belt–silicon composite nanostructure was characterized by scanning electron microscope, energy-dispersive X-ray spectroscopy, and high resolution transmission electron microscope. The nanobelt is a multilayered structure 100–800 nm in width and over 50 μm in length. One layer has a thickness of about 50 nm. A unique sword-like nanostructure is observed as the initial structure of the nanobelts. From these observations, a possible growth mechanism of the nanobelt is proposed. Current–voltage property measurements indicate that the resistivity of the nanobelts is slightly larger than that of the bulk bismuth material. - Graphical Abstract: TEM images, EDS, and electron diffraction pattern of bismuth nanobelts. Highlights: ► Bismuth nanobelts in situ grown on silicon wafer were achieved. ► Special bismuth–silicon nanostructure. ► Potential application in sensitive magnetic sensor and other electronic devices.

  19. Greener Friedel-Crafts Acylation using Microwave-enhanced reactivity of Bismuth Triflate in the Friedel-Crafts Benzoylation of Aromatic Compounds with Benzoic Anhydride

    DEFF Research Database (Denmark)

    Tran, Phuong Hoang; Nguyen, Hai Truong; Hansen, Poul Erik


    An efficient and facile bismuth trifluoromethanesulfonate-catalyzed benzoylation of aromatic compounds using benzoic anhydride under solvent-free microwave irradiation has been developed. The microwave-assisted Friedel-Crafts benzoylation results in good yields within short reaction times. Bismuth...

  20. The cytotoxicity of organobismuth compounds with certain molecular structures can be diminished by replacing the bismuth atom with an antimony atom in the molecules. (United States)

    Kohri, Kumiko; Yoshida, Eiko; Yasuike, Shuji; Fujie, Tomoya; Yamamoto, Chika; Kaji, Toshiyuki


    Organic-inorganic hybrid molecules, which are composed of an organic structure and metal(s), are indispensable for synthetic chemical reactions; however, their toxicity has been incompletely understood. In the present study, we discovered two cytotoxic organobismuth compounds whose cytotoxicity diminished upon replacement of the intramolecular bismuth atom with an antimony atom. The intracellular accumulation of the organobismuth compounds was much higher than that of the organoantimony compounds with the corresponding organic structures. We also showed that both the organic structure and bismuth atom are required for certain organobismuth compounds to exert their cytotoxic effect, suggesting that the cytotoxicity of such a compound is a result of an interaction between the organic structure and the bismuth atom. The present data suggest that organobismuth compounds with certain molecular structures exhibit cytotoxicity via an interaction between the molecular structure and the bismuth atom, and this cytotoxicity can be diminished by replacing the bismuth atom with an antimony atom, resulting in lower intracellular accumulation.

  1. Screen-printed electrodes made of a bismuth nanoparticle porous carbon nanocomposite applied to the determination of heavy metal ions

    International Nuclear Information System (INIS)

    Niu, Pengfei; Gich, Martí; Roig, Anna; Fernández-Sánchez, César; Navarro- Hernández, Carla; Fanjul-Bolado, Pablo


    This work reports on the simplified fabrication and on the characterization of bismuth-based screen-printed electrodes (SPEs) for use in heavy metal detection. A nanocomposite consisting of bismuth nanoparticles and amorphous carbon was synthesized by a combined one-step sol-gel and pyrolysis process and milled down to a specific particle size distribution as required for the preparation of an ink formulation to be used in screen printing. The resulting electrochemical devices were applied to the detection of Pb(II) and Cd(II) ions in water samples. The porous structure of carbon and the high surface area of the bismuth nanoparticles allow for the detection of Pb(II) and Cd(II) at concentration levels below 4 ppb. The application of the SPEs was demonstrated by quantifying these ions in tap drinking water and wastewater collected from an influent of an urban wastewater treatment plant. (author)

  2. Diffusion-controlled intergranular penetration and embrittlement of copper by liquid bismuth between 300 and 600 Celsius degrees

    International Nuclear Information System (INIS)

    Laporte, V.


    Hybrid reactors are a new concept for energy production and nuclear waste treatment. Among other requirements, structural materials have to withstand liquid metal embrittlement. This thesis aimed therefore to identify the controlling mechanism for the intergranular embrittlement of copper in contact with liquid bismuth. Scanning electron microscopy, Auger electron spectroscopy, X-ray photoelectron spectroscopy and Rutherford backscattering spectroscopy have been used to analyze fracture surfaces of both copper polycrystals and a copper bicrystal (symmetric tilt boundary 50 degrees ). These analyses reveal both parabolic intergranular penetration kinetics and a maximal intergranular bismuth concentration that is less than two monolayers equivalent. These two results allow us to identify grain boundary diffusion as the controlling mechanism for the intergranular penetration of copper by liquid bismuth between 300 and 600 Celsius degrees, showing the absence of perfect grain boundary wetting. (author)

  3. Assessment of breast absorbed doses during thoracic computed tomography scan to evaluate the effectiveness of bismuth shielding. (United States)

    Alonso, Thessa C; Mourão, Arnaldo P; Santana, Priscila C; da Silva, Teógenes A


    During a lung computed tomography (CT) examination, breast and nearby radiosensitive organs are unnecessarily irradiated because they are in the path of the primary beam. The purpose of this paper is to determine the absorbed dose in breast and nearby organs for unshielded and shielded exposures with bismuth. The experiment was done with a female anthropomorphic phantom undergoing a typical thoracic CT scan, with TLD-100 thermoluminescent detectors insert at breast, lung and thyroid positions. Results showed that dose reduction due to bismuth shielding was approximately 30% and 50% for breast and thyroid, respectively; however, the influence of the bismuth on the image quality needs to be considered. Copyright © 2016 Elsevier Ltd. All rights reserved.

  4. Inefficacy of triple therapy and comparison of two different bismuth-containing quadruple regimens as a firstline treatment option for helicobacter pylori. (United States)

    Kekilli, Murat; Onal, Ibrahim K; Ocal, Serkan; Dogan, Zeynal; Tanoglu, Alpaslan


    Increasing resistance of Helicobacter pylori to antimicrobials necessitated the development of new regimens and the modification of existing regimens. The present study aimed to compare the efficacy of two bismuth-containing quadruple regimens-one including clarithromycin (C) instead of metronidazole (M) and triple therapy. Patients with H. pylori infection given the following regimens were sequentially enrolled in this retrospective study: (1) Triple therapy: Lansoprazole 30 mg b.i.d., clarithromycin 500 mg b.i.d., and amoxicillin 1 g b.i.d., (2) bismuth group C: Lansoprazole 30 mg b.i.d., clarithromycin 500 mg b.i.d., amoxicillin 1 g b.i.d., and bismuth subsalicylate 524 mg b.i.d., and (3) bismuth group M: Lansoprazole 30 mg b.i.d., amoxicillin 1 g b.i.d., metronidazole 500 mg t.i.d., and bismuth subsalicylate 524 mg b.i.d. for 14 days. Gastroscopy and 14 C-urea breath test were performed before enrollment, and urea breath test was repeated four weeks after the treatment. At per-protocol analysis, the eradication rates were 64.7% (95% confidence interval 60.4-68.7) with the triple therapy (n = 504), 95.4% (95% confidence interval 91.5-99.4) with the bismuth group C (n = 501), and 93.9% (95% confidence interval 89.7-98.7) with the bismuth group M (n = 505). The eradication rates were similar between the two bismuth groups (P > 0.05) but significantly greater than that of the triple therapy (P bismuth-containing quadruple therapies reached high eradication rates, whereas triple therapy was shown to be ineffective. Moreover, clarithromycin may also be a component of bismuth-containing quadruple therapy.

  5. Antimicrobial activity of bismuth subsalicylate on Clostridium difficile, Escherichia coli O157:H7, norovirus, and other common enteric pathogens. (United States)

    Pitz, Adam M; Park, Geun Woo; Lee, David; Boissy, Ying L; Vinjé, Jan


    Previous studies have shown bismuth subsalicylate (BSS) has antimicrobial properties, but few studies have addressed the mechanism of action. Furthermore, following BSS ingestion other bismuth salts form throughout the gastrointestinal tract including bismuth oxychloride (BiOCl) that also act upon enteric pathogens. To further understand the antimicrobial activity of bismuth in infectious diarrhea, the antimicrobial effect of BSS and BiOCl on Clostridium difficile, Salmonella, Shigella, Shiga toxin-producing Escherichia coli strains and norovirus (NoV) were measured. Bacterial enteric pathogens in pure culture or in human fecal material were exposed to 35mg/ml BSS or BiOCl with or without a vehicle suspension. BSS and BiOCl treated samples were quantified and visualized by transmission electron microscopy. To measure the effect on NoV, reduction of infectious murine NoV (MNV), a surrogate for human NoV, and Norwalk virus RNA levels were measured by viral plaque assay and RT-qPCR, respectively. BSS and BiOCl reduced bacterial growth by 3-9 logs in all strains with majority resulting in populations of bismuth on bacterial membranes and within the bacterial organisms at 30 min post-treatment. At 8.8mg/ml BSS and BiOCl reduced infectivity of MNV significantly by 2.7 and 2.0 log after 24 h of exposure. In addition, both BSS and BiOCl slightly reduced the level of Norwalk replicon-bearing cells suggesting that bismuth may inhibit NoV in vivo. Collectively, our results confirm and build on existing data that BSS has antimicrobial properties against a wide-range of diarrhea-causing pathogens.

  6. Comparison Between Sequential Therapy and Modified Bismuth-Included Quadruple Therapy for Helicobacter pylori Eradication in Chinese Patients. (United States)

    Yang, Xiuhong; Tan, Pengsheng; Song, Lianying; Lu, Zhanying

    To compare the efficacy and safety of sequential therapy and modified bismuth-included quadruple therapy as a first-line Helicobacter pylori eradication in China. The patients were randomized to receive sequential therapy [n = 90; rabeprazole (20 mg twice daily) and amoxicillin (1 g twice daily) for 5 days, followed by rabeprazole (20 mg twice daily), tinidazole (500 mg twice daily) plus clarithromycin (500 mg twice daily) for another 5 days] or modified bismuth-included quadruple therapy [n = 109; rabeprazole (20 mg twice daily), levofloxacin hydrochloride (400 mg twice daily), clarithromycin (500 mg twice daily), and colloidal bismuth pectin (200 mg 3 times a day) for 7 days]. A follow-up urea breath test was applied 4 weeks later. A total of 199 patients were diagnosed with H. pylori infection. The intention-to-treat and per-protocol (PP) eradication rates were 91.7% and 92.6%, respectively, in the modified bismuth-included quadruple therapy group, and 74.4% and 76.1%, respectively, in the sequential therapy group. The eradication rates were significantly higher in the modified bismuth-included quadruple therapy group, compared with the sequential therapy group (P = 0.001 for intention to treat and P = 0.001 for PP). Adverse effects were reported by patients from both groups, but the difference did not reach significant level (P = 0.280). The modified bismuth-included quadruple therapy seemed to be superior to the sequential therapy as the first-line regimen for H. pylori eradication in Chinese patients.

  7. Dual-modality, fluorescent, PLGA encapsulated bismuth nanoparticles for molecular and cellular fluorescence imaging and computed tomography. (United States)

    Swy, Eric R; Schwartz-Duval, Aaron S; Shuboni, Dorela D; Latourette, Matthew T; Mallet, Christiane L; Parys, Maciej; Cormode, David P; Shapiro, Erik M


    Reports of molecular and cellular imaging using computed tomography (CT) are rapidly increasing. Many of these reports use gold nanoparticles. Bismuth has similar CT contrast properties to gold while being approximately 1000-fold less expensive. Herein we report the design, fabrication, characterization, and CT and fluorescence imaging properties of a novel, dual modality, fluorescent, polymer encapsulated bismuth nanoparticle construct for computed tomography and fluorescence imaging. We also report on cellular internalization and preliminary in vitro and in vivo toxicity effects of these constructs. 40 nm bismuth(0) nanocrystals were synthesized and encapsulated within 120 nm Poly(dl-lactic-co-glycolic acid) (PLGA) nanoparticles by oil-in-water emulsion methodologies. Coumarin-6 was co-encapsulated to impart fluorescence. High encapsulation efficiency was achieved ∼70% bismuth w/w. Particles were shown to internalize within cells following incubation in culture. Bismuth nanocrystals and PLGA encapsulated bismuth nanoparticles exhibited >90% and >70% degradation, respectively, within 24 hours in acidic, lysosomal environment mimicking media and both remained nearly 100% stable in cytosolic/extracellular fluid mimicking media. μCT and clinical CT imaging was performed at multiple X-ray tube voltages to measure concentration dependent attenuation rates as well as to establish the ability to detect the nanoparticles in an ex vivo biological sample. Dual fluorescence and CT imaging is demonstrated as well. In vivo toxicity studies in rats revealed neither clinically apparent side effects nor major alterations in serum chemistry and hematology parameters. Calculations on minimal detection requirements for in vivo targeted imaging using these nanoparticles are presented. Indeed, our results indicate that these nanoparticles may serve as a platform for sensitive and specific targeted molecular CT and fluorescence imaging.

  8. Phase transitions in shock compressed bismuth identified using single photon energy dispersive X-ray diffraction (SPEDX) (United States)

    Briggs, R.; Suggit, MJ; Gorman, MG; Coleman, A.; Heathcote, R.; Higginbotham, A.; Patel, S.; Wark, JS; McMahon, MI


    We present evidence for phase transitions in shock-compressed bismuth using the SPEDX x-ray diffraction technique. Experiments were performed on the Vulcan laser at the Central Laser Facility, RAL, Didcot, UK. We observed diffraction from the (110) bcc peak of Bi-V, and from its calculated lattice parameter the pressure was determined to be approximately 17 GPa. Upon further compression (higher laser intensities), no further diffraction from solid phases was observed. Shock melting of bismuth is thought to occur between 18 and 27 GPa. Diffraction results at lower pressures as a function of delay time are also presented.

  9. Increased biliary excretion of glutathione is generated by the glutathione-dependent hepatobiliary transport of antimony and bismuth. (United States)

    Gyurasics, A; Koszorús, L; Varga, F; Gregus, Z


    We have recently demonstrated that the hepatobiliary transport of arsenic is glutathione-dependent and is associated with a profound increase in biliary excretion of glutathione (GSH), hepatic GSH depletion and diminished GSH conjugation (Gyurasics A, Varga F and Gregus Z, Biochem Pharmacol 41: 937-944 and Gyurasics A, Varga F and Gregus Z, Biochem Pharmacol 42: 465-468, 1991). The present studies in rats aimed to determine whether antimony and bismuth, other metalloids in group Va of the periodic table, also possess similar properties. Antimony potassium tartrate (25-100 mumol/kg, i.v.) and bismuth ammonium citrate (50-200 mumol/kg, i.v.) increased up to 50- and 4-fold, respectively, the biliary excretion of non-protein thiols (NPSH). This resulted mainly from increased hepatobiliary transport of GSH as suggested by a close parallelism in the biliary excretion of NPSH and GSH after antimony or bismuth administration. Within 2 hr, rats excreted into bile 55 and 3% of the dose of antimony (50 mumol/kg, i.v.) and bismuth (150 mumol/kg, i.v.), respectively. The time courses of the biliary excretion of these metalloids and NPSH or GSH were strikingly similar suggesting co-ordinate hepatobiliary transport of the metalloids and GSH. However, at the peak of their excretion, each molecule of antimony or bismuth resulted in a co-transport of approximately three molecules of GSH. Diethyl maleate, indocyanine green and sulfobromophthalein (BSP), which decreased biliary excretion of GSH, significantly diminished excretion of antimony and bismuth into bile indicating that hepatobiliary transport of these metalloids is GSH-dependent. Administration of antimony, but not bismuth, decreased hepatic GSH level by 30% and reduced the GSH conjugation and biliary excretion of BSP. These studies demonstrate that the hepatobiliary transport of trivalent antimony and bismuth is GSH-dependent similarly to the hepatobiliary transport of trivalent arsenic. Proportionally to their biliary

  10. [Non-bismuth quadruple therapy versus standard triple therapy for Helicobacter pylori eradication: a randomized controlled study]. (United States)

    Wang, Shujun; Wang, Weihong; Chu, Yunxiang; Teng, Guigen; Hu, Fulian


    To compare the efficacies of non-bismuth quadruple therapy for 7 days versus standard triple therapy for 7 or 10 days in initial treatment of Helicobacter pylori (H.pylori) . A randomized, open-labeled, controlled trial comparing non-bismuth quadruple therapy with standard triple therapy was performed at Peking University First Hospital from August 2010 to July 2012. A total of 246 patients with a diagnosis of H.pylori infection by (13)C-urea breath test and receiving no eradication therapy were randomly divided into non-bismuth quadruple therapy and standard triple therapy for 7 or 10 days. There were 110 males and 136 females with an age range of 18-75 years. Among them, 81 patients received non-bismuth quadruple therapy (esomeprazole 20 mg, amoxicillin 1 000 mg, clarithromycin 500 mg and tinidazole 500 mg given twice daily for 7 days); 82 standard triple therapy (esomeprazole 20 mg, amoxicillin 1 000 mg and clarithromycin 500 mg given twice daily) for 7 days and 83 standard triple therapy for 10 days. The efficacies were examined at Week 4 post-therapy by (13)C-urea breath test. The incidence of adverse drug reactions was recorded. Among them, 242 patients completed the follow-up. The eradication rates for non-bismuth quadruple therapy and standard triple therapy for 7 or 10 days were 91.4% (74/81), 79.3% (65/82) and 79.5% (66/83) as determined by intention-to-treat analysis (ITT). The eradication rates were 92.5% (74/80), 81.3% (65/80) and 80.5% (66/82) respectively as determined by per-protocol analysis (PP).Non-bismuth quadruple therapy was superior to standard triple therapy for 7 days (ITT analysis P = 0.029, PP analysis P = 0.035) and 10 days (ITT analysis P = 0.032, PP analysis P = 0.026). The differences for the eradication rates between standard triple therapy for 7 days and for 10 days were insignificant (ITT analysis P = 0.968, PP analysis P = 0.902): Adverse reaction rates for non-bismuth quadruple therapy (8.8%, 7/80) and standard triple therapy for

  11. Determination of bismuth and cadmium after solid-phase extraction with chromosorb-107 in a syringe

    Energy Technology Data Exchange (ETDEWEB)

    Tokman, Nilgun; Akman, Suleyman


    The determination of bismuth and cadmium by graphite furnace atomic absorption spectrometry (GFAAS) after solid-phase extraction (SPE) on Chromosorb-107 filled in a syringe was described. To retain the analytes, the sample solution treated with and without ammonium pyrolidine dithiocarbamate (APDC) was drawn into the syringe filled with Chromosorb-107 and discharged back manually. Bismuth and cadmium were quantitatively sorbed at pH {>=} 6 irrespective of whether the analyte was complexed with APDC prior to passing through the Chromosorb-107. Analyte elements sorbed on the resin were quantitatively eluted with 3.0 M of HNO{sub 3} again drawing and discharging the eluent into the syringe and ejected it back. Optimum flow rates of sample or eluent for sorption and elution processes were 20 ml min{sup -1} for drawing and 20 ml min{sup -1} for discharging in all cases. Bismuth and cadmium were analyzed by graphite furnace atomic absorption spectrometry. The elements could be concentrated by drawing and discharging several portions of sample successively but eluting only one time. The validity of the proposed method was checked with standard reference materials (NIST SRM 1515 Apple-Leaves, CWW-TM-E Waste Water and CRM-SW Sea Water). The analyte elements were quantitatively (>95%) recovered from different matrices irrespective of treated samples with APDC. Detection limits ({delta}) were 0.8 and 1.2 {mu}g l{sup -1} for Bi and Cd, respectively. The method can be characterized with fastness, simplicity, quantitative recovery and high reproducibility.

  12. Synthesis, structure and photoluminescence properties of amine-templated open-framework bismuth sulfates

    Energy Technology Data Exchange (ETDEWEB)

    Marri, Subba R.; Behera, J.N., E-mail:


    Two organically-templated bismuth sulfates of the compositions, [C{sub 6}N{sub 2}H{sub 14}] [Bi(SO{sub 4}){sub 2}(NO{sub 3})], (1) and [C{sub 4}N{sub 2}H{sub 12}]{sub 4}[Bi{sub 4}(SO{sub 4}){sub 10}(H{sub 2}O){sub 4}], (2), with open architecture have been synthesized and their structures determined by single crystal X-ray diffraction. 1 has a corrugated layered structure with 8-membered aperture wherein the SO{sub 4} tetrahedra and the BiO{sub 8} polyhedra join together to form (4, 4) net sheets of the metal centers while 2 has a three-dimensional structure possessing 8- and 12-membered channels. Both the compounds show good fluorescence properties exhibiting blue luminescence. Time-resolved fluorescence behavior of 1 and 2 shows mean fluorescence life time of 0.9 and 1.0 ns, respectively. - Graphical abstract: Two open-framework bismuth sulfates with the layered and three-dimensional structures have been synthesized and characterized. Both the compounds show good fluorescence properties exhibiting blue luminescence. Display Omitted - Highlights: • Two organically-templated bismuth sulfates with open architecture have been synthesized and characterized. • One has a corrugated layered structure while the other one has a three-dimensional structure possessing channels. • They are novel in that open-framework three-dimensional main group metal sulfates are first to be reported. • They show good fluorescence properties exhibiting blue luminescence.

  13. Feasibility of preparing patterned molybdenum coatings on bismuth telluride thermoelectric modules.

    Energy Technology Data Exchange (ETDEWEB)

    Sarobol, Pylin; Hall, Aaron Christopher; Miller, Stephen Samuel; Knight, Marlene E.; LePage, William S.; Sobczak, Catherine Elizabeth.; Wesolowski, Daniel Edward


    Molybdenum electrical interconnects for thermoelectric modules were produced by air plasma spraying a 30%CE%BCm size molybdenum powder through a laser-cut Kapton tape mask. Initial feasibility demonstrations showed that the molybdenum coating exhibited excellent feature and spacing retention (~170%CE%BCm), adhered to bismuth-telluride, and exhibited electrical conductivity appropriate for use as a thermoelectric module interconnect. A design of experiments approach was used to optimize air plasma spray process conditions to produce a molybdenum coating with low electrical resistivity. Finally, a molybdenum coating was successfully produced on a fullscale thermoelectric module. After the addition of a final titanium/gold layer deposited on top of the molybdenum coating, the full scale module exhibited an electrical resistivity of 128%CE%A9, approaching the theoretical resistivity value for the 6mm module leg of 112%CE%A9. Importantly, air plasma sprayed molybdenum did not show significant chemical reaction with bismuth-telluride substrate at the coating/substrate interface. The molybdenum coating microstructure consisted of lamellar splats containing columnar grains. Air plasma sprayed molybdenum embedded deeply (several microns) into the bismuth-telluride substrate, leading to good adhesion between the coating and the substrate. Clusters of round pores (and cracks radiating from the pores) were found immediately beneath the molybdenum coating. These pores are believed to result from tellurium vaporization during the spray process where the molten molybdenum droplets (2623%C2%B0C) transferred their heat of solidification to the substrate at the moment of impact. Substrate cooling during the molybdenum deposition process was recommended to mitigate tellurium vaporization in future studies.

  14. Oxygen concentration diffusion analysis of lead-bismuth-cooled, natural-circulation reactor

    International Nuclear Information System (INIS)

    Ito, Kei; Sakai, Takaaki


    The feasibility study on fast breeder reactors in Japan has been conducted at JNC and related organizations. The Phase-I study has finished in March, 2001. During the Phase-I activity, lead-bismuth eutectic coolant has been selected as one of the possible coolant options and a medium-scale plant, cooled by a lead-bismuth natural circulation flow was studied. On the other side, it is known that lead-bismuth eutectic has a problem of structural material corrosiveness. It was found that oxygen concentration control in the eutectic plays an important role on the corrosion protection. In this report, we have developed a concentration diffusion analysis code (COCOA: COncentration COntrol Analysis code) in order to carry out the oxygen concentration control analysis. This code solves a two-dimensional concentration diffusion equation by the finite differential method. It is possible to simulate reaction of oxygen and hydrogen by the code. We verified the basic performance of the code and carried out oxygen concentration diffusion analysis for the case of an oxygen increase by a refueling process in the natural circulation reactor. In addition, characteristics of the oxygen control system was discussed for a different type of the control system as well. It is concluded that the COCOA code can simulate diffusion of oxygen concentration in the reactor. By the analysis of a natural circulation medium-scale reactor, we make clear that the ON-OFF control and PID control can well control oxygen concentration by choosing an appropriate concentration measurement point. In addition, even when a trouble occurs in the oxygen emission or hydrogen emission system, it observes that control characteristic drops away. It is still possible, however, to control oxygen concentration in such case. (author)

  15. First-line Bismuth-containing Five-day Concomitant Quintuple Therapy for Helicobacter Pylori Eradication. (United States)

    Dolapcioglu, Can; Sayiner, Mehmet; Akkus, Esra Elif; Kural, Abdulaziz; Dolapcioglu, Hatice; Dabak, Resat; Ahishali, Emel


    Widespread use of antibiotics has resulted in increased rates of antibiotic resistance and decreased rates of Helicobacter pylori (H. pylori) eradication, leading to a search for newer therapeutic options. This study aimed to examine the efficacy, tolerability, and patient compliance of a first-line bismuth-containing 5-day concomitant quintuple therapy. This prospective study included 144 eradication treatment naïve H. pylori positive patients with dyspeptic complaints. Patients received the following concomitant quintuple therapy for 5 days: bismuth subcitrate 300 mg q.i.d, omeprazole 20 mg b.i.d, clarithromycin 500 mg b.i.d., amoxicillin 1 g b.i.d., and metronidazole 500 mg t.i.d. Eradication was assessed with H. pylori stool antigen test or urea-breath test 6 weeks after the completion of therapy. Treatment compliance rate in this study was 97.2%. Intention to treat and per-protocol eradication rates were 134/144 (93.1%, 95% CI, 88.9-97.2) and 134/140 (95.7%, 95% CI, 92.2-98.6), respectively. Side effect was reported by 8.5% of the patients that attended follow-up visits, including epigastric pain (2.8%), nausea/vomiting (2.1%), diarrhea (1.4%), taste disturbance (1.4%), and fatigue (0.7%). Bismuth-containing, short course, quintuple concomitant therapy appears to be an effective and safe therapeutic option for the first-line H. pylori eradication, particularly in populations with high resistance. © 2015 John Wiley & Sons Ltd.

  16. Origin of broad NIR photoluminescence in bismuthate glass and Bi-doped glasses at room temperature

    International Nuclear Information System (INIS)

    Peng, Mingying; Zollfrank, Cordt; Wondraczek, Lothar


    Bi-doped glasses with broadband photoluminescence in the near-infrared (NIR) spectral range are presently receiving significant consideration for potential applications in telecommunications, widely tunable fiber lasers and spectral converters. However, the origin of NIR emission remains disputed. Here, we report on NIR absorption and emission properties of bismuthate glass and their dependence on the melting temperature. Results clarify that NIR emission occurs from the same centers as it does in Bi-doped glasses. The dependence of absorption and NIR emission of bismuthate glasses on the melting temperature is interpreted as thermal dissociation of Bi 2 O 3 into elementary Bi. Darkening of bismuthate glass melted at 1300 deg. C is due to the agglomeration of Bi atoms. The presence of Bi nanoparticles is confirmed by transmission electron microscopy, high-resolution energy dispersive x-ray spectroscopy and element distribution mapping. By adding antimony oxide as an oxidation agent to the glass, NIR emission centers can be eliminated and Bi 3+ is formed. By comparing with atomic spectral data, absorption bands at ∼320 , ∼500 , 700 , 800 and 1000 nm observed in Bi-doped glasses are assigned to Bi 0 transitions 4 S 3/2 → 2 P 3/2 , 4 S 3/2 → 2 P 1/2 , 4 S 3/2 → 2 D 5/2 , 4 S 3/2 → 2 D 3/2 (2) and 4 S 3/2 → 2 D 3/2 (1), respectively, and broadband NIR emission is assigned to the transition 2 D 3/2 (1)→ 4 S 3/2 .

  17. [Determination of trace bismuth in iron, steel and alloy by hydride generation-atomic fluorimetry]. (United States)

    Liu, Q


    With the aid of hydride generation-atomic fluorimetry, an analysis method by adding thiosemicarbazide-ascorbic acid and phosphoric acid to eliminate the interference of matrix has been developed for the determination of trace bismuth in iron, steel and alloy. The detection limit is Bi = 0.02 microgram.g-1 (3 sigma, n = 11, sample amount 0.2000 g). The method has been applied to determine trace arsenic in middle and low alloy steel, ferro and nickel-based superalloy, nickel-based superalloy, cobalt-based superalloy, copper alloy with satisfactory results.

  18. Cerium-modified Aurivillius-type sodium lanthanum bismuth titanate with enhanced piezoactivities

    International Nuclear Information System (INIS)

    Wang Chunming; Zhao Liang; Wang Jinfeng; Zheng Limei; Du Juan; Zhao Minglei; Wang Chunlei


    The electrical, piezoelectric and dielectric properties of cerium-modified Aurivillius-type sodium lanthanum bismuth titanate (Na 0.5 La 0.5 Bi 4 Ti 4 O 15 , NLBT) ceramics were investigated. It was found the piezoelectric activities of NLBT ceramics were significantly improved by cerium modification. The piezoelectric coefficient d 33 and Curie temperature T c for the 0.50 wt.% cerium-modified NLBT were found to be 29 pC/N and 573 deg. C, respectively. The reasons for piezoelectric activities improvement by cerium modification were given. A small dielectric abnormity was observed in NLBT ceramics, which can be suppressed by cerium modification.

  19. Polonium release from an ATW burner system with liquid lead-bismuth coolant

    International Nuclear Information System (INIS)

    Li, N.; Yefimov, E.; Pankratov, D.


    The authors analyzed polonium release hazards in a conceptual pool-type ATW burner with liquid lead-bismuth eutectic (LBE) coolant. Simplified quantitative models are used based on experiments and real NPP experience. They found little Po contamination outside the burner under normal operating conditions with nominal leakage from the gas system. In sudden gas leak and/or coolant spill accidents, the P contamination level can reach above the regulation limit but short exposure would not lead to severe health consequences. They are evaluating and developing mitigation methods

  20. Synthesis, characterization and luminescent properties of mixed phase bismuth molybdate-doped with Eu3+ ions (United States)

    Wang, Liyong; Guo, Xiaoqing; Cai, Xiaomeng; Song, Qingwei; Han, Yuanyuan; Jia, Guang


    Red phosphors of Eu3+-doped bismuth molybdate (BMO) are prepared by a low temperature hydrothermal method assisting with Phenol Formaldehyde resin (PFr), and characterized by X-ray diffraction (XRD) patterns, Fourier transform infrared-spectroscopy (FT-IR), thermogravimetric analyzer (TGA), differential thermal analyzer (DTA), and photoluminescence (PL) spectroscopy. PL properties influence factors including molar ratio of Bi3+ and Mo3+ ions, PFr dosage and dopants concentration are discussed in detail. The results show that BMO can act as a useful host for Eu3+ ions doping, and energy transferring from Bi3+ to Eu3+ achieved efficiently, the BMO phosphors displayed intense red color emission under ultraviolet light excitation.

  1. Selective oxidation of propylene to acrolein by hydrothermally synthesized bismuth molybdates

    DEFF Research Database (Denmark)

    Schuh, Kirsten; Kleist, Wolfgang; Høj, Martin


    Hydrothermal synthesis has been used as a soft chemical method to prepare bismuth molybdate catalysts for the selective oxidation of propylene to acrolein. All obtained samples displayed a plate-like morphology, but their individual aspect ratios varied with the hydrothermal synthesis conditions...... of nitric acid during hydrothermal synthesis enhanced both propylene conversion and acrolein yield, possibly due to a change in morphology. Formation of β-Bi2Mo2O9 was not observed under the applied conditions. In general, the catalytic performance of all samples decreased notably after calcination at 550...

  2. IR Bismuth active centers in optical fibers: Combined excitation-emission spectroscopy


    Firstov, S. V.; Khopin, V. F.; Bufetov, I. A.; Firstova, E. G.; Guryanov, A. N.; Dianov, E. M.


    3D excitation-emission luminescence spectra of Bi-doped optical fibers of various compositions were measured in a wide wavelength range 450-1700 nm. Such luminescence spectra were obtained for Bi-doped pure silica and germania fibers, and for Bi-doped Al- or P-codoped silica fibers (at room and liquid nitrogen temperatures). The energy level schemes of IR bismuth active centers in pure silica and germania core fibers were derived from spectra obtained. The energy level schemes similarity of b...

  3. Laboratory-Scale Bismuth Phosphate Extraction Process Simulation To Track Fate of Fission Products

    Energy Technology Data Exchange (ETDEWEB)

    Serne, R. JEFFREY; Lindberg, Michael J.; Jones, Thomas E.; Schaef, Herbert T.; Krupka, Kenneth M.


    Recent field investigation that collected and characterized vadose zone sediments from beneath inactive liquid disposal facilities at the Hanford 200 Areas show lower than expected concentrations of a long-term risk driver, Tc-99. Therefore laboratory studies were performed to re-create one of the three processes that were used to separate the plutonium from spent fuel and that created most of the wastes disposed or currently stored in tanks at Hanford. The laboratory simulations were used to compare with current estimates based mainly on flow sheet estimates and spotty historical data. Three simulations of the bismuth phosphate precipitation process show that less that 1% of the Tc-99, Cs-135/137, Sr-90, I-129 carry down with the Pu product and thus these isotopes should have remained within the metals waste streams that after neutralization were sent to single shell tanks. Conversely, these isotopes should not be expected to be found in the first and subsequent cycle waste streams that went to cribs. Measurable quantities (~20 to 30%) of the lanthanides, yttrium, and trivalent actinides (Am and Cm) do precipitate with the Pu product, which is higher than the 10% estimate made for current inventory projections. Surprisingly, Se (added as selenate form) also shows about 10% association with the Pu/bismuth phosphate solids. We speculate that the incorporation of some Se into the bismuth phosphate precipitate is caused by selenate substitution into crystal lattice sites for the phosphate. The bulk of the U daughter product Th-234 and Np-237 daughter product Pa-233 also associate with the solids. We suspect that the Pa daughter products of U (Pa-234 and Pa-231) would also co-precipitate with the bismuth phosphate induced solids. No more than 1 % of the Sr-90 and Sb-125 should carry down with the Pu product that ultimately was purified. Thus the current scheme used to estimate where fission products end up being disposed overestimates by one order of magnitude the

  4. Effect of Bismuth Oxide on the Microstructure and Electrical Conductivity of Yttria Stabilized Zirconia

    Directory of Open Access Journals (Sweden)

    Liwei Liu


    Full Text Available Bismuth oxide (Bi2O3-doped yttria-stabilized zirconia (YSZ were prepared via the solid state reaction method. X-ray diffraction and electron diffraction spectroscopy results indicate that doping with 2 mol% Bi2O3 and adding 10 mol% yttria result in a stable zirconia cubic phase. Adding Bi2O3 as a dopant increases the density of zirconia to above 96%, while reducing its normal sintering temperature by approximately 250 °C. Moreover, electrical impedance analyses show that adding Bi2O3 enhances the conductivity of zirconia, improving its capability as a solid electrolyte for intermediate or even lower temperatures.

  5. Development of Bismuth Hall sensors for ITER steady state magnetic diagnostics.

    Czech Academy of Sciences Publication Activity Database

    Ďuran, Ivan; Entler, Slavomír; Kočan, M.; Kohout, Michal; Viererbl, L.; Mušálek, Radek; Chráska, Tomáš; Vayakis, G.


    Roč. 123, November (2017), s. 690-694 ISSN 0920-3796. [SOFT 2016: Symposium on Fusion Technology /29./. Prague, 05.09.2016-09.09.2016] R&D Projects: GA MŠk LG14002 Institutional support: RVO:61389021 ; RVO:68378271 Keywords : ITER * Magnetic diagnostic * Hall sensor * Bismuth * Neutron irradiation * Radiation hardness Subject RIV: JF - Nuclear Energetics; JF - Nuclear Energetics (FZU-D) OBOR OECD: Nuclear related engineering; Nuclear related engineering (FZU-D) Impact factor: 1.319, year: 2016

  6. Liquid Nitrogen (-196°C effect under pollen of some cultured or ornamental species

    Directory of Open Access Journals (Sweden)

    Sabina GLIGOR


    Full Text Available The criopreservation involve the stock of the vegetal material at low temperatures (-196°C in liquid nitrogen, in thermal conditions in which the division of cells and metabolic processes slow down, thus that the samplings may be conserved for long periods without suffering any genetic modifications. This stock technique is applied till present only on 80 vegetal species, keeping their seeds and vitrocultures preponderantly; researches were made regarding the maintenance of pollen in liquid nitrogen.The mature pollen, able to resist a higher degree of desiccation, may be conserved at low temperatures, without criopreservation. It was made researches on criopreservation of rise, maize, wheat, roses, sun flower and soy pollen. Our study purpose was to follow the impact of liquid nitrogen (-196°C about on viability of some cultured and ornamental species. The designed time of criopreservation it was 30 minutes and 7 days, using the TTC (tripheniltetrazole chloride method which allows testing the viability of vegetal material based on dehydrogenase activity.It was observed at Petunia hybrida species, that the pollen viability was low - in relevance with the witness represented from the pollen which was not resigned to the nitrogen liquid treatment - between percentage limits of 3.5-8%, in the case when the vegetal material was submersed 30 minutes in liquid nitrogen and 7.5-14.5% 7 days at (-196°C. The submersing of Nicotiana alata var. grandiflora species at 7 days, determined a low viability with 11.53%. The following two studied species Cucurbita and Hosta were proved to be the most resistant at submersing and maintenance in liquid nitrogen. The most affected pollen was Campsis radicans species. At Datura stramonium species was observed 2.59% a low viability of pollen, after 30 minutes of liquid nitrogen treatment, was 19.56%, after 7 days of submersing, the most pollen granules losing completely their viability.

  7. Roman Policies towards Antiochus III and the Greeks from Winter 197/196 B.C. to Autumn 196 B.C.

    Directory of Open Access Journals (Sweden)

    Deutschmann, Eike Hellmut


    Full Text Available In the Second Macedonian War (200-196 B.C., the res publica reduced the strength of the enemy King Philip V apparently to establish a new political order in Southern Balkans: Assumedly a pro-Roman balance of forces should prevail there, untainted by influence of another major power. A particular senatorial policy towards the Greeks probably did not exist before the fighting in Hellas came to an end in summer 197 B.C. In the same year, the Seleucid king Antiochus III brought large parts of the west coast of Asia Minor under control and set about crossing the Hellespont. Rome subsequently stylized itself as the guardian of freedom for the Greeks living in Hellas and Asia Minor. The statesmen of the res publica could have perceived Antiochus’ expansion as a threat to the mentioned new order. Therefore, the Roman Policy of Freedom was possibly applied primarily to take action against the Seleucid king. Die res publica verminderte im Zweiten Makedonischen Krieg (200-196 a.c. die Macht des gegnerischen Königs Philipp V - anscheinend um eine neue politische Ordnung im südlichen Balkanraum zu etablieren: Vermutlich sollte dort ein romfreundliches Kräftegleichgewicht vorherrschen, auf das keine andere Großmacht Einfluß hat. Eine speziell an die Griechen gerichtete Politik seitens des römischen Senats gab es wahrscheinlich nicht vor Ende der Kampfhandlungen in Hellas im Sommer 197 a.c. In dem Jahr erweiterte der seleukidische König Antiochos III. seinen Einflussbereich auf große Teile der kleinasiatischen Westküste und schickte sich an, den Hellespont zu überqueren. Rom stilisierte sich in der Folgezeit zum Freiheitsgarant der in Hellas und Kleinasien lebenden Griechen. Antiochos Expansion könnte von den Staatsmännern der res publica als Bedrohung der genannten neuen Ordnung angesehen worden sein. Demzufolge wurde die römische Freiheitspolitik möglicherweise in erster Linie angewendet, um gegen den seleukidischen König vorzugehen.

  8. Computer modeling of the neurotoxin binding site of acetylcholine receptor spanning residues 185 through 196 (United States)

    Garduno-Juarez, R.; Shibata, M.; Zielinski, T. J.; Rein, R.


    A model of the complex between the acetylcholine receptor and the snake neurotoxin, cobratoxin, was built by molecular model building and energy optimization techniques. The experimentally identified functionally important residues of cobratoxin and the dodecapeptide corresponding to the residues 185-196 of acetylcholine receptor alpha subunit were used to build the model. Both cis and trans conformers of cyclic L-cystine portion of the dodecapeptide were examined. Binding residues independently identified on cobratoxin are shown to interact with the dodecapeptide AChR model.

  9. Sonochemical synthesis of bismuth(III) nano coordination compound and direct synthesis of Bi.sub.2./sub.O.sub.3./sub. nanoparticles from a bismuth(III) nano coordination compound precursor

    Czech Academy of Sciences Publication Activity Database

    Roodsari, M.S.; Shaabani, B.; Mirtamizdoust, B.; Dušek, Michal; Fejfarová, Karla


    Roč. 25, č. 5 (2015), s. 1226-1232 ISSN 1574-1443 Grant - others:AV ČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : nano coordination compound * sonochemical method * intramolecular proton transfer * nano bismuth oxide * isoniazid Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.308, year: 2015

  10. Outstanding visible photocatalytic activity of a new mixed bismuth titanatate material

    Energy Technology Data Exchange (ETDEWEB)

    Zambrano, P. [Instituto de Ciencia de Materiales de Sevilla, CSIC-Universidad de Sevilla, Americo Vespucio 49, 410092, Sevilla (Spain); Departamento Cristalografía, Mineralogía y Química Agrícola, Universidad de Sevilla, C/Profesor García González s/n, 41012 Sevilla (Spain); Sayagués, M.J.; Navío, J.A. [Instituto de Ciencia de Materiales de Sevilla, CSIC-Universidad de Sevilla, Americo Vespucio 49, 410092, Sevilla (Spain); Hidalgo, M.C., E-mail: [Instituto de Ciencia de Materiales de Sevilla, CSIC-Universidad de Sevilla, Americo Vespucio 49, 410092, Sevilla (Spain)


    Highlights: • Photocatalyst based on bismuth titanates with high visible activity. • Its visible activity as high as UV activity of TiO{sub 2} P25 for phenol degradation. • Photocatalyst is majority of phase Bi{sub 20}TiO{sub 32} with Bi{sub 4}Ti{sub 3}O{sub 12} and amorphous TiO{sub 2}. • High visible activity due to low BG, interconnected phases and high surface area. - Abstract: In this work, a new photocatalyst based on bismuth titanates with outstanding visible photocatalytic activity was prepared by a facile hydrothermal method. The synthesised material showed visible activity as high as UV activity of commercial TiO{sub 2} P25 under the same experimental conditions for phenol degradation. A wide characterisation of the photocatalyst was performed. The material was composed of three phases; majority of Bi{sub 20}TiO{sub 32} closely interconnected to Bi{sub 4}Ti{sub 3}O{sub 12} and amorphous TiO{sub 2}. The high visible activity showed by this material could be ascribed to a combination of several features; i.e. low band gap energy value (2.1 eV), a structure allowing a good separation path for visible photogenerated electron-holes pairs and a relatively high surface area. This photocatalyst appeared as a promising material for solar and visible applications of photocatalysis.

  11. Toxicity of Volatile Methylated Species of Bismuth, Arsenic, Tin, and Mercury in Mammalian Cells In Vitro

    Directory of Open Access Journals (Sweden)

    E. Dopp


    Full Text Available The biochemical transformation of mercury, tin, arsenic and bismuth through formation of volatile alkylated species performs a fundamental role in determining the environmental processing of these elements. While the toxicity of inorganic forms of most of these compounds are well documented (e.g., arsenic, mercury and some of them are of relatively low toxicity (e.g., tin, bismuth, the more lipid-soluble organometals can be highly toxic. In the present study we investigated the cyto- and genotoxicity of five volatile metal(loid compounds: trimethylbismuth, dimethylarsenic iodide, trimethylarsine, tetramethyltin, and dimethylmercury. As far as we know, this is the first study investigating the toxicity of volatile metal(loid compounds in vitro. Our results showed that dimethylmercury was most toxic to all three used cell lines (CHO-9 cells, CaCo, Hep-G2 followed by dimethylarsenic iodide. Tetramethyltin was the least toxic compound; however, the toxicity was also dependend upon the cell type. Human colon cells (CaCo were most susceptible to the toxicity of the volatile compounds compared to the other cell lines. We conclude from our study that volatile metal(loid compounds can be toxic to mammalian cells already at very low concentrations but the toxicity depends upon the metal(loid species and the exposed cell type.

  12. Thermodynamic properties and equation of state of liquid lead and lead bismuth eutectic (United States)

    Sobolev, V. P.; Schuurmans, P.; Benamati, G.


    Since the 1950s, liquid lead (Pb) and lead-bismuth eutectic (Pb-Bi) have been studied in the USA, Canada and in the former-USSR as potential coolants for nuclear installations due to their very attractive thermophysical and neutronic properties. However, experimental data on the thermal properties of these coolants in the temperature range of interest are still incomplete and often contradictory. This makes it very difficult to perform design calculations and to analyse the normal and abnormal behaviour of nuclear installations where these coolants are expected to be used. Recently, a compilation of heavy liquid metal (HLM) properties along with recommendations for its use was prepared by the OECD/NEA Working Party on Fuel Cycle (WPFC) Expert Group on Lead-Bismuth Eutectic Technology. A brief review of this compilation and some new data are presented in this article. A set of correlations for the temperature dependence of the main thermodynamic properties of Pb and Pb-Bi(e) at normal pressure, and a set of simplified thermal and caloric equations of state for the liquid phase are proposed.

  13. Development and Testing of an Americium/Lanthanide Separation Flowsheet Using Sodium Bismuthate

    Energy Technology Data Exchange (ETDEWEB)

    Jack Law; Bruce Mincher; Troy Garn; Mitchell Greenhalgh; Nicholas Schmitt; Veronica Rutledge


    The separation of Am from the lanthanides and curium is a key step in proposed advanced fuel cycle scenarios. The partitioning and transmutation of Am is desirable to minimize the long-term heat load of material interred in a future high-level waste repository. A separation process amenable to process scale-up remains elusive. Given only subtle chemistry differences within and between the ions of the trivalent actinide and lanthanide series this separation is challenging ; however, higher oxidation states of americium can be prepared using sodium bismuthate and separated via solvent extraction using diamylamylphosphonate (DAAP) extraction. Among the other trivalent metals only Ce is also oxidized and extracted. Due to the long-term instability of Am(VI) , the loaded organic phase is readily selectively stripped to partition the actinide to a new acidic aqueous phase. Batch extraction distribution ratio measurements were used to design a flowsheet to accomplish this separation. Additionally, crossflow filtration was investigated as a method to filter the bismuthate solids from the feed solution prior to extraction. Results of the filtration studies, flowsheet development work and flowsheet performance testing using a centrifugal contactor are detailed.

  14. Synthesis of Bismuth Oxide Thin Films Deposited by Reactive Magnetron Sputtering

    International Nuclear Information System (INIS)

    Iljinas, A.; Burinskas, S.; Dudonis, J.


    In this work Bi 2 O 3 thin films were deposited onto the Si (111) and soda lime glass substrates by the reactive direct current magnetron sputtering system using pure Bi as a sputtering target. The dependences of electro-optical characteristics of the films on the substrate type and temperature were investigated. Transmittance and reflectance of the Bi 2 O 3 films were measured with ultraviolet and visible light spectrometer. It was found that the substrate temperature during deposition has a very strong influence on the phase components of thin films. The results indicate that the direct allowed transitions dominate in the films obtained in this work. For the direct allowed transitions the band gap energy is found to be about 1.98 eV and 2.2 eV. The reflectance of thin bismuth oxide film depends on the substrate. Small transparency of thin films grown on glass is more related to large reflectance than absorption. The reflectance spectra of the bismuth oxide thin films deposited on the Si substrates show higher quality of optical characteristics compared to the samples deposited on glass substrates. (author)

  15. Electrical Characteristics of MnO2 Doped Bismuth Borate Glass Systems (United States)

    Nissar, Umair; Ahmad, Javed; Rana, Anwar Manzoor; Bukhari, S. H.; Jamil, M. T.; Khan, J. Alam; Shakeel, R.; Nadeem, M. Y.


    Transparent glasses have a large number of applications in the industry of electronics as well as optical devices. xMnO2-(25- x) Bi2O3-75H3BO3 (0 ≤ x ≤ 1.5 mol.%) transparent glasses have been prepared via melt-quench technique and characterized using dc electrical measurements, and by analyzing x-ray diffraction and Fourier transform infrared (FTIR) spectra. These characteristics were examined to understand the role of modifier oxides, i.e., Bi2O3 and MnO2 in the B2O3 glass network. Adding MnO2 into a glass network causes structural changes, which are responsible for any variations in electrical characteristics of bismuth borate glasses. Manganese bismuth borate glasses (MBBG) show Ohmic conduction at low fields; however, glasses with higher manganese content seem to conduct through bulk limited Poole-Frenkel mechanism. FTIR spectroscopy analyses depict the presence of BO3 and BO4 groups along with B-O-B and Bi-O-Bi bonding vibrations. Glasses with higher MnO2 content also show Mn-O bond vibrations. The reduction of BO4 groups and increase of BO3 units lead to the formation of non-bridging oxygens (NBOs) which are responsible for the variations in the electrical properties of these glasses.

  16. Preparation and Elastic Moduli of Germanate Glass Containing Lead and Bismuth

    Directory of Open Access Journals (Sweden)

    Wan M. M. Yunus


    Full Text Available This paper reports the rapid melt quenching technique preparation for the new family of bismuth-lead germanate glass (BPG systems in the form of (GeO260–(PbO40−x–(½Bi2O3x where x = 0 to 40 mol%. Their densities with respect of Bi2O3 concentration were determined using Archimedes’ method with acetone as a floatation medium. The current experimental data are compared with those of bismuth lead borate (B2O320–(PbO80−x–(Bi2O3x. The elastic properties of BPG were studied using the ultrasonic pulse-echo technique where both longitudinal and transverse sound wave velocities have been measured in each glass samples at a frequency of 15 MHz and at room temperature. Experimental data shows that all the physical parameters of BPG including density and molar volume, both longitudinal and transverse velocities increase linearly with increasing of Bi2O3 content in the germanate glass network. Their elastic moduli such as longitudinal, shear and Young’s also increase linearly with addition of Bi2O3 but the bulk modulus did not. The Poisson’s ratio and fractal dimensionality are also found to vary linearly with the Bi2O3 concentration.

  17. Development of silver-sheathed bismuth superconducting wires and their application (invited)

    International Nuclear Information System (INIS)

    Sato, K.; Shibuta, N.; Mukai, H.; Hikata, T.; Ueyama, M.; Kato, T.


    The development results for silver-sheathed bismuth (2223 phase) superconducting wires in the past two years have suggested that three different fields of application will be feasible in the very near future. The first field is large current conductor application in liquid nitrogen operation. The second is magnet application (relatively low magnetic field below 1 Tesla, such as for semiconductor crystal pulling and magnetic separation) in liquid nitrogen operation. The third is super-high field application above 20 Tesla in liquid helium operation. In this paper, we will describe the state of the art of high-T c superconducting wires using a combination of bismuth high-T c phase and powder-in-tube technique. Maximum J c at 77.3 K reached to 53 700 A/cm 2 in a zero magnetic field, 42 300 A/cm 2 at 0.1 Tesla and 12 000 A/cm 2 at 1 Tesla. Prototypes, such as a 1000 A carrying conductor at 77.3 K, a 1000 Gauss coil at 77.3 K and a super-high field coil at 4.2 K were made and tested successfully

  18. Dose reduction using bismuth shielding during paediatric CT examinations in Slovakia

    International Nuclear Information System (INIS)

    Gbelcova, L.; Nikodemova, D.; Horvathova, M.


    Considering the massive increase of computer tomography (CT) examinations in Slovakia during the last 10 y, it can be expected that a higher radiation load may be observed in the Slovak population. Since child population is more sensitive to radiation than adult population, a monitoring has started to see how high the radiation dose is for paediatric patients during CT examinations in chosen departments in Slovakia. The CT examination of the head is one of the most frequently done examinations in Slovakian departments and that is why measurements were done to clarify how usage of bismuth shields for eyes and thyroid can affect the eye and thyroid doses. For simulation, 215 thermoluminescent dosimeters were exposed on anthropomorphic phantom of a child with and without usage of bismuth shields. The result was that only two of the three chosen departments confirmed a reduction. On the other hand, one of the departments confirmed that the reduction can be up to 56-65 %, which is significant. (authors)

  19. Fe2O3 Modified Physical, Structural and Optical Properties of Bismuth Silicate Glasses

    Directory of Open Access Journals (Sweden)

    Rajesh Parmar


    Full Text Available Iron-containing bismuth silicate glasses with compositions 60SiO2·(100−xBi2O3·xFe2O3 have been prepared by conventional melt-quenching technique. The amorphous nature of the glass samples has been ascertained by the X-ray diffraction. The density (d has been measured using Archimedes principle, molar volume (Vm has also been estimated, and both are observed to decrease with the increase in iron content. The glass transition temperature (Tg of these iron bismuth silicate glasses has been determined using differential scanning calorimetry (DSC technique, and it increases with the increase in Fe2O3 content. The IR spectra of these glasses consist mainly of [BiO6], [BiO3], and [SiO4] structural units. The optical properties are measured using UV-VIS spectroscopy. The optical bandgap energy (Eop is observed to decrease with the increase in Fe2O3 content, whereas reverse trend is observed for refractive index.

  20. Cation distribution, magnetic properties and cubic-perovskite phase transition in bismuth-doped nickel ferrite (United States)

    Gore, Shyam K.; Jadhav, Santosh S.; Tumberphale, Umakant B.; Shaikh, Shoyeb M.; Naushad, Mu; Mane, Rajaram S.


    The phase transition of bismuth-substituted nickel ferrite, synthesized by using a simple sol-gel autocombustion method, from cubic to perovskite is confirmed from the X-ray diffraction spectrums. The changes in isomer shift, hyperfine field and cation distribution are obtained from the Mossbauer spectroscopy analysis. The cation distribution demonstrates Ni2+ cations occupy tetrahedral sites, while Fe3+ and Bi3+ occupy both tetrahedral as well as octahedral sites. For higher concentrations of bismuth, saturation magnetization is increased whereas, coercivity is decreased which is related to phase change. The variations of dielectric constant, tangent loss and conductivity (ac) with frequency (10 Hz-5 MHz) have been explored with Bi3+-doping i.e. 'x'. According to Maxwell-Wagener model, there is an involvement of electron hopping kinetics as both dielectric constant and tangent loss are decreased with increasing frequency. Increase of conductivity with frequency (measured at room temperature, 27 °C) is attributed to increase of number of carriers and mobility.