WorldWideScience

Sample records for birefringent 1d magnetophotonic

  1. Band structure and Bloch states in birefringent 1D magnetophotonic crystals: An analytical approach

    CERN Document Server

    Lévy, M; Levy, Miguel; Jalali, Amir A

    2007-01-01

    An analytical formulation for the band structure and Bloch modes in elliptically birefringent magnetophotonic crystals is presented. The model incorporates both the effects of gyrotropy and linear birefringence generally present in magneto-optic thin film devices. Full analytical expressions are obtained for the dispersion relation and Bloch modes in a layered stack photonic crystal and their properties are analyzed. It is shown that other models recently discussed in the literature are contained as special limiting cases of the formulation presented herein.

  2. Magnetophotonics from theory to applications

    CERN Document Server

    Inoue, Mitsuteru; Baryshev, Alexander V

    2013-01-01

    Focused on light-to-artificial magnetic matter phenomena, this book explores magnetophotonics, describing and analyzing consequences of light interaction with non-reciprocal media. Covers light-to-artificial magnetic matter phenomena and related applications.

  3. Permittivity disorder induced Anderson localization in magnetophotonic crystals

    Science.gov (United States)

    Abdi-Ghaleh, R.; Namdar, A.

    2016-11-01

    This theoretical study was carried out to investigate the permittivity disorder induced Anderson localization of light in one-dimensional magnetophotonic crystals. It was shown that the disorder create the resonant transmittance modes associated with enhanced Faraday rotations inside the photonic band gap. The average localization length of the right- and left-handed circular polarizations (RCP and LCP), the total transmittance together with the ensemble average of the RCP and LCP phases, and the Faraday rotation of the structure were also investigated. For this purpose, the off-diagonal elements of the permittivity tensor were varied for various wavelengths of incident light. The obtained results revealed the nonreciprocal property of circular eigen modes. This study can potentially open up a new aspect for utilizing the disorder magnetophotonic structures in nonreciprocal systems such as isolators and circulators.

  4. Permittivity disorder induced Anderson localization in magnetophotonic crystals

    Energy Technology Data Exchange (ETDEWEB)

    Abdi-Ghaleh, R., E-mail: r.abdi@bonabu.ac.ir [Department of Laser and Optical Engineering, University of Bonab, 5551761167 Bonab (Iran, Islamic Republic of); Namdar, A. [Faculty of Physics, University of Tabriz, 5166614766 Tabriz (Iran, Islamic Republic of)

    2016-11-15

    This theoretical study was carried out to investigate the permittivity disorder induced Anderson localization of light in one-dimensional magnetophotonic crystals. It was shown that the disorder create the resonant transmittance modes associated with enhanced Faraday rotations inside the photonic band gap. The average localization length of the right- and left-handed circular polarizations (RCP and LCP), the total transmittance together with the ensemble average of the RCP and LCP phases, and the Faraday rotation of the structure were also investigated. For this purpose, the off-diagonal elements of the permittivity tensor were varied for various wavelengths of incident light. The obtained results revealed the nonreciprocal property of circular eigen modes. This study can potentially open up a new aspect for utilizing the disorder magnetophotonic structures in nonreciprocal systems such as isolators and circulators. - Highlights: • We theoretically investigated the permittivity disorder induced Anderson localization of light in magnetophotonic crystals. • The disorder considered in the diagonal elements of the permittivity tensor of magneto-optical layers. • The disorder create the resonant transmittance modes associated with enhanced Faraday rotations in the photonic band gap. • The average localization length of the circular polarizations and the ensemble average of their phases were investigated. • The obtained results revealed the nonreciprocal property of circular eigen modes.

  5. Birefringence imaging

    CERN Document Server

    Geday, M A

    2001-01-01

    in tendons. Many transparent materials are optically anisotropic i.e. the refractive index varies with the polarisation orientation of the light. The variation, birefringence, can reveal the underlying anisotropy of the material, whether this anisotropy is caused by the structure of the material or by applied stress. Several methods have been developed to measure the birefringence, although only two imaging microscope techniques, the 'rotating polariser technique' and the 'Polscope', capable of separating the magnitude of the anisotropy (delta or vertical bar sin delta vertical bar), its orientation (phi) and its transmission (l sub 0) are in common use today. In this thesis the rotating polariser technique has been completely revised, with a new and easily accessible user interface as a result. Calibration routines and several analytical tools have been developed. The technique is now capable of measuring the change in birefringence during phase transitions to very high a degree of precision. Examples of the...

  6. Magneto-optical switching of Bloch surface waves in magnetophotonic crystals

    Science.gov (United States)

    Romodina, M. N.; Soboleva, I. V.; Fedyanin, A. A.

    2016-10-01

    Bloch-surface-wave (BSW) excitation controlled by Faraday rotation in one-dimensional magnetophotonic crystals is presented. Dispersion curves of the Bloch surface wave and waveguide modes of magnetophotonic crystals consisting of silicon dioxide and bismuth-substituted yttrium-iron-garnet (Bi:YIG) quarter-wavelength-thick layers are calculated using Berreman's 4×4 transfer matrix method. Enhanced Faraday rotation observed in the magnetophotonic crystals in the spectral vicinity of the BSW resonance enables the magneto-optical switching of BSWs. The excitation of the BSWs at the magnetophotonic crystal surface for p-polarized incident light is induced by magneto-optical activity in the Bi:YIG layers.

  7. Direct Laser Writing of Magneto-Photonic Sub-Microstructures for Prospective Applications in Biomedical Engineering

    Directory of Open Access Journals (Sweden)

    Thi Huong Au

    2017-05-01

    Full Text Available We report on the fabrication of desired magneto-photonic devices by a low one-photon absorption (LOPA direct laser writing (DLW technique on a photocurable nanocomposite consisting of magnetite ( Fe 3 O 4 nanoparticles and a commercial SU-8 photoresist. The magnetic nanocomposite was synthesized by mixing Fe 3 O 4 nanoparticles with different kinds of SU-8 photoresists. We demonstrated that the degree of dispersion of Fe 3 O 4 nanoparticles in the nanocomposite depended on the concentration of Fe 3 O 4 nanoparticles, the viscosity of SU-8 resist, and the mixing time. By tuning these parameters, the most homogeneous magnetic nanocomposite was obtained with a concentration of about 2 wt % of Fe 3 O 4 nanoparticles in SU-8 2005 photoresist for the mixing time of 20 days. The LOPA-based DLW technique was employed to fabricate on demand various magneto-photonic submicrometer structures, which are similar to those obtained without Fe 3 O 4 nanoparticles. The magneto-photonic 2D and 3D structures with sizes as small as 150 nm were created. We demonstrated the strong magnetic field responses of the magneto-photonic nanostructures and their use as micro-actuators when immersed in a liquid solution.

  8. Birefringent hollow core fibers

    DEFF Research Database (Denmark)

    Roberts, John

    2007-01-01

    Hollow core photonic crystal fiber (HC-PCF), fabricated according to a nominally non-birefringent design, shows a degree of un-controlled birefringence or polarization mode dispersion far in excess of conventional non polarization maintaining fibers. This can degrade the output pulse in many...... and an increased overlap between the polarization modes at the glass interfaces. The interplay between these effects leads to a wavelength for optimum polarization maintenance, lambda(PM), which is detuned from the wavelength of highest birefringence. By a suitable fiber design involving antiresonance of the core...

  9. Birefringent hollow core fibers

    DEFF Research Database (Denmark)

    Roberts, John

    2007-01-01

    Hollow core photonic crystal fiber (HC-PCF), fabricated according to a nominally non-birefringent design, shows a degree of un-controlled birefringence or polarization mode dispersion far in excess of conventional non polarization maintaining fibers. This can degrade the output pulse in many...... and an increased overlap between the polarization modes at the glass interfaces. The interplay between these effects leads to a wavelength for optimum polarization maintenance, lambda(PM), which is detuned from the wavelength of highest birefringence. By a suitable fiber design involving antiresonance of the core...

  10. Controlling birefringence in dielectrics

    Science.gov (United States)

    Danner, Aaron J.; Tyc, Tomáš; Leonhardt, Ulf

    2011-06-01

    Birefringence, from the very essence of the word itself, refers to the splitting of light rays into two parts. In natural birefringent materials, this splitting is a beautiful phenomenon, resulting in the perception of a double image. In optical metamaterials, birefringence is often an unwanted side effect of forcing a device designed through transformation optics to operate in dielectrics. One polarization is usually implemented in dielectrics, and the other is sacrificed. Here we show, with techniques beyond transformation optics, that this need not be the case, that both polarizations can be controlled to perform useful tasks in dielectrics, and that rays, at all incident angles, can even follow different trajectories through a device and emerge together as if the birefringence did not exist at all. A number of examples are shown, including a combination Maxwell fisheye/Luneburg lens that performs a useful task and is achievable with current fabrication materials.

  11. Birefringent Electroweak Textures

    CERN Document Server

    Thatcher, M J; Thatcher, Marcus J.; Morgan, Michael J.

    1999-01-01

    The behaviour of electromagnetic waves propagating through an electroweak homilia string network is examined. This string network is topologically stable as a cosmic texture, and is characterized by the spatial variation of the isospin rotation of the Higgs field. As a consequence the photon field couples to the intermediate vector bosons, producing a finite range electromagnetic field. It is found that the propagation speed of the photon depends on its polarization vector, whence an homilia string network acts as a birefringent medium. We estimate the birefringent scale for this texture and show that it depends on the frequency of the electromagnetic wave and the length scale of the homilia string network.

  12. Nonlinear electrodynamics with birefringence

    CERN Document Server

    Kruglov, S I

    2015-01-01

    A new model of nonlinear electrodynamics with three parameters is suggested. The phenomena of vacuum birefringence takes place when there is the external constant magnetic field. We calculate the indices of refraction for two polarizations of electromagnetic waves, parallel and perpendicular to the magnetic induction field. From the Bir\\'{e}fringence Magn\\'{e}tique du Vide (BMV) experiment one of the coefficients, $\\gamma\\approx 10^{-20}$ T$^{-2}$, was estimated. The canonical, symmetrical Belinfante energy-momentum tensors and dilatation current were obtained. The dilatation symmetry and the dual symmetry are broken in the model considered.

  13. High Birefringence Liquid Crystals

    Directory of Open Access Journals (Sweden)

    Jakub Herman

    2013-09-01

    Full Text Available Liquid crystals, compounds and mixtures with positive dielectric anisotropies are reviewed. The mesogenic properties and physical chemical properties (viscosity, birefringence, refractive indices, dielectric anisotropy and elastic constants of compounds being cyano, fluoro, isothiocyanato derivatives of biphenyl, terphenyl, quaterphenyl, tolane, phenyl tolane, phenyl ethynyl tolane, and biphenyl tolane are compared. The question of how to obtain liquid crystal with a broad range of nematic phases is discussed in detail. Influence of lateral substituent of different kinds of mesogenic and physicochemical properties is presented (demonstrated. Examples of mixtures with birefringence ∆n in the range of 0.2–0.5 are given.

  14. Nonreciprocal optical tunnelling through evanescently coupled Tamm states in magnetophotonic crystals

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Yun-Tuan [Jiangsu Univ., Zhenjiang (China). School of Computer Science and Telecommunication Engineering; Han, Ling [The Second Military Medical Univ., Shanghai (China). Dept. of Radiation Medicine; Gao, Yong-Feng [Jiangsu Univ., Zhenjiang (China). School of Mechanical Engineering

    2015-07-01

    Evanescently coupled Tamm states are achieved through two magnetophotonic crystals (MPCs) with a pair of coupling prisms. At the wavelengths of coupled Tamm states, a double of nonreciprocal optical tunnelling channels is found through the transmission spectra obtained from a developed transfer matrix method. The nonreciprocal tunnelling wavelength and the interval between two nonreciprocal channels can be adjusted depending on the width of the air gap between two MPCs or the scale invariant of a PC. The nonreciprocal tunnelling is demonstrated through electromagnetic field distribution simulations based on finite element software. Such theoretical results may provide a new method to design tunable optical isolators with a double of channels.

  15. Temporal coupled mode analysis of one-dimensional magneto-photonic crystals with cavity structures

    Science.gov (United States)

    Saghirzadeh Darki, Behnam; Zeidaabadi Nezhad, Abolghasem; Firouzeh, Zaker Hossein

    2016-12-01

    In this paper, we propose the time-dependent coupled mode analysis of one-dimensional magneto-photonic crystals including one, two or multiple defect layers. The performance of the structures, namely the total transmission, Faraday rotation and ellipticity, is obtained using the proposed method. The results of the developed analytic approach are verified by comparing them to the results of the exact numerical transfer matrix method. Unlike the widely used numerical method, our proposed analytic method seems promising for the synthesis as well as the analysis purposes. Moreover, the proposed method has not the restrictions of the previously examined analytic methods.

  16. Magnetophotonic crystal with cerium substituted yttrium iron garnet and enhanced Faraday rotation angle.

    Science.gov (United States)

    Yoshimoto, Takuya; Goto, Taichi; Isogai, Ryosuke; Nakamura, Yuichi; Takagi, Hiroyuki; Ross, C A; Inoue, M

    2016-04-18

    Magnetophotonic crystals (MPCs) comprising cerium-substituted yttrium iron garnet (CeYIG) sandwiched by two Bragg mirrors were fabricated by vacuum annealing. CeYIG was deposited on Bragg mirrors at room temperature and annealed in 5 Pa of residual air. No ceria or other non-garnet phases were detected. Cerium 3 + ions substituted on the yttrium sites and no cerium 4 + ions were found. The Faraday rotation angle of the MPC was -2.92° at a wavelength of λ = 1570 nm was 30 times larger than that of the CeYIG film. These results showed good agreement with calculated values derived using a matrix approach.

  17. Quantum vacuum magnetic birefringence

    Energy Technology Data Exchange (ETDEWEB)

    Berceau, Paul; Battesti, Remy; Fouche, Mathilde; Frings, Paul; Nardone, Marc; Portugall, Oliver; Rikken, Geert L. J. A.; Rizzo, Carlo, E-mail: carlo.rizzo@lncmi.cnrs.fr [UPR 3228, CNRS-UPS-UJF-INSA, Laboratoire National des Champs Magnetiques Intenses (France)

    2012-05-15

    In this contribution to EXA2011 congress, we present the status of the BMV (Birefringence Magnetique du Vide) experiment which is based on the use of a state-of-the-art optical resonant cavity and high pulsed magnetic fields, and it is hosted by the Laboratoire National des Champs Magnetiques Intenses in Toulouse, France.

  18. Birefringent phononic structures

    Directory of Open Access Journals (Sweden)

    I. E. Psarobas

    2014-12-01

    Full Text Available Within the framework of elastic anisotropy, caused in a phononic crystal due to low crystallographic symmetry, we adopt a model structure, already introduced in the case of photonic metamaterials, and by analogy, we study the effect of birefringence and acoustical activity in a phononic crystal. In particular, we investigate its low-frequency behavior and comment on the factors which determine chirality by reference to this model.

  19. Inflationary Birefringence and Baryogenesis

    CERN Document Server

    Alexander, Stephon H S

    2016-01-01

    A decade ago, the first leptogenesis model based on inflation was proposed, where the complex phase of the inflaton field carries lepton number. If the inflaton field is an axion, it can couple to gravitational waves and gauge fields via. Chern-Simons invariants. Due to these couplings, birefringent gravitational and gauge primordial perturbations are created during inflation to generate a lepton asymmetry, establishing a possible connection between non-vanishing TB-parity violating polarization cross-correlations and leptogenesis. We also discuss the prospect for a subset of these models can directly source circular (V-mode) polarization in the CMB.

  20. Birefringence phenomena revisited

    CERN Document Server

    Pereira, Dante D; Gonçalves, Bruno

    2016-01-01

    The propagation of electromagnetic waves is investigated in the context of the isotropic and nonlinear dielectric media at rest in the eikonal limit of the geometrical optics. Taking into account the functional dependence $\\varepsilon=\\varepsilon(E,B)$ and $\\mu=\\mu(E,B)$ for the dielectric coefficients, a set of phenomena related to the birefringence of the electromagnetic waves induced by external fields are derived and discussed. Our results contemplate the known cases already reported in the literature: Kerr, Cotton-Mouton, Jones and magnetoelectric effects. Moreover, new effects are presented here as well as the perspectives of its experimental confirmations.

  1. Magneto-photonic crystal microcavities based on magnetic nanoparticles embedded in Silica matrix

    Science.gov (United States)

    Hocini, Abdesselam; Moukhtari, Riad; Khedrouche, Djamel; Kahlouche, Ahmed; Zamani, Mehdi

    2017-02-01

    Using the three-dimensional finite difference time domain method (3D FDTD) with perfectly matched layers (PML), optical and magneto-optical properties of two-dimensional magneto-photonic crystals micro-cavity is studied. This micro-cavity is fabricated by SiO2/ZrO2 or SiO2/TiO2 matrix doped with magnetic nanoparticles, in which the refractive index varied in the range of 1.51-1.58. We demonstrate that the Q factor for the designed cavity increases as the refractive index increases, and we find that the Q factor decreases as the volume fraction VF% due to off-diagonal elements increases. These magnetic microcavities may serve as a fundamental structure in a variety of ultra compact magneto photonic devices such as optical isolators, circulators and modulators in the future.

  2. Analysis and synthesis of one-dimensional magneto-photonic crystals using coupled mode theory

    Science.gov (United States)

    Saghirzadeh Darki, Behnam; Nezhad, Abolghasem Zeidaabadi; Firouzeh, Zaker Hossein

    2017-03-01

    We utilize our previously developed temporal coupled mode approach to investigate the performance of one-dimensional magneto-photonic crystals (MPCs). We analytically demonstrate that a double-defect MPC provides adequate degrees of freedom to design a structure for arbitrary transmittance and Faraday rotation. By using our developed analytic approach along with the numerical transfer matrix method, we present a procedure for the synthesis of an MPC to generate any desired transmittance and Faraday rotation in possible ranges. However it is seen that only discrete values of transmittance and Faraday rotation are practically obtainable. To remedy this problem along with having short structures, we introduce a class of MPC heterostructures which are combinations of stacks with high and low optical contrast ratios.

  3. Spectral selectivity of 3D magnetophotonic crystal film fabricated from single butterfly wing scales

    Science.gov (United States)

    Peng, Wenhong; Zhu, Shenmin; Zhang, Wang; Yang, Qingqing; Zhang, Di; Chen, Zhixin

    2014-05-01

    3D magnetophotonic crystal (3D-MPC) film is an excellent platform for tailoring the magneto-optical response of magnetic materials. However, its fabrication is a great challenge due to the limitation of commonly used artificial synthesis methods. Inspired by the unique structures of biospecies, we hereby manipulate the pristine single wing scales of Morpho didius precisely and successfully fabricate Fe3O4 films with photonic structure. The synthesis strategy involves the fabrication of Fe2O3 film from a single wing scale using an improved sol-gel method followed by a subsequent reduction. The intrinsic hierarchical photonic structures as well as the anisotropic optical properties of the pristine butterfly wing scale have been retained in the obtained Fe2O3 and Fe3O4 films. When investigated under an external magnetic field, a spectral blue shift about 43 nm is observed in the designated orientation of the Fe3O4 film, which is useful for the design and creation of novel magnetic-optical modulator devices. Furthermore, these single scales can be used as building blocks to fabricate designable and more complicated assembled nano systems. This biomimetic technique combined with the variety of structures of butterfly wing scales provides an effective approach to produce magneto-photonic films with desired structure, paving a new way for theoretical research and practical applications.3D magnetophotonic crystal (3D-MPC) film is an excellent platform for tailoring the magneto-optical response of magnetic materials. However, its fabrication is a great challenge due to the limitation of commonly used artificial synthesis methods. Inspired by the unique structures of biospecies, we hereby manipulate the pristine single wing scales of Morpho didius precisely and successfully fabricate Fe3O4 films with photonic structure. The synthesis strategy involves the fabrication of Fe2O3 film from a single wing scale using an improved sol-gel method followed by a subsequent reduction

  4. Birefringent coherent diffraction imaging

    Science.gov (United States)

    Karpov, Dmitry; dos Santos Rolo, Tomy; Rich, Hannah; Kryuchkov, Yuriy; Kiefer, Boris; Fohtung, E.

    2016-10-01

    Directional dependence of the index of refraction contains a wealth of information about anisotropic optical properties in semiconducting and insulating materials. Here we present a novel high-resolution lens-less technique that uses birefringence as a contrast mechanism to map the index of refraction and dielectric permittivity in optically anisotropic materials. We applied this approach successfully to a liquid crystal polymer film using polarized light from helium neon laser. This approach is scalable to imaging with diffraction-limited resolution, a prospect rapidly becoming a reality in view of emergent brilliant X-ray sources. Applications of this novel imaging technique are in disruptive technologies, including novel electronic devices, in which both charge and spin carry information as in multiferroic materials and photonic materials such as light modulators and optical storage.

  5. Birefringence Measurements on Crystalline Silicon

    CERN Document Server

    Krüger, Christoph; Khalaidovski, Alexander; Steinlechner, Jessica; Nawrodt, Ronny; Schnabel, Roman; Lück, Harald

    2015-01-01

    Crystalline silicon has been proposed as a new test mass material in third generation gravitational wave detectors such as the Einstein Telescope (ET). Birefringence can reduce the interferometric contrast and can produce dynamical disturbances in interferometers. In this work we use the method of polarisation-dependent resonance frequency analysis of Fabry-Perot-cavities containing silicon as a birefringent medium. Our measurements show a birefringence of silicon along the (111) axis of the order of $\\Delta\\, n \\approx 10^{-7}$ at a laser wavelength of 1550nm and room temperature. A model is presented that explains the results of different settings of our measurements as a superposition of elastic strains caused by external stresses in the sample and plastic strains possibly generated during the production process. An application of our theory on the proposed ET test mass geometry suggests no critical effect on birefringence due to elastic strains.

  6. High-birefringent photonic crystal fiber

    DEFF Research Database (Denmark)

    Libori, Stig E. Barkou; Broeng, Jes; Knudsen, Erik

    2001-01-01

    A highly birefringent photonic crystal fiber design is analysed. Birefringence up to 10-3 is found. Random fluctuations in the cladding design are analysed, and the fiber is found to be a feasible polarization maintaining fiber.......A highly birefringent photonic crystal fiber design is analysed. Birefringence up to 10-3 is found. Random fluctuations in the cladding design are analysed, and the fiber is found to be a feasible polarization maintaining fiber....

  7. Polarization beam splitting using a birefringent graded photonic crystal.

    Science.gov (United States)

    Cassan, Eric; Van Do, Khanh; Dellinger, Jean; Le Roux, Xavier; de Fornel, Frédérique; Cluzel, Benoit

    2013-02-15

    The use of a birefringent graded photonic crystal (GPhC) is proposed for the realization of an efficient polarization beam splitter. This approach allows decoupling the two functions of efficient light injection for both polarizations and TE/TM beam splitting. A smooth light polarization splitting is naturally achieved due to the different curved trajectories followed within the graded medium by the TE and TM waves. A 160 nm operating bandwidth with insertion loss around 1 dB and interpolarization crosstalk below -15 dB is predicted by a finite difference time domain simulation. The unusually exploited electromagnetic phenomena are experimentally evidenced by scanning near-field optical measurements performed on samples fabricated using the silicon on insulator photonics technology. These experimental works open perspectives for the use of birefringent GPhCs to manage polarization diversity in silicon photonic circuits.

  8. Freeform Fabrication of Magnetophotonic Crystals with Diamond Lattices of Oxide and Metallic Glasses for Terahertz Wave Control by Micro Patterning Stereolithography and Low Temperature Sintering

    Directory of Open Access Journals (Sweden)

    Maasa Nakano

    2013-04-01

    Full Text Available Micrometer order magnetophotonic crystals with periodic arranged metallic glass and oxide glass composite materials were fabricated by stereolithographic method to reflect electromagnetic waves in terahertz frequency ranges through Bragg diffraction. In the fabrication process, the photo sensitive acrylic resin paste mixed with micrometer sized metallic glass of Fe72B14.4Si9.6Nb4 and oxide glass of B2O3·Bi2O3 particles was spread on a metal substrate, and cross sectional images of ultra violet ray were exposed. Through the layer by layer stacking, micro lattice structures with a diamond type periodic arrangement were successfully formed. The composite structures could be obtained through the dewaxing and sintering process with the lower temperature under the transition point of metallic glass. Transmission spectra of the terahertz waves through the magnetophotonic crystals were measured by using a terahertz time domain spectroscopy.

  9. Birefringence analysis of segmented cladding fiber.

    Science.gov (United States)

    Kumar, Ajeet; Rastogi, Vipul; Agrawal, Arti; Rahman, B M A

    2012-05-20

    We present a full-vectorial modal analysis of a segmented cladding fiber (SCF). The analysis is based on the H-field vectorial finite element method (VFEM) employing polar mesh geometry. Using this method, we have analyzed the circular SCF and the elliptical SCF. We have found that the birefringence of the circular SCF is very small (1.0×10(-8)). Birefringence of a highly elliptical SCF can be altered to some extent by the number of segments and duty cycle of segmentation in the segmented cladding. However, the change is not profound. The analysis shows that the circular SCF possesses low birefringence and that the segmented cladding does not add any significant birefringence in an elliptical fiber. This result strongly indicates that small deviations in the segmented cladding parameters arising from fabrication process do not significantly affect the birefringence of the fiber.

  10. Stress effects in twisted highly birefringent fibers

    Science.gov (United States)

    Wolinski, Tomasz R.

    1994-03-01

    Hydrostatic pressure and uniaxial longitudinal strain effects in twisted highly birefringent optical fibers have been investigated from the point of the Marcuse mode-coupling theory. The problem is analyzed in terms of local normal modes of the ideal fiber and in the limit of weak twist, where large linear birefringence dominates over twist effect, and therefore twist coupling between local modes is not effective. The authors present the results of birefringence measurements in highly birefringent bow-tie fibers influenced simultaneously by hydrostatic pressure up to 100 MPa and twisting the result for highly birefringent elliptical-core fibers influenced by uniaxial longitudinal strain up to 4000 (mu) (epsilon) and twisting effect. The birefringence measurement method is based on twist-induced effects and has been successfully applied in a stress environment. The experiment was conducted with a specially designed stress generating device that makes it possible to simultaneously generate various mechanical perturbations such as hydrostatic and radial pressure, axial strain and twist, allowing study of their influence on mode propagation in optical fibers. A comparison with theoretical results as well as with pervious experimental data on stress influence on the beat length parameter in highly birefringent fibers is also provided.

  11. Zero birefringence films of pullulan ester derivatives

    Science.gov (United States)

    Danjo, Takahiro; Enomoto, Yukiko; Shimada, Hikaru; Nobukawa, Shogo; Yamaguchi, Masayuki; Iwata, Tadahisa

    2017-04-01

    High-performance films with almost zero-birefringence and zero-wavelength dispersion were succeeded to prepare from pullulan esters derivatives (PLEs) without any additives. Optical transmittance analysis, birefringence measurement of PLE cast film and hot stretched films, and infrared dichroism analysis were conducted to characterize optical properties of PLE films comparing with cellulose triacetate which is commercially used as low-birefringence in optical devices. The aims of this study, characterization of optical properties of pullulan esters, can develop a deep understanding of the fundamental knowing and applicability of polysaccharides. Accordingly, authors believe this paper will open the gate for researches in the application of polysaccharides.

  12. New constraints on gravity-induced birefringence

    Science.gov (United States)

    Solanki, Sami K.; Haugan, Mark P.

    1996-01-01

    A wide class of gravitation theories predicts gravity-induced birefringence. For Moffat's NGT, the prototypical theory of this type, Gabriel, Haugan, Mann, and Palmer used the predicted gravitational birefringence and observations of solar polarization to constrain the Sun's nonsymmetric charge lsolar. We improve on this constraint by making use of improved knowledge of the solar source of polarization and of a refined analysis procedure. We obtain l2solar< (305 km)2.

  13. Improvement of diffraction efficiency of three-dimensional magneto-optic spatial light modulator with magnetophotonic crystal

    Energy Technology Data Exchange (ETDEWEB)

    Nakamura, K.; Takagi, H., E-mail: takagi@ee.tut.ac.jp; Lim, P. B.; Inoue, M., E-mail: inoue@tut.ac.jp [Department of Electrical and Electronic Information Engineering, Toyohashi University of Technology, Toyohashi, Aichi 441 8580 (Japan); Goto, Taichi [Department of Electrical and Electronic Information Engineering, Toyohashi University of Technology, Toyohashi, Aichi 441 8580 (Japan); JST, PRESTO, 4-1-8 Honcho, Kawaguchi, Saitama 332-0012 (Japan); Horimai, H. [HolyMine Corporation, Atsugi, Kanagawa 243 0813 (Japan); Yoshikawa, H. [Department of Computer Engineering, College of Science and Technology, Nihon University, Funabashi, Chiba 274 8501 (Japan); Bove, V. M. [MIT Media Lab, Cambridge, Massachusetts 02139 (United States)

    2016-01-11

    We have developed three-dimensional magneto-optic spatial light modulators (3D-MOSLMs) that use magnetic domains as submicron scale pixels to represent holograms. Our display system uses a submicron-scale magnetic pixel array on an amorphous TbFe film to create a wide viewing angle hologram. However, in previous work the reconstructed images had a low intensity and a low optical contrast; brightness of the reconstructed image was 4.4 × 10{sup −2 }cd/m{sup 2} with 532 nm illumination light at 10.8 mW/cm{sup 2}, while display standard ISO13406 recommends 100 cd/m{sup 2} or more. In this paper, we describe our development of a 3D-MOSLM composed of an artificial magnetic lattice structure of magnetophotonic crystals (MPCs). The MPCs enhance the diffraction efficiency of reconstructed 3D images and reduce the power consumption for controlling the magnetic pixels by a light localization effect. We demonstrate reconstructed 3D images using the MPC and show significant brightness improvement.

  14. Magnetic birefringence of natural and synthetic ferritin

    Energy Technology Data Exchange (ETDEWEB)

    Koralewski, M., E-mail: koral@amu.edu.pl [Optics Laboratory, Faculty of Physics, Adam Mickiewicz University, Umultowska 85, 61-614 Poznan (Poland); Pochylski, M. [Optics Laboratory, Faculty of Physics, Adam Mickiewicz University, Umultowska 85, 61-614 Poznan (Poland); Mitroova, Z.; Timko, M.; Kopcansky, P.; Melnikova, L. [Institute of Experimental Physics, SAS, Watsonova 47, 040 01 Kosice (Slovakia)

    2011-10-15

    Magnetically induced optical birefringence ({Delta}n) was measured for magnetoferritin (MFer), horse spleen ferritin (HSF) and nanoscale magnetite aqueous suspensions. The anisotropy of optical polarizability was calculated. The average magnetic dipole moment calculated assuming the Langevin model was about 20,000 and 8500 {mu}{sub B} per particle, for magnetite nanoparticle and magnetoferritin, respectively. Poor fitting results and the unphysical value of average magnetic moment per Fe ion for MFer excluded the use of the simple Langevin model for description of {Delta}n for this compound. It was deduced that for MFer the estimated average magnetic moment should be about 1125 {mu}{sub B} per molecule. A magnetic contribution from the protein shell was found to be negligible. Results from the low-field region permit the calculation of the Cotton-Mouton (C-M) constants and their comparison for the substances studied. It was shown that magnetic birefringence and C-M constant can be powerful parameters in identification of the magnetic core structure of ferritins, especially useful in biomedicine. - Highlights: > Magnetic birefringence of ferritins were studied and compared with nanoscale magnetite. > Magnetoferritin shows non-Langevin behaviour of magnetic birefringence in contrast to magnetite. > Cotton-Mouton constant of synthetic ferritin is four orders higher than that of the natural one. > Magnetic birefringence can be useful for identification of magnetic core of biogenic ferritins. > The described magnetooptical method can be of interest in biomedicine.

  15. Novel imaging technique for birefringent materials

    CERN Document Server

    Lewis, J G

    1998-01-01

    less than 40 seconds. Retardation and orientation changes of less than 1nm and 1 deg, respectively, can be resolved with a spatial resolution close to that of a conventional polarizing microscope image. A wide variety of optically anisotropic materials have been examined to demonstrate both the quantitative and qualitative nature of this new sensitive polarization microscopy technique. Preliminary measurements have shown that when the system is extended to use two or more wavelengths it is also capable of directly extracting information about the order of the phase difference. Many transparent materials including crystals, polymers, biological tissues and textile fibres are birefringent or optically anisotropic, i.e. the refractive index varies with the direction of vibration of light. Birefringent measurements are important as they provide information about the underlying structure of a material. In general, the most sensitive techniques for measuring birefringence are those that modulate the polarization st...

  16. OSQAR Status Report: Progress in Ultra-fine Birefringence Measurements

    CERN Document Server

    Pugnat, P

    2009-01-01

    Progress achieved in birefringence measurements within the OSQAR collaboration is reported. This constitutes an important and encouraging step toward the first measurement at CERN of the Vacuum Magnetic Birefringence predicted by the QED.

  17. Ultra-low birefringence dodecagonal vacuum glass cell

    CERN Document Server

    Brakhane, Stefan; Meschede, Dieter; Moon, Geol; Robens, Carsten; Alberti, Andrea

    2015-01-01

    We eport on an ultra-low birefringence dodecagonal glass cell for ultra-high vacuum applications. The epoxy-bonded trapezoidal windows of the cell are made of SF57 glass, which exhibits a very low stress-induced birefringence. We characterize the birefringence $\\Delta n$ of each window with the cell under vacuum conditions, obtaining values around $\

  18. Modeling and minimizing interference from corneal birefringence in retinal birefringence scanning for foveal fixation detection.

    Science.gov (United States)

    Irsch, Kristina; Gramatikov, Boris; Wu, Yi-Kai; Guyton, David

    2011-07-01

    Utilizing the measured corneal birefringence from a data set of 150 eyes of 75 human subjects, an algorithm and related computer program, based on Müller-Stokes matrix calculus, were developed in MATLAB for assessing the influence of corneal birefringence on retinal birefringence scanning (RBS) and for converging upon an optical/mechanical design using wave plates ("wave-plate-enhanced RBS") that allows foveal fixation detection essentially independently of corneal birefringence. The RBS computer model, and in particular the optimization algorithm, were verified with experimental human data using an available monocular RBS-based eye fixation monitor. Fixation detection using wave-plate-enhanced RBS is adaptable to less cooperative subjects, including young children at risk for developing amblyopia.

  19. Modeling and minimizing interference from corneal birefringence in retinal birefringence scanning for foveal fixation detection

    Science.gov (United States)

    Irsch, Kristina; Gramatikov, Boris; Wu, Yi-Kai; Guyton, David

    2011-01-01

    Utilizing the measured corneal birefringence from a data set of 150 eyes of 75 human subjects, an algorithm and related computer program, based on Müller-Stokes matrix calculus, were developed in MATLAB for assessing the influence of corneal birefringence on retinal birefringence scanning (RBS) and for converging upon an optical/mechanical design using wave plates (“wave-plate-enhanced RBS”) that allows foveal fixation detection essentially independently of corneal birefringence. The RBS computer model, and in particular the optimization algorithm, were verified with experimental human data using an available monocular RBS-based eye fixation monitor. Fixation detection using wave-plate-enhanced RBS is adaptable to less cooperative subjects, including young children at risk for developing amblyopia. PMID:21750772

  20. Anisotropic alteration of scleral birefringence to uniaxial mechanical strain.

    Directory of Open Access Journals (Sweden)

    Satoko Nagase

    Full Text Available PURPOSE: To investigate the relationship between scleral mechanical properties, its birefringence, and the anisotropy of birefringence alteration in respect of the direction of the strain by using PS-OCT. METHODS: The scleral birefringence of thirty-nine porcine eyes was measured with a prototype PS-OCT. A rectangle strip of sclera with a width of 4 mm was dissected at the temporal region 5 mm apart from the optic nerve head. The strain and force were measured with a uniaxial tension tester as the sample was stretched with a speed of 1.8 mm/min after preconditioning. The birefringence of the sample was measured by PS-OCT at the center of the sample before applying, denoted as inherent birefringence, and after applying stretching of 6.5% strain. The birefringence alteration was obtained by these two measurements and correlations between birefringence and elastic parameters, tangent modulus, and structural stiffness were examined. Twenty and 19 porcine eyes were stretched in meridional or equatorial directions, respectively. RESULTS: A moderate positive correlation was found between the inherent birefringence and the structural stiffness. A moderate positive correlation was also found between the inherent birefringence and the tangent modulus. The birefringence increased by strains. Marginal significance was found in the birefringence alteration between meridional and equatorial strains, where the mean birefringence elevation by meridional strain was higher than that by equatorial strain. CONCLUSIONS: The birefringence was found to be altered by applying strain and also be related with inherent birefringence. This implies the birefringence of the sclera of the in vivo eye also could be affected by its mechanical property.

  1. Astrophysical limits on quantum gravity motivated birefringence

    CERN Document Server

    Gleiser, R J; Gleiser, Reinaldo J.; Kozameh, Carlos N.

    2001-01-01

    We obtain observational upper bounds on a class of quantum gravity related birefringence effects, by analyzing the presence of linear polarization in the optical and ultraviolet spectrum of some distant sources. In the notation of Gambini and Pullin we find $\\chi < 10^{-3}$.

  2. Temperature Dependence of Photoinduced Birefringence in an Azobenzene Polymer

    Institute of Scientific and Technical Information of China (English)

    XU Hong-Tao; WANG Chang-Shun; PAN Xu; ZHANG Xiao-Qiang; WANG Chuan-Yu; SUN Cun-Ying

    2007-01-01

    The photoinduced birefringence in an azobenzene polymer is investigated at different temperatures between -20℃ to 50℃. It is found that there is a peak value of photoinduced birefringence in the temperature dependence of the photoinduced birefringence under a certain pumping intensity. With the pump light in 90 mW/cm2,the peak value of the photoinduced birefringence appeared at about 0℃. The effect of temperature on the photoinduced birefringence is discussed using the competition mechanism between the photoinduced reorientation and the thermal random motion.

  3. Vacuum birefringence in strong inhomogeneous electromagnetic fields

    CERN Document Server

    Karbstein, Felix; Reuter, Maria; Zepf, Matt

    2015-01-01

    Birefringence is one of the fascinating properties of the vacuum of quantum electrodynamics (QED) in strong electromagnetic fields. The scattering of linearly polarized incident probe photons into a perpendicularly polarized mode provides a distinct signature of the optical activity of the quantum vacuum and thus offers an excellent opportunity for a precision test of non-linear QED. Precision tests require accurate predictions and thus a theoretical framework that is capable of taking the detailed experimental geometry into account. We derive analytical solutions for vacuum birefringence which include the spatio-temporal field structure of a strong optical pump laser field and an x-ray probe. We show that the angular distribution of the scattered photons depends strongly on the interaction geometry and find that scattering of the perpendicularly polarized scattered photons out of the cone of the incident probe x-ray beam is the key to making the phenomenon experimentally accessible with the current generatio...

  4. Vacuum Birefringence as a Vacuum Emission Process

    CERN Document Server

    Karbstein, Felix

    2015-01-01

    We argue that the phenomenon of vacuum birefringence in strong inhomogeneous electromagnetic fields can be most efficiently analyzed in terms of a vacuum emission process. In this contribution, we exemplarily stick to the case of vacuum birefringence in a stationary perpendicularly directed, purely magnetic background field extending over a finite spatial extent. Similar field configurations are realized in the BMV and PVLAS experiments. We demonstrate that we can reproduce the conventional constant field result. Our focus is on effects which arise when the probe photons originate in the field free region, are directed towards the magnetic field region, and detected well after the interaction with the magnetic field has taken place, again at zero field.

  5. Magnetic Linear Birefringence Measurements Using Pulsed Fields

    CERN Document Server

    Berceau, Paul; Battesti, Remy; Rizzo, Carlo

    2011-01-01

    In this paper we present the accomplishment of the further step towards the vacuum magnetic birefringence measurement based on pulsed fields. After describing our BMV experiment, we report the calibration of our apparatus with nitrogen gas and we discuss the precision of our measurement giving a detailed error budget. Our best present vacuum sensitivity is 2.1x 10^-19 T^-2 per 5 ms magnetic pulse. We finally discuss the perspectives to reach our final goal.

  6. Reconsidering the origins of Forsbergh birefringence patterns

    Science.gov (United States)

    Schilling, A.; Kumar, A.; McQuaid, R. G. P.; Glazer, A. M.; Thomas, P. A.; Gregg, J. M.

    2016-07-01

    In 1949, Forsbergh, Jr. reported spontaneous spatial ordering in the birefringence patterns seen in flux-grown BaTi O3 crystals under the transmission polarized light microscope [Phys. Rev. 76, 1187 (1949), 10.1103/PhysRev.76.1187]. Stunningly regular square-net arrays were often only found within a finite temperature window and could be induced on both heating and cooling, suggesting genuine thermodynamic stability. At the time, Forsbergh rationalized the patterns to have resulted from the impingement of ferroelastic domains, creating a complex tessellation of variously shaped domain packets. However, no direct evidence for the intricate microstructural arrangement proposed by Forsbergh has subsequently been found. Moreover, there are no robust thermodynamic arguments to explain the finite region of thermal stability, its occurrence just below the Curie temperature, and the apparent increase in entropy associated with the loss of the Forsbergh pattern on cooling. Despite decades of research on ferroelectrics, this ordering phenomenon and its thermodynamic origin have hence remained a mystery. In this paper, we reexamine the microstructure of flux-grown BaTi O3 crystals, which show Forsbergh birefringence patterns. Given an absence of any obvious arrays of domain polyhedra or even regular shapes of domain packets, we suggest an alternative origin for the Forsbergh pattern in which sheets of orthogonally oriented ferroelastic stripe domains simply overlay one another. We show explicitly that the Forsbergh birefringence pattern occurs if the periodicity of the stripe domains is above a critical value. Moreover, by considering well-established semiempirical models, we show that the significant domain coarsening needed to generate the Forsbergh birefringence is fully expected in a finite window below the Curie temperature. We hence present a much more straightforward rationalization of the Forsbergh pattern than that originally proposed in which exotic thermodynamic

  7. Transient birefringence effects in electromagnetically induced transparency

    Energy Technology Data Exchange (ETDEWEB)

    Parshkov, O M [Yuri Gagarin State Technical University of Saratov, Saratov (Russian Federation)

    2015-11-30

    We report the results of numerical modelling of transient birefringence that arises as a result of electromagnetically induced transparency on degenerate quantum transitions between the states with J = 0, 1 and 2 in the presence of the Doppler broadening of spectral lines. It is shown that in the case of a linearly polarised control field, the effect of transient birefringence leads to a decay of the input circularly polarised probe pulse into separate linearly polarised pulses inside a medium. In the case of a circularly polarised control field, the effect of transient birefringence manifests itself in a decay of the input linearly polarised probe pulse into separate circularly polarised pulses. It is shown that the distance that a probe pulse has to pass in a medium before decaying into subpulses is considerably greater in the first case than in the second. The influence of the input probe pulse power and duration on the process of spatial separation into individual pulses inside a medium is studied. A qualitative analysis of the obtained results is presented. (nonlinear optical phenomena)

  8. The PVLAS experiment: measuring vacuum magnetic birefringence and dichroism with a birefringent Fabry-Perot cavity

    CERN Document Server

    Della Valle, F; Ejlli, A; Gastaldi, U; Messineo, G; Zavattini, G; Pengo, R; Ruoso, G

    2015-01-01

    Vacuum magnetic birefringence was predicted long time ago and is still lacking a direct experimental confirmation. Several experimental efforts are striving to reach this goal, and the sequence of results promises a success in the next few years. This measurement generally is accompanied by the search for hypothetical light particles that couple to two photons. The PVLAS experiment employs a sensitive polarimeter based on a high finesse Fabry-Perot cavity. In this paper we report on the latest experimental results of this experiment. The data are analysed taking into account the intrinsic birefringence of the dielectric mirrors of the cavity. Besides the limit on the vacuum magnetic birefringence, the measurements also allow the model-independent exclusion of new regions in the parameter space of axion-like and milli-charged particles. In particular, these last limits hold also for all types of neutrinos, resulting in a laboratory limit on their charge.

  9. The PVLAS experiment: measuring vacuum magnetic birefringence and dichroism with a birefringent Fabry-Perot cavity

    Energy Technology Data Exchange (ETDEWEB)

    Della Valle, Federico; Milotti, Edoardo [INFN, Trieste (Italy); Universita di Trieste, Dipt. di Fisica, Trieste (Italy); Ejlli, Aldo; Messineo, Giuseppe; Zavattini, Guido [INFN, Ferrara (Italy); Universita di Ferrara, Dipt. di Fisica e Scienze della Terra, Ferrara (Italy); Gastaldi, Ugo [INFN, Ferrara (Italy); Pengo, Ruggero; Ruoso, Giuseppe [INFN, Lab. Nazionale di Legnaro, Legnaro (Italy)

    2016-01-15

    Vacuum magnetic birefringence was predicted long time ago and is still lacking a direct experimental confirmation. Several experimental efforts are striving to reach this goal, and the sequence of results promises a success in the next few years. This measurement generally is accompanied by the search for hypothetical light particles that couple to two photons. The PVLAS experiment employs a sensitive polarimeter based on a high finesse Fabry-Perot cavity. In this paper we report on the latest experimental results of this experiment. The data are analysed taking into account the intrinsic birefringence of the dielectric mirrors of the cavity. Besides a new limit on the vacuum magnetic birefringence, the measurements also allow the model-independent exclusion of new regions in the parameter space of axion-like and milli-charged particles. In particular, these last limits hold also for all types of neutrinos, resulting in a laboratory limit on their charge. (orig.)

  10. Nonlinear pulse propagation in birefringent fiber Bragg gratings.

    Science.gov (United States)

    Pereira, S; Sipe, J

    1998-11-23

    We present two sets of equations to describe nonlinear pulse propagation in a birefringent fiber Bragg grating. The first set uses a coupled-mode formalism to describe light in or near the photonic band gap of the grating. The second set is a pair of coupled nonlinear Schroedinger equations. We use these equations to examine viable switching experiments in the presence of birefringence. We show how the birefringence can both aid and hinder device applications.

  11. Birefringence control for ion-exchanged channel glass waveguides.

    Science.gov (United States)

    Ayräs, P; Conti, G N; Honkanen, S; Peyghambarian, N

    1998-12-20

    We show that at 1.55-mum wavelength the waveguide birefringence of ion-exchanged channel waveguides in glass can be broadly tuned by a potassium and silver double-ion exchange. Two different potassium and silver double-ion-exchange processes are used to make surface waveguides with negligible waveguide birefringence. This process is crucially important in the manufacture of devices for dense wavelength-division multiplexing systems. The dependence of the waveguide birefringence on the channel width is also reported.

  12. Influence of Photon Mass on Vacuum Birefringence Experiment

    Institute of Scientific and Technical Information of China (English)

    CHEN Min; SHAO Cheng-Gang

    2007-01-01

    Influence of photon mass on vacuum birefringence experiment is analysed according to the nonlinearities of vacuum quantum electrodynamics for the light propagation through an intense electromagnetic field.It is shown that although the photon mass will cause a change of the refractive indices n⊥ and n(‖) of vacuum birefringence,the difference n(‖)-n⊥is unchanged,which means that the effect of photon mass cannot be observed in vacuum birefringence experiment.

  13. Detecting strain in birefringent materials using spectral polarimetry

    Science.gov (United States)

    Ragucci, Anthony J. (Inventor); Cisar, Alan J. (Inventor); Huebschman, Michael L. (Inventor); Garner, Harold R. (Inventor)

    2010-01-01

    A method, computer program product and system for analyzing multispectral images from a plurality of regions of birefringent material, such as a polymer film, using polarized light and a corresponding polar analyzer to identify differential strain in the birefringent material. For example, the birefringement material may be low-density polyethylene (LDPE), high-density polyethylene (HDPE), polypropylene, polyethylene terephthalate (PET), polyvinyl chloride (PVC), polyvinylidene chloride, polyester, nylon, or cellophane film. Optionally, the method includes generating a real-time quantitative strain map.

  14. Transfer matrix for treating stratified media including birefringent crystals.

    Science.gov (United States)

    Essinger-Hileman, Thomas

    2013-01-10

    Birefringent crystals are extensively used to manipulate polarized light. The generalized transfer matrix developed allows efficient calculation of the full polarization state of light transmitted through and reflected by a stack of arbitrarily many discrete layers of isotropic and birefringent materials at any frequency and angle of incidence. The matrix of a uniaxial birefringent crystal with arbitrary rotation is calculated, along with its reduction to the matrix of an isotropic medium. This method is of great practical importance where tight control of systematic effects is needed in optical systems employing birefringent crystals, one example being wave plates used by cosmic microwave background polarimetry with wide field-of-view telescopes.

  15. Transfer matrix for treating stratified media including birefringent crystals

    CERN Document Server

    Essinger-Hileman, Thomas

    2013-01-01

    Birefringent crystals are extensively used to manipulate polarized light. The generalized transfer matrix developed allows efficient calculation of the full polarization state of light transmitted through and reflected by a stack of arbitrarily-many discrete layers of isotropic and birefringent materials at any frequency and angle of incidence. The matrix of a uniaxial birefringent crystal with arbitrary rotation is calculated, along with its reduction to the matrix of an isotropic medium. This method is of great practical importance where tight control of systematic effects is needed in optical systems employing birefringent crystals, one example being wave plates used by cosmic microwave background polarimetry with wide field-of-view telescopes.

  16. Synthesis and Applications of Birefringent Metasurfaces

    CERN Document Server

    Achouri, Karim; Caloz, Christophe

    2016-01-01

    Birefringent metasurfaces are two-dimensional structures capable of independently controlling the amplitude, phase and polarization of orthogonally polarized incident waves. In this work, we propose a in-depth discussion on the mathematical synthesis of such metasurfaces. We compare two methods, one that is rigorous and based on the exact electromagnetic fields involved in the transformation and one that is based on approximate reflection and transmission coefficients. We next validate the synthesis technique in metasurfaces performing the operations of half- and quarter-wave plates, polarization beam splitting and orbital angular momentum multiplexing.

  17. Birefringent non-polarizing thin film design

    Institute of Scientific and Technical Information of China (English)

    QI Hongji; HONG Ruijin; HE Hongbo; SHAO Jianda; FAN Zhengxiu

    2005-01-01

    In this paper, 2×2 characteristic matrices of uniaxially anisotropic thin film for extraordinary and ordinary wave are deduced at oblique incidence. Furthermore, the reflectance and transmittance of thin films are calculated separately for two polarizations, which provide a new concept for designing non-polarizing thin films at oblique incidence. Besides, using the multilayer birefringent thin films, non-polarizing designs, such as beam splitter thin film at single wavelength, edge filter and antireflection thin film over visible spectral region are obtained at oblique incidence.

  18. Birefringent thin films and polarizing elements

    CERN Document Server

    Hodgkinson, Ian J

    1997-01-01

    This book describes the propagation of light in biaxial media, the properties of biaxial thin films, and applications such as birefringent filters for tuning the wavelength of dye lasers.A novel feature of the first part is the parallel treatment of Stokes, Jones, and Berreman matrix formalisms in a chapter-by-chapter development of wave equations, basis vectors, transfer matrices, reflection and transmission equations, and guided waves. Computational tools for MATLAB are included.The second part focuses on an emerging planar technology in which anisotropic microstructures are formed by obliqu

  19. Sensing characteristics of birefringent microstructured polymer optical fiber

    DEFF Research Database (Denmark)

    Szczurowski, Marcin K.; Frazao, Orlando; Baptista, J. M.;

    2011-01-01

    We experimentally studied several sensing characteristics of a birefringent microstructured polymer optical fiber. The fiber exhibits a birefringence of the order 2×10-5 at 1.3 μm because of two small holes adjacent to the core. In this fiber, we measured spectral dependence of phase and group mo...

  20. Sensing characteristics of birefringent microstructured polymer optical fiber

    DEFF Research Database (Denmark)

    Szczurowski, Marcin K.; Frazao, Orlando; Baptista, J. M.

    2011-01-01

    We experimentally studied several sensing characteristics of a birefringent microstructured polymer optical fiber. The fiber exhibits a birefringence of the order 2×10-5 at 1.3 μm because of two small holes adjacent to the core. In this fiber, we measured spectral dependence of phase and group mo...

  1. Note: Ultra-low birefringence dodecagonal vacuum glass cell

    Energy Technology Data Exchange (ETDEWEB)

    Brakhane, Stefan, E-mail: brakhane@iap.uni-bonn.de; Alt, Wolfgang; Meschede, Dieter; Robens, Carsten; Moon, Geol; Alberti, Andrea [Institut für Angewandte Physik, Universität Bonn, Wegelerstr. 8, D-53115 Bonn (Germany)

    2015-12-15

    We report on an ultra-low birefringence dodecagonal glass cell for ultra-high vacuum applications. The epoxy-bonded trapezoidal windows of the cell are made of SF57 glass, which exhibits a very low stress-induced birefringence. We characterize the birefringence Δn of each window with the cell under vacuum conditions, obtaining values around 10{sup −8}. After baking the cell at 150 °C, we reach a pressure below 10{sup −10} mbar. In addition, each window is antireflection coated on both sides, which is highly desirable for quantum optics experiments and precision measurements.

  2. Dichroic rugate filters based on birefringent porous silicon.

    Science.gov (United States)

    Ishikura, Nobuyuki; Fujii, Minoru; Nishida, Kohei; Hayashi, Shinji; Diener, Joachim

    2008-09-29

    Rugate filters made of anisotropically nanostructured birefringent silicon have been fabricated and studied by polarization-resolved transmission measurements. Electrochemical etching of a (110) oriented Si wafer results in porous silicon layers which exhibit a strong in-plane birefringence. We demonstrate that a sinusoidal refractive index variation of birefringent porous silicon combined with index-matching layers and apodization results in a dichroic rugate filter having a stop-band dependent on the polarization direction of the incident light without higher-order harmonics and sidelobes. We also demonstrate that the combination of different dichroic rugate filters allow us to realize filters with more complex properties in a single preparation step.

  3. High Frequency Modulation Method for Measuring of Birefringence

    Directory of Open Access Journals (Sweden)

    Šulc M.

    2013-05-01

    Full Text Available A method of optical birefringence measurement is presented. It uses an el ectro-optic modulator for the high frequency modulation of polarization of the laser beam. The developed optical apparatus exhibits high sensitivity. It is able to measure very small birefringence of samples down to 10-3 rad. The accuracy and sensitivity of the method was checked by measurement of calibrated Sol eil – Babi net compensator. Method can be also used for online and accurate measurement of an optical components birefringence. This application was developed with the aim to measure Cotton-Mouton effect in air and nitrogen.

  4. On the existence of Jones birefringence and Jones dichroism.

    Science.gov (United States)

    Arteaga, Oriol

    2010-05-01

    We claim that the so-called Jones birefringence and Jones dichroism effects, understood as new optical phenomena of difficult experimental observation, cannot be deduced from Jones publications and were proposed due to a misinterpretation of his original work.

  5. Propagation stability of a chirped soliton in birefringent fibers

    Energy Technology Data Exchange (ETDEWEB)

    Zheng Hongjun; Wu Chongqing [School of Science, Beijing Jiaotong University, Beijing 100044 (China); Liu Shanliang; Li Xin, E-mail: zhj@lcu.edu.cn, E-mail: hjzheng@yahoo.com [Institute of Optical Communication, Liaocheng University, Liaocheng Shandong, 252059 (China)

    2011-02-01

    The propagation stability of a chirped soliton at anomalous dispersion region in birefringent fibers is numerically studied by using the split-step Fourier-method. It is found that initial linear chirp can change obviously the threshold value A{sub th} above which soliton stably propagates in birefringent fibers, the A{sub th} increases with the decrease of the polarization angle | /4- |. The positive chirp makes obviously the A{sub th} smaller for group velocity mismatch parameter >0.5, the negative one makes the A{sub th} larger for <0.5. The effect of initial positive chirp on the A{sub th} is greater than that of negative chirp for high birefringent fibers, is less than that of negative chirp for low birefringent fibers.

  6. Angular tuning of the magnetic birefringence in rippled cobalt films

    Energy Technology Data Exchange (ETDEWEB)

    Arranz, Miguel A., E-mail: MiguelAngel.Arranz@uclm.es [Facultad de Ciencias y Tecnologías Químicas, Universidad de Castilla-La Mancha, Avda. Camilo J. Cela 10, 13071 Ciudad Real (Spain); Colino, José M. [Instituto de Nanociencia, Nanotecnología y Materiales Moleculares, Universidad de Castilla-La Mancha, Campus de la Fábrica de Armas, 45071 Toledo (Spain)

    2015-06-22

    We report the measurement of magnetically induced birefringence in rippled Co films. For this purpose, the magneto-optical properties of ion beam eroded ferromagnetic films were studied using Kerr magnetometry and magnetic birefringence in the transmitted light intensity. Upon sufficient ion sculpting, these ripple surface nanostructures developed a defined uniaxial anisotropy in the in-plane magnetization, finely tuning the magnetic birefringence effect. We have studied its dependence on the relative orientation between the ripple direction and the magnetic field, and found this effect to be dramatically correlated with the capability to neatly distinguish the mechanisms for the in-plane magnetization reversal, i.e., rotation and nucleation. This double refraction corresponds univocally to the two magnetization axes, parallel and perpendicular to the ripples direction. We have also observed that tuned birefringence in stack assemblies of rippled Co films, which enables us to technically manipulate the number and direction of refraction axes.

  7. Birefringent Microlens Array for Ultra High Resolution HMDs Project

    Data.gov (United States)

    National Aeronautics and Space Administration — This Small Business Innovation Research Phase I project will be used to analyze, design, model, and test a birefringent microlens array for use in a new type of...

  8. Singular optical manipulation of birefringent elastic media using nonsingular beams.

    Science.gov (United States)

    Brasselet, Etienne

    2009-10-15

    It is shown that nonsingular light beams can generate singular birefringent patterns in homogeneous birefringent elastic media. These orientational defects of the optical-axis spatial distribution originate from an optical torque driven by a nonzero longitudinal field component. Singular radial and spin-dependent azimuthal light-induced elastic distortion patterns are described and experimentally observed in a uniform liquid-crystal film in the course of a focused circularly polarized Gaussian beam.

  9. Form Birefringence in Thin Films with Oblique Columnar Structures

    Institute of Scientific and Technical Information of China (English)

    WANG Jian-Guo; SHAO Jian-Da; WANG Su-Mei; HE Hong-Bo; FAN Zheng-Xiu

    2005-01-01

    @@ Effective medium theory is useful for designing optical elements with form birefringent subwavelength structures. Thinfilms fabricated by oblique deposition are similar to the two-dimensional surface relief subwavelength gratings. We use the effective medium theory to calculate the anisotropic optical properties of the thin films with oblique columnar structures. The effective refractive indices and the directions are calculated from effective medium theory. It is shown that optical thin films with predetermined refractive indices and birefringence may be engineered.

  10. Quantifying strain birefringence halos around inclusions in diamond

    Science.gov (United States)

    Howell, D.; Wood, I. G.; Dobson, D. P.; Jones, A. P.; Nasdala, L.; Harris, J. W.

    2010-11-01

    The pressure and temperature conditions of formation of natural diamond can be estimated by measuring the residual stress that an inclusion remains under within a diamond. Raman spectroscopy has been the most commonly used technique for determining this stress by utilising pressure-sensitive peak shifts in the Raman spectrum of both the inclusion and the diamond host. Here, we present a new approach to measure the residual stress using quantitative analysis of the birefringence induced in the diamond. As the analysis of stress-induced birefringence is very different from that of normal birefringence, an analytical model is developed that relates the spherical inclusion size, R i, host diamond thickness, L, and measured value of birefringence at the edge of the inclusion, Updelta n(R_{text{i}} )_{text{av}} , to the peak value of birefringence that has been encountered; to first order Updelta n_{text{pk}} = (3/4)(L/R_{text{i}} ) Updelta n(R_{text{i}} )_{text{av}} . From this birefringence, the remnant pressure ( P i) can be calculated using the photoelastic relationship Updelta n_{text{pk}} = - (3/4)n3 q_{text{iso}} P_{text{i}} , where q iso is a piezo-optical coefficient, which can be assumed to be independent of crystallographic orientation, and n is the refractive index of the diamond. This model has been used in combination with quantitative birefringence analysis with a MetriPol system and compared to the results from both Raman point and 2D mapping analysis for a garnet inclusion in a diamond from the Udachnaya mine (Russia) and coesite inclusions in a diamond from the Finsch mine (South Africa). The birefringence model and analysis gave a remnant pressure of 0.53 ± 0.01 GPa for the garnet inclusion, from which a source pressure was calculated as 5.7 GPa at 1,175°C (temperature obtained from IR analysis of the diamond host). The Raman techniques could not be applied quantitatively to this sample to support the birefringence model; they were, however, applied

  11. Improved eye-fixation detection using polarization-modulated retinal birefringence scanning, immune to corneal birefringence.

    Science.gov (United States)

    Irsch, Kristina; Gramatikov, Boris I; Wu, Yi-Kai; Guyton, David L

    2014-04-07

    We present an improved method for remote eye-fixation detection, using a polarization-modulated approach to retinal birefringence scanning (RBS), without the need for individual calibration or separate background measurements and essentially independent of corneal birefringence. Polarization-modulated RBS detects polarization changes generated in modulated polarized light passing through a unique pattern of nerve fibers identifying and defining the retinal region where fixation occurs (the fovea). A proof-of-concept demonstration in human eyes suggests that polarization-modulated RBS has the potential to reliably detect true foveal fixation on a specified point with an accuracy of at least ± 0.75°, and that it can be applied to the general population, including individuals with sub-optimal eyes and young children, where early diagnosis of visual problems can be critical. As could be employed in an eye-controlled display or in other devices, polarization-modulated RBS also enables and paves the way for new and reliable eye-fixation-evoked human-machine interfaces.

  12. Optical rheology of porcine sclera by birefringence imaging.

    Directory of Open Access Journals (Sweden)

    Masahiro Yamanari

    Full Text Available PURPOSE: To investigate a relationship between birefringence and elasticity of porcine sclera ex vivo using polarization-sensitive optical coherence tomography (PS-OCT. METHODS: Elastic parameters and birefringence of 19 porcine eyes were measured. Four pieces of scleral strips which were parallel to the limbus, with a width of 4 mm, were dissected from the optic nerve head to the temporal side of each porcine eye. Birefringence of the sclera was measured with a prototype PS-OCT. The strain and force were measured with a uniaxial material tester as the sample was stretched with a speed of 1.8 mm/min after preconditioning. A derivative of the exponentially-fitted stress-strain curve at 0% strain was extracted as the tangent modulus. Power of exponential stress-strain function was also extracted from the fitting. To consider a net stiffness of sclera, structural stiffness was calculated as a product of tangent modulus and thickness. Correlations between birefringence and these elastic parameters were examined. RESULTS: Statistically significant correlations between birefringence and all of the elastic parameters were found at 2 central positions. Structural stiffness and power of exponential stress-strain function were correlated with birefringence at the position near the optic nerve head. No correlation was found at the position near the equator. CONCLUSIONS: The evidence of correlations between birefringence and elasticity of sclera tested uniaxially was shown for the first time. This work may become a basis for in vivo measurement of scleral biomechanics using PS-OCT.

  13. Terahertz generation by optical rectification in uniaxial birefringent crystals

    Science.gov (United States)

    Rowley, J. D.; Wahlstrand, J. K.; Zawilski, K. T.; Schunemann, P. G.; Giles, N. C.; Bristow, A. D.

    2012-07-01

    The angular dependence of terahertz (THz) emission from birefringent crystals can differ significantly from that of cubic crystals. Here we consider optical rectification in uniaxial birefringent materials, such as chalcopyrite crystals. The analysis is verified in (110)-cut ZnGeP_2 and compared to (zincblende) GaP. Although the crystals share the same nonzero second-order tensor elements, the birefringence in chalcopyrite crystals cause the pump pulse polarization to evolve as it propagates through the crystal, resulting in a drastically different angular dependence in chalcopyrite crystals. The analysis is extended to {012}- and {114}-cut chalcopyrite crystals and predicts more efficient conversion for the {114} crystal cut over the {012}- and {110}-cuts.

  14. Vacuum magnetic linear birefringence using pulsed fields: the BMV experiment

    CERN Document Server

    Cadène, A; Fouché, M; Battesti, R; Rizzo, C

    2013-01-01

    In this letter we present the measurement of the vacuum magnetic birefringence obtained using the first generation setup of the BMV experiment. In particular, we detail our procedure of data acquisition and our analysis which takes into account the symmetry properties of raw data with respect to the orientation of the magnetic field and the sign of the cavity birefringence. Our current value of vacuum magnetic linear birefringence k_CM was obtained with about 100 magnetic pulses and a maximum field of 6.5 T. We get k_CM = (-7.4 \\pm 8.7).10^{-21} T^{-2} at 3 sigma confidence level. Our result is a clear validation of our innovative experimental method.

  15. Gauge-origin independent calculations of Jones birefringence

    Science.gov (United States)

    Shcherbin, Dmitry; Thorvaldsen, Andreas J.; Jonsson, Dan; Ruud, Kenneth

    2011-10-01

    We present the first gauge-origin independent formulation of Jones birefringence at the Hartree-Fock level of theory. Gauge-origin independence is achieved through the use of London atomic orbitals. The implementation is based on a recently proposed atomic orbital-based response theory formulation that allows for the use of both time- and perturbation-dependent basis sets [Thorvaldsen, Ruud, Kristensen, Jørgensen, and Coriani, J. Chem. Phys. 129, 214108 (2008)]. We present the detailed expressions for the response functions entering the Jones birefringence when London atomic orbitals are used. The implementation is tested on a set of polar and dipolar molecules at the Hartree-Fock level of theory. It is demonstrated that London orbitals lead to much improved basis-set convergence, and that the use of small, conventional basis sets may lead to the wrong sign for the calculated birefringence. For large basis sets, London orbitals and conventional basis sets converge to the same results.

  16. Highly Nonlinear and Birefringent Spiral Photonic Crystal Fiber

    Directory of Open Access Journals (Sweden)

    S. Revathi

    2014-01-01

    Full Text Available We propose and design a spiral photonic crystal fiber with elliptical air holes for achieving high birefringence, large nonlinearity, and negative dispersion. The structure is designed using chalcogenide glass (As2S3 for different ellipticity ratios of air holes in the cladding and the effect on various properties is observed. The proposed structure has birefringence of the order 10−2, nonlinearity of 26739.42 W−1 m−1, and dispersion of −1136.69 at 0.85 μm. An accurate numerical approach based on finite element method is used for the design and simulation of the structure. Due to high birefringence and negative dispersion, the proposed structure can be used for polarization control and dispersion compensation, respectively.

  17. Flow birefringence of a triblock copolymer in steady shear flow

    Energy Technology Data Exchange (ETDEWEB)

    Osaki, Kunihiro; Takatori, Eiichi

    1988-06-20

    Because the stress-optical law was estimated not to be valid in triblock copolymer, informations on molecular motion can be obtained by studying the discrepancy from stress-optical law. The relatioship between the stress and birefringence for a triblock copolymer was investigated in steady shear flow. It was verified experimentally the discrepancy from the stress-optical law, change of macroscopic stress deviation coefficient and normal stress deviation coefficient due to shear rate, and the difference of average stress-optical coefficients calculated from the compoments. These features of birefringence proved that the contribution to stress of a polymer segment depended on its position along the chain and was larger as it was closer the center of the chain. This was useful to investigate the relaxation behavior of birefringence after the steplike shear deformation, as well as the motion of polymer chain. (4 figs, 1 tab, 11 refs)

  18. Estimation of the Birefringence Change in Crystals Induced by Gravitation Field

    OpenAIRE

    Vlokh R.; Kostyrko M.

    2007-01-01

    The effect of gravitation field of spherically symmetric mass on the birefringent properties of crystals has been analysed. It has been shown that the gravitation field with spherical symmetry can lead to a change of birefringence in anisotropic media.

  19. Electric birefringence anomaly of solutions of ionically charged anisometric particles.

    Science.gov (United States)

    Hoffmann, H; Gräbner, Dieter

    2015-02-01

    The term "electric birefringence anomaly" is known as the electric birefringence (EB) signal that occurs in solutions of ionically charged anisometric particles in a narrow concentration region. The signal is of opposite sign to the normal birefringence that occurs below and above this narrow concentration region. The normal electric birefringence signals in the dilute and more concentrated regions are due to the orientation of the particles in the direction of the applied electric field. The origin for the anomalous signal was not completely understood until now. The article summarises previous results in which the anomalous results had been observed but not well understood. It shows that the birefringence anomaly occurs in systems as diverse as micellar solutions, polyelectrolytes, solutions of clays, viruses and fibres. In all these systems the anomaly signals are present at the concentration when the length of the colloidal particles including the thickness of the electric double layer are about the same as the mean distance between the colloidal particles. Under these conditions the electric double layers of the particles overlap along the main axis of the particles but not in the direction across the particles. As a consequence of this situation a dipole is built up across the particles by the migration of the counter-ions of the particles in the electric field and this dipole leads to an orientation of the particles perpendicular to the electric field. The anomalous signal can usually be observed simultaneously with the normal signal. The amplitude of the anomalous signal can be larger than the amplitude of the normal signal. As a consequence the total birefringence changes its sign in the anomalous concentration region. The anomaly signal of the clays can also be explained by a fluctuating dipole around the particles, which is due to the fact that the centre of the ionic charges of the particles does not fall on the centre of the ionic charge of the counter

  20. Birefringence induced polarization-independent and nearly all-angle transparency through a metallic film

    OpenAIRE

    Gao, Dong-Liang; Gao, Lei; Qiu, Cheng-Wei

    2011-01-01

    We propose an birefringence route to perfect electromagnetic (EM) wave tunneling through a metallic film which relies on homogeneous birefringent coatings with moderate and positive parameters only. EM transparency is achieved in such an birefringent-metal-birefringent (BMB) structure for both polarizations and over nearly all incident angles. The stringent restrictions in conventional dielectric-metal-dielectric media, i.e., dielectrics with extremely negative permittivity, high magnetic fie...

  1. Tightly Focusing of Circularly Polarized Vortex Beams through a Uniaxial Birefringent Crystal

    Institute of Scientific and Technical Information of China (English)

    RAO Lian-Zhou; WANG Zong-Chi; ZHENG Xiao-Xia

    2008-01-01

    Under the approximation of small birefringence, the properties of circalarly polarized vortex beams tightly focused through a uniaxial birefringent crystal are studied. With the proper combination of the topological charge and the birefringence, the small focus, the small bottle beam and the inverse c-shaped intensity profile can be obtained.The effects of the focal shift and the Strehl ratio on the birefringence are analysed. A relation between angular momentum (included spin and orbital) and topological Pancharatnam charge is also presented.

  2. A birefringent cavity He-Ne laser and optical feedback

    Institute of Scientific and Technical Information of China (English)

    Liu Gang; Zhang Shu-Lian; Li Yan; Zhu Jun

    2004-01-01

    Strong modes competition makes only one of o-light and e-light oscillate in a birefringent dual-frequency laser when the angle between the crystalline axis and the laser beam is nearly zero. When the oscillated mode is in a different part of the gain curve, the detected intensity curves of o-light and e-light are quite different in the existence of optical feedback. The curves are divided into five cases. Three cases of the experimental results can be used for direction discrimination. The polarization characteristics of the birefringent cavity He-Ne laser are also discussed without optical feedback.

  3. Ultraviolet-induced birefringence in hydrogen-loaded optical fiber

    DEFF Research Database (Denmark)

    Canning, John; Deyerl, Hans-Jürgen; Sørensen, Henrik Rokkjær

    2005-01-01

    for the role of hydrogen and deuterium in the UV-induced process. Previous arguments for the origins are systematically ruled out by reviewing existing literature. We note that the birefringence is made up of at least two components with different thermal stabilities, one consistent simply with molecular...... hydrogen being present in the system. Overall the birefringence, by deduction, is associated with anisotropy in hydrogen reactions within the fiber. As a result they lead, through known mechanisms of dilation in glass, to anisotropic stress relaxation that can be annealed out, with or without hydrogen...

  4. A Simple Birefringent Terahertz Waveguide Based on Polymer Elliptical Tube

    Institute of Scientific and Technical Information of China (English)

    WANG Jing-Li; YAO Jian-Quan; CHEN He-Ming; LI Zhong-Yang

    2011-01-01

    We propose a simple birefringent terahertz (THz) waveguide which is a polymer elliptical tube with a cross section of elliptical ring structure. It can be achieved by stretching a normal circular-tube in one direction. Simulations based on the full-vector finite element method (FEM) show that this kind of waveguides exhibits high birefringence on a level of 10-2 over a wide THz frequency range. Moreover, as a majority of modal power is trapped in the air core inside the polymer elliptical tube, the THz waveguide guiding loss caused by material absorption can be reduced effectively.

  5. Zero-field birefringence of biocompatible magnetic fluids: A concentration dependence investigation

    Energy Technology Data Exchange (ETDEWEB)

    Eloi, Marcos T.A. [Universidade de Brasilia, Instituto de Fisica, Nucleo de Fisica Aplicada, 70919-970, Brasilia - DF (Brazil); Azevedo, Ricardo B. [Departamento de Genetica e Morfologia, Universidade de Brasilia, Instituto de Ciencias Biologicas, 70910-900, Brasilia - DF (Brazil); Lima, Emilia C.D. [Universidade Federal de Goias, Instituto de Quimica, 74001-970, Goiania - GO (Brazil); Pimenta, Angela C.M. [Universidade Federal de Goias, Instituto de Quimica, 74001-970, Goiania - GO (Brazil); Morais, Paulo C. [Universidade de Brasilia, Instituto de Fisica, Nucleo de Fisica Aplicada, 70919-970, Brasilia - DF (Brazil)]. E-mail: pcmor@unb.br

    2005-05-15

    Zero-field birefringence was used to investigate maghemite-based biocompatible magnetic fluids surface-coated with citrate. The model used to analyze the birefringence signal considers the dipolar magnetic interaction among dimers and the onset of a nematic phase near the sample holder surface. The data show that zero-field birefringence grows with sample dilution.

  6. Chirped Optical Solitons in Single-mode Birefringent Fibers.

    Science.gov (United States)

    Mahmood, M F

    1996-12-01

    The trapping behavior of two chirped solitons forming a bound state in a single-mode birefringent fiber is investigated on the basis of a model of coupled nonlinear Schroedinger equations. The positive initial chirp plays an important role in controlling the threshold amplitude for soliton trapping without causing excessive pulse broadening.

  7. Optical dynamical processing: an approach using birefringent pupils.

    Science.gov (United States)

    Trivi, M; Sicre, E E; Rabal, H J; Garavaglia, M J

    1988-04-01

    A new technique is proposed to perform several image-processing operations with the same optical system. Each operation can easily be selected by properly loading a birefringent photoelastic plate, which acts as the spatial filter of the-system. Thus different pupil transmittance configurations can be achieved, each of which is associated with a certain image transformation.

  8. Highly Birefringent Photonic Crystal Fibers BUsing Asymmetric Core Design

    Institute of Scientific and Technical Information of China (English)

    Zhao Chun-Liu; Lu Chao; Yan Min; Wang Xiaoyan; Lou Junjun; Li Qin; Zhou Xiaoqun; Cai Qing; P.R.Chaudhuri

    2003-01-01

    We demonstrate a highly birefringent photonic crystal fiber by utilizing the asymmetric core design. Based on spectral measurements of the polarization mode interfering, we estimate that the fiber has a beat length of about 0.33 mm at 1545 nm.

  9. Birefringence and noncommutative structure of space-time

    Energy Technology Data Exchange (ETDEWEB)

    Maceda, Marco, E-mail: mmac@xanum.uam.mx [Departamento de Fisica, Universidad Autonoma Metropolitana-Iztapalapa, A.P. 55-534, C.P. 09340, Mexico D.F. (Mexico); Macias, Alfredo, E-mail: amac@xanum.uam.mx [Departamento de Fisica, Universidad Autonoma Metropolitana-Iztapalapa, A.P. 55-534, C.P. 09340, Mexico D.F. (Mexico)

    2011-11-03

    We analyze the phenomenon of birefringence of the electromagnetic field in the context of noncommutative geometry, using as background a deformed pp-wave solution to noncommutative Einstein's equations. The light-cone structure is determined using a generalized Fresnel equation characterizing the propagation of light in premetric vacuum electrodynamics.

  10. Positive and negative contribution to birefringence in a family of carbonates: A Born effective charges analysis

    Science.gov (United States)

    Jing, Qun; Yang, Guang; Hou, Juan; Sun, Maozhu; Cao, Haibin

    2016-12-01

    It is an important topic to investigate the birefringence and reveal the contribution from ions to birefringence because it plays an important role in nonlinear optical materials. In this paper, the birefringence of carbonates with coplanar CO3 groups were investigated using the first-principles method. The results show that the lead carbonates exhibit relative large birefringence. After detailed investigate the electronic structures, and Born effective charges, the authors find out that anisotropic electron distribution in the CO3 groups and Pb atoms give positive contribution, while the negative contribution was found from fluorine atoms, meanwhile the Ca, Mg, and Cd atoms give very small contribution to birefringence.

  11. One-Dimensional (1-D) Nanoscale Heterostructures

    Institute of Scientific and Technical Information of China (English)

    Guozhen SHEN; Di CHEN; Yoshio BANDO; Dmitri GOLBERG

    2008-01-01

    One-dimensional (1-D) nanostructures have been attracted much attention as a result of their exceptional properties, which are different from bulk materials. Among 1-D nanostructures, 1-D heterostructures with modulated compositions and interfaces have recently become of particular interest with respect to potential applications in nanoscale building blocks of future optoelectronic devices and systems. Many kinds of methods have been developed for the synthesis of 1-D nanoscale heterostructures. This article reviews the most recent development, with an emphasize on our own recent efforts, on 1-D nanoscale heterostructures, especially those synthesized from the vapor deposition methods, in which all the reactive precursors are mixed together in the reaction chamber. Three types of 1-D nanoscale heterostructures, defined from their morphologies characteristics, are discussed in detail, which include 1-D co-axial core-shell heterostructures, 1-D segmented heterostructures and hierarchical heterostructures. This article begins with a brief survey of various methods that have been developed for synthesizing 1-D nanoscale heterostructures and then mainly focuses on the synthesis, structures and properties of the above three types of nanoscale heterostructures. Finally, this review concludes with personal views towards the topic of 1-D nanoscale heterostructures.

  12. Giant Birefringence of Lithium Niobate Crystals in the Terahertz Region

    Institute of Scientific and Technical Information of China (English)

    SUN Yi-Min; MAO Zong-Liang; HOU Bi-Hui; LIU Guo-Qing; WANG Li

    2007-01-01

    Terahertz time-domain spectroscopy (THz-TDS) is used to study the spectral response of lithium niobate crystals (LiNbO3) in the far infrared region. The optical constants are derived from the measured complex refractive index.A giant birefringence is observed in this material, and the average refractive-index difference between the ordinary wave and the extraordinary wave, no - ne, can reach up to about 1.6. Such a large birefringence is attributed to the different phonon modes of A1 (z) and E(x, y). This unusual property makes LiNbO3 a promising material to be used as a functional material in the terahertz region, e.g. Employed as wave-plates and polarization separators.

  13. Birefringence Oscillations In An Organic Guest-Host System

    Science.gov (United States)

    Knabke, Gerhard; Franke, Hilmar; Frank, Werner F.

    1990-01-01

    The nonlinear dye N,N-Dihexyl-4 amino-4-nitrostilbene (DHANS) was incorporated in the polymer matrix of poly(α-methyl-styrene) (Pα MS). Dye concentrations between 1 and 10 weight % were investigated. Bulk samples of DHANS/Pα MS were prepared with a residual solvent content of 5 wt% in an optical cell between electrodes. Solid samples of high viscosity were obtained. Electrooptic measurements were perfomed for DC electric fields up to 30 RV/cm with a HeNe laser. Besides the usual Pockels- and Kerreffect we observed birefringence oscillations. For this experiment the Pα MS matrix has to be in the glass transition region. Parallel to the birefringence oscillations peaks in the DC current were measured. Frequency and amplitude of the oscillations depend on the external electric field. We suggest an interpretation of local discharging due to the anisotropic electrical conductivity of the dye molecules.

  14. POLARBEAR constraints on cosmic birefringence and primordial magnetic fields

    Science.gov (United States)

    Ade, Peter A. R.; Arnold, Kam; Atlas, Matt; Baccigalupi, Carlo; Barron, Darcy; Boettger, David; Borrill, Julian; Chapman, Scott; Chinone, Yuji; Cukierman, Ari; Dobbs, Matt; Ducout, Anne; Dunner, Rolando; Elleflot, Tucker; Errard, Josquin; Fabbian, Giulio; Feeney, Stephen; Feng, Chang; Gilbert, Adam; Goeckner-Wald, Neil; Groh, John; Hall, Grantland; Halverson, Nils W.; Hasegawa, Masaya; Hattori, Kaori; Hazumi, Masashi; Hill, Charles; Holzapfel, William L.; Hori, Yasuto; Howe, Logan; Inoue, Yuki; Jaehnig, Gregory C.; Jaffe, Andrew H.; Jeong, Oliver; Katayama, Nobuhiko; Kaufman, Jonathan P.; Keating, Brian; Kermish, Zigmund; Keskitalo, Reijo; Kisner, Theodore; Kusaka, Akito; Le Jeune, Maude; Lee, Adrian T.; Leitch, Erik M.; Leon, David; Li, Yun; Linder, Eric; Lowry, Lindsay; Matsuda, Frederick; Matsumura, Tomotake; Miller, Nathan; Montgomery, Josh; Myers, Michael J.; Navaroli, Martin; Nishino, Haruki; Okamura, Takahiro; Paar, Hans; Peloton, Julien; Pogosian, Levon; Poletti, Davide; Puglisi, Giuseppe; Raum, Christopher; Rebeiz, Gabriel; Reichardt, Christian L.; Richards, Paul L.; Ross, Colin; Rotermund, Kaja M.; Schenck, David E.; Sherwin, Blake D.; Shimon, Meir; Shirley, Ian; Siritanasak, Praween; Smecher, Graeme; Stebor, Nathan; Steinbach, Bryan; Suzuki, Aritoki; Suzuki, Jun-ichi; Tajima, Osamu; Takakura, Satoru; Tikhomirov, Alexei; Tomaru, Takayuki; Whitehorn, Nathan; Wilson, Brandon; Yadav, Amit; Zahn, Alex; Zahn, Oliver; Polarbear Collaboration

    2015-12-01

    We constrain anisotropic cosmic birefringence using four-point correlations of even-parity E -mode and odd-parity B -mode polarization in the cosmic microwave background measurements made by the POLARization of the Background Radiation (POLARBEAR) experiment in its first season of observations. We find that the anisotropic cosmic birefringence signal from any parity-violating processes is consistent with zero. The Faraday rotation from anisotropic cosmic birefringence can be compared with the equivalent quantity generated by primordial magnetic fields if they existed. The POLARBEAR nondetection translates into a 95% confidence level (C.L.) upper limit of 93 nanogauss (nG) on the amplitude of an equivalent primordial magnetic field inclusive of systematic uncertainties. This four-point correlation constraint on Faraday rotation is about 15 times tighter than the upper limit of 1380 nG inferred from constraining the contribution of Faraday rotation to two-point correlations of B -modes measured by Planck in 2015. Metric perturbations sourced by primordial magnetic fields would also contribute to the B -mode power spectrum. Using the POLARBEAR measurements of the B -mode power spectrum (two-point correlation), we set a 95% C.L. upper limit of 3.9 nG on primordial magnetic fields assuming a flat prior on the field amplitude. This limit is comparable to what was found in the Planck 2015 two-point correlation analysis with both temperature and polarization. We perform a set of systematic error tests and find no evidence for contamination. This work marks the first time that anisotropic cosmic birefringence or primordial magnetic fields have been constrained from the ground at subdegree scales.

  15. Fourier polarimetry of the birefringence distribution of myocardium tissue

    Science.gov (United States)

    Ushenko, O. G.; Dubolazov, O. V.; Ushenko, V. O.; Gorsky, M. P.; Soltys, I. V.; Olar, O. V.

    2015-11-01

    The results of optical modeling of biological tissues polycrystalline multilayer networks have been presented. Algorithms of reconstruction of parameter distributions were determined that describe the linear and circular birefringence. For the separation of the manifestations of these mechanisms we propose a method of space-frequency filtering. Criteria for differentiation of causes of death due to coronary heart disease (CHD) and acute coronary insufficiency (ACI) were found.

  16. Modulation Instabilities in Birefringent Two-Core Optical Fibers

    CERN Document Server

    Li, J H; Malomed, B A; Chow, K W

    2012-01-01

    Previous studies of the modulation instability (MI) of continuous waves (CWs) in a two-core fiber (TCF) did not consider effects caused by co-propagation of the two polarized modes in a TCF that possesses birefringence, such as cross-phase modulation (XPM), polarization-mode dispersion (PMD), and polarization-dependent coupling (PDC) between the cores. This paper reports an analysis of these effects on the MI by considering a linear-birefringence TCF and a circular-birefringence TCF, which feature different XPM coefficients. The analysis focuses on the MI of the asymmetric CW states in the TCFs, which have no counterparts in single-core fibers. We find that, the asymmetric CW state exists when its total power exceeds a threshold (minimum) value, which is sensitive to the value of the XPM coefficient. We consider, in particular, a class of asymmetric CW states that admit analytical solutions. In the anomalous dispersion regime, without taking the PMD and PDC into account, the MI gain spectra of the birefringen...

  17. Spinning wave plate design for retinal birefringence scanning

    Science.gov (United States)

    Irsch, K.; Gramatikov, B. I.; Wu, Y.-K.; Guyton, D. L.

    2009-02-01

    To enhance foveal fixation detection while bypassing the deleterious effects of corneal birefringence in retinal birefringence scanning (RBS), we developed a new RBS design introducing a double-pass spinning half wave plate (HWP) and a fixed double-pass retarder into the optical system. Utilizing the measured corneal birefringence from a data set of 300 human eyes, an algorithm and a related computer program, based on Mueller-Stokes matrix calculus, were developed in MATLAB for optimizing the properties of both wave plates. Foveal fixation detection was optimized with the HWP spun 9/16 as fast as the circular scan, with the fixed retarder having a retardance of 45° and fast axis at 90°. With this new RBS design, a significant statistical improvement of 7.3 times in signal strength, i.e. FFT power, was achieved for the available data set compared with the previous RBS design. The computer-model-optimized RBS design has the potential not only for eye alignment screening, but also for remote fixation sensing and eye tracking applications.

  18. Photoinduced Birefringence in Azo-Dye Doped Polyurethane

    Science.gov (United States)

    Aleksejeva, J.; Gerbreders, A.; Reinfelde, M.; Teteris, J.

    2011-01-01

    In this report we describe a photoinduced birefringence in disperse red (DR1) azo-dye doped polyurethane films. DR1 dye molecules in these films are chemically bound with the polyurethane polymer's main chain. Under laser radiation the DR1 molecules experience the isomerization process; as a result, the dipole moment of such a molecule changes and they align in the presence of electric field. Photo-birefringence was induced by linearly polarized laser radiation (532 nm, 448 nm, 375 nm and 632.8 nm) in the films with various concentrations of DR1 dye. The photo-induced birefringence (PIBR) Δn was measured at 634 nm wavelength, and its dependences on the pumping beam wavelength and intensity were evaluated. The Δn relaxation was studied both in the dark and under light illumi-nation. In DR1-doped polyurethane films the holographic recording was performed using laser light radiation (532 nm). The profile of surface relief grating (SRG) was studied using AFM. The relationship between SRG formation and PIBR is discussed.

  19. POLARBEAR Constraints on Cosmic Birefringence and Primordial Magnetic Fields

    CERN Document Server

    Ade, Peter A R; Atlas, Matt; Baccigalupi, Carlo; Barron, Darcy; Boettger, David; Borrill, Julian; Chapman, Scott; Chinone, Yuji; Cukierman, Ari; Dobbs, Matt; Ducout, Anne; Dunner, Rolando; Elleflot, Tucker; Errard, Josquin; Fabbian, Giulio; Feeney, Stephen; Feng, Chang; Gilbert, Adam; Goeckner-Wald, Neil; Groh, John; Hall, Grantland; Halverson, Nils W; Hasegawa, Masaya; Hattori, Kaori; Hazumi, Masashi; Hill, Charles; Holzapfel, William L; Hori, Yasuto; Howe, Logan; Inoue, Yuki; Jaehnig, Gregory C; Jaffe, Andrew H; Jeong, Oliver; Katayama, Nobuhiko; Kaufman, Jonathan P; Keating, Brian; Kermish, Zigmund; Keskitalo, Reijo; Kisner, Theodore; Kusaka, Akito; Jeune, Maude Le; Lee, Adrian T; Leitch, Erik M; Leon, David; Li, Yun; Linder, Eric; Lowry, Lindsay; Matsuda, Frederick; Matsumura, Tomotake; Miller, Nathan; Montgomery, Josh; Myers, Michael J; Navaroli, Martin; Nishino, Haruki; Okamura, Takahiro; Paar, Hans; Peloton, Julien; Pogosian, Levon; Poletti, Davide; Puglisi, Giuseppe; Raum, Christopher; Rebeiz, Gabriel; Reichardt, Christian L; Richards, Paul L; Ross, Colin; Rotermund, Kaja M; Schenck, David E; Sherwin, Blake D; Shimon, Meir; Shirley, Ian; Siritanasak, Praween; Smecher, Graeme; Stebor, Nathan; Steinbach, Bryan; Suzuki, Aritoki; Suzuki, Jun-ichi; Tajima, Osamu; Takakura, Satoru; Tikhomirov, Alexei; Tomaru, Takayuki; Whitehorn, Nathan; Wilson, Brandon; Yadav, Amit; Zahn, Alex; Zahn, Oliver

    2015-01-01

    We constrain anisotropic cosmic birefringence using four-point correlations of even-parity $E$-mode and odd-parity $B$-mode polarization in the cosmic microwave background measurements made by the POLARBEAR experiment in its first season of observations. We find that the anisotropic cosmic birefringence signal from any parity violating processes is consistent with zero. The Faraday rotation from anisotropic cosmic birefringence can be compared with the equivalent quantity generated by primordial magnetic fields if they existed. The POLARBEAR non-detection translates into a 95% confidence level (C.L.) upper limit of 93 nano-Gauss (nG) on the amplitude of an equivalent primordial magnetic field inclusive of systematic uncertainties. This four-point correlation constraint on Faraday rotation is about 15 times tighter than the upper limit of 1380 nG inferred from constraining the contribution of Faraday rotation to two-point correlations of $B$-modes measured by Planck in 2015. Metric perturbations sourced by pri...

  20. A method to measure vacuum birefringence at FCC-ee

    CERN Document Server

    Uggerhøj, Ulrik I

    2016-01-01

    It is well-known that the Heisenberg-Euler-Schwinger effective Lagrangian predicts that a vacuum with a strong static electromagnetic field turns birefringent. We propose a scheme that can be implemented at the planned FCC-ee, to measure the nonlinear effect of vacuum birefringence in electrodynamics arising from QED corrections. Our scheme employs a pulsed laser to create Compton backscattered photons off a high energy electron beam, with the FCC-ee as a particularly interesting example. These photons will pass through a strong static magnetic field, which changes the state of polarization of the radiation - an effect proportional to the photon energy. This change will be measured by the use of an aligned single-crystal, where a large difference in the pair production cross-sections can be achieved. In the proposed experimental setup the birefringence effect gives rise to a difference in the number of pairs created in the analyzing crystal, stemming from the fact that the initial laser light has a varying st...

  1. On the torque on birefringent plates induced by quantum fluctuations

    CERN Document Server

    Iannuzzi, D; Barash, Y; Capasso, F; Iannuzzi, Davide; Munday, Jeremy N.; Barash, Yuri; Capasso, Federico

    2004-01-01

    We present detailed numerical calculations of the mechanical torque induced by quantum fluctuations on two parallel birefringent plates with in plane optical anisotropy, separated by either vacuum or a liquid (ethanol). The torque is found to vary as $\\sin(2\\theta)$, where $\\theta$ represents the angle between the two optical axes, and its magnitude rapidly increases with decreasing plate separation $d$. For a 40 $\\mu$m diameter disk, made out of either quartz or calcite, kept parallel to a Barium Titanate plate at $d\\simeq 100$ nm, the maximum torque (at $\\theta={\\pi\\over 4}$) is of the order of $\\simeq 10^{-19}$ N$\\cdot$m. We propose an experiment to observe this torque when the Barium Titanate plate is immersed in ethanol and the other birefringent disk is placed on top of it. In this case the retarded van der Waals (or Casimir-Lifshitz) force between the two birefringent slabs is repulsive. The disk would float parallel to the plate at a distance where its net weight is counterbalanced by the retarded van...

  2. Anomalous birefringence of swollen lamellar phases : blue smectics

    Science.gov (United States)

    Nallet, F.; Barois, Ph.

    1994-06-01

    The birefringence of a lyotropic lamellar phase is calculated as a function of dilution. It is found to vanish and change sign, provided the natural birefringence of surfactant bilayers is positive. Dispersion is calculated about the point of zero birefringence. These predictions are illustrated with experiments of spectrophotometry: the intensity of light transmitted between crossed polarizers through several lamellar samples vanishes as expected at some particular wavelength. The dependence of the transmitted light on wavelength and cell thickness is consistent with theory. La biréfringence d'une phase lamellaire lyotrope est calculée en fonction de la dilution. Nous montrons qu'elle peut s'annuler à condition que la biréfringence naturelle des bicouches de tensioactif soit positive. La dispersion au voisinage du point de biréfringence nulle est calculée. Ces résultats sont confirmés par des mesures de spectrophotométrie : la transmission des échantillons étudiés entre polariseurs croisés s'annule exactement pour une longueur d'onde particulière. La variation de l'intensité transmise en fonction de la longueur d'onde et de l'épaisseur des échantillons est conforme aux prévisions du modèle.

  3. Polarisation Control of DFB Fibre Laser Using UV-Induced Birefringent Phase-Shift

    DEFF Research Database (Denmark)

    Philipsen, Jacob Lundgreen; Lauridsen, Vibeke Claudia; Berendt, Martin Ole;

    1998-01-01

    The polarisation properties of a distributed feedback (DFB) fibre laser are investigated experimentally. A birefringent phase-shift is induced by side illumination of the centre part of the lasing structure with ultraviolet (UV) light and it is experimentally shown that the birefringence of the p......The polarisation properties of a distributed feedback (DFB) fibre laser are investigated experimentally. A birefringent phase-shift is induced by side illumination of the centre part of the lasing structure with ultraviolet (UV) light and it is experimentally shown that the birefringence...

  4. Coupled-mode equation of polarization modes of twisted birefringent fibers in a unified coordinate.

    Science.gov (United States)

    Fang, Zujie; Yang, Fei; Cai, Haiwen; Qu, Ronghui

    2013-01-20

    A coupled-mode equation (CME) of twisted birefringent fiber is presented in this paper, which uses the degenerate polarization modes of single-mode fibers as eigenmodes in a unified coordinate. The inconsistency between the coordinate and the rotating principal axis, existing in the previous CME, is solved by conversion to the lab coordinate. The CME gives self-consistent results for fibers with high birefringence or low birefringence and for single-mode fibers as well. Analyses and simulations show the CME gives characteristics of twisted birefringent fiber coincident with the property of polarization-maintaining fibers.

  5. Birefringence properties of a polarization maintaining Panda fibre during Bragg grating regeneration

    Science.gov (United States)

    Polz, Leonhard; Jarsen, Andreas; Bartelt, Hartmut; Roths, Johannes

    2015-09-01

    Regeneration of fibre Bragg gratings under application of a high temperature annealing process in a high birefringent polarisation maintaining fibre of type Panda was investigated. During the annealing process, a distinct nonlinearity and hysteresis of the birefringence with temperature was observed. After the temperature process, the birefringence between slow and fast axis at room temperature was nearly doubled, which is in agreement with observations of other researchers. The hysteresis in birefringence might be explained by the crossing of the transition temperature of the stress applying parts and the relief of in-frozen mechanical and thermal stresses.

  6. Tunable and rotatable birefringence controller based on electrical control of liquid crystal filled photonic bandgap fibers

    DEFF Research Database (Denmark)

    Wei, Lei; Alkeskjold, Thomas Tanggaard; Bjarklev, Anders Overgaard

    2009-01-01

    We demonstrate the first compact electrically tunable and rotatable birefringence controller based on LCPBG fibers. The birefringence can be tuned electrically to work as a quarter-wave or a half-wave plate in the wavelength range 1520nm-1600nm.......We demonstrate the first compact electrically tunable and rotatable birefringence controller based on LCPBG fibers. The birefringence can be tuned electrically to work as a quarter-wave or a half-wave plate in the wavelength range 1520nm-1600nm....

  7. Birefringence measurements in single crystal sapphire and calcite shocked along the a axis

    Science.gov (United States)

    Tear, Gareth R.; Chapman, David J.; Eakins, Daniel E.; Proud, William G.

    2017-01-01

    Calcite and sapphire were shock compressed along the direction (a axis) in a plate impact configuration. Polarimetery and Photonic Doppler Velocimetery (PDV) were used to measure the change in birefringence with particle velocity in the shock direction. Results for sapphire agree well with linear photoelastic theory and current literature showing a linear relationship between birefringence and particle velocity up to 310 m s-1. A maximum change in birefringence of 5% was observed. Calcite however showed anomolous behaviour with no detectable change in birefringence (less than 0.1%) over the range of particle velocities studied (up to 75 m s-1).

  8. Social exploration of 1D games

    DEFF Research Database (Denmark)

    Valente, Andrea; Marchetti, Emanuela

    2013-01-01

    In this paper the apparently meaningless concept of a 1 dimensional computer game is explored, via netnography. A small number of games was designed and implemented, in close contact with online communities of players and developers, providing evidence that 1 dimension is enough to produce...... interesting gameplay, to allow for level design and even to leave room for artistic considerations on 1D rendering. General techniques to re-design classic 2D games into 1D are also emerging from this exploration....

  9. Automated Detection of Ocular Alignment with Binocular Retinal Birefringence Scanning

    Science.gov (United States)

    Hunter, David G.; Shah, Ankoor S.; Sau, Soma; Nassif, Deborah; Guyton, David L.

    2003-06-01

    We previously developed a retinal birefringence scanning (RBS) device to detect eye fixation. The purpose of this study was to determine whether a new binocular RBS (BRBS) instrument can detect simultaneous fixation of both eyes. Control (nonmyopic and myopic) and strabismic subjects were studied by use of BRBS at a fixation distance of 45 cm. Binocularity (the percentage of measurements with bilateral fixation) was determined from the BRBS output. All nonstrabismic subjects with good quality signals had binocularity >75%. Binocularity averaged 5% in four subjects with strabismus (range of 0 -20%). BRBS may potentially be used to screen individuals for abnormal eye alignment.

  10. Design of anisotropic reflector with birefringent thin films

    Institute of Scientific and Technical Information of China (English)

    Jianguo Wang; Kui Yi; Jianda Shao; Zhengxiu Fan

    2005-01-01

    A novel design for dielectric anisotropic mirrors with birefringent thin films for normal incidence is presented. This mirror consists of a stack of quarter-wave biaxial layers. The biaxial anisotropic layers can be fabricated by oblique deposition. The reflectance is different for two linear polarizations of light incidence on the mirrors. As a numerical example, the design is carried out on glass with TiO2 and ZrO2. These thin films could be applied to anisotropic reflective devices for lasers.

  11. The Double Jones Birefringence in Magneto-electric Medium

    CERN Document Server

    Mahmood, Waqas

    2014-01-01

    In this paper, the Maxwell's equations for the tensorial magneto-electric (ME) medium have been solved which in fact is the extension of anisotropic nonmagnetic medium. All of the dielectric permittivity, magnetic permeability and the ME tensors are considered. The transverse polarization is shown explicitly and the propagation of electromagnetic wave in the ME medium is found to have the Double Jones Birefringence. We also find the condition of D'yakonov surface wave for magneto-isotropic but with ME anisotropic medium. Especially when the incident angle is $\\frac{\\pi}{4}$, it may be measurable in principle.

  12. X-ray natural birefringence in reflection from graphene

    Science.gov (United States)

    Jansing, C.; Mertins, H.-Ch.; Gilbert, M.; Wahab, H.; Timmers, H.; Choi, S.-H.; Gaupp, A.; Krivenkov, M.; Varykhalov, A.; Rader, O.; Legut, D.; Oppeneer, P. M.

    2016-07-01

    The existence of natural birefringence in x-ray reflection on graphene is demonstrated at energies spanning the carbon 1 s absorption edge. This new x-ray effect has been discovered with precision measurements of the polarization-plane rotation and the polarization-ellipticity changes that occur upon reflection of linearly polarized synchrotron radiation on monolayer graphene. Extraordinarily large polarization-plane rotations of up to 30∘, accompanied by a change from linearly to circularly polarized radiation have been measured for graphene on copper. Graphene on single crystalline cobalt, grown on tungsten, exhibits rotation values of up to 17∘. Both graphene systems show resonantly enhanced effects at the π* and σ* energies. The results are referenced against those obtained for polycrystalline carbon and highly oriented pyrolytic graphite (HOPG), respectively. As expected, polycrystalline carbon shows negligible rotation, whereas a huge maximum rotation of 140∘ has been observed for HOPG that may be considered a graphene multilayer system. HOPG is found to exhibit such large rotation values over a broad energy range, even well beyond the π* resonance energy due to the contributions of numerous graphene layers. To explain the origin of the observed natural birefringence of graphene, the Stokes parameters as well as the x-ray natural linear dichroism in reflection have been determined. It is shown that the birefringence directly results from the optical anisotropy related to the orthogonal alignment of π* and σ* bonds in the graphene layer. Our polarization analysis reveals a strong bonding of graphene on Co with a reduced σ* excitation energy and a strong tilt of 50 % of the pz orbitals towards diagonal orientation. In contrast, graphene on Cu is weakly bound with an orthogonal orientation of the pz orbitals. Exhibiting such a large natural birefringence that can be controlled through substrate choice, and because of excellent heat conductivity

  13. Comparison of two synthesis methods for birefringent metasurfaces

    Science.gov (United States)

    Achouri, Karim; Lavigne, Guillaume; Caloz, Christophe

    2016-12-01

    Birefringent metasurfaces are two-dimensional structures capable of independently controlling the amplitude, phase, and polarization of orthogonally polarized incident waves. In this work, we propose an in-depth discussion on the mathematical synthesis of such metasurfaces. We compare the two methods, one that is rigorous and based on the exact electromagnetic fields involved in the transformation and one that is based on approximate reflection and transmission coefficients. We next validate the synthesis technique in metasurfaces performing the operations of a half- and quarter-wave plates, polarization beam splitting, and orbital angular momentum multiplexing and present the corresponding microwave experimental demonstrations.

  14. A Novel Low Loss, Highly Birefringent Photonic Crystal Fiber in THz Regime

    DEFF Research Database (Denmark)

    Hasanuzzaman, G. K. M.; Rana, Sohel; Habib, Selim

    2016-01-01

    We present a new kind of dual-hole unit-based porous-core hexagonal photonic crystal fiber (H-PCF) with low loss and high birefringence in terahertz regime. The proposed fiber offers simultaneously high birefringence and low effective material loss (EML) in the frequency range of 0.5-0.85 THz wit...

  15. Tuning the birefringence of the nematic phase in suspensions of colloidal gibbsite platelets

    NARCIS (Netherlands)

    Verhoeff, A.A.; Brand, R.P.; Lekkerkerker, H.N.W.

    2011-01-01

    We consider the birefringence patterns of nematic liquid crystals of gibbsite platelets at interfaces and in an aligning magnetic field. In solvents with a refractive index close to the particle refractive index, the intrinsic birefringence of the platelets dominates, resulting in positive birefring

  16. Birefringence-induced splitting of the Zero-dispersion wavelength in nonlinear photonic crystal fibers

    DEFF Research Database (Denmark)

    Hansen, Kim Per; Petersson, A.; Folkenberg, Jakob Riis

    2004-01-01

    for transverse structural uniformity by adopting a simple effective-index approach in which the birefringence is calculated in a step-index fiber with an elliptical core. We find that to reduce the splitting to less than 1nm the birefringence should be less than 210 -5 , resulting in a transverse uniformity...

  17. Effects of M Ⅱ stage oocytes zona pellucida birefringence on pregnancy outcome

    Institute of Scientific and Technical Information of China (English)

    Jia Luo; Yan-Wen Xu; Ming-Fang Zhang; Ling Gao; Cong Fang; Can-Quan Zhou

    2013-01-01

    Objective: To explore the effects of different MⅡ stage oocytes zona pellucida birefringence on pregnancy outcome. Methods: A total of 46 couples with infertile which induced by single cause received in-vitro fertilization treatment were analyzed retrospectively, and randomly divided into the high zona birefringence (HZB)/HZB group, HZB/low zona birefringence (LZB) group and LZB/LZB group according to different oocytes zona pellucida birefringence. Intracytoplasmic sperm injection outcome was analyzed and compared. Results: The proportion of HZB oocytes, implantation rate and the pregnancy rate were decreased in three groups (HZB/HZB group>HZB/LZB group>LZB/LZB group) (P0.05). Logistic regression analysis showed that factors affect M Ⅱ stage oocytes zona pellucida birefringence were age, basal FSH level and the LH level on the day of HCG injection. Age and FSH levels were negatively correlated with the single oocyte zona pellucida birefringence; While the LH level on the day of hCG injection was positively correlated with the single oocyte zona pellucida birefringence. Conclusions: The primary influence factors on M Ⅱ stage oocytes zona pellucida are age, basal FSH level and the LH level on the day of hCG injection. The birefringence value of zona pellucida can affect the pregnancy outcome.

  18. Modeling optical behavior of birefringent biological tissues for evaluation of quantitative polarized light microscopy

    NARCIS (Netherlands)

    Turnhout, van M.C.; Kranenbarg, S.; Leeuwen, van J.L.

    2009-01-01

    Quantitative polarized light microscopy (qPLM) is a popular tool for the investigation of birefringent architectures in biological tissues. Collagen, the most abundant protein in mammals, is such a birefringent material. Interpretation of results of qPLM in terms of collagen network architecture and

  19. Measuring the Length Distribution of a Fibril System: a Flow Birefringence Technique applied to Amyloid Fibrils

    NARCIS (Netherlands)

    Rogers, S.S.; Venema, P.; Sagis, L.M.C.; Linden, van der E.; Donald, A.M.

    2005-01-01

    Relaxation of flow birefringence can give a direct measure of the rotational diffusion of rodlike objects in solution. With a suitable model of the rotational diffusivity, a length distribution can be sought by fitting the decay curve. We have measured the flow birefringence decay from solutions of

  20. Annealing of UV-Induced Birefringence in Hydrogen Loaded Germanosilicate Fibres

    DEFF Research Database (Denmark)

    Canning, John; Deyerl, Hans-Jürgen; Sørensen, Henrik Rokkjær

    2005-01-01

    UV-reduced birefringence in germanosilicate optical fibres loaded with hydrogen is annealed out at low temperatures (125o C). Annealing for induced birefringence in gratings written by either s or p polarised UV light are identical. The results are incosistent with previous models for the origin...

  1. A Novel Low Loss, Highly Birefringent Photonic Crystal Fiber in THz Regime

    DEFF Research Database (Denmark)

    Hasanuzzaman, G. K. M.; Rana, Sohel; Habib, Selim

    2016-01-01

    We present a new kind of dual-hole unit-based porous-core hexagonal photonic crystal fiber (H-PCF) with low loss and high birefringence in terahertz regime. The proposed fiber offers simultaneously high birefringence and low effective material loss (EML) in the frequency range of 0.5-0.85 THz wit...

  2. Measuring birefringence of curved sheet and single crystals by double-exposure speckle photography

    Science.gov (United States)

    El-Dessouki, T. A.; Hendawy, N. I.; Zaki, A. A.

    2009-06-01

    In this work, a new theoretical and experimental approach for measuring birefringence of solid materials was described. Dispersions of birefringence of quartz, calcite crystals and Fortypan sheet were determined in the visible region. The results were compared with other interferometric methods to verify the accuracy of this approach.

  3. Process-induced birefringence variations in fiber optic embedded in composite materials

    Science.gov (United States)

    Turpin, M.; Chazelas, J.; Stoppiglia, H.

    The use of embedded fiber optic sensors for the impact detection on woven-composite panels has been developed using interfero-polarimetric measurements. Preliminary results on the study of the process-induced birefringence properties modifications of two different types of specific optical fibers: Hi-Bi 'Bow-Tie' fibers and Side-hole birefringent 'FASE' fibers are discussed.

  4. Integrated quantitative phase and birefringence microscopy for imaging malaria-infected red blood cells

    Science.gov (United States)

    Li, Chengshuai; Chen, Shichao; Klemba, Michael; Zhu, Yizheng

    2016-09-01

    A dual-modality birefringence/phase imaging system is presented. The system features a crystal retarder that provides polarization mixing and generates two interferometric carrier waves in a single signal spectrum. The retardation and orientation of sample birefringence can then be measured simultaneously based on spectral multiplexing interferometry. Further, with the addition of a Nomarski prism, the same setup can be used for quantitative differential interference contrast (DIC) imaging. Sample phase can then be obtained with two-dimensional integration. In addition, birefringence-induced phase error can be corrected using the birefringence data. This dual-modality approach is analyzed theoretically with Jones calculus and validated experimentally with malaria-infected red blood cells. The system generates not only corrected DIC and phase images, but a birefringence map that highlights the distribution of hemozoin crystals.

  5. Birefringence-Directed Raman Selection Rules in 2D Black Phosphorus Crystals.

    Science.gov (United States)

    Mao, Nannan; Wu, Juanxia; Han, Bowen; Lin, Jingjing; Tong, Lianming; Zhang, Jin

    2016-05-01

    The incident and scattered light engaged in the Raman scattering process of low symmetry crystals always suffer from the birefringence-induced depolarization. Therefore, for anisotropic crystals, the classical Raman selection rules should be corrected by taking the birefringence effect into consideration. The appearance of the 2D anisotropic materials provides an excellent platform to explore the birefringence-directed Raman selection rules, due to its controllable thickness at the nanoscale that greatly simplifies the situation comparing with bulk materials. Herein, a theoretical and experimental investigation on the birefringence-directed Raman selection rules in the anisotropic black phosphorus (BP) crystals is presented. The abnormal angle-dependent polarized Raman scattering of the Ag modes in thin BP crystal, which deviates from the normal Raman selection rules, is successfully interpreted by the theoretical model based on birefringence. It is further confirmed by the examination of different Raman modes using different laser lines and BP samples of different thicknesses.

  6. Heat Capacity of 1D Molecular Chains

    Science.gov (United States)

    Bagatskii, M. I.; Barabashko, M. S.; Sumarokov, V. V.; Jeżowski, A.; Stachowiak, P.

    2017-04-01

    The heat capacity of 1D chains of nitrogen and methane molecules (adsorbed in the outer grooves of bundles of closed-cap single-walled carbon nanotubes) has been studied in the temperature ranges 2-40 and 2-60 K, respectively. The temperature dependence of the heat capacity of 1D chains of nitrogen molecules below 3 K is close to a linear. It was found that the rotational heat capacity of methane molecules is a significant part of the total heat capacity of the chains throughout the whole investigated temperature range, whereas in the case of nitrogen, the librations are significant only above 15 K. The dependence of the heat capacity for methane below 10 K indicates the presence of a Schottky anomaly caused by the tunneling between the lowest energy levels of the CH4 molecule rotational spectra. Characteristic features observed in the temperature dependence of the heat capacity of 1D methane crystals are also discussed.

  7. First Observation of Upsilon(1D) States

    CERN Document Server

    Csorna, S E; Bonvicini, G; Cinabro, D; Dubrovin, M; McGee, S; Bornheim, A; Lipeles, E; Pappas, S P; Shapiro, A; Sun, W M; Weinstein, A J; Mahapatra, R; Briere, R A; Chen, G P; Ferguson, T; Tatishvili, G T; Vogel, H; Adam, N E; Alexander, J P; Berkelman, K; Boisvert, V; Cassel, David G; Drell, P S; Duboscq, J E; Ecklund, K M; Ehrlich, R; Galik, R S; Gibbons, L; Gittelman, B; Gray, S W; Hartill, D L; Heltsley, B K; Hsu, L; Jones, C D; Kandaswamy, J; Kreinick, D L; Magerkurth, A; Mahlke-Krüger, H; Meyer, T O; Mistry, N B; Nordberg, E; Patterson, J R; Peterson, D; Pivarski, J; Riley, D; Sadoff, A J; Schwarthoff, H; Shepherd, M R; Thayer, J G; Urner, D; Viehhauser, G; Warburton, A; Weinberger, M; Athar, S B; Avery, P; Breva-Newell, L; Potlia, V; Stöck, H; Yelton, J; Brandenburg, G; Kim, D Y J; Wilson, R; Benslama, K; Eisenstein, B I; Ernst, J; Gollin, G D; Hans, R M; Karliner, I; Lowrey, N; Plager, C; Sedlack, C; Selen, M; Thaler, J J; Williams, J; Edwards, K W; Ammar, R; Besson, D; Zhao, X; Anderson, S; Frolov, V V; Kubota, Y; Lee, S J; Li, S Z; Poling, R A; Smith, A; Stepaniak, C J; Urheim, J; Metreveli, Z V; Seth, K K; Tomaradze, A G; Zweber, P; Ahmed, S; Alam, M S; Jian, L; Saleem, M; Wappler, F; Eckhart, E; Gan, K K; Gwon, C; Hart, T; Honscheid, K; Hufnagel, D; Kagan, H; Kass, R; Pedlar, T K; Thayer, J B; Von Törne, E; Wilksen, T; Zoeller, M M; Muramatsu, H; Richichi, S J; Severini, H; Skubic, P L; Dytman, S A; Müller, J A; Nam, S; Savinov, V; Chen, S; Hinson, J W; Lee, J; Miller, D H; Pavlunin, V; Shibata, E I; Shipsey, I P J; Cronin-Hennessy, D; Lyon, A L; Park, C S; Park, W; Thorndike, E H; Coan, T E; Gao, Y S; Liu, F; Maravin, Y; Stroynowski, R; Artuso, M; Boulahouache, C; Bukin, K; Dambasuren, E; Khroustalev, K; Mountain, R; Nandakumar, R; Skwarnicki, T; Stone, S; Wang, J C; Mahmood, A H

    2002-01-01

    The CLEO III experiment has recently accumulated a large statistics sample of 4.73 x 10^6 Upsilon(3S) decays. We present the first evidence for the production of the triplet Upsilon(1D) states in the four-photon cascade, Upslion(3S) -> gamma chi_b(2P), chi_b(2P) -> gamma Upsilon(1D), Upsilon(1D) -> gamma chi_b(1P), chi_b(1P) -> gamma Upsilon(1S), followed by the Upsilon(1S) annihilation to e+ e- or mu+ mu-. The signal has a significance of 9.7 standard deviations. The measured product branching ratio for these five decays, (3.3 +- 0.6 +- 0.5) x 10^{-5}, is consistent with the theoretical estimates. We see a 6.8 standard deviation signal for a state with a mass of 10162.2 +- 1.6 MeV/c^2, consistent with the Upsilon(1D_2) assignment. We also present improved measurements of the Upsilon(3S) -> pi0 pi0 Upsilon(1S) branching ratio and the associated di-pion mass distribution.

  8. DESIGN PACKAGE 1D SYSTEM SAFETY ANALYSIS

    Energy Technology Data Exchange (ETDEWEB)

    L.R. Eisler

    1995-02-02

    The purpose of this analysis is to systematically identify and evaluate hazards related to the Yucca Mountain Project Exploratory Studies Facility (ESF) Design Package 1D, Surface Facilities, (for a list of design items included in the package 1D system safety analysis see section 3). This process is an integral part of the systems engineering process; whereby safety is considered during planning, design, testing, and construction. A largely qualitative approach was used since a radiological System Safety analysis is not required. The risk assessment in this analysis characterizes the accident scenarios associated with the Design Package 1D structures/systems/components in terms of relative risk and includes recommendations for mitigating all identified risks. The priority for recommending and implementing mitigation control features is: (1) Incorporate measures to reduce risks and hazards into the structure/system/component (S/S/C) design, (2) add safety devices and capabilities to the designs that reduce risk, (3) provide devices that detect and warn personnel of hazardous conditions, and (4) develop procedures and conduct training to increase worker awareness of potential hazards, on methods to reduce exposure to hazards, and on the actions required to avoid accidents or correct hazardous conditions. The scope of this analysis is limited to the Design Package 1D structures/systems/components (S/S/Cs) during normal operations excluding hazards occurring during maintenance and ''off normal'' operations.

  9. Temperature dependence of birefringence in olarization-maintaining photonic crystal fibres

    Institute of Scientific and Technical Information of China (English)

    Zhao Hong; Chen Meng; Li Gang

    2012-01-01

    In this paper,the temperature dependence of birefringence in polarization maintaining photonic crystal fibres (PMPCFs) is investigated theoretically and experimentally.Utilizing the structural parameters of the PM-PCF samples in the experiment,two effects leading to the birefringence variation under different temperatures are analysed,which are the thermal expansion of silica material and the refractive index variation due to the temperature variation.The actual birefringence variation of the PM-PCF is the combination of the two effects,which is in the order of 10-9 K-1 for both fibre samples.Calculation results also show that the influence of refractive index variation is the dominant contribution,which determines the tendency of the fibre birefringence variation with varying temperature.Then,the birefringence beat lengths of the two fibre samples are measured under the temperature,which varies from -40 ℃ to 80 ℃.A traditional PANDA-type polarization maintaining fibre (PMF) is also measured in the same way for comparison.The experimental results indicate that the birefringence variation of the PM-PCF due to temperature variation is far smaller than that of the traditional PMF,which agrees with the theoretical analysis.The ultra-low temperature dependence of the birefringence in the PM-PCF has great potential applications in temperature-insensitive fibre interferometers,fibre sensors,and fibre gyroscopes.

  10. Thermal characterization of Bragg gratings in polarization-maintaining optical fibres: analysis of birefringence and regeneration

    Science.gov (United States)

    Abe, I.; de Oliveira, V.; Fiorin, R.; Kalinowski, H. J.

    2017-04-01

    This paper presents an analysis of birefringence and regeneration of fibre Bragg gratings (FBGs) in two types of polarization-maintaining (PM) optical fibres, bow tie and internal elliptical cladding (IEC), with different diameters. The thermal regeneration of FBGs in PM fibres with different degrees of saturation (weakly, slightly, and strongly saturated) is presented and the influence of the gratings’ saturation degree on the birefringence of PM fibres is shown. The birefringence values obtained for IEC fibres with 80 µm of diameter were for a strongly saturated seed grating of 5.3  ×  10-4 and 6.2  ×  10-4 refractive index units after the regeneration. The evolution of the fibre birefringence as a function of the temperature is presented and the results show hysteresis and nonlinear dependence of the birefringence on temperature. The thermal stability of regenerated gratings in PM fibres is demonstrated, and a sensitivity coefficient value of 0.0035 dBm min-1 at 900 °C was obtained. The results obtained show the feasibility of optimization of fibre birefringence; this could allow such fibers to be used as temperature sensors and even improve the birefringence after the grating regeneration.

  11. Origin of birefringence in common silicate garnet: intergrowth of different cubic phases

    Science.gov (United States)

    Antao, S.; Klincker, A.; Round, S.

    2013-05-01

    Birefringence is unexpected in ideal high symmetry cubic minerals, such as common silicate garnets. Birefringence in cubic garnet was reported over a century ago, but the origin still remains questionable. Some grossular, spessartine, andradite, and uvarovite samples may show birefringence under cross-polarized light, which may indicate that they are not optically cubic. Several reasons were given as the cause of the birefringence, but the main one appears to be cation order that may cause symmetry reduction. The crystal structure of several birefringent garnet samples (grossular, spessartine, andradite, and uvarovite) were refined by the Rietveld method, space group Ia-3d, and monochromatic synchrotron high-resolution powder X-ray diffraction (HRPXRD) data. Electron-microprobe results indicate the samples are homogeneous or non-homogenous with two or three distinct compositions. Each birefringent sample contains an assemblage of cubic phases that have slightly different unit-cell parameters. The intergrowth of different phases causes strain-induced birefringence that arises from mismatch of different cubic unit-cell parameters. These results have many implications, including garnet phase transitions from cubic to lower symmetry in the mantle, which has important geophysical consequences.

  12. Calibration of a 1D/1D urban flood model using 1D/2D model results in the absence of field data.

    Science.gov (United States)

    Leandro, J; Djordjević, S; Chen, A S; Savić, D A; Stanić, M

    2011-01-01

    Recently increased flood events have been prompting researchers to improve existing coupled flood-models such as one-dimensional (1D)/1D and 1D/two-dimensional (2D) models. While 1D/1D models simulate sewer and surface networks using a one-dimensional approach, 1D/2D models represent the surface network by a two-dimensional surface grid. However their application raises two issues to urban flood modellers: (1) stormwater systems planning/emergency or risk analysis demands for fast models, and the 1D/2D computational time is prohibitive, (2) and the recognized lack of field data (e.g. Hunter et al. (2008)) causes difficulties for the calibration/validation of 1D/1D models. In this paper we propose to overcome these issues by calibrating a 1D/1D model with the results of a 1D/2D model. The flood-inundation results show that: (1) 1D/2D results can be used to calibrate faster 1D/1D models, (2) the 1D/1D model is able to map the 1D/2D flood maximum extent well, and the flooding limits satisfactorily in each time-step, (3) the 1D/1D model major differences are the instantaneous flow propagation and overestimation of the flood-depths within surface-ponds, (4) the agreement in the volume surcharged by both models is a necessary condition for the 1D surface-network validation and (5) the agreement of the manholes discharge shapes measures the fitness of the calibrated 1D surface-network.

  13. Strong optical feedback in birefringent dual frequency laser

    Institute of Scientific and Technical Information of China (English)

    Mao Wei; Zhang Shu-Lian

    2006-01-01

    Strong optical feedback in a birefringent dual frequency He-Ne laser with a high reflectivity feedback mirror has been investigated for the first time. The output characteristics of two orthogonally polarized modes are demonstrated in two different optical feedback cases: one is for both modes being fed back and the other is for only one of the modes being fed back. Strong mode competition can be observed between the two modes with strong optical feedback. And when one mode's intensity is near its maximum, the other mode is nearly extinguished. When both modes are fed back into the laser cavity, the mode competition is stronger than when only one mode is fed back. The difference in initial intensity between the two orthogonally polarized modes plays an important role in the mode competition, which has been experimentally and theoretically demonstrated.

  14. Birefringence effects of short probe pulses of electromagnetically induced transparency

    Science.gov (United States)

    Parshkov, Oleg M.; Kochetkova, Anastasia E.; Budyak, Victoria V.

    2016-04-01

    The numerical simulation results of radiations evolution in the presence of electromagnetically induced transparency for J=0-->J=1-->J=2 scheme of degenerate quantum transitions are presented. The pulse regime of wave interaction with Doppler broadening spectral lines was investigated. It was indicated that when the control field is linear polarized, the input circular polarized probe pulse breaks up in the medium into pulses with mutually perpendicular linear polarizations. Polarization direction of one of these pulses coincides with the polarization direction of control fields. The distance, which probe pulse passes in the medium to its full separation, decreases, when input probe pulse duration or control field intensity decreases. The input probe pulse intensity variation almost does not influence separation distance and speed of the linear polarized probe pulses in the medium. The effects, described above, may be interpreted as the birefringence effects of electromagnetically induced transparency in the case of short probe pulse.

  15. Directional eye fixation sensor using birefringence-based foveal detection

    Science.gov (United States)

    Gramatikov, Boris I.; Zalloum, Othman H. Y.; Wu, Yi Kai; Hunter, David G.; Guyton, David L.

    2007-04-01

    We recently developed and reported an eye fixation monitor that detects the fovea by its radial orientation of birefringent nerve fibers. The instrument used a four-quadrant photodetector and a normalized difference function to check for a best match between the detector quadrants and the arms of the bow-tie pattern of polarization states surrounding the fovea. This function had a maximum during central fixation but could not tell where the subject was looking relative to the center. We propose a linear transformation to obtain horizontal and vertical eye position coordinates from the four photodetector signals, followed by correction based on a priori calibration information. The method was verified on both a computer model and on human eyes. The major advantage of this new eye-tracking method is that it uses true information coming from the fovea, rather than reflections from other structures, to identify the direction of foveal gaze.

  16. Numerical study on pulse trapping in birefringent photonic crystal fibers

    Institute of Scientific and Technical Information of China (English)

    YAO Yan-yan; LI Shu-guang; FU Bo; ZHANG Lei; ZHANG Mei-yan

    2011-01-01

    Using an adaptive split-step Fourier method, the coupled nonlinear Schrodinger equations have been numerically solved in this paper. The nonlinear propagation of an ultrashort optical pulse in the birefringent photonic crystal fibers is investigated numerically. It is found that the phenomenon of pulse trapping occurs when the incident pulse is deviating from the principal axis of the fiber with some angle. Owing to the bireffingence effect, the incident pulse can be regarded as twoorthogonal polarized pulses. The phenomenon of pulse trapping occurs because of the cross phase modulation (XPM) between the two components. As a result, the bandwidth of the supercontinuum (SC) decreases compared with the case that the incident pulse is input along the principal axis. When the polarization direction of the incident pulse is parallel to the fast axis, the bandwidth of the supercontinuum is maximaL

  17. Two-dimensional electronic spectroscopy with birefringent wedges

    Energy Technology Data Exchange (ETDEWEB)

    Réhault, Julien; Maiuri, Margherita; Oriana, Aurelio; Cerullo, Giulio [IFN-CNR, Dipartimento di Fisica, Politecnico di Milano, Piazza Leonardo da Vinci 32, 20133 Milano (Italy)

    2014-12-15

    We present a simple experimental setup for performing two-dimensional (2D) electronic spectroscopy in the partially collinear pump-probe geometry. The setup uses a sequence of birefringent wedges to create and delay a pair of phase-locked, collinear pump pulses, with extremely high phase stability and reproducibility. Continuous delay scanning is possible without any active stabilization or position tracking, and allows to record rapidly and easily 2D spectra. The setup works over a broad spectral range from the ultraviolet to the near-IR, it is compatible with few-optical-cycle pulses and can be easily reconfigured to two-colour operation. A simple method for scattering suppression is also introduced. As a proof of principle, we present degenerate and two-color 2D spectra of the light-harvesting complex 1 of purple bacteria.

  18. Propagation of Optical Pulses in Polarization Maintaining Highly Birefringent Fibers

    Science.gov (United States)

    Leiva, Ariel; Olivares, Ricardo

    2008-04-01

    The propagation of Gaussian optical pulses through optical PM-HiBi (Polarization Maintaining Highly Birefringent) fibers is analyzed and simulated. Based upon a model of propagation as described by Marcuse, et al., [1] and Sunnerud, et al., [2], and the use of PMD (Polarization Mode Dispersion) compensators and emulators used by Kogelnik, et al. [2], [3] and Lima, et al. [4], we construct a simple model that allows graphical representation of the distortion experienced by optical pulses when propagating in a PM-HiBi fiber for different initial polarizations. The results of our analysis have the benefit of being identical to the more elaborate models of [1], [2], while also providing the additional advantage of simple graphical representation.

  19. Detection of vacuum birefringence using intense laser pulses

    Energy Technology Data Exchange (ETDEWEB)

    Luiten, Andre N. [School of Physics M013, University of Western Australia, Nedlands, Western Australia 6009 (Australia)]. E-mail: andre@physics.uwa.edu.au; Petersen, Jesse C. [School of Physics M013, University of Western Australia, Nedlands, Western Australia 6009 (Australia)

    2004-10-04

    We propose a novel technique that promises hope of being the first to directly detect a polarization of the quantum electrodynamic (QED) vacuum. The technique exploits the high fields associated with ultra-short pulses of light stored in low dispersion optical resonators. We show that the technique circumvents the need for large-scale liquid helium cooled magnets, and more importantly avoids the experimental pitfalls that plague existing experimental approaches that use these magnets. The new technique has a predicted birefringence measurement sensitivity of {delta}n{approx}10-20 in a 1 s measurement. Currently available optics and lasers will enable observation of vacuum polarization in an experiment of only a few days in duration.

  20. Detection of vacuum birefringence using intense laser pulses

    Science.gov (United States)

    Luiten, Andre N.; Petersen, Jesse C.

    2004-10-01

    We propose a novel technique that promises hope of being the first to directly detect a polarization of the quantum electrodynamic (QED) vacuum. The technique exploits the high fields associated with ultra-short pulses of light stored in low dispersion optical resonators. We show that the technique circumvents the need for large-scale liquid helium cooled magnets, and more importantly avoids the experimental pitfalls that plague existing experimental approaches that use these magnets. The new technique has a predicted birefringence measurement sensitivity of Δn∼10 in a 1 s measurement. Currently available optics and lasers will enable observation of vacuum polarization in an experiment of only a few days in duration.

  1. Modulation instabilities in randomly birefringent two-mode optical fibers

    Science.gov (United States)

    Li, Jin-Hua; Ren, Hai-Dong; Pei, Shi-Xin; Cao, Zhao-Lou; Xian, Feng-Lin

    2016-12-01

    Modulation instabilities in the randomly birefringent two-mode optical fibers (RB-TMFs) are analyzed in detail by accounting the effects of the differential mode group delay (DMGD) and group velocity dispersion (GVD) ratio between the two modes, both of which are absent in the randomly birefringent single-mode optical fibers (RB-SMFs). New MI characteristics are found in both normal and anomalous dispersion regimes. For the normal dispersion, without DMGD, no MI exists. With DMGD, a completely new MI band is generated as long as the total power is smaller than a critical total power value, named by Pcr, which increases significantly with the increment of DMGD, and reduces dramatically as GVD ratio and power ratio between the two modes increases. For the anomalous dispersion, there is one MI band without DMGD. In the presence of DMGD, the MI gain is reduced generally. On the other hand, there also exists a critical total power (Pcr), which increases (decreases) distinctly with the increment of DMGD (GVD ratio of the two modes) but varies complicatedly with the power ratio between the two modes. Two MI bands are present for total power smaller than Pcr, and the dominant band can be switched between the low and high frequency bands by adjusting the power ratio between the two modes. The MI analysis in this paper is verified by numerical simulation. Project supported by the Natural Science Foundation of Jiangsu Provincial Universities (Grant No. 14KJB140009), the National Natural Science Foundation of China (Grant No. 11447113), and the Startup Foundation for Introducing Talent of NUIST (Grant No. 2241131301064).

  2. Polarized X-ray Scattering and Birefringence in Magnetars

    Science.gov (United States)

    Barchas, Joseph; Baring, Matthew G.

    2017-01-01

    Interest in radiative processes in the super-strong magnetic regime germane to magnetars has grown over the last two decades. These processes have an inherently anisotropic and polarization-dependent character. Of particular interest is the resonant cyclotron scattering domain, where the Compton cross section is enhanced by orders of magnitude very near the cyclotron frequency -- for electrons in magnetar atmospheres, this is above 10 MeV in energy, and for protons this can be at 1-10 keV. The Compton process is dominant in the highly optically thick environs of magnetar atmospheres, and also in the magnetospheric locales for the production of the hard X-ray bursts. The detailed forms of X-ray spectra will depend intimately on the character of the Compton cross section and the emission zone geometry. The practical determination of the rate of Compton scattering depends on the polarization configuration of incoming photons. This in turn is sensitive to the details of radiation dispersion and transport in hot plasmaspheres near neutron stars. This birefringent dispersion present in strongly-magnetized plasmas can profoundly influence the determination of scattering probabilities. Such polarization transfer is usually addressed by simplifying to the transfer two normal mode intensities. The assumptions involved in this simplification such as orthonormality and "large Faraday depolarization" are valid for a wide range of parameter space, but are known to break down in important cases, such as near a cyclotron resonance. We explore the polarization transfer problem for Compton scattering including the regime where Faraday depolarization is not large. Accordingly, plasma birefringence and the generalized Faraday effect are considered explicitly as part of the transfer problem. Spectra generated from two Monte Carlo models of the transfer problem are presented, one treating isothermal atmospheres in the normal X-ray band, and the other addressing hard X-ray flares in

  3. Dielectric relaxation and birefringence study of 7.O5O.7 dimeric liquid crystal compound

    Science.gov (United States)

    Bhattacharjee, Debanjan; Paul-Choudhury, Sandip; Alapati, Parameswara Rao; Bhattacharjee, Ayon

    2016-05-01

    Measurement of dielectric relaxation and birefringence phenomenon of dimeric liquid crystal compound with the dependence of temperature was reported in this paper. Homogeneous (HG) and homeotropic (HT) alignment of the cell are introduced to investigate the dielectric relaxation, activation energy and birefringence. Cole-Cole plots analyzed the dielectric relaxation of the dimeric compound. The observed Cole-Cole plots were semi-circular, and the relaxation mechanism obeys the non-Debye type of relaxation behaviour. Slater's perturbation equations have been used to analysis the activation energy of the compound. The birefringence of the compound has positively anisotropy and thin prism mechanism was used to study the anisotropy of the compound.

  4. Effects of Laser-Induced Heating on the Photoinduced Birefringence in Azobenzene-Side-Chain Copolymer

    Institute of Scientific and Technical Information of China (English)

    杨军; 明海; 章江英; 王沛; 郎建英; 鲁拥华; 刘剑; 张其锦

    2003-01-01

    The photoinduced birefringence was observed in the polymer poly[2-(4-(4-cyanophenyl) diazenyl phenyloxy) ethoxyl methacrylatel with a cw 532nm laser. The azobenzene polymer character has been studied under the conditions of various illuminating time and light intensities. By analysing the processes of reorientation, the effect of laser-induced heating has been introduced to the buildup of photoinduced birefringence in azobenzene-side-chain copolymer. The curves for the buildup of birefringence were fitted with a modified function, i.e., biexponential curves and Gaussian curves. The relationship among all the parameters has also been presented. With the modified fitting function, we obtain a better fitting result.

  5. Measurement of Birefringence of Low-Loss, High-Reflectance Coating of M-Axis Sapphire

    OpenAIRE

    2001-01-01

    The birefringence of a low-loss, high-reflectance coating applied to an 8-cm-diameter sapphire crystal grown in the m-axis direction has been mapped. By monitoring the transmission of a high-finesse Fabry-Perot cavity as a function of the polarization of the input light, we find an upper limit for the magnitude of the birefringence of 2.5 x 10^-4 rad and an upper limit in the variation in direction of the birefringence of 10 deg. These values are sufficiently small to allow consideration of m...

  6. Glass-based 1-D dielectric microcavities

    Science.gov (United States)

    Chiasera, Alessandro; Scotognella, Francesco; Valligatla, Sreeramulu; Varas, Stefano; Jasieniak, Jacek; Criante, Luigino; Lukowiak, Anna; Ristic, Davor; Gonçalves, Rogeria Rocha; Taccheo, Stefano; Ivanda, Mile; Righini, Giancarlo C.; Ramponi, Roberta; Martucci, Alessandro; Ferrari, Maurizio

    2016-11-01

    We have developed a reliable RF sputtering techniques allowing to fabricate glass-based one dimensional microcavities, with high quality factor. This property is strongly related to the modification of the density of states due to the confinement of the gain medium in a photonic band gap structure. In this short review we present some of the more recent results obtained by our team exploiting these 1D microcavities. In particular we present: (1) Er3+ luminescence enhancement of the 4I13/2 → 4I15/2 transition; (2) broad band filters based on disordered 1-D photonic structures; (3) threshold defect-mode lasing action in a hybrid structure.

  7. YORP torques with 1D thermal model

    CERN Document Server

    Breiter, Slawomir; Czekaj, Maria

    2010-01-01

    A numerical model of the Yarkovsky-O'Keefe-Radzievskii-Paddack (YORP) effect for objects defined in terms of a triangular mesh is described. The algorithm requires that each surface triangle can be handled independently, which implies the use of a 1D thermal model. Insolation of each triangle is determined by an optimized ray-triangle intersection search. Surface temperature is modeled with a spectral approach; imposing a quasi-periodic solution we replace heat conduction equation by the Helmholtz equation. Nonlinear boundary conditions are handled by an iterative, FFT based solver. The results resolve the question of the YORP effect in rotation rate independence on conductivity within the nonlinear 1D thermal model regardless of the accuracy issues and homogeneity assumptions. A seasonal YORP effect in attitude is revealed for objects moving on elliptic orbits when a nonlinear thermal model is used.

  8. On the birefringence of healthy and malaria-infected red blood cells

    CERN Document Server

    Dharmadhikari, Aditya K; Dharmadhikari, Jayashree A; Sharma, Shobhona; Mathur, Deepak

    2013-01-01

    We have probed how the birefringence of a healthy red blood cell (RBC) changes as it becomes infected by a malarial parasite. By analyzing the polarization properties of light transmitted through a single, optically-trapped cell we demarcate two types of birefringence: form birefringence which depends on the shape of the cell and intrinsic birefringence which is brought about by the presence of the parasite. We quantitatively measure changes in the refractive index as normal RBS become infected by a malarial parasite. Malarial infections are found to induce changes in the cell's refractive index whose magnitude depends on the stage of malarial infection; such changes were quantitatively explored and found to be large, in the range 1.2 to 3$\\times10^{-2}$. Our results have implications for the development and use of non-invasive techniques that seek to quantify changes in cell properties induced by pathological states accompanying diseases like malaria. From a broader prespective, information forthcoming from ...

  9. A polarisation modulation scheme for measuring vacuum magnetic birefringence with static fields

    CERN Document Server

    Zavattini, G; Ejlli, A; Ruoso, G

    2016-01-01

    A novel polarisation modulation scheme for polarimeters based on Fabry-Perot cavities is presented. The application to the proposed HERA-X experiment aiming to measuring the magnetic birefringence of vacuum with the HERA superconducting magnets is discussed.

  10. Electric Birefringence: A Simple Apparatus for Determining Physical Parameters of Macromolecules and Colloids.

    Science.gov (United States)

    Trimm, Harold H.; And Others

    1984-01-01

    Describes a birefringence apparatus that can be assembled for less than $100 and can be used to measure both the dimensions and dipole moments of many macromolecules. Details are given of the construction and manipulation of the apparatus. (JN)

  11. Birefringence measurement of glass ion-exchanged waveguides: burying depth or cover layer influence

    Science.gov (United States)

    Jamon, D.; Garayt, J. P.; Jordan, E.; Parsy, F.; Ghibaudo, E.; Neveu, S.; Broquin, J.-E.; Royer, F.

    2016-02-01

    This paper deals with an experimental non-destructive technique for the measurement of polarization behavior of integrated optical waveguides. It is based on a high resolution polarimeter associated to an ellipsometric-type calibration which allows determining the full state of polarization of the output light. A magneto-optic perturbation is also added to generate TE/TM mode beating, whose spatial period is directly linked to the modal TE/TM birefringence. This equipment is first qualified by the measurement of modal birefringence in totally or partially buried ion exchanged waveguides. The results show that the value of the birefringence varies as a function of the diffusion aperture width or with the burying depth. By adding a magneto-optical cover layer, consisting in magnetic nanoparticles doped silica matrix obtained by a sol gel process 1, we evidence a huge increase of the beating magnitude and a decrease of the modal birefringence.

  12. Quantitative Assessment of Birefringent Skin Structures in Scattered Light Confocal Imaging Using Radially Polarized Light

    Directory of Open Access Journals (Sweden)

    Natallia Eduarda Uzunbajakava

    2013-09-01

    Full Text Available The polarization characteristics of birefringent tissues could be only partially obtained using linearly polarized light in polarization sensitive optical imaging. Here we analyze the change in polarization of backscattered light from birefringent structures versus the orientations of the incident polarizations using linearly, circularly and radially polarized light in a cross-polarized confocal microscope. A spatially variable retardation plate composed of eight sectors of λ/2 wave plates was used to transform linearly polarized light into a radially polarized light. Based on the experimental data obtained from ex-vivo measurements on human scalp hairs and in-vivo measurements on hair and skin, we exemplify that the underestimation of the birefringence content resulting from the orientation related effects associated with the use of linearly polarized light for imaging tissues containing wavy birefringent structures could be minimized by using radially polarized light.

  13. Quantitative assessment of birefringent skin structures in scattered light confocal imaging using radially polarized light.

    Science.gov (United States)

    Varghese, Babu; Verhagen, Rieko; Hussain, Altaf; Boudot, Clemence; Tai, Qiangqiang; Ding, Siqi; Holz, Jasmin Alexandra; Uzunbajakava, Natallia Eduarda

    2013-09-17

    The polarization characteristics of birefringent tissues could be only partially obtained using linearly polarized light in polarization sensitive optical imaging. Here we analyze the change in polarization of backscattered light from birefringent structures versus the orientations of the incident polarizations using linearly, circularly and radially polarized light in a cross-polarized confocal microscope. A spatially variable retardation plate composed of eight sectors of λ/2 wave plates was used to transform linearly polarized light into a radially polarized light. Based on the experimental data obtained from ex-vivo measurements on human scalp hairs and in-vivo measurements on hair and skin, we exemplify that the underestimation of the birefringence content resulting from the orientation related effects associated with the use of linearly polarized light for imaging tissues containing wavy birefringent structures could be minimized by using radially polarized light.

  14. Sensitivity of Bragg gratings in birefringent optical fiber to transverse compression between conforming materials.

    Science.gov (United States)

    Dennison, Christopher R; Wild, Peter M

    2010-04-20

    A theoretical and experimental investigation of the transverse load sensitivity of Bragg gratings in birefringent fibers to conforming contact is presented. A plane elasticity model is used to predict the contact dimensions between a conforming material and optical fiber and the principal stresses, indicating birefringence, created as a result of this contact. The transverse load sensitivity of commercially available birefringent fiber is experimentally measured for two cases of conforming contact. Theoretical and experimental results show that birefringent optical fiber can be used to make modulus-independent measurements of contact load. Therefore, Bragg gratings could be applied to conforming contact load measurements while avoiding some of the complications associated with existing contact sensors: specifically, the necessity to precalibrate by using materials with mechanical properties identical to those found in situ.

  15. A polarisation modulation scheme for measuring vacuum magnetic birefringence with static fields

    Energy Technology Data Exchange (ETDEWEB)

    Zavattini, G.; Ejlli, A. [Universita di Ferrara, Dipt. di Fisica e Scienze della Terra (Italy); INFN, Sezione di Ferrara (Italy); Della Valle, F. [Universita di Trieste, Dipt. di Fisica, Trieste (Italy); INFN, Sezione di Trieste, TS (Italy); Ruoso, G. [INFN, Lab. Nazionali di Legnaro (Italy)

    2016-05-15

    A novel polarisation modulation scheme for polarimeters based on Fabry-Perot cavities is presented. The application to the measurement of the magnetic birefringence of vacuum with the HERA superconducting magnets in the ALPS-II configuration is discussed. (orig.)

  16. In-situ measurement of vacuum window birefringence by atomic spectroscopy

    CERN Document Server

    Steffen, Andreas; Genske, Maximilian; Meschede, Dieter; Robens, Carsten; Alberti, Andrea

    2013-01-01

    We present an in-situ method to measure the birefringence of a single vacuum window by means of microwave spectroscopy on an ensemble of cold atoms. Stress-induced birefringence can cause an ellipticity in the polarization of an initially linearly-polarized laser beam. The amount of ellipticity can be reconstructed by measuring the differential vector light shift of an atomic hyperfine transition. Measuring the ellipticity as a function of the linear polarization angle allows us to infer the amount of birefringence $\\Delta n$ at the level of $10^{-8}$ and identify the orientation of the optical axes. The key benefit of this method is the ability to separately characterize each vacuum window, allowing the birefringence to be precisely compensated in existing vacuum apparatuses.

  17. A strain-induced birefringent double-clad fiber Bragg grating

    Institute of Scientific and Technical Information of China (English)

    Lijun Li; Lei Sun; Wande Fan; Zhi Wang; Jianhua Luo; Shenggui Fu; Shuzhong Yuan; Xiaoyi Dong

    2005-01-01

    @@ A strain-induced birefringence double-clad (DC) fiber Bragg grating (FBG) is proposed and demonstrated.The grating is fabricated in the core of rectangular inner cladding double clad fiber by using phase mask method. By applying lateral strain on the grating, the birefringence is induced. In order to detect the birefringent effect of the grating, we use it as the output mirror of a laser. When lateral strain is applied,the grating becomes birefringent. Therefore, one reflection peak of double-clad fiber Bragg grating becomes two peaks and the laser also lases in two wavelengths. The wavelength spacing of the laser can be tuned from 0 to 0.8 nm. The absolute wavelengths for the two polarizations can be tuned 1.2 and 2.0 nm,respectively.

  18. Spin-Hall effect and circular birefringence of a uniaxial crystal plate

    CERN Document Server

    Bliokh, K Y; Prajapati, C; Puentes, G; Viswanathan, N K; Nori, F

    2016-01-01

    The linear birefringence of uniaxial crystal plates is known since the 17th century. Here we demonstrate, both theoretically and experimentally, a fine lateral circular birefringence of such crystal plates. We show that this effect is a novel example of the spin-Hall effect of light, i.e., a transverse spin-dependent shift of the paraxial light beam transmitted through the plate. The well-known linear birefringence and the new circular birefringence form an interesting analogy with the Goos-Hanchen and Imbert-Fedorov beam shifts that appear in the light reflection at a dielectric interface. We report the experimental observation of the effect in a remarkably simple system of a tilted half-wave plate and polarizers using polarimetric and quantum-weak-measurement techniques for the beam-shift measurements.

  19. Approach for fast numerical propagation of uniformly polarized random electromagnetic fields in dispersive linearly birefringent systems.

    Science.gov (United States)

    Makowski, Piotr L; Domanski, Andrzej W

    2013-09-01

    An efficient simulation technique is proposed for computing propagation of uniformly polarized statistically stationary fields in linear nonimage-forming systems that includes dispersion of linear birefringence to all orders. The method is based on the discrete-time Fourier transformation of modified frequency profiles of the spectral Stokes parameters. It works under the condition that all (linearly) birefringent sections present in the system are described by the same phase birefringence dispersion curve, being a monotonic function of the optical frequency within the bandwidth of the light. We demonstrate the technique as a supplement for the Mueller-Stokes matrix formalism extended to any uniformly polarized polychromatic illumination. Accuracy of its numerical implementation has been verified by using parameters of a Lyot depolarizer made of a highly birefringent and dispersive monomode photonic crystal fiber.

  20. Large tuning of birefringence in two strip silicon waveguides via optomechanical motion.

    Science.gov (United States)

    Ma, Jing; Povinelli, Michelle L

    2009-09-28

    We present an optomechanical method to tune phase and group birefringence in parallel silicon strip waveguides. We first calculate the deformation of suspended, parallel strip waveguides due to optical forces. We optimize the frequency and polarization of the pump light to obtain a 9 nm deformation for an optical power of 20 mW. Widely tunable phase and group birefringence can be achieved by varying the pump power, with maximum values of 0.026 and 0.13, respectively. The giant phase birefringence allows linear to circular polarization conversion within 30 microm for a pump power of 67 mW. The group birefringence gives a tunable differential group delay of 6fs between orthogonal polarizations. We also evaluate the tuning performance of waveguides with different cross sections.

  1. Accurate and quantitative polarization-sensitive OCT by unbiased birefringence estimator with noise-stochastic correction

    Science.gov (United States)

    Kasaragod, Deepa; Sugiyama, Satoshi; Ikuno, Yasushi; Alonso-Caneiro, David; Yamanari, Masahiro; Fukuda, Shinichi; Oshika, Tetsuro; Hong, Young-Joo; Li, En; Makita, Shuichi; Miura, Masahiro; Yasuno, Yoshiaki

    2016-03-01

    Polarization sensitive optical coherence tomography (PS-OCT) is a functional extension of OCT that contrasts the polarization properties of tissues. It has been applied to ophthalmology, cardiology, etc. Proper quantitative imaging is required for a widespread clinical utility. However, the conventional method of averaging to improve the signal to noise ratio (SNR) and the contrast of the phase retardation (or birefringence) images introduce a noise bias offset from the true value. This bias reduces the effectiveness of birefringence contrast for a quantitative study. Although coherent averaging of Jones matrix tomography has been widely utilized and has improved the image quality, the fundamental limitation of nonlinear dependency of phase retardation and birefringence to the SNR was not overcome. So the birefringence obtained by PS-OCT was still not accurate for a quantitative imaging. The nonlinear effect of SNR to phase retardation and birefringence measurement was previously formulated in detail for a Jones matrix OCT (JM-OCT) [1]. Based on this, we had developed a maximum a-posteriori (MAP) estimator and quantitative birefringence imaging was demonstrated [2]. However, this first version of estimator had a theoretical shortcoming. It did not take into account the stochastic nature of SNR of OCT signal. In this paper, we present an improved version of the MAP estimator which takes into account the stochastic property of SNR. This estimator uses a probability distribution function (PDF) of true local retardation, which is proportional to birefringence, under a specific set of measurements of the birefringence and SNR. The PDF was pre-computed by a Monte-Carlo (MC) simulation based on the mathematical model of JM-OCT before the measurement. A comparison between this new MAP estimator, our previous MAP estimator [2], and the standard mean estimator is presented. The comparisons are performed both by numerical simulation and in vivo measurements of anterior and

  2. Tuning Characteristics of Frequency Difference for Zeeman-Birefringence He-Ne Dual Frequency Laser

    Institute of Scientific and Technical Information of China (English)

    肖岩; 张书练; 李岩; 朱钧

    2003-01-01

    Characteristics of frequency difference tuning of Zeeman-birefringence He-Ne dual frequency lasers (ZBDFLs) are explored. We design an automatic system of tuning cavity and power detection, which can tune the laser cavity and record the tuning curves of light power and frequency difference simultaneously. A synthetic phenomenon by Zeeman effect, mode pulling effect and birefringence effect is verified to exist in ZBDFLs. By analysing the tuning behaviour, this synthetic phenomenon is discovered and qualitatively explained for the first time.

  3. Birefringence signals in mammalian and frog myocardium. E-C coupling implications

    OpenAIRE

    1983-01-01

    Birefringence signals from mammalian and frog hearts were studied. The period between excitation and the onset of contraction in which optical signals were free of movement artifact was determined by changes in scattered incandescent light and changes in laser diffraction patterns. The birefringence signal preceding contraction was found to behave as a change in retardation and was not contaminated measurably by linear dichroic or isotropic absorption changes. There were two components of the...

  4. Light-induced rotations of chiral birefringent microparticles in optical tweezers

    Science.gov (United States)

    Donato, M. G.; Mazzulla, A.; Pagliusi, P.; Magazzù, A.; Hernandez, R. J.; Provenzano, C.; Gucciardi, P. G.; Maragò, O. M.; Cipparrone, G.

    2016-01-01

    We study the rotational dynamics of solid chiral and birefringent microparticles induced by elliptically polarized laser light in optical tweezers. We find that both reflection of left circularly polarized light and residual linear retardance affect the particle dynamics. The degree of ellipticity of laser light needed to induce rotations is found. The experimental results are compared with analytical calculations of the transfer of angular moment from elliptically polarized light to chiral birefringent particles. PMID:27601200

  5. Influence of Photosensitive Group Concentration on Birefringence Induced in Benzaldehyde Polymers

    Science.gov (United States)

    Mahilny, U. V.; Stankevich, A. I.; Trofimova, A. V.

    2014-01-01

    Induction of optical anisotropy in benzaldehyde polymer layers by linearly polarized UV radiation was investigated experimentally. Negative dichroism in absorption spectra and strong negative birefringence (-2 · 10-3) were related to the presence of an oriented ensemble of residual benzaldehyde groups. The thermal stability of photoinduced birefringence at high photosensitive group concentration was associated with a high density of photocross-links formed between macromolecules.

  6. 1-D EQUILIBRIUM DISCRETE DIFFUSION MONTE CARLO

    Energy Technology Data Exchange (ETDEWEB)

    T. EVANS; ET AL

    2000-08-01

    We present a new hybrid Monte Carlo method for 1-D equilibrium diffusion problems in which the radiation field coexists with matter in local thermodynamic equilibrium. This method, the Equilibrium Discrete Diffusion Monte Carlo (EqDDMC) method, combines Monte Carlo particles with spatially discrete diffusion solutions. We verify the EqDDMC method with computational results from three slab problems. The EqDDMC method represents an incremental step toward applying this hybrid methodology to non-equilibrium diffusion, where it could be simultaneously coupled to Monte Carlo transport.

  7. Quantification of birefringence readily measures the level of muscle damage in zebrafish

    Energy Technology Data Exchange (ETDEWEB)

    Berger, Joachim, E-mail: Joachim.Berger@Monash.edu [Australian Regenerative Medicine Institute, EMBL Australia, Monash University, Clayton (Australia); Sztal, Tamar; Currie, Peter D. [Australian Regenerative Medicine Institute, EMBL Australia, Monash University, Clayton (Australia)

    2012-07-13

    Highlights: Black-Right-Pointing-Pointer Report of an unbiased quantification of the birefringence of muscle of fish larvae. Black-Right-Pointing-Pointer Quantification method readily identifies level of overall muscle damage. Black-Right-Pointing-Pointer Compare zebrafish muscle mutants for level of phenotype severity. Black-Right-Pointing-Pointer Proposed tool to survey treatments that aim to ameliorate muscular dystrophy. -- Abstract: Muscular dystrophies are a group of genetic disorders that progressively weaken and degenerate muscle. Many zebrafish models for human muscular dystrophies have been generated and analysed, including dystrophin-deficient zebrafish mutants dmd that model Duchenne Muscular Dystrophy. Under polarised light the zebrafish muscle can be detected as a bright area in an otherwise dark background. This light effect, called birefringence, results from the diffraction of polarised light through the pseudo-crystalline array of the muscle sarcomeres. Muscle damage, as seen in zebrafish models for muscular dystrophies, can readily be detected by a reduction in the birefringence. Therefore, birefringence is a very sensitive indicator of overall muscle integrity within larval zebrafish. Unbiased documentation of the birefringence followed by densitometric measurement enables the quantification of the birefringence of zebrafish larvae. Thereby, the overall level of muscle integrity can be detected, allowing the identification and categorisation of zebrafish muscle mutants. In addition, we propose that the establish protocol can be used to analyse treatments aimed at ameliorating dystrophic zebrafish models.

  8. Birefringence of the central cornea in children assessed with scanning laser polarimetry

    Science.gov (United States)

    Irsch, Kristina; Shah, Ashesh A.

    2012-08-01

    Corneal birefringence is a well-known confounding factor with all polarization-sensitive technology used for retinal scanning and other intraocular assessment. It has been studied extensively in adults, but little is known regarding age-related differences. Specifically, no information is available concerning corneal birefringence in children. For applications that are geared towards children, such as retinal birefringence scanning for strabismus screening purposes, it is important to know the expected range of both corneal retardance and azimuth in pediatric populations. This study investigated central corneal birefringence in children (ages three and above), by means of scanning laser polarimetry (GDx-VCC™, Carl Zeiss Meditec, Inc.). Children's measures of corneal retardance and azimuth were compared with those obtained in adults. As with previous studies in adults, corneal birefringence was found to vary widely in children, with corneal retardance ranging from 10 to 77 nm, and azimuth (slow axis) ranging from -11° to 71° (measured nasally downward). No significant differences in central corneal birefringence were found between children and adults, nor were significant age-related differences found in general. In conclusion, establishing knowledge of the polarization properties of the central cornea in children allows better understanding, exploitation, or bypassing of these effects in new polarization-sensitive pediatric ophthalmic applications.

  9. Birefringence of the central cornea in children assessed with scanning laser polarimetry.

    Science.gov (United States)

    Irsch, Kristina; Shah, Ashesh A

    2012-08-01

    Corneal birefringence is a well-known confounding factor with all polarization-sensitive technology used for retinal scanning and other intraocular assessment. It has been studied extensively in adults, but little is known regarding age-related differences. Specifically, no information is available concerning corneal birefringence in children. For applications that are geared towards children, such as retinal birefringence scanning for strabismus screening purposes, it is important to know the expected range of both corneal retardance and azimuth in pediatric populations. This study investigated central corneal birefringence in children (ages three and above), by means of scanning laser polarimetry (GDx-VCC™, Carl Zeiss Meditec, Inc.). Children's measures of corneal retardance and azimuth were compared with those obtained in adults. As with previous studies in adults, corneal birefringence was found to vary widely in children, with corneal retardance ranging from 10 to 77 nm, and azimuth (slow axis) ranging from -11° to 71° (measured nasally downward). No significant differences in central corneal birefringence were found between children and adults, nor were significant age-related differences found in general. In conclusion, establishing knowledge of the polarization properties of the central cornea in children allows better understanding, exploitation, or bypassing of these effects in new polarization-sensitive pediatric ophthalmic applications.

  10. Fluorescence spectroscopy and birefringence of molecular changes in maturing rat tail tendon.

    Science.gov (United States)

    Korol, Renee M; Finlay, Helen M; Josseau, Melanie J; Lucas, Alexandra R; Canham, Peter B

    2007-01-01

    Tissue remodeling during maturation, wound healing, and response to vascular stress involves molecular changes of collagen and elastin in the extracellular matrix (ECM). Two optical techniques are effective for investigating these changes--laser-induced fluorescence (LIF) spectroscopy and polarizing microscopy. LIF spectroscopy integrates the signal from both elastin and collagen cross-linked structure, whereas birefringence is a measure of only collagen. Our purpose is (1) to evaluate the rat tail tendon (RTT) spectroscopy against data from purified extracted protein standards and (2) to correlate the two optical techniques in the study of RTT and skin. Spectra from tissue samples from 27 male rats and from extracted elastin and collagen were obtained using LIF spectroscopy (357 nm). Birefringence was measured on 5-mum histological sections of the same tissue. Morphometric analysis reveals that elastin represents approximately 10% of tendon volume and contributes to RTT fluorescence. RTT maximum fluorescence emission intensity (FEI(max)), which includes collagen and elastin, increases with animal weight (R(2)=0.64). Birefringence, when plotted against weight, increases to a plateau (nonlinear correlation: R(2)=0.90), tendon having greater birefringence than skin. LIF spectroscopy and collagen fiber birefringence are shown to provide complementary measurements of molecular structure (tendon birefringence versus FEI(max) at R(2)=0.60).

  11. Some phenomenological relations for strain-induced birefringence of amorphous polymers

    Energy Technology Data Exchange (ETDEWEB)

    Osaki, K.; Inoue, T. (Kyoto University, Kyoto (Japan). Institute for Chemical Research)

    1991-09-20

    In the present paper, we derive phenomenological relations for strain-induced birefringence on the basis of the linear response theory. In the time-scales of the rubbery plateau zone and the terminal flow zone, the birefringence and stress of amorphous polymers are related to each other through the stress-optical rule. The anisotropic component of the birefringence is proportional to the anisotropic component of the stress. The ratio of birefringence and stress, the stress-optical coefficient is constant in any deformation process. The stress-optical rule is not valid in the glassy and the glass-to-rubber transition zones. When the stress or the strain is sufficiently small, the birefringence may be described in terms of the linear response theory similar to the linear viscoelasticity theory. In this paper, we present some new relations among the response functions such as the time-dependent stress-optical coefficient and strain-optical coefficient. These equations may be employed in analyzing the birefringence in complicated deformation histories or confirming the consistency of data obtained for various deformation histories. 8 refs.

  12. Properties of monomeric paramyosin using a transient electric birefringence techniques.

    Science.gov (United States)

    DeLaney, D; Krause, S

    1976-01-01

    Paramyosin samples obtained from the chowder clam, Mercenaria mercenaria, by different extraction techniques were studied using transient electric birefringence techniques. The protein remain monomeric (unaggregated) in 1 mM buffer solution at pH 3.1 to 3.8 and near pH 10. At pH 3.2, the molecules obtained by different extraction techniques exhibit rotational diffusion constants that indicate a 5% difference in length between them, with the probable native form of paramyosin being the longer species. This difference in rotational diffusion constant disappears at higher pH, and, in addition, a large difference in dipole moment between the molecules observed at pH 3.2 also disappears at high pH. These results are used to hypothesize that the rodlike native paramyosin molecules have one or two partly flexible portions on their ends; at one end of each molecule this portion probably contains excess basic amino acids which are charged at low pH to account for the higher dipole moment of this form of paramyosin at these low pH values. At pH 3.2, these portions of the macromolecule are not flexible and act as stiff parts of the rodlike molecules, but they gradually become flexible at higher pH. Possible mechanisms for this change in flexibility are discussed.

  13. Time Circular Birefringence in Time-Dependent Magnetoelectric Media

    CERN Document Server

    Zhang, Ruo-Yang; Lin, Shi-Rong; Zhao, Qing; Wen, Weijia; Ge, Mo-Lin

    2015-01-01

    Light traveling in time-dependent media has many extraordinary properties which can be utilized to convert frequency, achieve temporal cloaking, and simulate cosmological phenomena. In this paper, we focus on time-dependent axion-type magnetoelectric (ME) media, and prove that light in these media always has two degenerate modes with opposite circular polarizations corresponding to one wave vector $\\mathbf{k}$, and name this effect "time circular birefringence" (TCB). By interchanging the status of space and time, the pair of TCB modes can appear simultaneously via "time refraction" and "time reflection" of a linear polarized incident wave at a time interface of ME media. The superposition of the two TCB modes causes the "time Faraday effect", namely the globally unified polarization axes rotate with time. A circularly polarized Gaussian pulse traversing a time interface is also studied. If the wave-vector spectrum of a pulse mainly concentrates in the non-traveling-wave band, the pulse will be trapped with n...

  14. Validating Laser-Induced Birefringence Theory with Plasma Interferometry

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Cecilia [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Cornell Univ., Ithaca, NY (United States)

    2015-09-02

    Intense laser beams crossing paths in plasma is theorized to induce birefringence in the medium, resulting from density and refractive index modulations that affect the polarization of incoming light. The goal of the associated experiment, conducted on Janus at Lawrence Livermore’s Jupiter Laser Facility, was to create a tunable laser-plasma waveplate to verify the relationship between dephasing angle and beam intensity, plasma density, plasma temperature, and interaction length. Interferometry analysis of the plasma channel was performed to obtain a density map and to constrain temperature measured from Thomson scattering. Various analysis techniques, including Fast Fourier transform (FFT) and two variations of fringe-counting, were tried because interferograms captured in this experiment contained unusual features such as fringe discontinuity at channel edges, saddle points, and islands. The chosen method is flexible, semi-automated, and uses a fringe tracking algorithm on a reduced image of pre-traced synthetic fringes. Ultimately, a maximum dephasing angle of 49.6° was achieved using a 1200 μm interaction length, and the experimental results appear to agree with predictions.

  15. Imaging of skin birefringence for human scar assessment using polarization-sensitive optical coherence tomography aided by vascular masking

    Science.gov (United States)

    Gong, Peijun; Chin, Lixin; Es'haghian, Shaghayegh; Liew, Yih Miin; Wood, Fiona M.; Sampson, David D.; McLaughlin, Robert A.

    2014-12-01

    We demonstrate the in vivo assessment of human scars by parametric imaging of birefringence using polarization-sensitive optical coherence tomography (PS-OCT). Such in vivo assessment is subject to artifacts in the detected birefringence caused by scattering from blood vessels. To reduce these artifacts, we preprocessed the PS-OCT data using a vascular masking technique. The birefringence of the remaining tissue regions was then automatically quantified. Results from the scars and contralateral or adjacent normal skin of 13 patients show a correspondence of birefringence with scar type: the ratio of birefringence of hypertrophic scars to corresponding normal skin is 2.2±0.2 (mean±standard deviation), while the ratio of birefringence of normotrophic scars to normal skin is 1.1±0.4. This method represents a new clinically applicable means for objective, quantitative human scar assessment.

  16. Diamond-based 1-D imaging arrays

    Energy Technology Data Exchange (ETDEWEB)

    Lansley, S.P.; Williams, O.A.; Ye, H. [Electronic and Electrical Engineering, University College London, Torrington Place, London WC1E 7JE (United Kingdom); Rizvi, N.; Whitfield, M.D.; Jackman, R.B. [Exitech Limited, Hanborough Park, Long Hanborough, Oxford OX8 8LH (United Kingdom); McKeag, R.D. [Centronic Ltd., Centronic House, King Henry' s Drive, New Addington, Croydon CR9 OBG (United Kingdom)

    2002-10-16

    Diamond has shown great promise for the fabrication of high sensitivity, low dark current, fast and visible-blind deep UV photodetectors. In addition to careful choice of substrate material, defect passivation treatments applied to the diamond after growth have been found to considerably enhance the detector characteristics achieved. In this paper we report on the first purposefully designed 1-D CVD diamond imaging array for the detection of nanosecond 193 nm excimer laser pulses using this approach. It is shown to perform extremely well, giving less than 2% pixel-to-pixel variation in signal response, and is fast enough to avoid any sign of charge build up during prolonged operation. (Abstract Copyright [2002], Wiley Periodicals, Inc.)

  17. Relaxation of a 1-D gravitational system

    CERN Document Server

    Valageas, P

    2006-01-01

    We study the relaxation towards thermodynamical equilibrium of a 1-D gravitational system. This OSC model shows a series of critical energies $E_{cn}$ where new equilibria appear and we focus on the homogeneous ($n=0$), one-peak ($n=\\pm 1$) and two-peak ($n=2$) states. Using numerical simulations we investigate the relaxation to the stable equilibrium $n=\\pm 1$ of this $N-$body system starting from initial conditions defined by equilibria $n=0$ and $n=2$. We find that in a fashion similar to other long-range systems the relaxation involves a fast violent relaxation phase followed by a slow collisional phase as the system goes through a series of quasi-stationary states. Moreover, in cases where this slow second stage leads to a dynamically unstable configuration (two peaks with a high mass ratio) it is followed by a new sequence ``violent relaxation/slow collisional relaxation''. We obtain an analytical estimate of the relaxation time $t_{2\\to \\pm 1}$ through the mean escape time of a particle from its potent...

  18. Ion-exchanged glass waveguides with low birefringence for a broad range of waveguide widths.

    Science.gov (United States)

    Yliniemi, Sanna; West, Brian R; Honkanen, Seppo

    2005-06-01

    Optical communications networks require integrated photonic components with negligible polarization dependence, which typically means that the waveguides must feature very low birefringence. Recent studies have shown that waveguides with low birefringence can be obtained, e.g., by use of silica-on-silicon waveguides or buried ion-exchanged glass waveguides. However, many integrated photonic circuits consist of waveguides with varying widths. Therefore low birefringence is consequently required for waveguides having different widths. This is a difficult task for most waveguide fabrication technologies. We present experimental results on waveguide birefringence for buried silver-sodium ion-exchanged glass waveguides. We show that the waveguide birefringence of the order of 10(-6) for waveguide mask opening widths ranging from 2 to 10 microm can be obtained by postprocessing the sample through annealing at an elevated temperature. The measured values are in agreement with the values calculated with our modeling software for ion-exchanged glass waveguides. This unique feature of ion-exchanged waveguides may be of significant importance in a wide variety of integrated photonic circuits requiring polarization-independent operation.

  19. Exposure and compositional factors that influence polarization induced birefringence in silica glass

    Science.gov (United States)

    Allan, Douglas C.; Mlejnek, Michal; Neukirch, Ulrich; Smith, Charlene M.; Smith, Frances M.

    2007-03-01

    Silica glass exhibits a permanent anisotropic response, referred to as polarization induced birefringence (PIB), when exposed to short wavelength, polarized light. The magnitude of the PIB has been empirically correlated with the OH content of the glass. Our recent studies pertaining to PIB have focused on careful characterization of PIB, with particular emphasis on understanding all of the contributions to the measured birefringence signal and finally extracting only that signal associated with birefringence arising from exposure to a polarized light beam. We will demonstrate that a critical contributor to the total birefringence signal is birefringence that comes from exposure beam inhomogeneities. After subtracting beam profile effects we are able to show that PIB is proportional to the OH content of the glass. Polarized infrared (IR) measurements were performed on glasses that developed PIB as a consequence of exposure to polarized 157-nm light. These studies reveal that there is preferential bleaching of a specific hydroxyl (OH) species in the glass with OH aligned parallel to the incident polarization undergoing more bleaching than those perpendicular. Further, we observe a very strong correlation between the measured PIB of these samples and the anisotropic bleaching. From these studies we propose a mechanism that can explain the role of hydroxyl in PIB.

  20. Cosmic birefringence fluctuations and cosmic microwave background B-mode polarization

    Directory of Open Access Journals (Sweden)

    Seokcheon Lee

    2015-06-01

    Full Text Available Recently, BICEP2 measurements of the cosmic microwave background (CMB B-mode polarization has indicated the presence of primordial gravitational waves at degree angular scales, inferring the tensor-to-scalar ratio of r=0.2 and a running scalar spectral index, provided that dust contamination is low. In this Letter, we show that the existence of the fluctuations of cosmological birefringence can give rise to CMB B-mode polarization that fits BICEP2 data with r<0.11 and no running of the scalar spectral index. When dust contribution is taken into account, we derive an upper limit on the cosmological birefringence, Aβ2<0.0075, where A is the amplitude of birefringence fluctuations that couple to electromagnetism with a coupling strength β.

  1. Birefringence measurement in polarization-sensitive optical coherence tomography using differential-envelope detection method

    Science.gov (United States)

    Kuo, Wen-Chuan; Lin, Shey-Chien; Chuang, Chung-Yu

    2010-05-01

    In this research, we integrated two demodulating logarithmic amplifiers with one differential amplifier for use in a Mach-Zehnder interferometer so as to obtain a two-channel polarization-sensitive optical coherence tomography system. Birefringence signals can be acquired using this system along with a differential-envelope detection method. Because the two orthogonal polarizations are common-path propagation, common noise originating from background fluctuations or multiple scattering in turbid media can be reduced to improve the detection sensitivity and accuracy of birefringence measurement. Besides, this simple and effective technique is an analog detection method and is capable of providing high temporal response; it can also help obtain a high time-bandwidth product as compared to the conventional method of using a numerical method with a limited sampling rate. The feasibility of the proposed system is supported by theory and is also shown by performing experiments involving a human vessel, which is a highly scattering medium with weak birefringence.

  2. Probing vacuum birefringence using x-ray free electron and optical high-intensity lasers

    CERN Document Server

    Karbstein, Felix

    2016-01-01

    Vacuum birefringence is one of the most striking predictions of strong field quantum electrodynamics: Probe photons traversing a strong field region can indirectly sense the applied "pump" electromagnetic field via quantum fluctuations of virtual charged particles which couple to both pump and probe fields. This coupling is sensitive to the field alignment and can effectively result in two different indices of refraction for the probe photon polarization modes giving rise to a birefringence phenomenon. In this article we perform a dedicated theoretical analysis of the proposed discovery experiment of vacuum birefringence at a x-ray free electron laser/optical high-intensity laser facility. Describing both pump and probe laser pulses realistically in terms of their macroscopic electromagnetic fields, we go beyond previous analyses by accounting for various effects not considered before in this context. Our study facilitates stringent quantitative predictions and optimizations of the signal in an actual experim...

  3. Probing vacuum birefringence using x-ray free electron and optical high-intensity lasers

    Science.gov (United States)

    Karbstein, Felix; Sundqvist, Chantal

    2016-07-01

    Vacuum birefringence is one of the most striking predictions of strong field quantum electrodynamics: Probe photons traversing a strong field region can indirectly sense the applied "pump" electromagnetic field via quantum fluctuations of virtual charged particles which couple to both pump and probe fields. This coupling is sensitive to the field alignment and can effectively result in two different indices of refraction for the probe photon polarization modes giving rise to a birefringence phenomenon. In this article, we perform a dedicated theoretical analysis of the proposed discovery experiment of vacuum birefringence at an x-ray free electron laser/optical high-intensity laser facility. Describing both pump and probe laser pulses realistically in terms of their macroscopic electromagnetic fields, we go beyond previous analyses by accounting for various effects not considered before in this context. Our study facilitates stringent quantitative predictions and optimizations of the signal in an actual experiment.

  4. Novel technique for distributed fibre sensing based on coherent Rayleigh scattering measurements of birefringence

    Science.gov (United States)

    Lu, Xin; Soto, Marcelo A.; Thévenaz, Luc

    2016-05-01

    A novel distributed fibre sensing technique is described and experimentally validated, based on birefringence measurements using coherent Rayleigh scattering. It natively provides distributed measurements of temperature and strain with more than an order of magnitude higher sensitivity than Brillouin sensing, and requiring access to a single fibre-end. Unlike the traditional Rayleigh-based coherent optical time-domain reflectometry, this new method provides absolute measurements of the measurand and may lead to a robust discrimination between temperature and strain in combination with another technique. Since birefringence is purposely induced in the fibre by design, large degrees of freedom are offered to optimize and scale the sensitivity to a given quantity. The technique has been validated in 2 radically different types of birefringent fibres - elliptical-core and Panda polarization-maintaining fibres - with a good repeatability.

  5. Enhanced Transmission Stability of Polarization Solitons in Birefringent Fibres with an Optical Phase Conjugator

    Institute of Scientific and Technical Information of China (English)

    陈伟成; 谢嘉宁; 路洪; 徐文成

    2003-01-01

    An optical phase conjugator is used to enhance transmission stability of polarization solitons in highly birefringent fibres. Two polarization solitons form a breather in fibres with low birefringence firstly and the optical phase conjugator is used to make the spectra of polarization solitons converse, which results in the fact that the polarization soliton along the fast axis is compressed due to the strengthened self-phase modulation effect. Two polarization solitons are compressed further due to the cross-phase modulation effect. The enhanced nonlinear effects make the central peak frequencies of two polarization solitons shift to the larger range in opposite directions so that they trap each other fully to suppress the effect of birefringence.

  6. A bifunctional amorphous polymer exhibiting equal linear and circular photoinduced birefringences.

    Science.gov (United States)

    Royes, Jorge; Provenzano, Clementina; Pagliusi, Pasquale; Tejedor, Rosa M; Piñol, Milagros; Oriol, Luis

    2014-11-01

    The large and reversible photoinduced linear and circular birefringences in azo-compounds are at the basis of the interest in these materials, which are potentially useful for several applications. Since the onset of the linear and circular anisotropies relies on orientational processes, which typically occur on the molecular and supramolecular length scale, respectively, a circular birefringence at least one order of magnitude lower than the linear one is usually observed. Here, the synthesis and characterization of an amorphous polymer with a dimeric repeating unit containing a cyanoazobenzene and a cyanobiphenyl moiety are reported, in which identical optical linear and circular birefringences are induced for proper light dose and ellipticity. A pump-probe technique and an analytical method based on the Stokes-Mueller formalism are used to investigate the photoinduced effects and to evaluate the anisotropies. The peculiar photoresponse of the polymer makes it a good candidate for applications in smart functional devices.

  7. Birefringence imaging of biological tissue by spectral domain polarization sensitive optical coherence tomography

    Science.gov (United States)

    Jing, Zhijun; Fan, Chuanmao; Jiang, Jingying; Gong, Qiang; Ma, Zhenhe; Zhang, Fan; Yao, Jianquan; Wang, R. K.

    2007-02-01

    A spectral domain Polarization sensitive optical coherence tomography (SDPS-OCT) system has been developed to acquire depth images of biological tissues such as porcine tendon, rabbit eye. The Stocks vectors (I, Q, U, and V) of the backscattered light from the biological tissues have been reconstructed. Further, the phase retardation and polarization degree between the two orthogonal polarizing states have been computed. Reconstructed images, i.e. birefringence images, from Stokes parameters, retardation and polarization degree of biological tissues show significant local variations in the polarization state. And the birefringence contrast of biological tissue possibly changes by some outside force. In addition, the local thickness of the birefringence layer determined with our system is significant. The results presented show SDPS-OCT is a potentially powerful technique to investigate tissue structural properties on the basis of the fact that any fibrous structure with biological tissues can influence the polarization state of light.

  8. Highly birefringent extruded elliptical-hole photonic crystal fibers with single defect and double defects

    Institute of Scientific and Technical Information of China (English)

    Zhongjiao He

    2009-01-01

    Highly birefringent elliptical-hole photonic crystal fibers(PCFs)with single defect and double defects are proposed,which are suppoosed to be achieved by extruding normal circular-hole PCFs based on a triangular lattice photonic crystal structure.Comparative research on the birefringence and the confinement loss of the proposed PCFs with single defect and double defects is presented.Simulation results show that the proposed PCFs with single defect and double defects can be with high birefringence(even up to the order of 10-2).The confinement loss increases when the ellipticity of the air hole of the PCFs increases,which nevertheless can be overconle by increasing the ring number or the area of the air holes in the fiber cladding.

  9. 1D-1D Coulomb drag in a 6 Million Mobility Bi-layer Heterostructure

    Science.gov (United States)

    Bilodeau, Simon; Laroche, Dominique; Xia, Jian-Sheng; Lilly, Mike; Reno, John; Pfeiffer, Loren; West, Ken; Gervais, Guillaume

    We report Coulomb drag measurements in vertically-coupled quantum wires. The wires are fabricated in GaAs/AlGaAs bilayer heterostructures grown from two different MBE chambers: one at Sandia National Laboratories (1.2M mobility), and the other at Princeton University (6M mobility). The previously observed positive and negative drag signals are seen in both types of devices, demonstrating the robustness of the result. However, attempts to determine the temperature dependence of the drag signal in the 1D regime proved challenging in the higher mobility heterostructure (Princeton), in part because of difficulties in aligning the wires within the same transverse subband configuration. Nevertheless, this work, performed at the Microkelvin laboratory of the University of Florida, is an important proof-of-concept for future investigations of the temperature dependence of the 1D-1D drag signal down to a few mK. Such an experiment could confirm the Luttinger charge density wave interlocking predicted to occur in the wires. Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under Contract DE-AC04-94AL8500.

  10. Flow-induced birefringence: the hidden PSF killer in high performance injection-molded plastic optics

    Science.gov (United States)

    Chidley, Matthew D.; Tkaczyk, Tomasz; Kester, Robert; Descour, Michael R.

    2006-02-01

    A 7-mm OD, NA = 1 water immersion injection-molded plastic endoscope objective has been fabricated for a laser scanning fiber confocal reflectance microscope (FCRM) system specifically designed for in vivo detection of cervical and oral pre-cancers. Injection-molded optics was selected for the ability to incorporate aspheric surfaces into the optical design and its high volume capabilities. Our goal is high performance disposable endoscope probes. This objective has been built and tested as a stand-alone optical system, a Strehl ratio greater than 0.6 has been obtained. One of the limiting factors of optical performance is believed to be flow-induced birefringence. We have investigated different configurations for birefringence visualization and believe the circular polariscope is most useful for inspection of injection-molded plastic optics. In an effort to decrease birefringence effects, two experiments were conducted. They included: (1) annealing of the optics after fabrication and (2) modifying the injection molding prameters (packing pressures, injection rates, and hold time). While the second technique showed improvement, the annealing process could not improve quality without physically warping the lenses. Therefore, to effectively reduce flow-induced birefringence, molding conditions have to be carefully selected. These parameters are strongly connected to the physical part geometry. Both optical design and fabrication technology have to be considered together to deliver low birefringence while maintaining the required manufacturing tolerances. In this paper we present some of our current results that illustrate how flow-induced birefringence can degrade high performance injection-molded plastic optical systems.

  11. EPOXY-BASED AZO POLYMERS WITH HIGH CHROMOPHORE DENSITY:SYNTHESIS, CHARACTERIZATION AND PHOTOINDUCED BIREFRINGENCE

    Institute of Scientific and Technical Information of China (English)

    Xiao-lin Wang; Xiao-gong Wang

    2012-01-01

    Three epoxy-based azo polymers (PEP-AZ-C1,PEP-AZ-CN and PEP-AZ-NT) with high chromophore density were synthesized by using post-polymerization azo-coupling reactions between epoxy-bascd precursor polymer (PEP-AN)and diazonium salts of 4-chloroaniline,4-aminobenzonitrile and 4-nitroaniline,respectively.The structures and properties of the azo polymers were characterized by using 1H-NMR,FT-IR,UV-Vis and thermal analyses.The photoinduced birefringence of the azo polymers was studied by irradiating spin-coated films of the polymers with laser beam at three different wavelengths (488,532,and 589 nm).The results indicate that the photoinduced birefringence of the azo polymers is related with the electron-withdrawing group on azo chromophores and the excitation wavelength.The excitation wavelength that can cause the efficient responses is determined by the absorption band positions of the azo chromophores,which are mainly affected by the electron-withdrawing group on the chromophores.Therefore,the azo polymers containing chromophores with different electron-withdrawing groups show different responsive behavior to the irradiation light at different wavelengths.When irradiated with 488 nm light,PEP-AZ-Cl shows the shortest time to reach the saturated birefringence but with the lowest saturation birefringence level compared with the other two azo polymers.When irradiated with 532 nm light,PEP-AZ-CN shows the shortest time to reach the saturated birefringence.When irradiated with 532 and 589 nm light,PEP-AZ-NT shows the highest saturation birefringence level.

  12. Femtosecond laser fabrication of birefringent directional couplers as polarization beam splitters in fused silica.

    Science.gov (United States)

    Fernandes, Luís A; Grenier, Jason R; Herman, Peter R; Aitchison, J Stewart; Marques, Paulo V S

    2011-06-20

    Integrated polarization beam splitters based on birefringent directional couplers are demonstrated. The devices are fabricated in bulk fused silica glass by femtosecond laser writing (300 fs, 150 nJ at 500 kHz, 522 nm). The birefringence was measured from the spectral splitting of the Bragg grating resonances associated with the vertically and horizontally polarized modes. Polarization splitting directional couplers were designed and demonstrated with 0.5 dB/cm propagation losses and -19 dB and -24 dB extinction ratios for the polarization splitting.

  13. Highly birefringent suspended-core photonic microcells for refractive-index sensing

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Chao [Department of Electrical Engineering, The Hong Kong Polytechnic University, Hong Kong (China); The Hong Kong Polytechnic University Shenzhen Research Institute, Shenzhen 518057 (China); Jin, Wa; Ma, Jun; Jin, Wei, E-mail: eewjin@polyu.edu.hk; Yang, Fan; Ho, Hoi Lut [Department of Electrical Engineering, The Hong Kong Polytechnic University, Hong Kong (China); Liao, Changrui; Wang, Yiping [Key Laboratory of Optoelectronic Devices and Systems of Ministry of Education/Guangdong Province, Shenzhen University, Shenzhen 518060 (China)

    2014-08-11

    An in-line photonic microcell with a highly birefringent suspended microfiber core is fabricated by locally heating and pressurizing selected air-holes of an endless single mode photonic crystal fiber. The microfiber core has rhombus-like cross-sectional geometry and could achieve a high birefringence of up to 10{sup −2}. The microfiber core is fixed at the center of the microcell by thin struts attached to an outer jacket tube, which protects and isolates the microfiber from environmental contaminations. Highly sensitive and robust refractive index sensors based on such microcells are experimentally demonstrated.

  14. A complex-polarization-propagator protocol for magneto-chiral axial dichroism and birefringence dispersion

    DEFF Research Database (Denmark)

    Cukras, Janusz; Kauczor, Joanna; Norman, Patrick

    2016-01-01

    A computational protocol for magneto-chiral dichroism and magneto-chiral birefringence dispersion is presented within the framework of damped response theory, also known as complex polarization propagator theory, at the level of time-dependent Hartree–Fock and time-dependent density functional...... theory. Magneto-chiral dichroism and magneto-chiral birefringence spectra in the (resonant) frequency region below the first ionization threshold of R-methyloxirane and L-alanine are presented and compared with the corresponding results obtained for both the electronic circular dichroism and the magnetic...

  15. Coherent ultrashort pulse generation from incoherent light by pulse trapping in birefringent fibers.

    Science.gov (United States)

    Shiraki, Eiji; Nishizawa, Norihiko

    2012-05-07

    We investigated the nonlinear fiber phenomena of pulse trapping and amplification between incoherent light and an ultrashort soliton pulse in birefringent fibers both experimentally and numerically. Using the phenomena in a 1.4 km-long low-birefringence fiber, a coherent, nearly transform-limited, sech2-shaped, ultrashort pulse was generated from incoherent light from a super-luminescent diode. The average pulse energy and pulse width were 121 pJ and 640 fs, respectively. The estimated gain of this system was as large as 62 dB.

  16. ANALYSIS OF INDEXED-GUIDED HIGHLY BIREFRINGENT PHOTONIC CRYSTAL FIBER EMPLOYING DIFFERENT CLADDING GEOMETRIES

    Directory of Open Access Journals (Sweden)

    A. M. Jouri

    2015-07-01

    Full Text Available      In this paper, a comparative study of three geometries of highly birefringent photonic crystal fibers (HB PCF is presented. The proposed geometries are: V type PCF, Pseudo-Panda PCF and selectively liquid-filled PCF. Based on the famous Finite Difference Time Domain (FDTD method with the perfectly matched layer (PML boundary condition, the simulations are carried out in the aim to find a tradeoff between the chromatic dispersion, the birefringence and the confinement loss.

  17. Analysis of birefringence in magneto-optical waveguides based on nanoparticles doped sol–gel matrix with an optimized substrate

    Energy Technology Data Exchange (ETDEWEB)

    Lebbal, M.R., E-mail: Lebbalmohamedredha@yahoo.fr; Boumaza, T.; Bouchemat, M.

    2015-01-01

    The elimination of birefringence remains a key challenge in integrated optical systems. In this work, we present birefringence study based on the controlling of layer thickness of planar waveguides, using deposited layers based on magnetic nanoparticles. The birefringence can be reduced with a planar device, depending on a glass substrate. The simulation carried out by MATLAB allowed us to deduce the conditions to decrease the phase mismatch and increase the conversion ratio of modes. - Highlights: • We simulate the birefringence in isotropic and anisotropic waveguides. • The perpendicularly applied gelation field is very promising in decreasing the birefringence. • It is very promising to use the glass substrate and adjust the thin layer thickness. • The glass substrate contributes in increasing the range of mono-mode waveguide. • The optimal thickness is taken close to the cut-off thickness of the 2nd mode TE.

  18. Analysis list: Nr1d2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Nr1d2 Liver + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d2.1.tsv... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d2.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d...2.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d2.Liver.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Liver.gml ...

  19. Analysis list: Nr1d1 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Nr1d1 Adipocyte,Cardiovascular,Liver,Neural + mm9 http://dbarchive.biosciencedbc.jp.../kyushu-u/mm9/target/Nr1d1.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d1.5.tsv http://db...archive.biosciencedbc.jp/kyushu-u/mm9/target/Nr1d1.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1....Adipocyte.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1.C...ardiovascular.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Nr1d1.Liver.tsv,http://dbarchive.biosc

  20. Effect of Third-order Dispersion of Birefringent Fiber on Pulse Transmission

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The effect of thirdorder dispersion on pulse transmission is discussed. The coupled nonlinear Schrdinger equations characterizing the birefringent singlemode fibers is solved numerically with combined consideration on chromatic dispersion, including second and thirdorder dispersions, polarization mode dispersion (PMD) and nonlinearity. Various simulation results are presented.

  1. The quantum vacuum in electromagnetic fields: From the Heisenberg-Euler effective action to vacuum birefringence

    CERN Document Server

    Karbstein, Felix

    2016-01-01

    The focus of these lectures is on the quantum vacuum subjected to classical electromagnetic fields. To this end we explicitly derive the renowned Heisenberg-Euler effective action in constant electromagnetic fields in a rather pedagogical and easy to conceive way. As an application, we use it to study vacuum birefringence constituting one of the most promising optical signatures of quantum vacuum nonlinearity.

  2. A photoelastic modulator-based birefringence imaging microscope for measuring biological specimens

    Science.gov (United States)

    Freudenthal, John; Leadbetter, Andy; Wolf, Jacob; Wang, Baoliang; Segal, Solomon

    2014-11-01

    The photoelastic modulator (PEM) has been applied to a variety of polarimetric measurements. However, nearly all such applications use point-measurements where each point (spot) on the sample is measured one at a time. The main challenge for employing the PEM in a camera-based imaging instrument is that the PEM modulates too fast for typical cameras. The PEM modulates at tens of KHz. To capture the specific polarization information that is carried on the modulation frequency of the PEM, the camera needs to be at least ten times faster. However, the typical frame rates of common cameras are only in the tens or hundreds frames per second. In this paper, we report a PEM-camera birefringence imaging microscope. We use the so-called stroboscopic illumination method to overcome the incompatibility of the high frequency of the PEM to the relatively slow frame rate of a camera. We trigger the LED light source using a field-programmable gate array (FPGA) in synchrony with the modulation of the PEM. We show the measurement results of several standard birefringent samples as a part of the instrument calibration. Furthermore, we show results observed in two birefringent biological specimens, a human skin tissue that contains collagen and a slice of mouse brain that contains bundles of myelinated axonal fibers. Novel applications of this PEM-based birefringence imaging microscope to both research communities and industrial applications are being tested.

  3. Design of a pentagonal photonic crystal fiber with high birefringence and large flattened negative dispersion.

    Science.gov (United States)

    Li, Xuyou; Liu, Pan; Xu, Zhenlong; Zhang, Zhiyong

    2015-08-20

    Novel pentagonal photonic crystal fiber with high birefringence, large flattened negative dispersion, and high nonlinearity is proposed. The dispersion and birefringence properties of this structure are simulated and analyzed numerically based on the full vector finite element method (FEM). Numerical results indicate that the fiber obtains a large average dispersion of -611.9  ps/nm/km over 1,460-1,625 nm and -474  ps/nm/km over 1425-1675 nm wavelength bands for two kinds of optimized designs, respectively. In addition, the proposed PCF shows a high birefringence of 1.67×10-2 and 1.75×10-2 at the operating wavelength of 1550 nm. Moreover, the influence of the possible variation in the parameters during the fabrication process on the dispersion and birefringence properties is studied. The proposed PCF would have important applications in polarization maintaining transmission systems, residual dispersion compensation, supercontinuum generation, and the design of widely tunable wavelength converters based on four-wave mixing.

  4. Polarization modulational instability in a birefringent optical fiber with fourth order dispersion

    Indian Academy of Sciences (India)

    R Ganapathy; V C Kuriakose

    2001-10-01

    We obtain conditions for the occurrence of polarization modulational instability in the anomalous and normal dispersion regimes for the coupled nonlinear Schrödinger equation modelling fourth order dispersion effects when the linearly polarized pump is oriented at arbitrary angles with respect to the slow and fast axes of the birefringent fiber.

  5. Light-induced circular birefringence in cyanoazobenzene side-chain liquid-crystalline polyester films

    DEFF Research Database (Denmark)

    Naydenova, I; Nikolova, L; Ramanujam, P.S.;

    1999-01-01

    We report the inducement of large circular birefringence (optical activity) in films of a cyanoazobenzene side-chain liquid-crystalline polyester on illumination with circularly polarized light. The polyester has no chiral groups and is initially isotropic. The induced optical rotation is up to 5...

  6. Extremely High-Birefringent Asymmetric Slotted-Core Photonic Crystal Fiber in THz Regime

    DEFF Research Database (Denmark)

    Islam, Raonaqul; Habib, Selim; Hasanuzzaman, G.K.M.

    2015-01-01

    of the circular cladding confines most of the power in the fiber-core. The fiber structure reported in this letter exhibits simultaneously ultrahigh modal birefringence of 7.5 × 10−2 and a very low effective absorption loss of 0.07 cm−1 for y-polarization mode at an operating frequency of 1 THz. It is highly...

  7. The measurement system of birefringence and Verdet constant of optical fiber

    Science.gov (United States)

    Huang, Yi; Chen, Li; Guo, Qiang; Pang, Fufei; Wen, Jianxiang; Shang, Yana; Wang, Tingyun

    2013-12-01

    The Faraday magneto-optical effect of optical fiber has many applications in monitoring magnetic field and electric current. When a linearly polarized light propagates in the direction of a magnetic field, the plane of polarization will rotate linearly proportional to the strength of the applied magnetic field, which following the relationship of θF =VBl. θF is the Faraday rotation angle, which is proportional to the magnetic flux density B and the Verdet constant V . However, when the optical fiber contains the effect of linear birefringence, the detection of Faraday rotation angle will depend on the line birefringence. In order to determine the Verdet constant of an optical fiber under a linear birefringence, the fiber birefringence needs to be accurately measured. In this work, a model is applied to analyze the polarization properties of an optical fiber by using the Jones matrix method. A measurement system based on the lock-in amplifier technology is designed to test the Verdet constant and the birefringence of optical fiber. The magnetic field is produced by a solenoid with a DC current. A tunable laser is intensity modulated with a motorized rotating chopper. The actuator supplies a signal as the phase-locked synchronization reference to the signal of the lock-in amplifier. The measurement accuracy is analyzed and the sensitivity of the system is optimized. In this measurement system, the Verdet constant of the SMF-28 fiber was measured to be 0.56±0.02 rad/T·m at 1550nm. This setup is well suitable for measuring the high signal-to-noise ratio (SNR) sensitivity for lock-in amplifier at a low magnetic field strength.

  8. A 1D version of EllipSys

    DEFF Research Database (Denmark)

    van der Laan, Paul; Sørensen, Niels N.

    2017-01-01

    A one-dimensional version of EllipSys, labeled as EllipSys1D is presented. Three atmospheric boundary layer test cases are used to show that results of EllipSys1D are exactly the same or very similar as results of EllipSys3D, while EllipSys1D uses 3 to 4 orders of magnitude less CPU hours compared...

  9. Use of retinal nerve fiber layer birefringence as an addition to absorption in retinal scanning for biometric purposes

    Science.gov (United States)

    Agopov, Mikael; Gramatikov, Boris I.; Wu, Yi-Kai; Irsch, Kristina; Guyton, David L.

    2008-03-01

    We built a device sensitive to the birefringence of the retinal nerve fiber layer for biometric purposes. A circle of 20° diameter on the retina was scanned around the optic disk with a spot of light from a 785 nm laser diode. The nonbirefringent blood vessels indenting or displacing the retinal nerve fiber layer were seen as “blips” in the measured birefringence-derived signal. For comparison, the reflection-absorption signature of the blood vessel pattern in the scanned circle was also measured. The birefringence-derived signal proved to add useful information to the reflectance-absorption signature for retinal biometric scanning.

  10. Influence of the Wavelength Dependence of Birefringence in the Generation of Supercontinuum and Dispersive Wave in Fiber Optics

    Directory of Open Access Journals (Sweden)

    Rodrigo Acuna Herrera

    2017-01-01

    Full Text Available In this paper, we perform numerical analysis about the influence of the wavelength dependence of birefringence (WDB in the Supercontinuum (SC and dispersive wave (DW generation. We study different birefringence profiles such as constant, linear, and parabolic. We see that, for a linear and parabolic profile, the generation of SC practically does not change, while this does so when the constant value of the birefringence varies. Similar situation happens with the generation of dispersive waves. In addition, we observe that the broadband of the SC increases when the Stimulated Raman Scattering (SRS is neglected for all WDB profiles.

  11. Diffusion and particle mobility in 1D system

    NARCIS (Netherlands)

    Borman, V. D.; Johansson, B.; Skorodumova, N. V.; Tronin, I. V.; Tronin, V. N.; Troyan, V. I.

    2006-01-01

    The transport properties of one-dimensional (1D) systems have been studied theoretically. Contradictory experimental results on molecular transport in quasi-1D systems, such as zeolite structures, when both diffusion transport acceleration and the existence of the diffusion mode with lower particle

  12. SANS, SAXS, rheology and birefringence-strengths and weaknesses in probing phase behaviour of a diblock copolymer

    DEFF Research Database (Denmark)

    Vigild, Martin Etchells; Eskimergen, Rüya; Mortensen, Kell

    2004-01-01

    Asymmetrically composed diblock copolymers exhibit multiphase behaviour and transit the lamellae, gyroid and hexagonal cylindrical phases before reaching the order–disorder temperature, TODT. During a heating experiment towards TODT we observe that birefringence measurements are more sensitive th...

  13. Spectral-domain measurement of the strain sensitivity of phase modal birefringence of polarization-maintaining optical fibers

    Science.gov (United States)

    Kaczmarek, Cezary

    2016-09-01

    The paper presents a new and simple method of measuring the strain sensitivity of phase modal birefringence (dΔn/dε) of polarization maintaining fibers (PMFs). The method is based on measuring the spectral strain sensitivity of a strain sensor in the configuration of a Sagnac interferometer with a PMF. The measured spectral strain sensitivity of the sensor is used to determine the strain sensitivity of phase modal birefringence and the polarimetric strain sensitivity of the PMF. In addition, a new procedure for determining the sign of the strain sensitivity of phase and group modal birefringence of a PMF. Using this method, measurements of the strain sensitivity of modal birefringence of PMFs were performed: a PM-PCF and a Bow-Tie fiber, in the wavelength range 1460-1600 nm. A comparison of the results of these measurements with results obtained using other methods for the same types of fibers is presented.

  14. Segment Orientation and Optical Birefringence of Amorphous Polymers Under Tensile Deformation: Novel Computational Method applied to Different Glassy Polycarbonates

    Science.gov (United States)

    Natarajan, Upendra; Sulatha, M. S.

    2005-03-01

    Orientation dependent optical properties of Bisphenol A polycarbonate and two aliphatic substituted polycarbonates in glassy phase have been studied by atomistic modeling using molecular mechanics simulations under tensile deformation. Probability distributions and orientation functions show that phenylene rings and carbonate groups vectors along the main chain orient towards stretching direction following deformation. Interchain packing of rings and carbonates become ordered with strain. Efficient computational approach for calculation of optical birefringence of amorphous polymers is presented and applied to the polycarbonates in detail. Polarizability anisotropy of the polymer segments and chain as a function of deformation is calculated by combining information on the conformations and group polarizabilities, and used to estimate birefringence during deformation. Simulated and experimental values for segment orientation and bulk birefringence are in very good agreement. Effect of the optical properties of atomic groups on bulk birefringence is brought forth for the first time by molecular simulation for polymers other than polyethylene.

  15. 3-D TECATE/BREW: Thermal, stress, and birefringent ray-tracing codes for solid-state laser design

    Science.gov (United States)

    Gelinas, R. J.; Doss, S. K.; Nelson, R. G.

    1994-07-01

    This report describes the physics, code formulations, and numerics that are used in the TECATE (totally Eulerian code for anisotropic thermo-elasticity) and BREW (birefringent ray-tracing of electromagnetic waves) codes for laser design. These codes resolve thermal, stress, and birefringent optical effects in 3-D stationary solid-state systems. This suite of three constituent codes is a package referred to as LASRPAK.

  16. A novel synthesis approach for birefringent filters having arbitrarily amplitude transmittances

    Science.gov (United States)

    Halassi, Abde Rezzaq; Hamdi, Rachid; Bendimerad, Djalal Falih; Benkelfat, Badr-Eddine

    2016-06-01

    In this paper, we present a novel procedure for the synthesis of a filter having an arbitrarily specified amplitude transmittance. The filter configuration consists of N birefringent stages placed between a polarizer and an analyzer, with each stage containing an identical section and a variable section. An additional variable section is placed in front of the analyzer. The synthesis procedure is based on the resolution of a generalized nonlinear equation system directly deducted from the Jones matrix formalism to determine the angles of each stage, the angle of the analyzer and the phase shifts of the variable sections. A typical example of a 6-stage birefringent filter having an arbitrarily non-symmetric amplitude transmittance is shown and the opto-geometrical parameters are given to demonstrate the efficiency of the proposed synthesis procedure. The results obtained show an excellent agreement with those developed in the literature.

  17. Anomalous birefringence in andradite-grossular solid solutions: a quantum-mechanical approach

    Science.gov (United States)

    Lacivita, Valentina; D'Arco, Philippe; Orlando, Roberto; Dovesi, Roberto; Meyer, Alessio

    2013-11-01

    The static linear optical properties (refractive indices, birefringence and axial angle) of andradite-grossular (Ca3Fe2Si3O12-Ca3Al2Si3O12) solid solutions have been computed at the ab initio quantum-mechanical level through the Coupled Perturbed Kohn-Sham scheme, using an all-electron Gaussian-type basis set. Geometry relaxation after substitution of 1-8 Al for Fe atoms in the primitive cell of andradite yields 23 non-equivalent configurations ranging from cubic to triclinic symmetry. Refractive indices vary quite regularly between the andradite (1.860) and grossular (1.671) end-members; the birefringence δ and the axial angle 2 V at intermediate compositions can be as large as 0.02° and 89°, respectively. Comparison with experiments suffers from inhomogeneities and impurities of natural samples; however, semi-quantitative agreement is observed.

  18. Negligible birefringence in dual-mode ion-exchanged glass waveguide gratings.

    Science.gov (United States)

    Yliniemi, Sanna; Albert, Jacques; Laronche, Albane; Castro, Jose M; Geraghty, David; Honkanen, Seppo

    2006-09-01

    Polarization dependence of UV-written Bragg gratings in buried ion-exchanged glass waveguides is investigated. A polarization-dependent shift in Bragg wavelength of less than 0.02 nm is measured, both for the even and the odd modes of a laterally dual-mode waveguide. The measured wavelength shift corresponds to a waveguide birefringence of the order of 10(-5), which is negligible for most applications in optical communications. It is observed that the UV-induced birefringence is small, within the limits of the measurement accuracy. The thermal stability of the fabricated gratings is also very good. The results are of particular importance for devices considered here since they require a polarization-independent mode-converting waveguide Bragg grating. Polarization-independent performance of these gratings enables the fabrication of a new class of integrated optical devices for telecommunication applications.

  19. Polarized light imaging of birefringence and diattenuation at high resolution and high sensitivity

    Science.gov (United States)

    Mehta, Shalin B.; Shribak, Michael; Oldenbourg, Rudolf

    2013-01-01

    Polarized light microscopy provides unique opportunities for analyzing the molecular order in man-made and natural materials, including biological structures inside living cells, tissues, and whole organisms. 20 years ago, the LC-PolScope was introduced as a modern version of the traditional polarizing microscope enhanced by liquid crystal devices for the control of polarization, and by electronic imaging and digital image processing for fast and comprehensive image acquisition and analysis. The LCPolScope is commonly used for birefringence imaging, analyzing the spatial and temporal variations of the differential phase delay in ordered and transparent materials. Here we describe an alternative use of the LC-PolScope for imaging the polarization dependent transmittance of dichroic materials. We explain the minor changes needed to convert the instrument between the two imaging modes, discuss the relationship between the quantities measured with either instrument, and touch on the physical connection between refractive index, birefringence, transmittance, diattenuation, and dichroism. PMID:24273640

  20. Measurement of stress-induced birefringence in glasses based on reflective laser feedback effect

    Science.gov (United States)

    Haisha, Niu; YanXiong, Niu; Jiyang, Li

    2017-02-01

    A glass birefringence measurement system utilizing the reflective laser feedback (RLF) effect is presented. The measurement principle is analyzed based on the equivalent cavity of a Fabry-Perot interferometer, and the experiments are conducted with a piece of quartz glass with applied extrusion force. In the feedback system, aluminum film used as a feedback mirror is affixed to the back of the sample. When the light is reflected back into the cavity, as the reinjected light is imprinted with the birefringence information in the sample, the gain and polarization states of the laser are modulated. The variation of optical power and polarization states hopping is monitored to obtain the magnitude of the stress. The system has advantages such as simplicity and low-cost with a precision of 1.9 nm. Moreover, by adjusting the position of the aluminum, large-area samples can be measured anywhere at any place.

  1. Design of low-loss and highly birefringent hollow-core photonic crystal fiber

    Science.gov (United States)

    Roberts, P. J.; Williams, D. P.; Sabert, H.; Mangan, B. J.; Bird, D. M.; Birks, T. A.; Knight, J. C.; Russell, P. St. J.

    2006-08-01

    A practical hollow-core photonic crystal fiber design suitable for attaining low-loss propagation is analyzed. The geometry involves a number of localized elliptical features positioned on the glass ring that surrounds the air core and separates the core and cladding regions. The size of each feature is tuned so that the composite core-surround geometry is antiresonant within the cladding band gap, thus minimizing the guided mode field intensity both within the fiber material and at material / air interfaces. A birefringent design, which involves a 2-fold symmetric arrangement of the features on the core-surround ring, gives rise to wavelength ranges where the effective index difference between the polarization modes is larger than 10-4. At such high birefringence levels, one of the polarization modes retains favorable field exclusion characteristics, thus enabling low-loss propagation of this polarization channel.

  2. Novel laser machining of optical fibers for long cavities with low birefringence

    CERN Document Server

    Takahashi, Hiroki; Orucevic, Fedja; Noguchi, Atsushi; Kassa, Ezra; Keller, Matthias

    2015-01-01

    We present a novel method of machining optical fiber surfaces with a CO${}_2$ laser for use in Fiber-based Fabry-Perot Cavities (FFPCs). Previously FFPCs were prone to large birefringence and limited to relatively short cavity lengths ($\\le$ 200 $\\mu$m). These characteristics hinder their use in some applications such as cavity quantum electrodynamics with trapped ions. We optimized the laser machining process to produce large, uniform surface structures. This enables the cavities to achieve high finesse even for long cavity lengths. By rotating the fibers around their axis during the laser machining process the asymmetry resulting from the laser's transverse mode profile is eliminated. Consequently we are able to fabricate fiber mirrors with a high degree of rotational symmetry, leading to remarkably low birefringence. Through measurements of the cavity finesse over a range of cavity lengths and the polarization dependence of the cavity linewidth, we confirmed the quality of the produced fiber mirrors for us...

  3. A device for continuous monitoring of true central fixation based on foveal birefringence.

    Science.gov (United States)

    Gramatikov, Boris; Irsch, Kristina; Müllenbroich, Marie; Frindt, Nicole; Qu, Yinhong; Gutmark, Ron; Wu, Yi-Kai; Guyton, David

    2013-09-01

    A device for continuous monitoring of central fixation utilizes birefringence, the property of the Henle fibers surrounding the human fovea, to change the polarization state of light. A circular scan of retinal birefringence, where the scanning circle encompasses the fovea, allows identification of true central fixation-an assessment much needed in various applications in ophthalmology, psychology, and psychiatry. The device allows continuous monitoring for central fixation over an extended period of time in the presence of fixation targets and distracting stimuli, which may be helpful in detecting attention deficit hyperactivity disorder, autism spectrum disorders, and other disorders characterized by changes in the subject's ability to maintain fixation. A proof-of-concept has been obtained in a small study of ADHD patients and normal control subjects.

  4. A complex-polarization-propagator protocol for magneto-chiral axial dichroism and birefringence dispersion.

    Science.gov (United States)

    Cukras, Janusz; Kauczor, Joanna; Norman, Patrick; Rizzo, Antonio; Rikken, Geert L J A; Coriani, Sonia

    2016-05-21

    A computational protocol for magneto-chiral dichroism and magneto-chiral birefringence dispersion is presented within the framework of damped response theory, also known as complex polarization propagator theory, at the level of time-dependent Hartree-Fock and time-dependent density functional theory. Magneto-chiral dichroism and magneto-chiral birefringence spectra in the (resonant) frequency region below the first ionization threshold of R-methyloxirane and l-alanine are presented and compared with the corresponding results obtained for both the electronic circular dichroism and the magnetic circular dichroism. The additional information content yielded by the magneto-chiral phenomena, as well as their potential experimental detectability for the selected species, is discussed.

  5. Detecting relic gravitational waves in the CMB: The contamination caused by the cosmological birefringence

    Directory of Open Access Journals (Sweden)

    Wen Zhao

    2014-10-01

    Full Text Available The B-mode polarization of the cosmic microwave background (CMB radiation is an excellent information channel for the detection of relic gravitational waves. However, the detection is contaminated by the B-mode polarization generated by some other effects. In this paper, we discuss the contaminations caused by the cosmological birefringence, which converts the CMB E-mode to the B-mode, and forms the effective noise for the detection of gravitational waves. We find that this contamination is significant, if the rotation angle is large. However, this kind of B-mode can be properly de-rotated, and the effective noises can be greatly reduced. We find that, comparing with the contaminations caused by cosmic weak lensing, the residual polarization generated by the cosmological birefringence is negligible for the detection of relic gravitational waves in the CMB.

  6. Birefringence and residual stress induced by CO2 laser mitigation of damage growth in fused silica

    Science.gov (United States)

    Gallais, L.; Cormont, P.; Rullier, J. L.

    2009-10-01

    We investigate the residual stress field created near mitigated sites and its influence on the efficiency on the CO2 laser mitigation of damage growth process. A numerical model of CO2 laser interaction with fused silica is developed that take into account laser energy absorption, heat transfer, thermally-induced stress and birefringence. Specific photoelastic methods are developed to characterize the residual stress near mitigated sites in fused silica samples. The stress distribution and quantitative values of stress levels are obtained for sites treated with the CO2 laser in various conditions of energy deposition (beam size, pulse duration, incident power). The results obtained also show that the presence of birefringence/residual stress around the mitigated sites has a critical effect on their laser damage resistance.

  7. Competition of Faraday rotation and birefringence in femtosecond laser direct written waveguides in magneto-optical glass.

    Science.gov (United States)

    Liu, Qiang; Gross, S; Dekker, P; Withford, M J; Steel, M J

    2014-11-17

    We consider the process of Faraday rotation in femtosecond laser direct-write waveguides. The birefringence commonly associated with such waveguides may be expected to impact the observable Faraday rotation. Here, we theoretically calculate and experimentally verify the competition between Faraday rotation and birefringence in two waveguides created by laser writing in a commercial magneto-optic glass. The magnetic field applied to induce Faraday rotation is nonuniform, and as a result, we find that the two effects can be clearly separated and used to accurately determine even weak birefringence. The birefringence in the waveguides was determined to be on the scale of Δn = 10(-6) to 10(-5). The reduction in Faraday rotation caused by birefringence of order Δn = 10(-6) was moderate and we obtained approximately 9° rotation in an 11 mm waveguide. In contrast, for birefringence of order 10(-5), a significant reduction in the polarization azimuth change was found and only 6° rotation was observed.

  8. Interaction of environmental contaminants with zebrafish organic anion transporting polypeptide, Oatp1d1 (Slco1d1)

    Energy Technology Data Exchange (ETDEWEB)

    Popovic, Marta; Zaja, Roko [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia); Fent, Karl [University of Applied Sciences Northwestern Switzerland, School of Life Sciences, Gründenstrasse 40, CH-4132 Muttenz (Switzerland); Swiss Federal Institute of Technology (ETH Zürich), Department of Environmental System Sciences, Institute of Biogeochemistry and Pollution Dynamics, CH-8092 Zürich (Switzerland); Smital, Tvrtko, E-mail: smital@irb.hr [Laboratory for Molecular Ecotoxicology, Division for Marine and Environmental Research, Rudjer Boskovic Institute, Bijenicka 54, 10 000 Zagreb (Croatia)

    2014-10-01

    Polyspecific transporters from the organic anion transporting polypeptide (OATP/Oatp) superfamily mediate the uptake of a wide range of compounds. In zebrafish, Oatp1d1 transports conjugated steroid hormones and cortisol. It is predominantly expressed in the liver, brain and testes. In this study we have characterized the transport of xenobiotics by the zebrafish Oatp1d1 transporter. We developed a novel assay for assessing Oatp1d1 interactors using the fluorescent probe Lucifer yellow and transient transfection in HEK293 cells. Our data showed that numerous environmental contaminants interact with zebrafish Oatp1d1. Oatp1d1 mediated the transport of diclofenac with very high affinity, followed by high affinity towards perfluorooctanesulfonic acid (PFOS), nonylphenol, gemfibrozil and 17α-ethinylestradiol; moderate affinity towards carbaryl, diazinon and caffeine; and low affinity towards metolachlor. Importantly, many environmental chemicals acted as strong inhibitors of Oatp1d1. A strong inhibition of Oatp1d1 transport activity was found by perfluorooctanoic acid (PFOA), chlorpyrifos-methyl, estrone (E1) and 17β-estradiol (E2), followed by moderate to low inhibition by diethyl phthalate, bisphenol A, 7-acetyl-1,1,3,4,4,6-hexamethyl-1,2,3,4 tetrahydronapthalene and clofibrate. In this study we identified Oatp1d1 as a first Solute Carrier (SLC) transporter involved in the transport of a wide range of xenobiotics in fish. Considering that Oatps in zebrafish have not been characterized before, our work on zebrafish Oatp1d1 offers important new insights on the understanding of uptake processes of environmental contaminants, and contributes to the better characterization of zebrafish as a model species. - Highlights: • We optimized a novel assay for determination of Oatp1d1 interactors • Oatp1d1 is the first SLC characterized fish xenobiotic transporter • PFOS, nonylphenol, diclofenac, EE2, caffeine are high affinity Oatp1d1substrates • PFOA, chlorpyrifos

  9. Influence of Feedback Levels on Polarized Optical Feedback Characteristics in Zeeman-Birefringence Dual Frequency Lasers

    Institute of Scientific and Technical Information of China (English)

    MAO Wei; ZHANG Shu-Lian; ZHOU Lu-Fei; LIU Xiao-Yan; WANG Ming-Ming

    2007-01-01

    The influence of Feedback levels on the intensity and polarization properties of polarized optical feedback in a Zeeman-birefringence dual frequency laser is systematically investigated. By changing the feedback power ratio, different feedback levels are obtained. Three distinct regimes of polarized optical feedback effects are found and defined as regimes Ⅰ, Ⅱand Ⅲ. The feedback level boundaries among the regimes are acquired experimentally. The theoretical analysis is presented to be in good agreement with the experimental results.

  10. Study on Birefringent Color Generation for a Reflective Ferroelectric Liquid Crystal Display

    Science.gov (United States)

    Valyukh, Sergiy; Valyukh, Iryna; Xu, Peizhi; Chigrinov, Vladimir

    2006-10-01

    We study the possibility of a layer of a surface stabilized ferroelectric liquid crystal coupled with several retardation plates for birefringent color generation. Double and single polarizer reflective bistable dichromatic ferroelectric liquid crystal displays are considered. We demonstrate that one or two retardation plates are sufficient for a display having good color characteristics and high brightness. Optimal parameters for green/red and blue/yellow ferroelectric liquid crystal displays are found.

  11. Dispersion-managed soliton interactions in fibers with randomly varying birefringence

    Institute of Scientific and Technical Information of China (English)

    CAI; Ju; (蔡炬); YANG; Xianglin; (杨祥林)

    2003-01-01

    In this paper, a soliton transmission model in high-speed dispersion-managed systems is advanced, and the equation of intrachannel soliton interactions in randomly varying birefringent fibers is acquired. The soliton interactions with the impact of PMD in uniform dispersion systems and DMS systems are also investigated numerically. We reveal the change in the collision length with PMD and map strength, and verify the robustness of DMS to PMD in soliton interactions.

  12. Suppression of Soliton Timing Jitters in Fibers with Random Birefringence by Periodical Polarization Modulation

    Institute of Scientific and Technical Information of China (English)

    CHEN Wei-cheng; XU Wen-cheng

    2006-01-01

    Periodical polarization modulation scheme is proposed to suppress timing jitters induced by frequency fluctuations between two polarization components of solitons. In periodical polarization modulation scheme, the polarization states of the soliton are modulated to excite equally for suppressing timing jitters induced by two unequal polarization components in the soliton trapping. Moreover, polarization modulation can weaken the effect of random birefringence on the soliton pulses in each relay distance. The numerical result shows that the soliton timing jitters are suppressed by our proposed method.

  13. Longitudinal coherence properties of light waves propagating through a birefringent fiber.

    Science.gov (United States)

    Tsubokawa, M; Shibata, N; Higashi, T; Seikai, S

    1987-05-01

    Longitudinal coherence properties of the waves propagating through a birefringent fiber are investigated theoretically and experimentally. Significant loss due to the polarization-dispersion slope is observed clearly for the interference between the two orthogonally polarized HE(11) modes. The results obtained experimentally reflect the theoretical predictions well for both the modulus of the degree of coherence and its curve shape versus the optical path difference in the wavelength region from 816 to 1540 nm.

  14. Imaging of irradiated human costal cartilage birefringence by PS-OCT

    Energy Technology Data Exchange (ETDEWEB)

    Martinho Junior, Antonio C.; Freitas, Anderson Z.; Santin, Stefany P.; Soares, Fernando A.N.; Mosca, Rodrigo C.; Bringel, Fabiana A.; Mathor, Monica B., E-mail: freitas.az@ipen.b, E-mail: rmosca@usp.b, E-mail: mathor@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    Sterilization by ionizing radiation is a technique used for tissue banks around the world to avoid transmission of infectious diseases by human allografts. However, high doses of ionizing radiation may cause undesirable changes in tissue structure, decreasing its mechanical properties, for example. Optical Coherence Tomography (OCT) is a non destructive, non ionizing and real time method to investigate biological tissues without promote any change in tissue structure. Polarization Sensitive Optical Coherence Tomography (PS-OCT) is an OCT technique that combines polarimetry with low coherence reflectometry to provide depth resolved measurements from birefringent structures as collagen. Costal cartilages from 15 cadaveric donors were preserved in high concentration glycerol and each individual sample was divided in 6 fragments. One of them was kept as a control group and the others were irradiated with gamma radiation from a Co-60 source with doses of 15, 25, 50, 75 and 100 kGy. OCT and PS-OCT images of the same region of the samples were obtained from a device OCS 1300 SS (Thorlabs, USA) with a coupling polarization module PSOCT 1300 (Thorlabs, USA). According with our results, birefringence may be visualized in all test groups as well in the control group, suggesting that sterilization by ionizing radiation does not affect the collagen structure significantly to cause total loss of birefringence, even if high doses as 75 and 100 kGy are used. The next step of our work is to develop a new method to quantify the birefringence using the optical properties of the tissue. (author)

  15. Phase-locked pulses for two-dimensional spectroscopy by a birefringent delay line.

    Science.gov (United States)

    Brida, Daniele; Manzoni, Cristian; Cerullo, Giulio

    2012-08-01

    We introduce the translating wedge-based identical pulses encoding system, a novel device for the generation of collinear, interferometrically locked ultrashort pulse pairs. By means of birefringent wedges, we are able to control the pulse delay with attosecond precision and stability better that λ/360, without affecting the pulse duration and in a spectral range that spans from UV to mid-IR. This device is expected to dramatically simplify two-dimensional spectroscopy experiments.

  16. Birefringence and dispersion of cylindrically polarized modes in nanobore photonic crystal fiber

    CERN Document Server

    Euser, T G; Joly, N Y; Gabriel, C; Marquardt, C; Zang, L Y; Förtsch, M; Banzer, P; Brenn, A; Elser, D; Scharrer, M; Leuchs, G; Russell, P St J

    2010-01-01

    We demonstrate experimentally and theoretically that a nanoscale hollow channel placed centrally in the solid glass core of a photonic crystal fiber strongly enhances the cylindrical birefringence (the modal index difference between radially and azimuthally polarized modes). Furthermore, it causes a large split in group velocity and group velocity dispersion. We show analytically that all three parameters can be varied over a wide range by tuning the diameters of the nanobore and the core.

  17. Higher Order Statistsics of Stokes Parameters in a Random Birefringent Medium

    OpenAIRE

    Said, Salem; Bihan, Nicolas le

    2007-01-01

    We present a new model for the propagation of polarized light in a random birefringent medium. This model is based on a decomposition of the higher order statistics of the reduced Stokes parameters along the irreducible representations of the rotation group. We show how this model allows a detailed description of the propagation, giving analytical expressions for the probability densities of the Mueller matrix and the Stokes vector throughout the propagation. It also allows an exact descripti...

  18. Thermal distortion and birefringence in repetition-rate plasma electrode Pockels cell for high average power

    Institute of Scientific and Technical Information of China (English)

    Dingxiang Cao; Xiongjun Zhang; Wanguo Zheng; Shaobo He; Zhan Sui

    2007-01-01

    We numerically study thermally induced birefringence and distortion in plasma electrode Pockels cell based on KD*P as the electro-optic material. This device can repetitively operate under the heat capacity mode.Simulation results indicate that the excellent switching performances and low wave-front distortion are achieved within several tens seconds working time at average power in excess of 1 kW.

  19. Bragg Gratings Induced in Birefringent Optical Fiber with an Elliptical Stress Cladding

    Directory of Open Access Journals (Sweden)

    I. K. Meshkovskiy

    2013-01-01

    Full Text Available The paper presents the results of writing of type I and high-performance type II fiber Bragg gratings in birefringent optical fiber with an elliptical stress cladding by a single 20 ns pulse of KrF excimer laser (248 nm. The gratings’ efficiency produced by a single pulse was up to 100%. Experimental results on visualization of these gratings are presented.

  20. Zona pellucida birefringence and meiotic spindle visualisation of human oocytes are not influenced by IVM technology.

    Science.gov (United States)

    Omidi, Marjan; Khalili, Mohammad Ali; Ashourzadeh, Sareh; Rahimipour, Marzieh

    2014-03-01

    The aim of the present study was to investigate the relationship between the presence of the meiotic spindle and zona pellucida (ZP) birefringence with morphology of in vivo- and in vitro-matured human oocytes. Germinal vesicles (n=47) and MI (n=38) oocytes obtained from stimulated ovaries of patients undergoing intracytoplasmic sperm injection (ICSI) underwent IVM. Using a PolScope (OCTAX PolarAID; Octax, Herbon, Germany), the presence of spindles and ZP birefringence was assessed in both in vivo-matured (n=56) and IVM (n=56) oocytes. In addition, the morphology of each matured oocyte was evaluated microscopically. There were insignificant differences for ZP birefringence and meiotic spindle between the in vivo-matured and IVM MII oocytes. Subanalysis revealed that the rates of morphologically abnormal oocytes did not differ significantly between the two groups, except in the case of irregular shape (P=0.001), refractile body (P=0.001) and fragmented polar body (P=0.03), which were higher in IVM oocytes. In the case of in vivo-matured oocytes, a significantly higher percentage of oocytes with intracytoplasmic and both intra- and extracytoplasmic abnormalities have a low birefringent ZP (P=0.007 and P=0.02, respectively). There was no relationship between morphological abnormalities and spindle detection. The findings suggest that clinical IVM is a safe technology that maintains the high maturation rate and integrity of oocytes. In addition, the use of the non-invasive PolScope is recommended for the detection of oocytes most suitable for ICSI.

  1. FARADAY PLASMA CURRENT SENSOR WITH COMPENSATION FOR RECIPROCAL BIREFRINGENCE INDUCED BY MECHANICALPERTURBATIONS

    Directory of Open Access Journals (Sweden)

    Y. O. Barmenkov

    2003-07-01

    Full Text Available A Faraday fiber-optic current sensor was employed to measure the tokamak plasma current. In order todecrease the influence of mechanical perturbations on the sensor sensitivity, a two-pass optical scheme witha variable Faraday mirror at the fiber end is proposed. A decrease, by two orders of magnitude, in theinfluence of the linear birefringence produced by an external piezoceramic fiber modulator was experimentallyobserved.

  2. X-ray Birefringence Imaging of Materials with Anisotropic Molecular Dynamics.

    Science.gov (United States)

    Palmer, Benjamin A; Edwards-Gau, Gregory R; Kariuki, Benson M; Harris, Kenneth D M; Dolbnya, Igor P; Collins, Stephen P; Sutter, John P

    2015-02-05

    The X-ray birefringence imaging (XBI) technique, reported very recently, is a sensitive tool for spatially resolved mapping of the local orientational properties of anisotropic materials. In this paper, we report the first XBI measurements on materials that undergo anisotropic molecular dynamics. Using incident linearly polarized X-rays with energy close to the Br K-edge, the X-ray birefringence is dictated by the orientational properties of the C-Br bonds in the material. We focus on two materials (urea inclusion compounds containing 1,8-dibromooctane and 1,10-dibromodecane guest molecules) for which the reorientational dynamics of the brominated guest molecules (and hence the reorientational dynamics of the C-Br bonds) are already well characterized by other experimental techniques. The XBI results demonstrate clearly that, for the anisotropic molecular dynamics in these materials, the effective X-ray optic axis for the X-ray birefringence phenomenon is the time-averaged resultant of the orientational distribution of the C-Br bonds.

  3. Rotational analysis of birefringent crystal particles based on modified theory in optical tweezers

    Science.gov (United States)

    Wei, Yong; Zhu, Yanying; Yao, Wenying; Pei, Huan

    2015-04-01

    In order to achieve high-precision, controllable rotation of uniaxial birefringent crystal particles, we study the principle of optical rotation due to the transfer of spin angular momentum from light to birefringent crystal particles. The interaction process between the beam and particles is affected by various factors existed actually, for instance: the reflection of beam on the crystal surface, laser power, the set of angle between the crystal optical axis and surface, radius, phase difference between the ordinary ray and extraordinary ray. According to the analysis of these factors, the theoretical model of optical rotation is reconstructed. The theoretical curves of calcium carbonate and silicon particles chosen as experimental material between the rotational frequency and the radius are simulated and calculated. The result shows that the rotation frequency is inversely proportional to the cube of radius, and compared the performance of modified model with traditional model. The birefringent particles are rotated by optical tweezers in the experiment, and rotation frequency is measured with the same laser power. According to the experimental results of optical rotation, the modified Friese theoretical model is proved to be the reasonably and excellence, in addition, the result shows the maximum frequency of calcium carbonate is 19.1Hz, and the maximum frequency of silicon particles is 11.5Hz. The rationality of our experiment is testified by compared with theoretical analysis. Our study has great directive significance to the design of optical driven micro-mechanical motor and the material selection of rotor.

  4. An Optimal Cure Process to Minimize Residual Void and Optical Birefringence for a LED Silicone Encapsulant

    Directory of Open Access Journals (Sweden)

    Min-Jae Song

    2014-05-01

    Full Text Available Silicone resin has recently attracted great attention as a high-power Light Emitting Diode (LED encapsulant material due to its good thermal stability and optical properties. In general, the abrupt curing reaction of the silicone resin for the LED encapsulant during the curing process induces reduction in the mechanical and optical properties of the LED product due to the generation of residual void and moisture, birefringence, and residual stress in the final formation. In order to prevent such an abrupt curing reaction, the reduction of residual void and birefringence of the silicone resin was observed through experimentation by introducing the multi-step cure processes, while the residual stress was calculated by conducting finite element analysis that coupled the heat of cure reaction and cure shrinkage. The results of experiment and analysis showed that it was during the three-step curing process that the residual void, birefringence, and residual stress reduced the most in similar tendency. Through such experimentation and finite element analysis, the study was able to confirm that the optimization of the LED encapsulant packaging process was possible.

  5. Polarization birefringence measurements for characterizing the myocardium, including healthy, infarcted, and stem-cell-regenerated tissues

    Science.gov (United States)

    Wood, Michael F. G.; Ghosh, Nirmalya; Wallenburg, Marika A.; Li, Shu-Hong; Weisel, Richard D.; Wilson, Brian C.; Li, Ren-Ke; Vitkin, I. Alex

    2010-07-01

    Myocardial infarction leads to structural remodeling of the myocardium, in particular to the loss of cardiomyocytes due to necrosis and an increase in collagen with scar formation. Stem cell regenerative treatments have been shown to alter this remodeling process, resulting in improved cardiac function. As healthy myocardial tissue is highly fibrous and anisotropic, it exhibits optical linear birefringence due to the different refractive indices parallel and perpendicular to the fibers. Accordingly, changes in myocardial structure associated with infarction and treatment-induced remodeling will alter the anisotropy exhibited by the tissue. Polarization-based linear birefringence is measured on the myocardium of adult rat hearts after myocardial infarction and compared with hearts that had received mesenchymal stem cell treatment. Both point measurement and imaging data show a decrease in birefringence in the region of infarction, with a partial rebound back toward the healthy values following regenerative treatment with stem cells. These results demonstrate the ability of optical polarimetry to characterize the micro-organizational state of the myocardium via its measured anisotropy, and the potential of this approach for monitoring regenerative treatments of myocardial infarction.

  6. Novel laser machining of optical fibers for long cavities with low birefringence.

    Science.gov (United States)

    Takahashi, Hiroki; Morphew, Jack; Oručević, Fedja; Noguchi, Atsushi; Kassa, Ezra; Keller, Matthias

    2014-12-15

    We present a novel method of machining optical fiber surfaces with a CO₂ laser for use in Fiber-based Fabry-Perot Cavities (FFPCs). Previously FFPCs were prone to large birefringence and limited to relatively short cavity lengths (≤ 200 μm). These characteristics hinder their use in some applications such as cavity quantum electrodynamics with trapped ions. We optimized the laser machining process to produce large, uniform surface structures. This enables the cavities to achieve high finesse even for long cavity lengths. By rotating the fibers around their axis during the laser machining process the asymmetry resulting from the laser's transverse mode profile is eliminated. Consequently we are able to fabricate fiber mirrors with a high degree of rotational symmetry, leading to remarkably low birefringence. Through measurements of the cavity finesse over a range of cavity lengths and the polarization dependence of the cavity linewidth, we confirmed the quality of the produced fiber mirrors for use in low-birefringence FFPCs.

  7. Photon pair generation by intermodal spontaneous four wave mixing in birefringent, weakly guiding optical fibers

    CERN Document Server

    Garay-Palmett, K; Dominguez-Serna, F; Ortiz-Ricardo, E; Monroy-Ruz, J; Ramirez, H Cruz; Ramirez-Alarcon, R; U'Ren, A B

    2016-01-01

    We present a theoretical and experimental study of the generation of photon pairs through the process of spontaneous four wave mixing (SFWM) in a few-mode, birefringent fiber. Under these conditions, multiple SFWM processes are in fact possible, each associated with a different combination of transverse modes for the four waves involved. We show that in the weakly guiding regime, for which the propagation modes may be well approximated by linearly polarized modes, the departure from circular symmetry due to the fiber birefringence translates into conservation rules which retain elements from azimuthal and rectangular symmetries: both OAM and parity must be conserved for a process to be viable. We have implemented a SFWM source based on a "bow-tie" birefringent fiber, and have measured for a collection of pump wavelengths the SFWM spectra of each of the signal and idler photons in coincidence with its partner photon. We have used this information, together with knowledge of the transverse modes into which the ...

  8. Digital Beam Steering Device Based on Decoupled Birefringent Prism Deflector and Polarization Rotator

    Science.gov (United States)

    Pishnyak, Oleg; Kreminska, Lyubov; Laventovich, Oleg D.; Pouch, John J.; Miranda, Felix A.; Winker, Bruce K.

    2004-01-01

    We describe digital beam deflectors (DBDs) based on liquid crystals. Each stage of the device comprises a polarization rotator and a birefringent prism deflector. The birefringent prism deflects the beam by an angle that depends on polarization of the incident beam. The prism can be made of the uniaxial smectic A (SmA) liquid crystal (LC) or a solid crystal such as yttrium orthovanadate (YVO4). SmA prisms have high birefringence and can be constructed in a variety of shapes, including single prisms and prismatic blazed gratings of different angles and profiles. We address the challenges of uniform alignment of SmA, such as elimination of focal conic domains. Rotation of linear polarization is achieved by an electrically switched twisted nematic (TN) cell. A DBD composed of N rotator-deflector pairs steers the beam into 2(sup N) directions. As an example, we describe a four-stage DBD deflecting normally incident laser beam within the range of +/- 56 mrad with 8 mrad steps. Redirection of the beam is achieved by switching the TN cells.

  9. Microwave birefringent metamaterials for polarization conversion based on spoof surface plasmon polariton modes

    Science.gov (United States)

    Li, Yongfeng; Zhang, Jieqiu; Ma, Hua; Wang, Jiafu; Pang, Yongqiang; Feng, Dayi; Xu, Zhuo; Qu, Shaobo

    2016-10-01

    We propose the design of wideband birefringent metamaterials based on spoof surface plasmon polaritons (SSPPs). Spatial k-dispersion design of SSPP modes in metamaterials is adopted to achieve high-efficiency transmission of electromagnetic waves through the metamaterial layer. By anisotropic design, the transmission phase accumulation in metamaterials can be independently modulated for x- and y-polarized components of incident waves. Since the dispersion curve of SSPPs is nonlinear, frequency-dependent phase differences can be obtained between the two orthogonal components of transmitted waves. As an example, we demonstrate a microwave birefringent metamaterials composed of fishbone structures. The full-polarization-state conversions on the zero-longitude line of Poincaré sphere can be fulfilled twice in 6–20 GHz for both linearly polarized (LP) and circularly polarized (CP) waves incidence. Besides, at a given frequency, the full-polarization-state conversion can be achieved by changing the polarization angle of the incident LP waves. Both the simulation and experiment results verify the high-efficiency polarization conversion functions of the birefringent metamaterial, including circular-to-circular, circular-to-linear(linear-to-circular), linear-to-linear polarization conversions.

  10. Characteristics of Highly Birefringent Photonic Crystal Fiber with Defected Core and Equilateral Pentagon Architecture

    Directory of Open Access Journals (Sweden)

    Fei Yu

    2016-01-01

    Full Text Available A novel high birefringence and nearly zero dispersion-flattened photonic crystal fiber (PCF with elliptical defected core (E-DC and equilateral pentagonal architecture is designed. By applying the full-vector finite element method (FEM, the characteristics of electric field distribution, birefringence, and chromatic dispersion of the proposed E-DC PCF are numerically investigated in detail. The simulation results reveal that the proposed PCF can realize high birefringence, ranging from 10-3 to 10-2 orders of magnitude, owing to the embedded elliptical air hole in the core center. However, the existence of the elliptical air hole gives rise to an extraordinary electric field distribution, where a V-shaped notch appears and the size of the V-shaped notch varies at different operating wavelengths. Also, the mode field diameter is estimated to be about 2 μm, which implies the small effective mode area and highly nonlinear coefficient. Furthermore, the investigation of the chromatic dispersion characteristic shows that the introduction of the elliptical air hole is helpful to control the chromatic dispersion to be negative or nearly zero flattened over a wide wavelength bandwidth.

  11. Microwave birefringent metamaterials for polarization conversion based on spoof surface plasmon polariton modes

    Science.gov (United States)

    Li, Yongfeng; Zhang, Jieqiu; Ma, Hua; Wang, Jiafu; Pang, Yongqiang; Feng, Dayi; Xu, Zhuo; Qu, Shaobo

    2016-01-01

    We propose the design of wideband birefringent metamaterials based on spoof surface plasmon polaritons (SSPPs). Spatial k-dispersion design of SSPP modes in metamaterials is adopted to achieve high-efficiency transmission of electromagnetic waves through the metamaterial layer. By anisotropic design, the transmission phase accumulation in metamaterials can be independently modulated for x- and y-polarized components of incident waves. Since the dispersion curve of SSPPs is nonlinear, frequency-dependent phase differences can be obtained between the two orthogonal components of transmitted waves. As an example, we demonstrate a microwave birefringent metamaterials composed of fishbone structures. The full-polarization-state conversions on the zero-longitude line of Poincaré sphere can be fulfilled twice in 6–20 GHz for both linearly polarized (LP) and circularly polarized (CP) waves incidence. Besides, at a given frequency, the full-polarization-state conversion can be achieved by changing the polarization angle of the incident LP waves. Both the simulation and experiment results verify the high-efficiency polarization conversion functions of the birefringent metamaterial, including circular-to-circular, circular-to-linear(linear-to-circular), linear-to-linear polarization conversions. PMID:27698443

  12. Collagen birefringence assessment in heart chordae tendineae through PS-OCT

    Science.gov (United States)

    Real, Eusebio; Revuelta, José M.; González-Vargas, Nieves; Pontón, Alejandro; Calvo-Díez, Marta; López-Higuera, José M.; Conde, Olga M.

    2017-02-01

    Degenerative mitral regurgitation is a serious and frequent human heart valve disease. Malfunctioning of this valve brings the left-sided heart through a significant increase of pressure and volume overload. Severe degenerative mitral incompetence generally requires surgical repair or valve replacement with a bioprosthesis or mechanical heart valve. Degenerative disease affects the leaflets or/and the chordae tendineae, which link both leaflets to the papillary muscles. During mitral valve surgical repair, reconstruction of the valve leaflets, annulus and chordae are provided to prevent postoperative recurrence of valve regurgitation. The operative evaluation of the diseased and apparently normal chordae tendineae mainly depends of the surgeońs experience, without any other objective diagnosis tool. In this work, PS-OCT (Polarization Sensitive-Optical Coherence Tomography) is applied for the first time to evaluate the pathological condition of human chordae coming from the mitral valve. It consists on a prospective study to test the viability of this technique for the evaluation of the collagen core of chords. This core presents a strong birefringence due to the longitudinal and organized arrangement of its collagen bundles. Different densities and organizations of the collagen core translate into different birefringence indicators whose measurement become an objective marker of the core structure. Ex-vivo mitral degenerative chordae tendineae have been analyzed with PS-OCT. Intensity OCT is used to obtain complementary morphological information of the chords. Birefringence results correlate with the previously reported values for human tendinous tissue.

  13. The Gain Properties of 1-D Active Photonic Crystal

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    The terminology 'ID frequency'(w ID) is proposed after analyzing the 1D active photonic crystal based on the transfer matrix method. The relationship between wID and the structure parameters of the photonic crystal is investigated.

  14. Severe Hypertriglyceridemia in Glut1D on Ketogenic Diet.

    Science.gov (United States)

    Klepper, Joerg; Leiendecker, Baerbel; Heussinger, Nicole; Lausch, Ekkehart; Bosch, Friedrich

    2016-04-01

    High-fat ketogenic diets are the only treatment available for Glut1 deficiency (Glut1D). Here, we describe an 8-year-old girl with classical Glut1D responsive to a 3:1 ketogenic diet and ethosuximide. After 3 years on the diet a gradual increase of blood lipids was followed by rapid, severe asymptomatic hypertriglyceridemia (1,910 mg/dL). Serum lipid apheresis was required to determine liver, renal, and pancreatic function. A combination of medium chain triglyceride-oil and a reduction of the ketogenic diet to 1:1 ratio normalized triglyceride levels within days but triggered severe myoclonic seizures requiring comedication with sultiam. Severe hypertriglyceridemia in children with Glut1D on ketogenic diets may be underdiagnosed and harmful. In contrast to congenital hypertriglyceridemias, children with Glut1D may be treated effectively by dietary adjustments alone.

  15. IMPROVEMENTS OF RIVER MODELING 1D DATA PREPARATION

    Directory of Open Access Journals (Sweden)

    ION-MARIAN MOISOIU

    2012-11-01

    Full Text Available Improvements of river modeling 1D data preparation. The importance of hydrographical networks data and the need for detailed studies do generate an increase of projects in this specialized area and a diversification of river mathematical modeling software. River mathematical modeling can be done in two ways, namely; the "2D mode" and the “1D mode”. The “2D mode” is where a digital terrain model of a full hydrographical basin must be produced and "1D mode" is where only cross sections, long sections and structures elevations needs to be presented in a graphical environment and in a specific formats for the mathematical modeling software. This paper will show the principle of a custom built GIS, specially created to help the preparation of 1D river modeling data. The benefits are; elimination of human errors, automated processing, increasing productivity, flexible output and cost reduction.

  16. Supported plasma-made 1D heterostructures: perspectives and applications

    OpenAIRE

    Borras, Ana; Macias-Montero, Manuel; Romero-Gomez, Pablo; Gonzalez-Elipe, Agustin R.

    2011-01-01

    Abstract Plasma related methods have been widely used in the fabrication of carbon nanotubes and nanofibres and semiconducting inorganic nanowires. A natural progression of the research in the field of 1D nanostructures is the synthesis of multicomponent nanowires and nanofibres. In this article we review the state of the art of the fabrication by plasma methods of 1D heterostructures including applications and perspectives. Furthermore, recent developments on the use of metal seeds (Ag, A...

  17. 1D photonic crystal sensor integrated in a microfluidic system

    DEFF Research Database (Denmark)

    Nunes, Pedro; Mortensen, Asger; Kutter, Jörg Peter

    2009-01-01

    A refractive index sensor was designed as a 1D resonator incorporated in a microfluidic channel, where aqueous solutions were injected. A sensitivity of 480 nm/RIU and a minimum difference of Deltan = 0.002 were determined.......A refractive index sensor was designed as a 1D resonator incorporated in a microfluidic channel, where aqueous solutions were injected. A sensitivity of 480 nm/RIU and a minimum difference of Deltan = 0.002 were determined....

  18. TBC1D24 genotype–phenotype correlation

    Science.gov (United States)

    Balestrini, Simona; Milh, Mathieu; Castiglioni, Claudia; Lüthy, Kevin; Finelli, Mattea J.; Verstreken, Patrik; Cardon, Aaron; Stražišar, Barbara Gnidovec; Holder, J. Lloyd; Lesca, Gaetan; Mancardi, Maria M.; Poulat, Anne L.; Repetto, Gabriela M.; Banka, Siddharth; Bilo, Leonilda; Birkeland, Laura E.; Bosch, Friedrich; Brockmann, Knut; Cross, J. Helen; Doummar, Diane; Félix, Temis M.; Giuliano, Fabienne; Hori, Mutsuki; Hüning, Irina; Kayserili, Hulia; Kini, Usha; Lees, Melissa M.; Meenakshi, Girish; Mewasingh, Leena; Pagnamenta, Alistair T.; Peluso, Silvio; Mey, Antje; Rice, Gregory M.; Rosenfeld, Jill A.; Taylor, Jenny C.; Troester, Matthew M.; Stanley, Christine M.; Ville, Dorothee; Walkiewicz, Magdalena; Falace, Antonio; Fassio, Anna; Lemke, Johannes R.; Biskup, Saskia; Tardif, Jessica; Ajeawung, Norbert F.; Tolun, Aslihan; Corbett, Mark; Gecz, Jozef; Afawi, Zaid; Howell, Katherine B.; Oliver, Karen L.; Berkovic, Samuel F.; Scheffer, Ingrid E.; de Falco, Fabrizio A.; Oliver, Peter L.; Striano, Pasquale; Zara, Federico

    2016-01-01

    Objective: To evaluate the phenotypic spectrum associated with mutations in TBC1D24. Methods: We acquired new clinical, EEG, and neuroimaging data of 11 previously unreported and 37 published patients. TBC1D24 mutations, identified through various sequencing methods, can be found online (http://lovd.nl/TBC1D24). Results: Forty-eight patients were included (28 men, 20 women, average age 21 years) from 30 independent families. Eighteen patients (38%) had myoclonic epilepsies. The other patients carried diagnoses of focal (25%), multifocal (2%), generalized (4%), and unclassified epilepsy (6%), and early-onset epileptic encephalopathy (25%). Most patients had drug-resistant epilepsy. We detail EEG, neuroimaging, developmental, and cognitive features, treatment responsiveness, and physical examination. In silico evaluation revealed 7 different highly conserved motifs, with the most common pathogenic mutation located in the first. Neuronal outgrowth assays showed that some TBC1D24 mutations, associated with the most severe TBC1D24-associated disorders, are not necessarily the most disruptive to this gene function. Conclusions: TBC1D24-related epilepsy syndromes show marked phenotypic pleiotropy, with multisystem involvement and severity spectrum ranging from isolated deafness (not studied here), benign myoclonic epilepsy restricted to childhood with complete seizure control and normal intellect, to early-onset epileptic encephalopathy with severe developmental delay and early death. There is no distinct correlation with mutation type or location yet, but patterns are emerging. Given the phenotypic breadth observed, TBC1D24 mutation screening is indicated in a wide variety of epilepsies. A TBC1D24 consortium was formed to develop further research on this gene and its associated phenotypes. PMID:27281533

  19. Magneto-photonic phenomena at terahertz frequencies

    CERN Document Server

    Shalaby, Mostafa

    2014-01-01

    Magneto-terahertz phenomena are the main focus of the thesis. This work started as supporting research for the science of an X-ray laser (SwissFEL). X-ray lasers have recently drawn great attention as an unprecedented tool for scientific research on the ultrafast scale..... To answer this fundamental question, we performed original numerical simulations using a coupled Landau- Lifshitz-Gilbert Maxwell model. ... Those requirements were the motivations for the experiments performed in the second part of the thesis. To shape the terahertz pulses, .... Regarding the field intensities, we followed two approaches. The first deals with field enhancement in nanoslits arrays. We designed a subwavelength structure characterized by simultaneous high field enhancement and high transmission at terahertz frequencies to suit nonlinear sources. The second approach depended on up-scaling the generation from laser-induced plasma by increasing the pump wavelengths. Numerical calculations have also brought to our attention the ...

  20. Contribution of counterions and degree of ionization for birefringence creation and relaxation kinetics parameters of PAH/PAZO films

    Energy Technology Data Exchange (ETDEWEB)

    Raposo, Maria, E-mail: mfr@fct.unl.pt; Monteiro Timóteo, Ana Rita; Ribeiro, Paulo A. [CEFITEC, Departamento de Física, Faculdade de Ciências e Tecnologia, UNL, Campus de Caparica, 2829-516 Caparica (Portugal); Ferreira, Quirina [CEFITEC, Departamento de Física, Faculdade de Ciências e Tecnologia, UNL, Campus de Caparica, 2829-516 Caparica (Portugal); Instituto de Telecomunicações, Instituto Superior Técnico, University of Lisbon, Av. Rovisco Pais, P-1049-001 Lisboa (Portugal); Botelho do Rego, Ana Maria [Centro de Química-Física Molecular and IN, Complexo Interdisciplinar, Instituto Superior Técnico, University of Lisbon, 1049-001 Lisboa (Portugal)

    2015-09-21

    Photo induced birefringent materials can be used to develop optical and conversion energy devices, and consequently, the study of the variables that influences the creation and relaxation of birefringence should be carefully analyzed. In this work, the parameters of birefringence creation and relaxation kinetics curves obtained on layer-by-layer (LBL) films, prepared from azo-polyectrolyte poly[1-[4-(3-carboxy-4 hydroxyphenylazo) benzene sulfonamido]-1,2-ethanediyl, sodium salt] (PAZO) and poly(allylamine hydrochloride)(PAH), are related with the presence of counterions and the degree of ionization of the polyelectrolytes. Those kinetics curves obtained on PAH/PAZO LBL films, prepared from PAH solutions with different pHs and maintaining the pH of PAZO solution constant at pH = 9, were analyzed taking into account the films composition which was characterized by X-ray photoelectron spectroscopy. The creation and relaxation birefringence curves are justified by two processes: one associated to local mobility of the azobenzene with a characteristic time 30 s and intensity constant and other associated with polymeric chains mobility with the characteristic time and intensity decreasing with pH. These results allow us to conclude that the birefringence creation process, associated to local mobility of azobenzenes is independent of the degree of ionization and of number of counterions or co-ions present while the birefringence creation process associated to mobility of chains have its characteristic time and intensity dependent of both degree of ionization and number of counterions. The birefringence relaxation processes are dependent of the degree of ionization. The analysis of the films composition revealed, in addition, the presence of a protonated secondary or tertiary amine revealing that PAZO may have positive charges and consequently a zwitterionic behavior.

  1. Flexible Photodetectors Based on 1D Inorganic Nanostructures

    Science.gov (United States)

    Lou, Zheng

    2015-01-01

    Flexible photodetectors with excellent flexibility, high mechanical stability and good detectivity, have attracted great research interest in recent years. 1D inorganic nanostructures provide a number of opportunities and capabilities for use in flexible photodetectors as they have unique geometry, good transparency, outstanding mechanical flexibility, and excellent electronic/optoelectronic properties. This article offers a comprehensive review of several types of flexible photodetectors based on 1D nanostructures from the past ten years, including flexible ultraviolet, visible, and infrared photodetectors. High‐performance organic‐inorganic hybrid photodetectors, as well as devices with 1D nanowire (NW) arrays, are also reviewed. Finally, new concepts of flexible photodetectors including piezophototronic, stretchable and self‐powered photodetectors are examined to showcase the future research in this exciting field. PMID:27774404

  2. 1D nanocrystals with precisely controlled dimensions, compositions, and architectures.

    Science.gov (United States)

    Pang, Xinchang; He, Yanjie; Jung, Jaehan; Lin, Zhiqun

    2016-09-16

    The ability to synthesize a diverse spectrum of one-dimensional (1D) nanocrystals presents an enticing prospect for exploring nanoscale size- and shape-dependent properties. Here we report a general strategy to craft a variety of plain nanorods, core-shell nanorods, and nanotubes with precisely controlled dimensions and compositions by capitalizing on functional bottlebrush-like block copolymers with well-defined structures and narrow molecular weight distributions as nanoreactors. These cylindrical unimolecular nanoreactors enable a high degree of control over the size, shape, architecture, surface chemistry, and properties of 1D nanocrystals. We demonstrate the synthesis of metallic, ferroelectric, upconversion, semiconducting, and thermoelectric 1D nanocrystals, among others, as well as combinations thereof.

  3. Quantum electrodynamics with 1D arti cial atoms

    DEFF Research Database (Denmark)

    Javadi, Alisa

    A 1D atom, a single quantum emitter coupled to a single optical mode, exhibits rich quantum electrodynamic (QED) e_ects and is thought to be the key ingredient for many applications in quantuminformation processing. Single quantum dots (QD) in photonic-crystal waveguides (PCW) constitute a robust...... platform for realizing a 1D atom, and are the subject of theoretical and experimental investigations in this thesis. We use _nite element method in 3D to calculate the local density of states (LDOS) in photonic-crystal membranes. The detailed spatial maps show strong inhibition of LDOS in the bandgap...... atom. One of the signatures and functions of a 1D atom is the nonlinear optical response at the single-photon level. A PCW chip is designed to experimentally study the transmission spectrum of an embedded QD. The transmission spectrum is shown to be modi_ed by 30% around the resonance of the QD...

  4. 1D nanocrystals with precisely controlled dimensions, compositions, and architectures

    Science.gov (United States)

    Pang, Xinchang; He, Yanjie; Jung, Jaehan; Lin, Zhiqun

    2016-09-01

    The ability to synthesize a diverse spectrum of one-dimensional (1D) nanocrystals presents an enticing prospect for exploring nanoscale size- and shape-dependent properties. Here we report a general strategy to craft a variety of plain nanorods, core-shell nanorods, and nanotubes with precisely controlled dimensions and compositions by capitalizing on functional bottlebrush-like block copolymers with well-defined structures and narrow molecular weight distributions as nanoreactors. These cylindrical unimolecular nanoreactors enable a high degree of control over the size, shape, architecture, surface chemistry, and properties of 1D nanocrystals. We demonstrate the synthesis of metallic, ferroelectric, upconversion, semiconducting, and thermoelectric 1D nanocrystals, among others, as well as combinations thereof.

  5. Quantum electrodynamics with 1D arti cial atoms

    DEFF Research Database (Denmark)

    Javadi, Alisa

    atom. One of the signatures and functions of a 1D atom is the nonlinear optical response at the single-photon level. A PCW chip is designed to experimentally study the transmission spectrum of an embedded QD. The transmission spectrum is shown to be modi_ed by 30% around the resonance of the QD......A 1D atom, a single quantum emitter coupled to a single optical mode, exhibits rich quantum electrodynamic (QED) e_ects and is thought to be the key ingredient for many applications in quantuminformation processing. Single quantum dots (QD) in photonic-crystal waveguides (PCW) constitute a robust...... platform for realizing a 1D atom, and are the subject of theoretical and experimental investigations in this thesis. We use _nite element method in 3D to calculate the local density of states (LDOS) in photonic-crystal membranes. The detailed spatial maps show strong inhibition of LDOS in the bandgap...

  6. Diffusion and particle mobility in 1D system

    Energy Technology Data Exchange (ETDEWEB)

    Borman, V.D. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation); Johansson, B. [Condensed Matter Theory Group, Department of Physics, Box 530, Uppsala University, S-75121 Uppsala (Sweden); Applied Materials Physics, Department of Materials and Engineering, Royal Institute of Technology (KTH), S-10044 Stockholm (Sweden); Skorodumova, N.V. [Condensed Matter Theory Group, Department of Physics, Box 530, Uppsala University, S-75121 Uppsala (Sweden); Tronin, I.V. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation)]. E-mail: ivt@rbcmail.ru; Tronin, V.N. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation); Troyan, V.I. [Moscow Engineering Physics Institute (State University), Kashirskoe shosse, 31, 115409 Moscow (Russian Federation)

    2006-12-04

    The transport properties of one-dimensional (1D) systems have been studied theoretically. Contradictory experimental results on molecular transport in quasi-1D systems, such as zeolite structures, when both diffusion transport acceleration and the existence of the diffusion mode with lower particle mobility (single-file diffusion ({approx}t{sup 1/2})) have been reported, are consolidated in a consistent model. Transition from the single-file diffusion mode to an Einstein-like diffusion {approx}t with diffusion coefficient increasing with the density has been predicted to occur at large observation times.

  7. GIS-BASED 1-D DIFFUSIVE WAVE OVERLAND FLOW MODEL

    Energy Technology Data Exchange (ETDEWEB)

    KALYANAPU, ALFRED [Los Alamos National Laboratory; MCPHERSON, TIMOTHY N. [Los Alamos National Laboratory; BURIAN, STEVEN J. [NON LANL

    2007-01-17

    This paper presents a GIS-based 1-d distributed overland flow model and summarizes an application to simulate a flood event. The model estimates infiltration using the Green-Ampt approach and routes excess rainfall using the 1-d diffusive wave approximation. The model was designed to use readily available topographic, soils, and land use/land cover data and rainfall predictions from a meteorological model. An assessment of model performance was performed for a small catchment and a large watershed, both in urban environments. Simulated runoff hydrographs were compared to observations for a selected set of validation events. Results confirmed the model provides reasonable predictions in a short period of time.

  8. Optical characterization of the nematic lyotropic chromonic liquid crystals: light absorption, birefringence, and scalar order parameter.

    Science.gov (United States)

    Nastishin, Yu A; Liu, H; Schneider, T; Nazarenko, V; Vasyuta, R; Shiyanovskii, S V; Lavrentovich, O D

    2005-10-01

    We report on the optical properties of the nematic (N) phase formed by lyotropic chromonic liquid crystals (LCLCs) in well aligned planar samples. LCLCs belong to a broad class of materials formed by one-dimensional molecular self-assembly and are similar to other systems such as "living polymers" and "wormlike micelles." We study three water soluble LCLC forming materials: disodium chromoglycate, a derivative of indanthrone called Blue 27, and a derivative of perylene called Violet 20. The individual molecules have a planklike shape and assemble into rodlike aggregates that form the phase once the concentration exceeds about 0.1 M. The uniform surface alignment of the N phase is achieved by buffed polyimide layers. According to the light absorption anisotropy data, the molecular planes are on average perpendicular to the aggregate axes and thus to the nematic director. We determined the birefringence of these materials in the N and biphasic N-isotropic (I) regions and found it to be negative and significantly lower in the absolute value as compared to the birefringence of typical thermotropic low-molecular-weight nematic materials. In the absorbing materials Blue 27 and Violet 20, the wavelength dependence of birefringence is nonmonotonic because of the effect of anomalous dispersion near the absorption bands. We describe positive and negative tactoids formed as the nuclei of the new phase in the biphasic N-I region (which is wide in all three materials studied). Finally, we determined the scalar order parameter of the phase of Blue 27 and found it to be relatively high, in the range 0.72-0.79, which puts the finding into the domain of general validity of the Onsager model. However, the observed temperature dependence of the scalar order parameter points to the importance of factors not accounted for in the athermal Onsager model, such as interaggregate interactions and the temperature dependence of the aggregate length.

  9. Novel technique for spatially resolved imaging of molecular bond orientations using x-ray birefringence

    Energy Technology Data Exchange (ETDEWEB)

    Sutter, John P., E-mail: john.sutter@diamond.ac.uk; Dolbnya, Igor P.; Collins, Stephen P. [Diamond Light Source Ltd, Harwell Science and Innovation Campus, Chilton, Didcot, Oxfordshire OX11 0DE (United Kingdom); Harris, Kenneth D. M., E-mail: HarrisKDM@cardiff.ac.uk; Edwards-Gau, Gregory R.; Kariuki, Benson M. [School of Chemistry, Cardiff University, Park Place, Cardiff CF10 3AT (United Kingdom); Palmer, Benjamin A. [Department of Structural Biology, Weizmann Institute of Science, 234 Herzl St., Rehovot 7610001 (Israel)

    2016-07-27

    Birefringence has been observed in anisotropic materials transmitting linearly polarized X-ray beams tuned close to an absorption edge of a specific element in the material. Synchrotron bending magnets provide X-ray beams of sufficiently high brightness and cross section for spatially resolved measurements of birefringence. The recently developed X-ray Birefringence Imaging (XBI) technique has been successfully applied for the first time using the versatile test beamline B16 at Diamond Light Source. Orientational distributions of the C–Br bonds of brominated “guest” molecules within crystalline “host” tunnel structures (in thiourea or urea inclusion compounds) have been studied using linearly polarized incident X-rays near the Br K-edge. Imaging of domain structures, changes in C–Br bond orientations associated with order-disorder phase transitions, and the effects of dynamic averaging of C–Br bond orientations have been demonstrated. The XBI setup uses a vertically deflecting high-resolution double-crystal monochromator upstream from the sample and a horizontally deflecting single-crystal polarization analyzer downstream, with a Bragg angle as close as possible to 45°. In this way, the ellipticity and rotation angle of the polarization of the beam transmitted through the sample is measured as in polarizing optical microscopy. The theoretical instrumental background calculated from the elliptical polarization of the bending-magnet X-rays, the imperfect polarization discrimination of the analyzer, and the correlation between vertical position and photon energy introduced by the monochromator agrees well with experimental observations. The background is calculated analytically because the region of X-ray phase space selected by this setup is sampled inefficiently by standard methods.

  10. Gravity-induced birefringence within the framework of Poincare gauge theory

    CERN Document Server

    Preuss, O; Haugan, Mark P; Jordan, S; Preuss, Oliver; Solanki, Sami K.; Jordan, Stefan

    2005-01-01

    Gauge theories of gravity provide an elegant and promising extension of general relativity. In this paper we show that the Poincar\\'e gauge theory exhibits gravity-induced birefringence under the assumption of a specific gauge invariant nonminimal coupling between torsion and Maxwell's field. Furthermore we give for the first time an explicit expression for the induced phaseshift between two orthogonal polarization modes within the Poincar\\'e framework. Since such a phaseshift can lead to a depolarization of light emitted from an extended source this effect is, in principle, observable. We use white dwarf polarimetric data to constrain the essential coupling constant responsible for this effect.

  11. Polarization sensitive localization based super-resolution microscopy with a birefringent wedge

    Science.gov (United States)

    Sinkó, József; Gajdos, Tamás; Czvik, Elvira; Szabó, Gábor; Erdélyi, Miklós

    2017-03-01

    A practical method has been presented for polarization sensitive localization based super-resolution microscopy using a birefringent dual wedge. The measurement of the polarization degree at the single molecule level can reveal the chemical and physical properties of the local environment of the fluorescent dye molecule and can hence provide information about the sub-diffraction sized structure of biological samples. Polarization sensitive STORM imaging of the F-Actins proved correlation between the orientation of fluorescent dipoles and the axis of the fibril.

  12. Tunable Microwave Photonic Notch Filter Based on a high-birefringence linearly chirped fiber Bragg grating

    Energy Technology Data Exchange (ETDEWEB)

    Jin Yongxing; Dong Xinyong; Wang Jianfeng [Institute of Optoelectronic Technology, China Jiliang University, Hangzhou (China); Zhou Junqiang, E-mail: phyjyxin@gmail.com [Network Technology Research Centre, Nanyang Technological University (Singapore)

    2011-02-01

    In this paper, a continuously tunable microwave photonic notch filter is proposed and experimentally demonstrated. This filter is based on the differential group delay generated by a high-birefringence linearly chirped fiber Bragg grating. This microwave photonic filter belongs to the orthogonal polarization approach, polarization maintaining structure ensures the filter free from the random optical interference problem. Its response is induced by the differential group delay (DGD) of the Hi-Bi LCFBG and it can be varied by tuning the grating through adding gradient strength to the grating. Free spectral range tuning by 9.27 GHz with more than 35 dB notch rejection is achieved.

  13. Design of low-loss and highly birefringent hollow-core photonic crystal fiber

    DEFF Research Database (Denmark)

    Roberts, Peter John; Williams, D.P.; Sabert, H.;

    2006-01-01

    A practical hollow-core photonic crystal fiber design suitable for attaining low-loss propagation is analyzed. The geometry involves a number of localized elliptical features positioned on the glass ring that surrounds the air core and separates the core and cladding regions. The size of each...... feature is tuned so that the composite core-surround geometry is antiresonant within the cladding band gap, thus minimizing the guided mode field intensity both within the fiber material and at material / air interfaces. A birefringent design, which involves a 2-fold symmetric arrangement of the features...

  14. Repeating Pulsed Magnet System for Axion-like Particle Searches and Vacuum Birefringence Experiments

    CERN Document Server

    Yamazaki, T; Namba, T; Asai, S; Kobayashi, T; Matsuo, A; Kindo, K; Nojiri, H

    2016-01-01

    We have developed a repeating pulsed magnet system which generates magnetic fields of about 10 T in a direction transverse to an incident beam over a length of 0.8 m with a repetition rate of 0.2 Hz. Its repetition rate is by two orders of magnitude higher than usual pulsed magnets. It is composed of four low resistance racetrack coils and a 30 kJ transportable capacitor bank as a power supply. The system aims at axion-like particle searches with a pulsed light source and vacuum birefringence measurements. We report on the details of the system and its performances.

  15. Simultaneous measurement of dynamic strain and temperature distribution using high birefringence PANDA fiber Bragg grating

    Science.gov (United States)

    Zhu, Mengshi; Murayama, Hideaki

    2017-04-01

    New approach in simultaneous measurement of dynamic strain and temperature has been done by using a high birefringence PANDA fiber Bragg grating sensor. By this technique, we have succeeded in discriminating dynamic strain and temperature distribution at the sampling rate of 800 Hz and the spatial resolution of 1 mm. The dynamic distribution of strain and temperature were measured with the deviation of 5mm spatially. In addition, we have designed an experimental setup by which we can apply quantitative dynamic strain and temperature distribution to the fiber under testing without bounding it to a specimen.

  16. Numerical analysis of stress distribution in embedded highly birefringent PANDA fibers

    Science.gov (United States)

    Lesiak, Piotr; Woliński, Tomasz

    2015-09-01

    The paper presents numerical analysis compared with experimental data of influence of polymerization shrinkage on highly birefringent (HB) PANDA optical fibers embedded in a composite material. Since polymerization is a chemical process consisting in combining single molecules in a macromolecular compound [1], principal directions of the polymerization shrinkage depend on a number of the composite layers associated with this process. In this paper a detailed analysis of the piezo-optic effects occurring in HB optical fibers before and after the lamination process answers the question to what extent a degree of the material degradation can be properly estimated.

  17. Design of infrared imaging birefringent interferometers for small-UAVs and handheld scanning systems (Conference Presentation)

    Science.gov (United States)

    Pola Fossi, Armande; Ferrec, Yann; Guerineau, Nicolas; Roux, Nicolas; Kling, Emmanuel; Sauer, Hervé

    2016-10-01

    Hyperspectral imaging from unmanned aerial vehicles arouses a growing interest, as well for agriculture management as pollution monitoring or security purposes. Most of current instruments are in the visible or near infrared spectral range, but the midwave or longwave infrared may also be interesting. Among the available solutions for compact imaging spectrometers in this spectral range, static imaging Fourier transform spectrometers are well adapted, thanks to the absence of moving part, a 2D snapshot imaging, which can be useful for image registration, and a high flux collection efficiency. To reach a high compactness compliant with small UAVs, birefringent interferometers are good candidates. Indeed, they can be roughly seen as a plate which comes in front of the camera lens. We propose here firstly to expose the design rules of such instruments in the midwave or longwave infrared. The first point is about the material: highly birefringent uniaxial crystals materials are not so common in this spectral domain. For MWIR spectral imagers, TeO2 or YVO4 can be used. For LWIR instruments, current materials, like ZnGeP2 or AgGaS2 are available, but their birefringence is not so high. Calomel is a promising way, but not still available. The second point consists in defining the type of interferometer, like Savart interferometer, Wollaston interferometer, or other designs. To help this choice, we have developed a software tool to calculate the propagation of plane waves in a stack of birefringent plates. This allows us to choose the optimal assembly of the plates to reach the required spectral resolution. We will then present experimental results obtained with a MWIR prototype. This prototype, called SIBI,, works in the [3.7µm-4.8µm] spectral domain (or [2050cm 1-2700cm 1]), with a spectral resolution about 13cm 1. A first ground campaign was led in June 2015, on Mount Etna (Italy). This campaign was useful to emphasize the assets and drawbacks of this instrument

  18. 2D IR spectroscopy with phase-locked pulse pairs from a birefringent delay line.

    Science.gov (United States)

    Réhault, Julien; Maiuri, Margherita; Manzoni, Cristian; Brida, Daniele; Helbing, Jan; Cerullo, Giulio

    2014-04-21

    We introduce a new scheme for two-dimensional IR spectroscopy in the partially collinear pump-probe geometry. Translating birefringent wedges allow generating phase-locked pump pulses with exceptional phase stability, in a simple and compact setup. A He-Ne tracking scheme permits to scan continuously the acquisition time. For a proof-of-principle demonstration we use lithium niobate, which allows operation up to 5 μm. Exploiting the inherent perpendicular polarizations of the two pump pulses, we also demonstrate signal enhancement and scattering suppression.

  19. Single negative birefringence in stacked spoof plasmon metasurfaces by prism experiment.

    Science.gov (United States)

    Beruete, M; Navarro-Cía, M; Falcone, F; Campillo, I; Sorolla, M

    2010-03-01

    We report negative and positive refraction in a prism made of stacked perforated thin surfaces for s and p polarization, respectively. By corrugating the subwavelength slits of a free-standing periodic arrangement, geometrically induced surface-plasmon-like currents are excited and transmission is allowed under s polarization (electric-field vector parallel to the slit). When several of those corrugated slit arrays are subwavelength stacked, the stack behaves as a negative effective index medium (because of double negativity) under s polarization, whereas it behaves as a positive effective index medium under p polarization. The birefringence has been confirmed by the usual wedge experiment in the millimeter-wave range.

  20. Two-dimensional electronic spectroscopy in the ultraviolet by a birefringent delay line.

    Science.gov (United States)

    Borrego-Varillas, Rocio; Oriana, Aurelio; Ganzer, Lucia; Trifonov, Anton; Buchvarov, Ivan; Manzoni, Cristian; Cerullo, Giulio

    2016-12-12

    We introduce a 2D electronic spectroscopy setup in the UV spectral range in the partially collinear pump-probe geometry. The required interferometrically phase-locked few-optical-cycle UV pulse pair is generated by combining a passive birefringent interferometer in the visible and nonlinear phase transfer. This is achieved by sum-frequency generation between the phase-locked visible pulse pair and narrowband infrared pulses. We demonstrate a pair of 16-fs, 330-nm pulses whose delay is interferometrically stable with an accuracy better than λ/450. 2DUV maps of pyrene solution probed in the UV and visible spectral ranges are demonstrated.

  1. Strongly birefringent cut-wire pair structure as negative index wave plates at THz frequencies

    OpenAIRE

    Weis, P.; Paul, O.; Imhof, C.; Beigang, R; Rahm, M.

    2009-01-01

    We report a new approach for the design and fabrication of thin wave plates with high transmission in the terahertz (THz) regime. The wave plates are based on strongly birefringent cut-wire pair metamaterials that exhibit refractive indices of opposite signs for two orthogonal polarization components of an incident wave. As specific examples, we fabricated and investigated a quarter- and a half-wave plate that revealed a peak intensity transmittance of 74% and 58% at 1.34 THz and 1.3 THz, res...

  2. Thermal Stress-Induced Birefringence in Borate Glass Irradiated by Femtosecond Laser Pulses

    Institute of Scientific and Technical Information of China (English)

    DAI Ye; YU Bing-Kun; LU Bo; QIU Jian-Rong; YAN Xiao-Na; JIANG Xiong-Wei; ZHU Cong-Shan

    2005-01-01

    @@ Thermal stress-induced birefringence in borate glass which has been irradiated by 800-nm femtosecond laser pulses is observed under cross-polarized light. Due to the high temperature and pressure formed in the focal volume, the material at the edge of the micro-modified region is compressed between the expanding region and the unheated one, then stress emerges. Raman spectroscopy is used to investigate the stress distribution in the micro-modified region and indicates the redistributions of density and refractive index by Raman peak shift. We suggest that this technique can develop waveguide polarizers and Fresnel zone plates in integrated optics.

  3. Repeating pulsed magnet system for axion-like particle searches and vacuum birefringence experiments

    Science.gov (United States)

    Yamazaki, T.; Inada, T.; Namba, T.; Asai, S.; Kobayashi, T.; Matsuo, A.; Kindo, K.; Nojiri, H.

    2016-10-01

    We have developed a repeating pulsed magnet system which generates magnetic fields of about 10 T in a direction transverse to an incident beam over a length of 0.8 m with a repetition rate of 0.2 Hz. Its repetition rate is by two orders of magnitude higher than usual pulsed magnets. It is composed of four low resistance racetrack coils and a 30 kJ transportable capacitor bank as a power supply. The system aims at axion-like particle searches with a pulsed light source and vacuum birefringence measurements. We report on the details of the system and its performances.

  4. Effect of grain size on optical transmittance of birefringent polycrystalline ceramics

    Science.gov (United States)

    Wen, Tzu-Chien

    Polycrystalline ceramics are increasingly used for fabricating windows and domes for the mid infra-red regime (3-5 mum) due to their superior durability as compared to glass and the lower cost of their fabrication and finishing relative to single crystals without significant compromise in optical properties. Due to the noncubic structure, MgF2 and Al2O3 are birefringent ceramics. Birefringence causes scatter of light at the grain boundaries and diminishes in-line transmittance and optical performance. This dissertation presents experimental results and analyses of the grain-size and wavelength dependence of the in-line transmittance of polycrystalline MgF2 and Al2O3. Chapter 2 presents experimental results and analyses of light transmission in polycrystalline MgF2 as a function of the mean grain size at different wavelengths. The scattering coefficient of polycrystalline MgF 2 increased linearly with the mean grain size and inversely with the square of the wavelength of light. These trends are consistent with theoretical models based on both a limiting form of the Raleigh-Gans-Debye theory of particle scattering and light retardation theories that take refractive-index variations along the light path. Chapter 3 investigates the applicability of particle light scattering theories to light attenuation in birefringent polycrystalline ceramics by measuring light transmittance in a model two-phase system. The system consisted of microspheres of silica dispersed in a solution of glycerol in water. It was found that RGD theory showed the systematic deviation for higher particle volume fraction (φ > 0.2) and larger particle size (d p > 1 mum). This result suggested that light scattering models based on single particle scattering are unlikely to provide viable physical explanation for the effect of grain size on light transmittance in birefringent polycrystalline ceramics due to the high volume fraction in dense polycrystalline ceramics. Chapter 4 analyses light

  5. Cladding defects in hollow core fibers for surface mode suppression and improved birefringence.

    Science.gov (United States)

    Michieletto, M; Lyngsø, J K; Lægsgaard, J; Bang, O

    2014-09-22

    We demonstrate a novel polarization maintaining hollow-core photonic bandgap fiber geometry that reduces the impact of surface modes on fiber transmission. The cladding structure is modified with a row of partially collapsed holes to strip away unwanted surface modes. A theoretical investigation of the surface mode stripping is presented and compared to the measured performance of four 7-cells core fibers that were drawn with different collapse ratio of the defects. The varying pressure along the defect row in the cladding during drawing introduces an ellipticity of the core. This, combined with the presence of antiresonant features on the core wall, makes the fibers birefringent, with excellent polarization maintaining properties.

  6. Pump Spectral Bandwidth, Birefringence, and Entanglement in Type-II Parametric Down Conversion

    Directory of Open Access Journals (Sweden)

    Daniel Erenso

    2009-01-01

    Full Text Available The twin photons produced by a type-II spontaneous parametric down conversion are well know as a potential source of photons for quantum teleportation due to the strong entanglement in polarization. This strong entanglement in polarization, however, depends on the spectral composition of the pump photon and the nature of optical isotropy of the crystal. By exact numerical calculation of the concurrence, we have shown that how pump photons spectral width and the birefringence nature of the crystal directly affect the degree of polarization entanglement of the twin photons.

  7. Stress induced birefringence in hybrid TIR/PBG guiding solid photonic crystal fibers

    DEFF Research Database (Denmark)

    Lyngsøe, Jens Kristian; Mangan, Brian Joseph; Olausson, Christina Bjarnal Thulin

    2010-01-01

    We report on two types of polarization maintaining solid photonic crystal fibers that guide light by a combination of a photonic bandgap and total internal reflection. Group and phase birefringence are studied experimentally and numerically for stress-applying parts made from B-doped and F......-doped silica. The stress field originating from Ge-doped cladding rods is shown to interfere with the stress field from the B-doped and F-doped rods. Since the differential expansion coefficients of B-doped and F-doped silica have opposite signs this interference is either destructive or constructive...

  8. Refractive indices and birefringence of hybrid liquid crystal - nanoparticles composite materials in the terahertz region

    Directory of Open Access Journals (Sweden)

    E. Mavrona

    2015-07-01

    Full Text Available We show that a hybrid LC-ferroelectric nanoparticle suspension of liquid crystal E7 doped with BaTiO3 nanoparticles leads to 10% increase in birefringence in the THz region of spectrum as compared to pure E7. Doped liquid crystals can be used to increase performance of THz modulators and waveplates. BaTiO3 nanoparticles used in the mixture were synthesised with the sol gel technique, and their refractive index has been measured in THz in powder form and in solution.

  9. Measurement of the modal birefringence of single-mode K(+) ion-exchanged planar waveguides with polarimetric interferometry.

    Science.gov (United States)

    Qi, Z M; Itoh, K; Murabayashi, M

    2000-11-01

    The polarimetric interference pattern on the surface of single-mode planar waveguides made by potassium ion exchange in soda-lime glass substrates can be observed through a 45 degrees analyzer, which allows for the high-precision measurement of the modal birefringence of samples in a wide range of 0 to 5 x 10(-4). Using this method, believed to be new, we investigated the effects of exchange temperature and time on the modal birefringence of single-mode potassium ion-exchanged waveguides. The modal birefringence profile was achieved by measurement of the variation of the phase difference between the TE(0) and the TM(0) modes with hydrofluoric-acid-etching depth of the sample.

  10. Wide-field polarimetric analysis of photoinduced birefringence in azo-dye-doped thin films: irradiance and time dependence

    Science.gov (United States)

    Marino, I.-G.; Razzetti, C.; Lottici, P. P.

    2007-03-01

    We have investigated by wide field polariscopy the behaviour of photoinduced birefringence (PIB) in sol-gel hybrid disperse red 1 (DR1) doped films. This technique allows the mapping of the local values of a bell-shaped pump beam irradiance and those of the corresponding photoinduced birefringence. By means of a point-to-point correlation of these maps, we have tracked the dependence of PIB, simultaneously and continuously, on exposure times and pump irradiances. We have then applied some of the available theoretical models, representing birefringence as an analytical function of irradiance and time, to interpolate the experimental PIB data. As compared to the usual PIB measurements, which neglect the spatial distribution of the pump irradiance, our results provide a more detailed and reliable empirical basis on which models of the orientational mechanisms of the photoisomerizable molecules can be developed.

  11. On the D1-D5 conformal field theory

    Science.gov (United States)

    Dijkgraaf, Robbert

    2000-03-01

    I give a review of some aspects of the D1-D5 conformal field theory that is dual to string theory on AdS 3 . Particular attention is paid to the gravitational interpretation of the elliptic genus as a sum over 3-manifolds.

  12. Nonclassical Particle Transport in the 1-D Diffusive Limit

    CERN Document Server

    Vasques, Richard; Krycki, Kai

    2016-01-01

    This paper provides numerical results that demonstrate the validity of the nonclassical diffusion approximation to the nonclassical transport equation in certain 1-D diffusive systems. This result provides a more solid foundation in which to improve this theory for relevant nuclear applications.

  13. Quantitative 1D saturation profiles on chalk by NMR

    DEFF Research Database (Denmark)

    Olsen, Dan; Topp, Simon; Stensgaard, Anders;

    1996-01-01

    Quantitative one-dimensional saturation profiles showing the distribution of water and oil in chalk core samples are calculated from NMR measurements utilizing a 1D CSI spectroscopy pulse sequence. Saturation profiles may be acquired under conditions of fluid flow through the sample. Results reveal...

  14. Ultracold spherical horizons in gauged N=1, d=4 supergravity

    Energy Technology Data Exchange (ETDEWEB)

    Meessen, Patrick, E-mail: meessenpatrick@uniovi.e [Department of Physics, University of Oviedo, Avda. Calvo Sotelo s/n, E-33007 Oviedo (Spain); Ortin, Tomas, E-mail: Tomas.Ortin@cern.c [Instituto de Fisica Teorica UAM/CSIC, Facultad de Ciencias C-XVI, C.U. Cantoblanco, E-28049 Madrid (Spain)

    2010-10-04

    We show that the near-horizon limit of ultracold magnetic Reissner-Nordstroem-De Sitter black holes, whose geometry is the direct product of 2-dimensional Minkowski spacetime and a 2-sphere, preserves half of the supersymmetries of minimal R-gauged N=1, d=4 supergravity.

  15. Active damping of the 1D rocking mode

    NARCIS (Netherlands)

    Babakhani, B.; de Vries, Theodorus J.A.

    Active damping of a rotational vibration mode in the linear guidance of a precision machine in a one dimensional (1D) setting is considered in this paper. This so-called rocking mode presents itself in machines having linear actuation. The limitation this vibration mode imposes on the machine

  16. Energy harvesting and storage in 1D devices

    Science.gov (United States)

    Sun, Hao; Zhang, Ye; Zhang, Jing; Sun, Xuemei; Peng, Huisheng

    2017-06-01

    Power systems and electronic devices that are bulky and rigid are not practical for use in wearable applications that require flexibility and breathability. To address this, a range of 1D energy harvesting and storage devices have been fabricated that show promise for such applications compared with their 2D and 3D counterparts. These 1D devices are based on fibres that are flexible and can accommodate deformation, for example, by twisting and stretching. The fibres can be woven into textiles and fabrics that breathe freely or can be integrated into different materials that fit the curved surface of the human body. In this Review, the development of fibre-based energy harvesting and storage devices is presented, focusing on dye-sensitized solar cells, lithium-ion batteries, supercapacitors and their integrated devices. An emphasis is placed on the interface between the active materials and the electrodes or electrolyte in the 1D devices. The differing properties of these interfaces compared with those in 2D and 3D devices are derived from the curved surface and long charge transport path in 1D electrodes.

  17. Simulation of Organic Solar Cells Using AMPS-1D Program

    Directory of Open Access Journals (Sweden)

    Samah G. Babiker

    2012-03-01

    Full Text Available The analysis of microelectronic and photonic structure in one dimension program [AMPS-1D] program has been successfully used to study inorganic solar cells. In this work the program has been used to optimize the performance of the organic solar cells. The cells considered consist of poly(2-methoxy-5-(3,7- dimethyloctyloxy-1,4-phenylenevinylene [MDMO-PPV

  18. Suppression of spin-orbit effects in 1D system

    OpenAIRE

    Entin, M. V.; Magarill, L. I.

    2004-01-01

    We report the absence of spin effects such as spin-galvanic effect, spin polarization and spin current under static electric field and inter-spin-subband absorption in 1D system with spin-orbit interaction of arbitrary form. It was also shown that the accounting for the direct interaction of electron spin with magnetic field violates this statement.

  19. Inverse parameter identification for a branching 1D arterial network

    CSIR Research Space (South Africa)

    Bogaers, Alfred EJ

    2012-07-01

    Full Text Available In this paper we investigate the invertability of a branching 1D arterial blood flow network. We limit our investigation to a single bifurcating vessel, where the material properties, unloaded areas and variables characterizing the input and output...

  20. Active damping of the 1D rocking mode

    NARCIS (Netherlands)

    Babakhani, Bayan; Vries, de Theo

    2010-01-01

    Active damping of a rotational vibration mode in the linear guidance of a precision machine in a one dimensional (1D) setting is considered in this paper. This so-called rocking mode presents itself in machines having linear actuation. The limitation this vibration mode imposes on the machine precis

  1. Birefringence dynamics of poly{l_brace}1-[4-(3-carboxy-4-hydroxyphenylazo)benzenesulfonamido]-1,2-ethanediyl, sodium salt{r_brace} cast films

    Energy Technology Data Exchange (ETDEWEB)

    Madruga, Carla [Centro de Fisica e Investigacao Tecnologica CEFITEC, Departamento de Fisica, Faculdade de Ciencias e Tecnologia, Universidade Nova de Lisboa, Campus da Caparica, 2829-516 Caparica (Portugal); Filho, Paulo Alliprandini [Instituto de Fisica, Universidade Federal de Uberlandia, 38400902, Uberlandia, MG (Brazil); Andrade, Marta M. [REQUIMTE, CQFB, Departamento de Quimica, Faculdade de Ciencias e Tecnologia, Universidade Nova de Lisboa, 2829-516 Caparica (Portugal); Goncalves, Manuel [Institute of Experimental Physics, Ulm University, Albert-Einstein-Allee 11, 89069 Ulm (Germany); Raposo, Maria [Centro de Fisica e Investigacao Tecnologica CEFITEC, Departamento de Fisica, Faculdade de Ciencias e Tecnologia, Universidade Nova de Lisboa, Campus da Caparica, 2829-516 Caparica (Portugal); Ribeiro, Paulo A., E-mail: pfr@fct.unl.pt [Centro de Fisica e Investigacao Tecnologica CEFITEC, Departamento de Fisica, Faculdade de Ciencias e Tecnologia, Universidade Nova de Lisboa, Campus da Caparica, 2829-516 Caparica (Portugal)

    2011-09-01

    Photoinduced birefringence creation/decay dynamics in poly{l_brace}1-[4-(3-carboxy-4-hydroxyphenylazo)benzenesulfonamido]-1,2-ethanediyl, sodium salt{r_brace}cast films, has been characterized in the 5 to 100 mW writing laser power range at the wavelength of 514 nm. The maximum birefringence magnitude increased with laser beam power, being the largest value of 0.03, measured at 632.8 nm. Birefringence creation kinetics followed a biexponential behavior, where a slow process and a fast process could be clearly distinguished. The fast process accounted for more than 60% of birefringence. The time constants for both fast and slow processes decreased with increasing power of writing beam. Birefringence relaxation after removal of writing laser beam revealed to be independent of beam power and, was found to be ruled by two processes, described by a biexponential curve plus a constant term accounting for residual birefringence. A high residual birefringence signal of 85 {+-} 3% was attained, with the fast process contributing to 67% of decay from maximum value. The large values obtained for time constants for both birefringence creation and relaxation processes are believed to arise from stabilization of azo-group either by the formation of an ionic network, or by local short range interactions that are coming through as a result polyelectrolyte coiling due to its high degree of ionization.

  2. Laser-induced radial birefringence and spin-to-orbital optical angular momentum conversion in silver-doped glasses

    CERN Document Server

    Amjad, Jafar Mostafavi; Slussarenko, Sergei; Karimi, Ebrahim; Marrucci, Lorenzo; Santamato, Enrico; 10.1063/1.3610474

    2012-01-01

    Samples of Ag$^+$/Na$^{+}$ ion-exchanged glass that have been subject to intense laser irradiation may develop novel optical properties, as a consequence of the formation of patterns of silver nanoparticles and other structures. Here, we report the observation of a laser-induced permanent transverse birefringence, with the optical axis forming a radial pattern, as revealed by the spin-to-orbital angular momentum conversion occurring in a probe light beam. The birefringence pattern can be modeled well as resulting from thermally-induced stresses arising in the silver-doped glass during laser exposure, although the actual mechanism leading to the permanent anisotropy is probably more complex.

  3. Laser-induced radial birefringence and spin-to-orbital optical angular momentum conversion in silver-doped glasses

    Science.gov (United States)

    Amjad, Jafar Mostafavi; Khalesifard, Hamid Reza; Slussarenko, Sergei; Karimi, Ebrahim; Marrucci, Lorenzo; Santamato, Enrico

    2011-07-01

    Samples of Ag+/Na+ ion-exchanged glass that have been subject to intense laser irradiation may develop novel optical properties, as a consequence of the formation of patterns of silver nanoparticles and other structures. Here, we report the observation of a laser-induced permanent transverse birefringence, with the optical axis forming a radial pattern, as revealed by the spin-to-orbital angular momentum conversion occurring in a probe light beam. The birefringence pattern can be modeled well as resulting from thermally-induced stresses arising in the silver-doped glass during laser exposure, although the actual mechanism leading to the permanent anisotropy is probably more complex.

  4. Natural enamel caries in polarized light microscopy: differences in histopathological features derived from a qualitative versus a quantitative approach to interpret enamel birefringence.

    Science.gov (United States)

    De Medeiros, R C G; Soares, J D; De Sousa, F B

    2012-05-01

    Lesion area measurement of enamel caries using polarized light microscopy (PLM) is currently performed in a large number of studies, but measurements are based mainly on a mislead qualitative interpretation of enamel birefringence in a single immersion medium. Here, five natural enamel caries lesions are analysed by microradiography and in PLM, and the differences in their histopathological features derived from a qualitative versus a quantitative interpretation of enamel birefringence are described. Enamel birefringence in different immersion media (air, water and quinoline) is interpreted by both qualitative and quantitative approaches, the former leading to an underestimation of the depth of enamel caries mainly when the criterion of validating sound enamel as a negatively birefringent area in immersion in water is used (a current common practice in dental research). Procedures to avoid the shortcomings of a qualitative interpretation of enamel birefringence are presented and discussed. © 2012 The Authors Journal of Microscopy © 2012 Royal Microscopical Society.

  5. The system spatial-frequency filtering of birefringence images of human blood layers

    Science.gov (United States)

    Ushenko, A. G.; Boychuk, T. M.; Mincer, O. P.; Angelsky, P. O.; Bodnar, N. B.; Oleinichenko, B. P.; Bizer, L. I.

    2013-09-01

    Among various opticophysical methods [1 - 3] of diagnosing the structure and properties of the optical anisotropic component of various biological objects a specific trend has been singled out - multidimensional laser polarimetry of microscopic images of the biological tissues with the following statistic, correlative and fractal analysis of the coordinate distributions of the azimuths and ellipticity of polarization in approximating of linear birefringence polycrystalline protein networks [4 - 10]. At the same time, in most cases, experimental obtaining of tissue sample is a traumatic biopsy operation. In addition, the mechanisms of transformation of the state of polarization of laser radiation by means of the opticoanisotropic biological structures are more varied (optical dichroism, circular birefringence). Hereat, real polycrystalline networks can be formed by different types, both in size and optical properties of biological crystals. Finally, much more accessible for an experimental investigation are biological fluids such as blood, bile, urine, and others. Thus, further progress of laser polarimetry can be associated with the development of new methods of analysis and processing (selection) of polarization- heterogeneous images of biological tissues and fluids, taking into account a wider set of mechanisms anisotropic mechanisms. Our research is aimed at developing experimental method of the Fourier polarimetry and a spatialfrequency selection for distributions of the azimuth and the ellipticity polarization of blood plasma laser images with a view of diagnosing prostate cancer.

  6. Macroscopic birefringence in liquid crystals from novel cyanobacterial polysaccharide with an extremely high molecular weight

    Science.gov (United States)

    Okajima-Kaneko, Maiko; Hayasaka-Kaneko, Daisaku; Miyazato, Shinji; Kaneko, Tatsuo

    2007-05-01

    We report an efficient method for extraction of anionic polysaccharides (PS) from cyanobacteria, Aphanothece sacrum; we used a hot alkaline solution (0.01 N NaOH) as an elution solvent in the first step of the extraction and isopropanol as a precipitation solvent in the last step. Thin fibers of PS were obtained at a high yield (50-80 % to the weight of the raw cyanobacterial sample). The spectroscopy and elemental analyses indicated the PS contains fucose, uronic acids (14.2 % by a carbazole-sulfuric acid method), a sugar unit containing amides. The solution of PS with a concentration of 1 wt% showed a very high viscosity (80 000cps) implying a high molecular weight, and a strong macroscopic birefringence with a texture typical of nematic liquid crystals was confirmed by crossed-polarizing microscopy (more than 0.5 wt%). The PS from A. sacrum may form a special structure rigid-rod enough to show LC phase and macroscopic birefringence.

  7. Novel pressure sensor by diode-pumped birefringent Nd:YAG dual-frequency laser

    Science.gov (United States)

    Huang, Chunning; Li, Yan; Zhang, Shulian; Guo, Hui

    2002-09-01

    The prototype of a novel sensor based on laser frequency splitting technology is presented in this paper and the results of a series of experiments are reported. A scheme of the novel pressure sensor by diode-pumped birefringent Nd:YAG dual-frequency laser is brought forward. As a result of the stress birefringence the laser's longitudinal mode is split to two with frequency difference. Both the theoretical analysis and the experiments indicate that there is a direct ratio relation between the frequency difference and the pressure imposed on the Nd:YAG crystal. Therefore when the external pressure is sensed by the Nd:YAG dual-frequency laser and the beat frequency is measured by the frequency counter, the pressure value can be obtained from the magnitude of the beat frequency. The laser can operate under single mode or complex modes with little error to the experiment results. Some research work under different pumping ways is finished and it indicates that the beat frequency has little relation with pumping ways. The experiment has a good linearity (R greater than 0.999) with satisfied precision, sensitivity (5.27 MHz/kPa) and stability, which provides a good academic and experimental foundation for further research.

  8. [Temperature-dependent optical activity and birefringence study of D-alanine single crystal].

    Science.gov (United States)

    Li, Zong-Sheng; Gong, Yan; Wang, Wen-Qing; Du, Wei-Min

    2006-02-01

    The measurement of the anisotropy of optical acitivity and birefringence is one of the most important clues to studying physical properties of a biaxial crystal of D-alanine. In order to investigate a second-order phase transition predicted by A. Salam between two states of D-alanine, the behavior of birefringence and optical activity is useful for the phenomenological approach to the transition mechanism. The optical activity as a peculiar quantity can respond to the modulation of the crystal lattice and to the change in the bonding nature of constituent atoms. In the present paper, the authors use the PEM-90 photoelastic modulator to study the conformation change of D-alanine at the temperature ranging from 220 to 290 K. The temperature dependence of I(2f)/I(dc) showed that the conformation of D-alanine molecule in single crystal changed around 250 K. The obtained results provide an obvious evidence of optical rotation phase transition predicted by Salam.

  9. High-magnification super-resolution FINCH microscopy using birefringent crystal lens interferometers

    Science.gov (United States)

    Siegel, Nisan; Lupashin, Vladimir; Storrie, Brian; Brooker, Gary

    2016-12-01

    Fresnel incoherent correlation holography (FINCH) microscopy is a promising approach for high-resolution biological imaging but has so far been limited to use with low-magnification, low-numerical-aperture configurations. We report the use of in-line incoherent interferometers made from uniaxial birefringent α-barium borate (α-BBO) or calcite crystals that overcome the aberrations and distortions present with previous implementations that employed spatial light modulators or gradient refractive index lenses. FINCH microscopy incorporating these birefringent elements and high-numerical-aperture oil immersion objectives could outperform standard wide-field fluorescence microscopy, with, for example, a 149 nm lateral point spread function at a wavelength of 590 nm. Enhanced resolution was confirmed with sub-resolution fluorescent beads. Taking the Golgi apparatus as a biological example, three different proteins labelled with GFP and two other fluorescent dyes in HeLa cells were resolved with an image quality that is comparable to similar samples captured by structured illumination microscopy.

  10. An Elimination Method of Temperature-Induced Linear Birefringence in a Stray Current Sensor

    Directory of Open Access Journals (Sweden)

    Shaoyi Xu

    2017-03-01

    Full Text Available In this work, an elimination method of the temperature-induced linear birefringence (TILB in a stray current sensor is proposed using the cylindrical spiral fiber (CSF, which produces a large amount of circular birefringence to eliminate the TILB based on geometric rotation effect. First, the differential equations that indicate the polarization evolution of the CSF element are derived, and the output error model is built based on the Jones matrix calculus. Then, an accurate search method is proposed to obtain the key parameters of the CSF, including the length of the cylindrical silica rod and the number of the curve spirals. The optimized results are 302 mm and 11, respectively. Moreover, an effective factor is proposed to analyze the elimination of the TILB, which should be greater than 7.42 to achieve the output error requirement that is not greater than 0.5%. Finally, temperature experiments are conducted to verify the feasibility of the elimination method. The results indicate that the output error caused by the TILB can be controlled less than 0.43% based on this elimination method within the range from −20 °C to 40 °C.

  11. Infrared birefringence imaging of residual stress and bulk defects in multicrystalline silicon

    Energy Technology Data Exchange (ETDEWEB)

    Ganapati, Vidya; Schoenfelder, Stephan; Castellanos, Sergio; Oener, Sebastian; Koepge, Ringo; Sampson, Aaron; Marcus, Matthew A.; Lai, Barry; Morhenn, Humphrey; Hahn, Giso; Bagdahn, Joerg; Buonassisi1, Tonio

    2010-05-05

    This manuscript concerns the application of infrared birefringence imaging (IBI) to quantify macroscopic and microscopic internal stresses in multicrystalline silicon (mc-Si) solar cell materials. We review progress to date, and advance four closely related topics. (1) We present a method to decouple macroscopic thermally-induced residual stresses and microscopic bulk defect related stresses. In contrast to previous reports, thermally-induced residual stresses in wafer-sized samples are generally found to be less than 5 MPa, while defect-related stresses can be several times larger. (2) We describe the unique IR birefringence signatures, including stress magnitudes and directions, of common microdefects in mc-Si solar cell materials including: {beta}-SiC and {beta}-Si{sub 3}N{sub 4} microdefects, twin bands, nontwin grain boundaries, and dislocation bands. In certain defects, local stresses up to 40 MPa can be present. (3) We relate observed stresses to other topics of interest in solar cell manufacturing, including transition metal precipitation, wafer mechanical strength, and minority carrier lifetime. (4) We discuss the potential of IBI as a quality-control technique in industrial solar cell manufacturing.

  12. Infrared birefringence imaging of residual stress and bulk defects in multicrystalline silicon

    Science.gov (United States)

    Ganapati, Vidya; Schoenfelder, Stephan; Castellanos, Sergio; Oener, Sebastian; Koepge, Ringo; Sampson, Aaron; Marcus, Matthew A.; Lai, Barry; Morhenn, Humphrey; Hahn, Giso; Bagdahn, Joerg; Buonassisi, Tonio

    2010-09-01

    This manuscript concerns the application of infrared birefringence imaging (IBI) to quantify macroscopic and microscopic internal stresses in multicrystalline silicon (mc-Si) solar cell materials. We review progress to date, and advance four closely related topics. (1) We present a method to decouple macroscopic thermally-induced residual stresses and microscopic bulk defect related stresses. In contrast to previous reports, thermally-induced residual stresses in wafer-sized samples are generally found to be less than 5 MPa, while defect-related stresses can be several times larger. (2) We describe the unique IR birefringence signatures, including stress magnitudes and directions, of common microdefects in mc-Si solar cell materials including: β-SiC and β-Si3N4 microdefects, twin bands, nontwin grain boundaries, and dislocation bands. In certain defects, local stresses up to 40 MPa can be present. (3) We relate observed stresses to other topics of interest in solar cell manufacturing, including transition metal precipitation, wafer mechanical strength, and minority carrier lifetime. (4) We discuss the potential of IBI as a quality-control technique in industrial solar cell manufacturing.

  13. Measurements of linear and circular birefringence in metals by femtosecond optical pump-probe spectroscopy

    CERN Document Server

    Wilks, R

    2002-01-01

    Optically induced transient linear and circular birefringence has been studied in three different materials: ferromagnetic Ni, semiconducting GaAs and the non-magnetic metal Al. A pump-probe experiment with sub-ps resolution was set up for this purpose. The time-resolved reflectivity, rotation and ellipticity of the reflected probe beam were recorded after pumping with light of variable helicity. In the Ni sample an ultrafast demagnetisation effect was observed and the variation of the rotation and ellipticity on sub-picosecond time scales was compared. Rotation and ellipticity were found to have a similar time dependence. In GaAs, optical orientation of spin was achieved and the subsequent spin relaxation was measured for different pump powers. Fitting of the optical rotation data has revealed the power dependence of the various decay constants. In the Al sample a small signal was observed that decays on ps time scales. This was attributed to a linear birefringence effect resulting from a cubic optical nonli...

  14. Periodic reversal of magneto-optic Faraday rotation on uniaxial birefringence crystal with ultrathin magnetic films

    Directory of Open Access Journals (Sweden)

    C. W. Su

    2013-07-01

    Full Text Available An experimental approach of inclined incidence magneto-optic Faraday effect observed in the polar plane is applied. Three samples containing ferromagnetic cobalt ultrathin films on a semiconductor zinc oxide (0001 single crystal substrate with in-plane and out-of-plane anisotropy are evaluated. Through the fine adjustment of crossed polarizers in the magneto-optic effect measurement completely recorded the detail optical and magneto-optical responses from the birefringent crystal substrate and the magnetic film, especially for the signal induced from the substrate with uniaxial optical axis. The angle dependency of interference phenomena periodically from the optical and magneto-optical responses is attributed to the birefringence even in the absence of a magnetic field. The new type of observation finds that the transmission Faraday intensity in the oblique incidence includes a combination of polarization rotations, which results from optical compensation from the substrate and magneto-optical Faraday effects from the film. The samples grown at different rates and examined by this method exhibit magnetic structure discriminations. This result can be applied in the advanced polarized-light technologies to enhance the spatial resolution of magnetic surfaces with microstructural information under various magnetic field direction.

  15. 1D Josephson quantum interference grids: diffraction patterns and dynamics

    Science.gov (United States)

    Lucci, M.; Badoni, D.; Corato, V.; Merlo, V.; Ottaviani, I.; Salina, G.; Cirillo, M.; Ustinov, A. V.; Winkler, D.

    2016-02-01

    We investigate the magnetic response of transmission lines with embedded Josephson junctions and thus generating a 1D underdamped array. The measured multi-junction interference patterns are compared with the theoretical predictions for Josephson supercurrent modulations when an external magnetic field couples both to the inter-junction loops and to the junctions themselves. The results provide a striking example of the analogy between Josephson phase modulation and 1D optical diffraction grid. The Fiske resonances in the current-voltage characteristics with voltage spacing {Φ0}≤ft(\\frac{{\\bar{c}}}{2L}\\right) , where L is the total physical length of the array, {Φ0} the magnetic flux quantum and \\bar{c} the speed of light in the transmission line, demonstrate that the discrete line supports stable dynamic patterns generated by the ac Josephson effect interacting with the cavity modes of the line.

  16. D1-D5-P microstates at the cap

    CERN Document Server

    Giusto, Stefano; Mathur, Samir D; Turton, David

    2012-01-01

    The geometries describing D1-D5-P bound states in string theory have three regions: flat asymptotics, an anti-de Sitter throat, and a 'cap' region at the bottom of the throat. We identify the CFT description of a known class of supersymmetric D1-D5-P microstate geometries which describe degrees of freedom in the cap region. The class includes both regular solutions and solutions with conical defects, and generalizes configurations with known CFT descriptions: a parameter related to spectral flow in the CFT is generalized from integer to fractional values. We provide strong evidence for this identification by comparing the massless scalar excitation spectrum between gravity and CFT and finding exact agreement.

  17. New D1-D5-P geometries from string amplitudes

    CERN Document Server

    Giusto, Stefano; Turton, David

    2011-01-01

    We derive the long range supergravity fields sourced by a D1-D5-P bound state from disk amplitudes for massless closed string emission. We suggest that since the parameter controlling the string perturbation expansion for this calculation decreases with distance from the bound state, the resulting asymptotic fields are valid even in the regime of parameters in which there is a classical black hole solution with the same charges. The supergravity fields differ from the black hole solution by multipole moments and are more general than those contained within known classes of solutions in the literature, whilst still preserving four supersymmetries. Our results support the conjecture that the black hole solution should be interpreted as a coarse-grained description rather than an exact description of the gravitational field sourced by D1-D5-P bound states in this regime of parameters.

  18. Developing 1D nanostructure arrays for future nanophotonics

    Directory of Open Access Journals (Sweden)

    Cooke DG

    2006-01-01

    Full Text Available AbstractThere is intense and growing interest in one-dimensional (1-D nanostructures from the perspective of their synthesis and unique properties, especially with respect to their excellent optical response and an ability to form heterostructures. This review discusses alternative approaches to preparation and organization of such structures, and their potential properties. In particular, molecular-scale printing is highlighted as a method for creating organized pre-cursor structure for locating nanowires, as well as vapor–liquid–solid (VLS templated growth using nano-channel alumina (NCA, and deposition of 1-D structures with glancing angle deposition (GLAD. As regards novel optical properties, we discuss as an example, finite size photonic crystal cavity structures formed from such nanostructure arrays possessing highQand small mode volume, and being ideal for developing future nanolasers.

  19. Iron-based 1D nanostructures by electrospinning process.

    Science.gov (United States)

    Eid, Cynthia; Brioude, Arnaud; Salles, Vincent; Plenet, Jean-Claude; Asmar, Roy; Monteil, Yves; Khoury, Randa; Khoury, Antonio; Miele, Philippe

    2010-03-26

    Iron-based 1D nanostructures have been successfully prepared using an electrospinning technique and varying the pyrolysis atmospheres. Hematite (Fe(2)O(3)) nanotubes and polycrystalline Fe(3)C nanofibers were obtained by simple air or mixed gas (H(2), Ar) annealing treatments. Using the air annealing treatment, a high control of the morphology as well as of the wall thickness of the nanotubes was demonstrated with a direct influence of the starting polymer concentration. When mixed gases (H(2) and Ar) were used for the annealing treatments, for the first time polycrystalline Fe(3)C nanofibers composed of carbon graphitic planes were obtained, ensuring Fe(3)C nanoparticle stability and nanofiber cohesion. The morphology and structural properties of all these iron-based 1D nanostructures were fully characterized by SEM, TEM, XRD and Raman spectroscopy.

  20. Phase diagram of a bulk 1d lattice Coulomb gas

    Science.gov (United States)

    Démery, V.; Monsarrat, R.; Dean, D. S.; Podgornik, R.

    2016-01-01

    The exact solution, via transfer matrix, of the simple one-dimensional lattice Coulomb gas (1d LCG) model can reproduce peculiar features of ionic liquid capacitors, such as overscreening, layering, and camel- and bell-shaped capacitance curves. Using the same transfer matrix method, we now compute the bulk properties of the 1d LCG in the constant voltage ensemble. We unveil a phase diagram with rich structure exhibiting low-density disordered and high-density ordered phases, separated by a first-order phase transition at low temperature; the solid state at full packing can be ordered or not, depending on the temperature. This phase diagram, which is strikingly similar to its three-dimensional counterpart, also sheds light on the behaviour of the confined system.

  1. Ultrahigh-Q nanocavity with 1D photonic gap.

    Science.gov (United States)

    Notomi, M; Kuramochi, E; Taniyama, H

    2008-07-21

    Recently, various wavelength-sized cavities with theoretical Q values of approximately 10(8) have been reported, however, they all employ 2D or 3D photonic band gaps to realize strong light confinement. Here we numerically demonstrate that ultrahigh-Q (2.0x10(8)) and wavelength-sized (V(eff) approximately 1.4(lambda/n)3) cavities can be achieved by employing only 1D periodicity.

  2. Polaron in a quasi 1D cylindrical quantum wire

    Directory of Open Access Journals (Sweden)

    I.Nsangou

    2005-01-01

    Full Text Available Polaron states in a quasi 1D cylindrical quantum wire with a parabolic confinement potential are investigated applying the Feynman variational principle. The effect of the wire radius on the polaron ground state energy level, the mass and the Fröhlich electron-phonon-coupling constant are obtained for the case of a quasi 1D cylindrical quantum wire. The effect of anisotropy of the structure on the polaron ground state energy level and the mass are also investigated. It is observed that as the wire radius tends to zero, the polaron mass and energy diverge logarithmically. The polaron mass and energy differ from the canonical strong-coupling behavior by the Fröhlich electron-phonon coupling constant and the radius of the quasi 1D cylindrical quantum wire that are expressed through a logarithmic function. Moreover, it is observed that the polaron energy and mass for strong coupling for the case of the quasi 1D cylindrical quantum wire are greater than those for bulk crystals. It is also observed that the anisotropy of the structure considerably affects both the polaron ground state energy level and the mass. It is found that as the radius of the cylindrical wire reduces, the regimes of the weak and intermediate coupling polaron shorten while the region of the strong coupling polaron broadens and extends into those of the weak and intermediate ones. Analytic expressions for the polaron ground state energy level and mass are derived for the case of strong coupling polarons.

  3. Supported plasma-made 1D heterostructures: perspectives and applications

    Energy Technology Data Exchange (ETDEWEB)

    Borras, Ana; Macias-Montero, Manuel; Romero-Gomez, Pablo; Gonzalez-Elipe, Agustin R, E-mail: anaisabel.borras@icmse.csic.es [Materials Science Institute of Seville (CSIC-Universidad Sevilla), C/Americo Vespucio 49 41092, Sevilla (Spain)

    2011-05-04

    Plasma-related methods have been widely used in the fabrication of carbon nanotubes and nanofibres (NFs) and semiconducting inorganic nanowires (NWs). A natural progression of the research in the field of 1D nanostructures is the synthesis of multicomponent NWs and NFs. In this paper we review the state of the art of the fabrication by plasma methods of 1D heterostructures including applications and perspectives. Furthermore, recent developments on the use of metal seeds (Ag, Au, Pt) to obtain metal-oxide nanostructures are also extensively described. Results are shown for various metal substrates, either metal foils or supported nanoparticles/thin films of the metal where the effects of the size, surface coverage, percolation degree and thickness of the metal seeds have been systematically evaluated. The possibilities of the process are illustrated by the preparation of nanostructured films and supported NFs of different metal-oxides (Ag, Au and SiO{sub 2}, TiO{sub 2}, ZnO). Particularly, in the case of silver, the application of an oxygen plasma treatment prior to the deposition of the oxide was critical for efficiently controlling the growth of the 1D heterostructures. A phenomenological model is proposed to account for the thin-film nanostructuring and fibre formation by considering basic phenomena such as stress relaxation, inhomogeneities in the plasma sheath electrical field and the local disturbance of the oxide growth.

  4. Enhancing Solar Cell Efficiencies through 1-D Nanostructures

    Directory of Open Access Journals (Sweden)

    Yu Kehan

    2008-01-01

    Full Text Available Abstract The current global energy problem can be attributed to insufficient fossil fuel supplies and excessive greenhouse gas emissions resulting from increasing fossil fuel consumption. The huge demand for clean energy potentially can be met by solar-to-electricity conversions. The large-scale use of solar energy is not occurring due to the high cost and inadequate efficiencies of existing solar cells. Nanostructured materials have offered new opportunities to design more efficient solar cells, particularly one-dimensional (1-D nanomaterials for enhancing solar cell efficiencies. These 1-D nanostructures, including nanotubes, nanowires, and nanorods, offer significant opportunities to improve efficiencies of solar cells by facilitating photon absorption, electron transport, and electron collection; however, tremendous challenges must be conquered before the large-scale commercialization of such cells. This review specifically focuses on the use of 1-D nanostructures for enhancing solar cell efficiencies. Other nanostructured solar cells or solar cells based on bulk materials are not covered in this review. Major topics addressed include dye-sensitized solar cells, quantum-dot-sensitized solar cells, and p-n junction solar cells.

  5. The stability of 1-D soliton in transverse direction

    Science.gov (United States)

    Verma, Deepa; Bera, Ratan Kumar; Das, Amita; Kaw, Predhiman

    2016-12-01

    The complete characterization of the exact 1-D solitary wave solutions (both stationary and propagating) for light plasma coupled system have been studied extensively in the parameter space of light frequency and the group speed [Poornakala et al., Phys. Plasmas 9(5), 1820 (2002)]. It has been shown in 1-D that solutions with single light wave peak and paired structures are stable and hence long lived. However, solutions having multiple peaks of light wave are unstable due to Raman scattering instability [Saxena et al., Phys. Plasmas 14, 072307 (2007)]. Here, we have shown with the help of 2-D fluid simulation that single peak and paired solutions too get destabilized by the transverse filamentation instability. The numerical growth rates obtained from simulations is seen to compare well with the analytical values. It is also shown that multiple peaks solitons first undergo the regular 1-D forward Raman scattering instability. Subsequently, they undergo a distinct second phase of destabilization through transverse filamentation instability. This is evident from the structure as well as the plot of the perturbed energy which shows a second phase of growth after saturating initially. The growth rate of the filamentation instability being comparatively slower than the forward Raman instability this phase comes quite late and is clearly distinguishable.

  6. Development of 1D Liner Compression Code for IDL

    Science.gov (United States)

    Shimazu, Akihisa; Slough, John; Pancotti, Anthony

    2015-11-01

    A 1D liner compression code is developed to model liner implosion dynamics in the Inductively Driven Liner Experiment (IDL) where FRC plasmoid is compressed via inductively-driven metal liners. The driver circuit, magnetic field, joule heating, and liner dynamics calculations are performed at each time step in sequence to couple these effects in the code. To obtain more realistic magnetic field results for a given drive coil geometry, 2D and 3D effects are incorporated into the 1D field calculation through use of correction factor table lookup approach. Commercial low-frequency electromagnetic fields solver, ANSYS Maxwell 3D, is used to solve the magnetic field profile for static liner condition at various liner radius in order to derive correction factors for the 1D field calculation in the code. The liner dynamics results from the code is verified to be in good agreement with the results from commercial explicit dynamics solver, ANSYS Explicit Dynamics, and previous liner experiment. The developed code is used to optimize the capacitor bank and driver coil design for better energy transfer and coupling. FRC gain calculations are also performed using the liner compression data from the code for the conceptual design of the reactor sized system for fusion energy gains.

  7. Homogenization of 1D and 2D magnetoelastic lattices

    Directory of Open Access Journals (Sweden)

    Schaeffer Marshall

    2015-01-01

    Full Text Available This paper investigates the equivalent in-plane mechanical properties of one dimensional (1D and two dimensional (2D, periodic magneto-elastic lattices. A lumped parameter model describes the lattices using magnetic dipole moments in combination with axial and torsional springs. The homogenization procedure is applied to systems linearized about stable configurations, which are identified by minimizing potential energy. Simple algebraic expressions are derived for the properties of 1D structures. Results for 1D lattices show that a variety of stiffness changes are possible through reconfiguration, and that magnetization can either stiffen or soften a structure. Results for 2D hexagonal and re-entrant lattices show that both reconfigurations and magnetization have drastic effects on the mechanical properties of lattice structures. Lattices can be stiffened or softened and the Poisson’s ratio can be tuned. Furthermore for certain hexagonal lattices the sign of Poisson’s ratio can change by varying the lattice magnetization. In some cases presented, analytical and numerically estimated equivalent properties are validated through numerical simulations that also illustrate the unique characteristics of the investigated configurations.

  8. Molecular characterization of zebrafish Oatp1d1 (Slco1d1), a novel organic anion-transporting polypeptide.

    Science.gov (United States)

    Popovic, Marta; Zaja, Roko; Fent, Karl; Smital, Tvrtko

    2013-11-22

    The organic anion-transporting polypeptide (OATP/Oatp) superfamily includes a group of polyspecific transporters that mediate transport of large amphipathic, mostly anionic molecules across cell membranes of eukaryotes. OATPs/Oatps are involved in the disposition and elimination of numerous physiological and foreign compounds. However, in non-mammalian species, the functional properties of Oatps remain unknown. We aimed to elucidate the role of Oatp1d1 in zebrafish to gain insights into the functional and structural evolution of the OATP1/Oatp1 superfamily. We show that diversification of the OATP1/Oatp1 family occurs after the emergence of jawed fish and that the OATP1A/Oatp1a and OATP1B/Oatp1b subfamilies appeared at the root of tetrapods. The Oatp1d subfamily emerged in teleosts and is absent in tetrapods. The zebrafish Oatp1d1 is similar to mammalian OATP1A/Oatp1a and OATP1B/Oatp1b members, with the main physiological role in transport and balance of steroid hormones. Oatp1d1 activity is dependent upon pH gradient, which could indicate bicarbonate exchange as a mode of transport. Our analysis of evolutionary conservation and structural properties revealed that (i) His-79 in intracellular loop 3 is conserved within OATP1/Oatp1 family and is crucial for the transport activity; (ii) N-glycosylation impacts membrane targeting and is conserved within the OATP1/Oatp1 family with Asn-122, Asn-133, Asn-499, and Asn-512 residues involved; (iii) the evolutionarily conserved cholesterol recognition interaction amino acid consensus motif is important for membrane localization; and (iv) Oatp1d1 is present in dimeric and possibly oligomeric form in the cell membrane. In conclusion, we describe the first detailed characterization of a new Oatp transporter in zebrafish, offering important insights into the functional evolution of the OATP1/Oatp1 family and the physiological role of Oatp1d1.

  9. A New Distributed Measurement of Birefringence Vectors by P-OTDR Assisted by a High Speed Polarization Analyzer

    Institute of Scientific and Technical Information of China (English)

    SHANG Chao; WU Chong-Qing; LI Zheng-Yong; YANG Shuang-Show

    2011-01-01

    A new polarimetric optical time domain reflectometry (P-OTDR) measurement device assisted by a high speed polarization analyzer is designed and a new algorithm, which can be used to accurately measure the birefringence vector, is proposed. In this method, only one measurement is required and the result is insensitive to the input state of polarization. An 1-km single mode fiber (SMF) is measured and the distribution of the local birefringence vector along the SMF is obtained with a resolution of 2 cm.%@@ A new polarimetric optical time domain reflectometry(P-OTDR)measurement device assisted by a high speed polarization analyzer is designed and a new algorithm,which can be used to accurately measure the birefringence vector,is proposed.In this method,only one measurement is required and the result is insensitive to the input state of polarization.An 1-km single mode fiber(SMF)is measured and the distribution of the local birefringence vector along the SMF is obtained with a resolution of 2 cm.

  10. Efficiency of four-wave mixing between orthogonally polarized linear waves and solitons in a birefringent fiber

    Science.gov (United States)

    Mas Arabí, C.; Bessin, F.; Kudlinski, A.; Mussot, A.; Skryabin, D.; Conforti, M.

    2016-12-01

    We analyze the interaction between orthogonally polarized solitons and dispersive waves via four-wave mixing in a birefringent fiber. We calculate analytically the efficiency of the phase-sensitive scattering between orthogonally polarized solitons and dispersive waves. Experiments performed by using a photonic crystal fiber perfectly match the analytical predictions.

  11. Highly birefringent photonic crystal fiber with ultra-flattened negative dispersion over S + C + L + U bands

    DEFF Research Database (Denmark)

    Habib, Selim; Khandker, Emran

    2015-01-01

    + C + L + U wavelength bands and average dispersion of about −558.96 ps∕nm∕km with absolute dispersion variation of 9.7 ps∕nm∕km from 1460 to 1675 nm (215 nm bandwidth). Moreover, ultrahigh birefringence of 0.0299 is also achieved at a 1500 nm wavelength. © 2015 Optical Society of America...

  12. Deep tissue volume imaging of birefringence through fibre-optic needle probes for the delineation of breast tumour

    Science.gov (United States)

    Villiger, Martin; Lorenser, Dirk; McLaughlin, Robert A.; Quirk, Bryden C.; Kirk, Rodney W.; Bouma, Brett E.; Sampson, David D.

    2016-07-01

    Identifying tumour margins during breast-conserving surgeries is a persistent challenge. We have previously developed miniature needle probes that could enable intraoperative volume imaging with optical coherence tomography. In many situations, however, scattering contrast alone is insufficient to clearly identify and delineate malignant regions. Additional polarization-sensitive measurements provide the means to assess birefringence, which is elevated in oriented collagen fibres and may offer an intrinsic biomarker to differentiate tumour from benign tissue. Here, we performed polarization-sensitive optical coherence tomography through miniature imaging needles and developed an algorithm to efficiently reconstruct images of the depth-resolved tissue birefringence free of artefacts. First ex vivo imaging of breast tumour samples revealed excellent contrast between lowly birefringent malignant regions, and stromal tissue, which is rich in oriented collagen and exhibits higher birefringence, as confirmed with co-located histology. The ability to clearly differentiate between tumour and uninvolved stroma based on intrinsic contrast could prove decisive for the intraoperative assessment of tumour margins.

  13. Investigation of stress-induced birefringence of tissue determined with polarisation sensitive optical coherence tomography (Conference Presentation)

    Science.gov (United States)

    Karnowski, Karol; Li, Qingyun; Villiger, Martin; Sampson, David D.

    2017-02-01

    Polarisation sensitive optical coherence tomography (PS-OCT) offers additional intrinsic contrast to probe differences between healthy tissue and cancer that are often barely visible due to limited scattering contrast in an OCT image. PS-OCT reconstructs tissue birefringence from phase-sensitive measurements of orthogonal polarisation components of backscattering. In material science, polarisation has been used to study stress distribution, including the birefringence induced by stress in an otherwise isotropic material. Similar effects in biological tissues have not been well studied yet; however, may have application to tissues subjected to stress, e.g., tendons, muscles, lens, cornea or airway smooth muscle (ASM). The objective of this work is to explore stress-induced birefringence in tissue. We employ an advanced swept source-based PS-OCT system capable of measurement of tissue local polarisation properties. The sample in both cases is illuminated with orthogonal, passively depth-encoded polarisation states. Light returning from the tissue is detected via a polarisation-diversity detection module and a Mueller formalism is used to reconstruct polarisation properties (including retardation, diattenuation, and depolarisation) of the tissue. In this study, we demonstrate the measurement of stress-induced birefringence in phantoms and in soft tissues with polarisation sensitive optical coherence tomography.

  14. Tensor network simulation of QED on infinite lattices: Learning from (1 +1 ) d , and prospects for (2 +1 ) d

    Science.gov (United States)

    Zapp, Kai; Orús, Román

    2017-06-01

    The simulation of lattice gauge theories with tensor network (TN) methods is becoming increasingly fruitful. The vision is that such methods will, eventually, be used to simulate theories in (3 +1 ) dimensions in regimes difficult for other methods. So far, however, TN methods have mostly simulated lattice gauge theories in (1 +1 ) dimensions. The aim of this paper is to explore the simulation of quantum electrodynamics (QED) on infinite lattices with TNs, i.e., fermionic matter fields coupled to a U (1 ) gauge field, directly in the thermodynamic limit. With this idea in mind we first consider a gauge-invariant infinite density matrix renormalization group simulation of the Schwinger model—i.e., QED in (1 +1 ) d . After giving a precise description of the numerical method, we benchmark our simulations by computing the subtracted chiral condensate in the continuum, in good agreement with other approaches. Our simulations of the Schwinger model allow us to build intuition about how a simulation should proceed in (2 +1 ) dimensions. Based on this, we propose a variational ansatz using infinite projected entangled pair states (PEPS) to describe the ground state of (2 +1 ) d QED. The ansatz includes U (1 ) gauge symmetry at the level of the tensors, as well as fermionic (matter) and bosonic (gauge) degrees of freedom both at the physical and virtual levels. We argue that all the necessary ingredients for the simulation of (2 +1 ) d QED are, a priori, already in place, paving the way for future upcoming results.

  15. Coupling of Nod1D and HOTCHANNEL: static case; Acoplamiento de Nod1D y HOTCHANNEL: caso estatico

    Energy Technology Data Exchange (ETDEWEB)

    Gomez T, A.M. [IPN-ESFM, 07738 Mexico D.F. (Mexico); Ovando C, R. [IIE-Gcia. de Energia Nuclear, Cuernavaca, Morelos (Mexico)]. e-mail: rovando@iie.org.mx

    2003-07-01

    In this work the joining of the programs Nod1D and HOTCHANNEL, developed in the National Polytechnic Institute (IPN) and in the Electrical Research Institute (IIE) respectively is described. The first one allows to study the neutronic of a nuclear reactor and the second one allows to carry out the analysis of hot channel of a Boiling Water Reactor (BWR). Nod1 D is a program that it solves by nodal methods type finite element those diffusion equations in multigroup, and it is the static part of Nod Kin that it solves the diffusion equation in their time dependent part. For another side HOTCHANNEL is based on a mathematical model constituted by four conservation equations (two of mass conservation, one of motion quantity and one of energy), which are solved applying one discretization in implicit finite differences. Both programs have been verified in independent form using diverse test problems. In this work the modifications that were necessary to carry out to both for obtaining a coupled program that it provides the axial distribution of the neutron flux, the power, the burnup and the void fraction, among others parameters as much as neutronic as thermal hydraulics are described. Those are also mentioned limitations, advantages and disadvantages of the final product to which has been designated Nod1 D-HotChn. Diverse results for the Cycle 1 of the Laguna Verde Unit 1 reactor of the Nucleo electric central comparing them with those obtained directly with the CoreMasterPresto code are provided. (Author)

  16. BGK electron solitary waves: 1D and 3D

    Directory of Open Access Journals (Sweden)

    L.-J. Chen

    2002-01-01

    Full Text Available This paper presents new results for 1D BGK electron solitary wave (phase-space electron hole solutions and, based on the new results, extends the solutions to include the 3D electrical interaction (E ~ 1/r 2 of charged particles. Our approach for extending to 3D is to solve the nonlinear 3D Poisson and 1D Vlasov equations based on a key feature of 1D electron hole (EH solutions; the positive core of an EH is screened by electrons trapped inside the potential energy trough. This feature has not been considered in previous studies. We illustrate this key feature using an analytical model and argue that the feature is independent of any specific model. We then construct azimuthally symmetric EH solutions under conditions where electrons are highly field-aligned and ions form a uniform background along the magnetic field. Our results indicate that, for a single humped electric potential, the parallel cut of the perpendicular component of the electric field (E⊥ is unipolar and that of the parallel component (E|| bipolar, reproducing the multi-dimensional features of the solitary waves observed by the FAST satellite. Our analytical solutions presented in this article capture the 3D electric interaction and the observed features of (E|| and E⊥. The solutions predict a dependence of the parallel width-amplitude relation on the perpendicular size of EHs. This dependence can be used in conjunction with experimental data to yield an estimate of the typical perpendicular size of observed EHs; this provides important information on the perpendicular span of the source region as well as on how much electrostatic energy is transported by the solitary waves.

  17. Birefringence and polarization rotator induced by electromagnetically induced transparency in rare earth ion-doped crystals

    Science.gov (United States)

    Li, Zhixiang; Liu, Jianji; Yu, Ping; Zhang, Guoquan

    2016-05-01

    The birefringence induced by the electromagnetically induced transparency effect in a {Pr}^{3+}:{Y}_2 {SiO}_5 crystal was studied by using a balanced polarimeter technique. The results show that it is possible to control the polarization state of the output probe beam by adjusting the experimental conditions. Particularly, the coherently prepared {Pr}^{3+}:{Y}_2 {SiO}_5 crystal can serve as a polarization rotator for a linearly polarized input probe beam at the two-photon resonant condition. Such coherent control on the polarization of light should be useful for polarization-based classical and quantum information processing such as all-optical switching, polarization preserving light pulse memory and polarization qubits based on rare earth ion-doped solids.

  18. Polarized light imaging of birefringence and diattenuation at highresolution and high sensitivity

    CERN Document Server

    Mehta, Shalin B; Oldenbourg, Rudolf

    2013-01-01

    Polarized light microscopy provides unique opportunities for analyzing the molecular order in man-made and natural materials, including biological structures inside living cells, tissues, and whole organisms. 20 years ago, the LC-PolScope was introduced as a modern version of the traditional polarizing microscope enhanced by liquid crystal devices for the control of polarization, and by electronic imaging and digital image processing for fast and comprehensive image acquisition and analysis. The LC- PolScope is commonly used for birefringence imaging, analyzing the spatial and temporal variations of the differential phase delay in ordered and transparent materials. Here we describe an alternative use of the LC-PolScope for imaging the polarization dependent transmittance of dichroic materials. We explain the minor changes needed to convert the instrument between the two imaging modes, discuss the relationship between the quantities measured with either instrument, and touch on the physical connection between ...

  19. Localization length calculations in alternating metamaterial-birefringent disordered layered stacks

    CERN Document Server

    del Barco, O; Gevorkian, Zh

    2015-01-01

    A detailed theoretical and numerical analysis of the localization length in alternating metamaterial-birefringent random layered stacks, under uncorrelated thickness-disorder, has been performed. Similar structures have recently been reported to suppress the Brewster delocalization for $\\it{p}$-polarized light, when "standard" isotropic layers (with positive index of refraction) are considered instead of metamaterial layers, providing a generic means to produce polarization-insensitive, broadband reflections. However, this enhancement of localization is valid for short wavelengths $\\lambda$ compared to the mean layer thickness $a_0$. At higher wavelengths, we recover the Brewster anomalies for $\\it{p}$-polarized states impeding a remarkable localization of light. To achieve a better localization for a wider range of wavelengths, we replaced the conventional isotropic layers by negative-index metamaterials presenting low losses and constant index of refraction over the near-infrared range. As a result, our num...

  20. Anisotropy induced wave birefringence in bounded supercritical plasma confined in a multicusp magnetic field

    Science.gov (United States)

    Dey, Indranuj; Bhattacharjee, Sudeep

    2011-04-01

    Laboratory observation of rotation of the polarization axis (θc˜20°-40° with respect to vacuum) of a penetrating electromagnetic wave through a bounded supercritical plasma (plasma frequency ωp>wave frequency ω), confined in a multicusp magnetic field is reported. Birefringence of the radial and polar wave electric field components (Er and Eθ) has been identified as the cause for the rotation, similar to a magneto-optic medium, however, with distinct differences owing to the presence of wave induced resonances. Numerical simulation results obtained by solving the Maxwell's equations by incorporating the plasma and magnetostatic field inhomogeneities within a conducting boundary shows a reasonable agreement with the experimental results.

  1. Giant birefringence in optical antenna arrays with widely tailorable optical anisotropy

    CERN Document Server

    Kats, Mikhail A; Aoust, Guillaume; Yu, Nanfang; Blanchard, Romain; Aieta, Francesco; Gaburro, Zeno; Capasso, Federico

    2012-01-01

    The manipulation of light by conventional optical components such as a lenses, prisms and wave plates involves engineering of the wavefront as it propagates through an optically-thick medium. A new class of ultra-flat optical components with high functionality can be designed by introducing abrupt phase shifts into the optical path, utilizing the resonant response of arrays of scatters with deeply-subwavelength thickness. As an application of this concept, we report a theoretical and experimental study of birefringent arrays of two-dimensional (V- and Y-shaped) optical antennas which support two orthogonal charge-oscillation modes and serve as broadband, anisotropic optical elements that can be used to locally tailor the amplitude, phase, and polarization of light. The degree of optical anisotropy can be designed by controlling the interference between the light scattered by the antenna modes; in particular, we observe a striking effect in which the anisotropy disappears as a result of destructive interferenc...

  2. In vitro birefringence imaging with spectral domain polarization-sensitive optical coherence tomography

    Institute of Scientific and Technical Information of China (English)

    Qiang Gong; Chuanmao Fan; Fan Zhang; Jianquan Yao

    2008-01-01

    Spectral domain polarization-sensitive optical coherence tomography (SDPS-OCT) is a depth-resolved polarization-sensitive interferometry which integrates polarization optics into spectral domain optical co-herence tomography (SD-OCT). This configuration can obtain birefringence information of samples and improve the imaging speed. In this paper, horizontally polarized light is used to replace natural light of the source. Then, right-rotated circularly polarized light is the incident sample light. To obtain two orthogonal components of the polarized interferogram, the reflected light of the reference arm is set to be 45° linearly polarized light. These two components are acquired by two spectrometers synchronously. The system was employed to achieve 12.8-#m axial resolution and 4.36-#m transverse resolution. We have imaged in vitro chicken tendon and muscle tissues with these system.

  3. Manipulating full photonic band gaps in two dimensional birefringent photonic crystals.

    Science.gov (United States)

    Proietti Zaccaria, Remo; Verma, Prabhat; Kawaguchi, Satoshi; Shoji, Satoru; Kawata, Satoshi

    2008-09-15

    The probability to realize a full photonic band gap in two-dimensional birefringent photonic crystals can be readily manipulated by introducing symmetry reduction or air holes in the crystal elements. The results lie in either creation of new band gaps or enlargement of existing band gaps. In particular, a combination of the two processes produces an effect much stronger than a simple summation of their individual contributions. Materials with both relatively low refractive index (rutile) and high refractive index (tellurium) were considered. The combined effect of introduction of symmetry reduction and air holes resulted in a maximum enlargement of the band gaps by 8.4% and 20.2%, respectively, for the two materials.

  4. Birefringence-dependent linearly-polarized emission in a liquid crystalline organic light emitting polymer.

    Science.gov (United States)

    Lee, Dong-Myoung; Lee, You-Jin; Kim, Jae-Hoon; Yu, Chang-Jae

    2017-02-20

    We investigated the linearly polarized emission of uniformly aligned poly(9,9-di-n-octylfluorenyl-2,7-diyl)-alt-(benzo[2,1,3]thia-diazol-4,8-diyl) (F8BT) with a liquid crystalline phase on a rubbed alignment layer. The polarization ratio, defined by the ratio of luminous intensities polarized parallel and perpendicular to the rubbed direction, gradually decreased with increasing thickness of the F8BT film. In the photoluminescence (PL) process, the polarized light is emitted throughout the whole F8BT film, while in the electroluminescence (EL) process, the polarized light is emitted at a certain region within the F8BT film. The thickness-dependent polarization ratios in both PL and EL processes were successfully described based on a simple model wherein the mean optical birefringence was expressed as a function of the thickness of the F8BT film.

  5. A birefringent etalon enhances the Faraday rotation of thin magneto-optical films

    Science.gov (United States)

    Almpanis, E.; Pantazopoulos, P. A.; Papanikolaou, N.; Yannopapas, V.; Stefanou, N.

    2017-07-01

    The magneto-optical response of a Faraday-active Fabry-Pérot etalon with birefringent mirrors is studied by means of electrodynamic simulations using the finite-element and the scattering-matrix methods. The specific structure under consideration consists of a magnetic garnet film sandwiched between two metallic layers, patterned with periodically spaced parallel grooves on their outer sides. Our results are analyzed by reference to the properties of the individual structural components and a consistent interpretation of the different spectral features observed is provided. It is shown that, by properly adjusting the geometrical parameters involved, strong Faraday rotation enhancement can be obtained through constructive synergy between the Fabry-Pérot resonant mode of the magneto-optical nanocavity and the slot plasmon mode localized in the grooves.

  6. An ab initio investigation of the Buckingham birefringence of furan, thiophene, and selenophene in cyclohexane solution

    Science.gov (United States)

    Rizzo, Antonio; Frediani, Luca; Ruud, Kenneth

    2007-10-01

    Using a recently developed quadratic response methodology for the calculation of frequency-dependent third-order properties of molecules in solution, we investigate the Buckingham birefringence of furan, thiophene, and selenophene in cyclohexane solution. These systems are chosen since accurate experimental data are available, allowing for a direct comparison of experimental observations with our theoretical estimates. Our model for describing the solvent effects is based on a dielectric continuum approach for the solvent, and uses a molecule-shaped cavity. Our results show qualitatively different Buckingham constants and effective quadrupole centers calculated with and without the solvent, and only when the solvent is included are the qualitative trends observed experimentally reproduced. It is demonstrated that a significant part of this effect arises from the geometry relaxation of the molecules in the solvent.

  7. Optical Search for QED vacuum magnetic birefringence, Axions and photon Regeneration

    CERN Multimedia

    Pugnat, P; Hryczuk, A; Slunecka, M; Finger, M; Finger, M; Jary, V; Kral, M

    2007-01-01

    Since its prediction in 1936 by Euler, Heisenberg and Weisskopf in the earlier development of the Quantum Electrodynamic (QED) theory, the Vacuum Magnetic Birefringence (VMB) is still a challenge for optical metrology techniques. According to QED, the vacuum behaves as an optically active medium in the presence of an external magnetic field. It can be experimentally probed with a linearly polarized laser beam. After propagating through the vacuum submitted to a transverse magnetic field, the polarization of the laser beam will change to elliptical and the parameters of the polarization are directly related to fundamental constants such as the fine structure constant and the electron Compton wavelength. Contributions to the VMB could also arise from the existence of light scalar or pseudo-scalar particles like axions that couple to two photons and this would manifest itself as a sizeable deviation from the initial QED prediction. On one side, the interest in axion search, providing an answer to the strong-CP p...

  8. Optical feedback characteristics in a helium neon laser with a birefringent internal cavity

    Institute of Scientific and Technical Information of China (English)

    Mao Wei; Zhang Shu-Lian; Xu Ting; Wan Xin-Jun; Liu Gang

    2007-01-01

    The output characteristics of optical feedback in a helium-neon laser with a birefringent internal cavity are studied systematically in five different regions of the gain curve for the two orthogonally polarized modes. When the laser operates in the two end regions of the laser gain curve, one of the two orthogonally polarized modes will be a leading one in optical feedback. Strong mode competition can be observed. However, when the laser operates in the middle region of the laser gain curve, the two modes can oscillate equally with optical feedback. Besides the intensity of the two polarized lights, the total light intensity is also studied at the same time. M-shaped optical feedback curves are found. Particularly, when the average intensities of the two lights are comparable, the intensity modulation curve of the total light is doubled, which can be used to improve the resolution of an optical feedback system.

  9. Quantum storage of polarization qubits in birefringent and anisotropically absorbing materials

    CERN Document Server

    Clausen, Christoph; Afzelius, Mikael; Gisin, Nicolas

    2012-01-01

    Storage of quantum information encoded into true single photons is an essential constituent of long-distance quantum communication based on quantum repeaters and of optical quantum information processing. The storage of photonic polarization qubits is, however, complicated by the fact that many materials are birefringent and have polarization-dependent absorption. Here we present and demonstrate a simple scheme that allows compensating for these polarization effects. The scheme is demonstrated using a solid-state quantum memory implemented with an ensemble of rare-earth ions doped into a biaxial yttrium orthosilicate (Y_{2}SiO_{5}) crystal. Heralded single photons generated from a filtered spontaneous parametric downconversion source are stored, and quantum state tomography of the retrieved polarization state reveals an average fidelity of 97.5 \\pm 0.4%, which is significantly higher than what is achievable with a measure-and-prepare strategy.

  10. The measurement of temperature with using of birefringence crystals as detectors

    Directory of Open Access Journals (Sweden)

    Gaba V. M.

    2009-02-01

    Full Text Available The carried out researches allowed to motivate and put into practice the polarizatoin-optical method of temperature measurement based on the phenomenon of temperature alteration in value of birefringence of the optically anisotropic crystals. The practical realization of the method with the use of Al2O3 and LiNbO3 plates as active elements of thermometers has shown, that the application of Al2O3 is more preferable due to a wide temperature interval of employment of material, its mechanical and chemical stability, absence of phase transitions. LiNbO3 has such lacks as nonlinearity of graduate dependence and presence of a phase transition point. Nevertheless, its use allows to raise the sensitivity of the thermometer and to increase the accuracy of measurements.

  11. Transient birefringence of liquids induced by terahertz electric-field torque on permanent molecular dipoles

    Science.gov (United States)

    Sajadi, Mohsen; Wolf, Martin; Kampfrath, Tobias

    2017-04-01

    Collective low-frequency molecular motions have large impact on chemical reactions and structural relaxation in liquids. So far, these modes have mostly been accessed indirectly by off-resonant optical pulses. Here, we provide evidence that intense terahertz (THz) pulses can resonantly excite reorientational-librational modes of aprotic and strongly polar liquids through coupling to the permanent molecular dipole moments. We observe a significantly enhanced response because the transient optical birefringence is up to an order of magnitude higher than obtained with optical excitation. Frequency-dependent measurements and a simple analytical model indicate that the enhancement arises from resonantly driven librations and their coupling to reorientational motion, assisted by the pump field and/or a cage translational mode. Our results open up the path to applications such as efficient molecular alignment, enhanced transient Kerr signals and systematic resonant nonlinear THz spectroscopy of the coupling between intermolecular modes in liquids.

  12. Distributed measurement of mode coupling in birefringent fibers with random polarization modes

    CERN Document Server

    Xu, Tianhua; Jing, Wencai; Zhang, Hongxia; Jia, Dagong; Zhang, Xuemin; Zhou, Ge; Zhang, Yimo

    2016-01-01

    A scanning white light interferometer is developed to measure the distributed polarization coupling (DPC) in high birefringence polarization maintaining fibers (PMFs). Traditionally, this technique requests only one polarization mode to be excited or both polarization modes to be excited with equal intensity in the PMF. Thus, an accurate alignment of the polarization direction with the principal axis in PMF is strictly required, which is not facilely realized in practical measurement. This paper develops a method to measure the spatial distribution of polarization mode coupling with random modes excited using a white light Michelson interferometer. The influence of incident polarization extinction ratio (PER) on polarization coupling detection is evaluated theoretically and experimentally. It is also analyzed and validated in corresponding measurement that the sensitivity of the polarization coupling detection system can be improved more than 100 times with the rotation of the analyzer.

  13. Fibre orientation contrast for depth-resolved identification of structural interfaces in birefringent tissue

    Energy Technology Data Exchange (ETDEWEB)

    Kemp, Nate J; Park, Jesung; Zaatari, Haitham N; III, H Grady Rylander; Milner, Thomas E [Department of Biomedical Engineering, University of Texas at Austin, 1 University Station C0800, Austin, TX 78712-1084 (United States)

    2006-08-07

    Incorporation of polarimetric sensitivity into optical coherence tomography can provide additional image contrast when structures of interest are optically anisotropic (e.g., fibrous tissue). We present a generalized technique based on polarization-sensitive optical coherence tomography to detect changes in depth-resolved fibre orientation and thus increase image contrast in multiple-layered birefringent tissues. A high contrast B-scan image of collagen fibre orientation is shown for a porcine intervertebral disc cartilage specimen that exhibited low backscattering intensity contrast. Interfaces in the annulus fibrosus identified using depth-resolved fibre orientation allowed quantification of lamellae thickness. Moreover, the technique detects changes in fibre orientation without intense processing needed to effectively quantify tissue retardation and diattenuation.

  14. Transient birefringence of liquids induced by terahertz electric-field torque on permanent molecular dipoles

    CERN Document Server

    Sajadi, Mohsen; Kampfrath, Tobias

    2016-01-01

    Microscopic understanding of low-frequency molecular motions in liquids has been a longstanding goal in soft-matter science. So far, such low-frequency motions have mostly been accessed indirectly by off-resonant optical pulses. A more direct approach would be to interrogate the dynamic structure of liquids with terahertz (THz) radiation. Here, we provide evidence that resonant excitation with intense THz pulses is capable of driving reorientational-librational modes of aprotic polar liquids through coupling to the permanent molecular dipole moments. We observe a hallmark of this enhanced coupling: a transient optical birefringence up to an order of magnitude higher than obtained with optical excitation. Our results open up the path to applications such as efficient molecular alignment and systematic study of the coupling of rotational motion to other collective motions in liquids.

  15. Neural network calibration of a snapshot birefringent Fourier transform spectrometer with periodic phase errors.

    Science.gov (United States)

    Luo, David; Kudenov, Michael W

    2016-05-16

    Systematic phase errors in Fourier transform spectroscopy can severely degrade the calculated spectra. Compensation of these errors is typically accomplished using post-processing techniques, such as Fourier deconvolution, linear unmixing, or iterative solvers. This results in increased computational complexity when reconstructing and calibrating many parallel interference patterns. In this paper, we describe a new method of calibrating a Fourier transform spectrometer based on the use of artificial neural networks (ANNs). In this way, it is demonstrated that a simpler and more straightforward reconstruction process can be achieved at the cost of additional calibration equipment. To this end, we provide a theoretical model for general systematic phase errors in a polarization birefringent interferometer. This is followed by a discussion of our experimental setup and a demonstration of our technique, as applied to data with and without phase error. The technique's utility is then supported by comparison to alternative reconstruction techniques using fast Fourier transforms (FFTs) and linear unmixing.

  16. High-resolution birefringence cartography of a vertical cavity semiconductor laser

    CERN Document Server

    Wang, T

    2015-01-01

    We report on spatially resolved birefringence measurements in a multimode vertical-cavity surface-emitting laser (VCSEL) by using the emission wavelength distribution mapping. The point-by-point, polarization-resolved spectral information lends itself to the identification of anisotropies in the material and enables the estimate of refractive index differences and gradients in the two orthogonal polarization components with high spatial resolution. Compared with classical optical microscopy techniques, we can easily recognize the position of the emission wavelength split (which carefully points to the position of defects) with a much better spectral sensitivity (potentially as low as 3 GHz). The presented method is general and can be used with any bulk, light-emitting source (even passive, if external illumination is added) and may prove very useful for device fabrication, quality checks and process improvements.

  17. Automatic simulation of 1D and 2D chaotic oscillators

    Energy Technology Data Exchange (ETDEWEB)

    Tlelo-Cuautle, E; Munoz-Pacheco, J-M [Department of Electronics, INAOE, Luis Enrique Erro No. 1, Tonantzintla, Puebla, 72840 MEXICO (Mexico)], E-mail: e.tlelo@ieee.org, E-mail: mpacheco@inaoep.mx

    2008-02-15

    A new method is introduced for automatic simulation of three kinds of chaotic oscillators: Chua's circuit, generalized Chua's circuit and chaotic oscillator implemented with saturated functions. The former generates the double-scroll, and the others 1D n-scroll attractors. The third chaotic oscillator is modified to generate 2D n-scrolls attractors. The oscillators are modelled by applying state variables and piecewise-linear approximation. Basically, the method computes the eigenvalues of the oscillators to begin time simulation and to make control of step-size automatically.

  18. Main: 1D6R [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D6R 大豆 Soybean Glycine max (L.) Merrill Bowman-Birk Type Proteinase Inhibitor Precursor Glycine Ma...x Molecule: Trypsinogen; Chain: A; Fragment: Cationic Precursor; Molecule: Bowman-Birk Prote...inase Inhibitor Precursor; Chain: I Hydrolase 3.4.21.4 (Bowman-Birk Proteinase Inhibitor Precursor) J.Koepke...r Crystal Structure Of Cancer Chemopreventive Bowman-Birk Inhibitor In Ternary Complex With Bovine Trypsin A... 477 2000 Protease Inhibitor, Serine Protease, Bowman-Birk Inhibitor SWS:TRY1_BOV

  19. Nonlocal order parameters for the 1D Hubbard model.

    Science.gov (United States)

    Montorsi, Arianna; Roncaglia, Marco

    2012-12-07

    We characterize the Mott-insulator and Luther-Emery phases of the 1D Hubbard model through correlators that measure the parity of spin and charge strings along the chain. These nonlocal quantities order in the corresponding gapped phases and vanish at the critical point U(c)=0, thus configuring as hidden order parameters. The Mott insulator consists of bound doublon-holon pairs, which in the Luther-Emery phase turn into electron pairs with opposite spins, both unbinding at U(c). The behavior of the parity correlators is captured by an effective free spinless fermion model.

  20. 1D superconductivity in porous Nb ultrathin films

    Energy Technology Data Exchange (ETDEWEB)

    Trezza, M., E-mail: trezza@sa.infn.it [CNR-SPIN Salerno and Dipartimento di Fisica, ' E. R. Caianiello' , Universita degli Studi di Salerno, Via Ponte don Melillo, Fisciano I-84084 (Italy); Prischepa, S.L. [State University of Informatics and RadioElectronics, P. Brovka Street 6, Minsk 220013 (Belarus); Cirillo, C.; Attanasio, C. [CNR-SPIN Salerno and Dipartimento di Fisica, ' E. R. Caianiello' , Universita degli Studi di Salerno, Via Ponte don Melillo, Fisciano I-84084 (Italy)

    2012-09-15

    We report on the measurements of the transport properties of superconducting Nb ultrathin bridges grown by UHV magnetron sputtering on porous Si substrates. The films are about 10 nm thick and inherit from the substrate a structure made of holes with diameter of 10 nm and interpore spacing in the range 20-40 nm. Due to their reduced dimensions, they are sensitive to thermal fluctuations typical of 1D superconductors and exhibit a nonzero resistance below the superconducting transition temperature, T{sub c}. Clear hysteresis and finite jumps in the I-V curves are also observed.

  1. ESO science data product standard for 1D spectral products

    Science.gov (United States)

    Micol, Alberto; Arnaboldi, Magda; Delmotte, Nausicaa A. R.; Mascetti, Laura; Retzlaff, Joerg

    2016-07-01

    The ESO Phase 3 process allows the upload, validation, storage, and publication of reduced data through the ESO Science Archive Facility. Since its introduction, 2 million data products have been archived and published; 80% of them are one-dimensional extracted and calibrated spectra. Central to Phase3 is the ESO science data product standard that defines metadata and data format of any product. This contribution describes the ESO data standard for 1d-spectra, its adoption by the reduction pipelines of selected instrument modes for in-house generation of reduced spectra, the enhanced archive legacy value. Archive usage statistics are provided.

  2. Restrained Dark $U(1)_d$ at Low Energies

    CERN Document Server

    Correia, F C

    2016-01-01

    We investigate a spontaneously broken $U(1)_d$ gauge symmetry with a muon-specific dark Higgs. Our first goal is to verify how the presence of a new dark Higgs, $\\phi$, and a dark gauge boson, $V$, can simultaneously face the anomalies from the muon magnetic moment and the proton charge radius. Secondly, by assuming that $V$ must decay to an electron-positron pair, we explore the corresponding parameter space determined with the low energy constraints coming from $ K \\to \\mu X$, electron $(g-2)_e$, $K \\to \\mu \

  3. Breakdown of 1D water wires inside Charged Carbon Nanotubes

    CERN Document Server

    Pant, Shashank

    2016-01-01

    Using Molecular Dynamics approach we investigated the structure, dynamics of water confined inside pristine and charged 6,6 carbon nanotubes (CNTs). This study reports the breakdown of 1D water wires and the emergence of triangular faced water on incorporating charges in 6,6 CNTs. Incorporation of charges results in high potential barriers to the flipping of water molecules due to the formation of a large number of hydrogen bonds. The PMF analyses show the presence of ~2 kcal/mol barrier for the movement of water inside pristine CNT and almost negligible barrier in charged CNTs.

  4. Fixed Delay Birefringence Imaging Interferometry for Spectral Drifting Surveys of an Astrocomb

    Science.gov (United States)

    Zhai, Yang; Xiao, Dong

    2015-08-01

    Astrocomb has been developed for exploring and investigation of extrasolar planets via radial velocity measurement based on Doppler spectroscopy. The energy loss, modal and speckle noise as well as non-linear output drift would degenerate the precision of astrocomb after coupling with multimode fiber. Due to its ultra-narrow spectral line space, traditional dispersion spectrometer and instrument are inapplicable investigating the beam quality and spectrum from the astrocomb. In this paper, we present a new technique based on fixed delay birefringence imaging interferometry with high throughput, high resolution and large field-of-view surveys for the spectral drift of astrocomb. This coherence system utilizes multi-optical Savart splitter and large interferometric delays to achieve the required spectral resolution. Such large interferometric delay scan usually causes a significant curvature of fringe pattern, so we update this Savart component with an extra sandwiched half-wave plate as a field-of-view compensator that enables target image and near-straight fringes for Fourier analysis can be obtained and captured by a two-dimensional CCD at the same time. Also, the instrumental design employs a secondary set of birefringent plates with opposite thermal properties to passively stabilize the system from phase drifting error caused by temperature fluctuations. Under the compensation, the spectral resolution could reach 105~106 in a narrow-band target region and the field-of-view will extend 3-5 times as large as a common interference imaging spectrometer and throughput will raise 1-2 orders of magnitude. The ultra-high spectral resolutions and field-of-view compensation principle are demonstrated experimentally.

  5. Relationship between birefringence and neurotubule density in the primate retinal nerve fiber layer

    Science.gov (United States)

    Aranibar, R. G.; Kemp, N. J.; Dwelle, J. C.; Byers, S. E.; Markey, M. K.; Milner, T. E.; Rylander, H. G.

    2007-02-01

    The relationship between retinal nerve fiber layer (RNFL) birefringence (Δn) and neurotubule density (NTD, retinal ganglion cell (RGC) neurotubules per unit RNFL area) was investigated by correlating measurements of these two parameters in 1 eye of a healthy cynomolgus monkey. Phase retardation per unit depth (PR/UD, proportional to Δn) was measured at 5.6-15 ° intervals around the optic nerve head (ONH) with an enhanced polarization-sensitive optical coherence tomography (EPS-OCT) instrument. Transverse tissue sections containing 3 RGC nerve fiber bundles from each peripapillary RNFL octant were imaged with a transmission electron microscope (TEM). Morphological measurements taken in TEM images were used by a novel algorithm to estimate NTD. Registered PR/UD and NTD data were then correlated using single- and multi-level models, yielding correlation coefficients in the range 0.49 = 80%), NTD measurements in at least 16, rather than 8, RNFL sectors were needed. Interestingly, a single-level correlation coefficient of r = 0.81 (P = 0.01) was calculated between octant-averaged PR/UD and RGC axoplasmic area (A x, axon area less non-cytoskeletal organelle area) mode. A x represents a RGC axon's neurotubule-inhabitable area. Intuitively, a strong relationship should exist between A x and neurotubule number if neurotubules provide the primary structural support for RGC axons and structural requirements are the same in all RGC axons. If this relationship exists, error resulting from NTD estimation methods or preservation artifacts may have caused lower observed correlations of PR/UD with NTD than with A x mode, and more accurate methods of measuring in vivo NTD may be required to determine an accurate relationship between RNFL birefringence and NTD.

  6. Modeling atrazine transport in soil columns with HYDRUS-1D

    Directory of Open Access Journals (Sweden)

    John Leju CELESTINO LADU

    2011-09-01

    Full Text Available Both physical and chemical processes affect the fate and transport of herbicides. It is useful to simulate these processes with computer programs to predict solute movement. Simulations were run with HYDRUS-1D to identify the sorption and degradation parameters of atrazine through calibration from the breakthrough curves (BTCs. Data from undisturbed and disturbed soil column experiments were compared and analyzed using the dual-porosity model. The study results show that the values of dispersivity are slightly lower in disturbed columns, suggesting that the more heterogeneous the structure is, the higher the dispersivity. Sorption parameters also show slight variability, which is attributed to the differences in soil properties, experimental conditions and methods, or other ecological factors. For both of the columns, the degradation rates were similar. Potassium bromide was used as a conservative non-reactive tracer to characterize the water movement in columns. Atrazine BTCs exhibited significant tailing and asymmetry, indicating non-equilibrium sorption during solute transport. The dual-porosity model was verified to best fit the BTCs of the column experiments. Greater or lesser concentration of atrazine spreading to the bottom of the columns indicated risk of groundwater contamination. Overall, HYDRUS-1D successfully simulated the atrazine transport in soil columns.

  7. Study of 1D Strange Charmed Meson Family Using HQET

    Directory of Open Access Journals (Sweden)

    Pallavi Gupta

    2016-01-01

    Full Text Available Recently LHCb predicted spin 1 and spin 3 states Ds1⁎(2860 and Ds3⁎(2860 which are studied through their strong decays and are assigned to fit the 13D1 and 13D3 states in the charm spectroscopy. In this paper, using the heavy quark effective theory, we state that assigning Ds1⁎(2860 as the mixing of 13D1-23S1 states is rather a better justification to its observed experimental values than a pure state. We study its decay modes variation with hadronic coupling constant gxh and the mixing angle θ. We appoint spin 3 state Ds3⁎(2860 as the missing 1D  3-JP state and also study its decay channel behavior with coupling constant gyh. To appreciate the above results, we check the variation of decay modes for their spin partners states, that is, 1D2 and 1D2′, with their masses and strong coupling constant, that is, gxh and gyh. Our calculation using HQET approach gives mixing angle of the 13D1-23S1 state for Ds1⁎(2860 to lie in the range (-1.6 radians ≤θ≤-1.2 radians. Our calculation for coupling constant values gives gxh to lie within value range of 0.17–0.20 and gyh to be 0.40. We expect from experiments to observe this mixing angle to verify our results.

  8. A Framework for Low-Communication 1-D FFT

    Directory of Open Access Journals (Sweden)

    Ping Tak Peter Tang

    2013-01-01

    Full Text Available In high-performance computing on distributed-memory systems, communication often represents a significant part of the overall execution time. The relative cost of communication will certainly continue to rise as compute-density growth follows the current technology and industry trends. Design of lower-communication alternatives to fundamental computational algorithms has become an important field of research. For distributed 1-D FFT, communication cost has hitherto remained high as all industry-standard implementations perform three all-to-all internode data exchanges (also called global transposes. These communication steps indeed dominate execution time. In this paper, we present a mathematical framework from which many single-all-to-all and easy-to-implement 1-D FFT algorithms can be derived. For large-scale problems, our implementation can be twice as fast as leading FFT libraries on state-of-the-art computer clusters. Moreover, our framework allows tradeoff between accuracy and performance, further boosting performance if reduced accuracy is acceptable.

  9. Tunability and Sensing Properties of Plasmonic/1D Photonic Crystal.

    Science.gov (United States)

    Shaban, Mohamed; Ahmed, Ashour M; Abdel-Rahman, Ehab; Hamdy, Hany

    2017-02-08

    Gold/one-dimensional photonic crystal (Au/1D-PC) is fabricated and applied for sensitive sensing of glucose and different chemical molecules of various refractive indices. The Au layer thickness is optimized to produce surface plasmon resonance (SPR) at the right edge of the photonic band gap (PBG). As the Au deposition time increased to 60 sec, the PBG width is increased from 46 to 86 nm in correlation with the behavior of the SPR. The selectivity of the optimized Au/1D-PC sensor is tested upon the increase of the environmental refractive index of the detected molecules. The resonance wavelength and the PBG edges increased linearly and the transmitted intensity increased nonlinearly as the environment refractive index increased. The SPR splits to two modes during the detection of chloroform molecules based on the localized capacitive coupling of Au particles. Also, this structure shows high sensitivity at different glucose concentrations. The PBG and SPR are shifted to longer wavelengths, and PBG width is decreased linearly with a rate of 16.04 Å/(μg/mm(3)) as the glucose concentration increased. The proposed structure merits; operation at room temperature, compact size, and easy fabrication; suggest that the proposed structure can be efficiently used for the biomedical and chemical application.

  10. Entanglement and Nonlocality in Infinite 1D Systems

    Science.gov (United States)

    Wang, Zizhu; Singh, Sukhwinder; Navascués, Miguel

    2017-06-01

    We consider the problem of detecting entanglement and nonlocality in one-dimensional (1D) infinite, translation-invariant (TI) systems when just near-neighbor information is available. This issue is deeper than one might think a priori, since, as we show, there exist instances of local separable states (classical boxes) which admit only entangled (nonclassical) TI extensions. We provide a simple characterization of the set of local states of multiseparable TI spin chains and construct a family of linear witnesses which can detect entanglement in infinite TI states from the nearest-neighbor reduced density matrix. Similarly, we prove that the set of classical TI boxes forms a polytope and devise a general procedure to generate all Bell inequalities which characterize it. Using an algorithm based on matrix product states, we show how some of them can be violated by distant parties conducting identical measurements on an infinite TI quantum state. All our results can be easily adapted to detect entanglement and nonlocality in large (finite, not TI) 1D condensed matter systems.

  11. Error analysis of subaperture processing in 1-D ultrasound arrays.

    Science.gov (United States)

    Zhao, Kang-Qiao; Bjåstad, Tore Gruner; Kristoffersen, Kjell

    2015-04-01

    To simplify the medical ultrasound system and reduce the cost, several techniques have been proposed to reduce the interconnections between the ultrasound probe and the back-end console. Among them, subaperture processing (SAP) is the most straightforward approach and is widely used in commercial products. This paper reviews the most important error sources of SAP, such as static focusing, delay quantization, linear delay profile, and coarse apodization, and the impacts introduced by these errors are shown. We propose to use main lobe coherence loss as a simple classification of the quality of the beam profile for a given design. This figure-ofmerit (FoM) is evaluated by simulations with a 1-D ultrasound subaperture array setup. The analytical expressions and the coherence loss can work as a quick guideline in subaperture design by equalizing the merit degradations from different error sources, as well as minimizing the average or maximum loss over ranges. For the evaluated 1-D array example, a good balance between errors and cost was achieved using a subaperture size of 5 elements, focus at 40 mm range, and a delay quantization step corresponding to a phase of π/4.

  12. Tunability and Sensing Properties of Plasmonic/1D Photonic Crystal

    Science.gov (United States)

    Shaban, Mohamed; Ahmed, Ashour M.; Abdel-Rahman, Ehab; Hamdy, Hany

    2017-01-01

    Gold/one-dimensional photonic crystal (Au/1D-PC) is fabricated and applied for sensitive sensing of glucose and different chemical molecules of various refractive indices. The Au layer thickness is optimized to produce surface plasmon resonance (SPR) at the right edge of the photonic band gap (PBG). As the Au deposition time increased to 60 sec, the PBG width is increased from 46 to 86 nm in correlation with the behavior of the SPR. The selectivity of the optimized Au/1D-PC sensor is tested upon the increase of the environmental refractive index of the detected molecules. The resonance wavelength and the PBG edges increased linearly and the transmitted intensity increased nonlinearly as the environment refractive index increased. The SPR splits to two modes during the detection of chloroform molecules based on the localized capacitive coupling of Au particles. Also, this structure shows high sensitivity at different glucose concentrations. The PBG and SPR are shifted to longer wavelengths, and PBG width is decreased linearly with a rate of 16.04 Å/(μg/mm3) as the glucose concentration increased. The proposed structure merits; operation at room temperature, compact size, and easy fabrication; suggest that the proposed structure can be efficiently used for the biomedical and chemical application. PMID:28176799

  13. Transformation of 1-D Chiral-chained Titanium Phosphate to 2-D Layer Structure Through a 1-D Zigzag Chain

    Institute of Scientific and Technical Information of China (English)

    CHEN Chao; YANG Yu-lin; LI Wei-sheng; LIU Yun-ling; YI Zhuo; GUO Yang-hong; PANG Wen-qin

    2005-01-01

    The transformation of titanium phosphate from 1-D chiral- chain(JTP-A) to 2-D layer(TP-J1) has been carefully investigated. Through a hydrolysis-condensation self-assembly pathway, the crystals of TP-J1 can be obtained from the JTP-A phase under hydrothermal conditions. An intermediate material with zigzag chain during the transformation was observed by XRD characterization. A hypothesis of the transformation mechanism is also described in this article. It is noteworthy that ethylenediamine plays an important role in the transformation.

  14. Phenomenological predictions of 3+1d anisotropic hydrodynamics

    CERN Document Server

    Nopoush, Mohammad; Ryblewski, Radoslaw

    2016-01-01

    We make phenomenological predictions for particle spectra and elliptic flow in heavy-ion collisions using 3+1d anisotropic hydrodynamics (aHydro) including the effects of both shear and bulk viscosities. The dynamical equations necessary are derived by taking moments of the Boltzmann equation allowing for three distinct (diagonal) momentum-space anisotropy parameters. The formulation is based on relaxation-time approximation for the collisional kernel and a lattice-QCD-based equation of state. Evolving the system to late times, we calculate particle production using THERMINATOR 2, modified to account for an ellipsoidal distribution function. We obtain particle spectra for different particle species such as pions, kaons, and protons, and elliptic flow $v_2$ as a function of centrality, transverse momentum, and rapidity. In our model, we have four free parameters, i.e. freeze-out temperature, initial central energy density, initial momentum-space anisotropies, and shear viscosity to entropy density ratio. Using...

  15. Effective theory of Black Holes in the 1/D expansion

    CERN Document Server

    Emparan, Roberto; Suzuki, Ryotaku; Tanabe, Kentaro; Tanaka, Takahiro

    2015-01-01

    The gravitational field of a black hole is strongly localized near its horizon when the number of dimensions D is very large. In this limit, we can effectively replace the black hole with a surface in a background geometry (eg Minkowski or Anti-deSitter space). The Einstein equations determine the effective equations that this 'black hole surface' (or membrane) must satisfy. We obtain them up to next-to-leading order in 1/D for static black holes of the Einstein-(A)dS theory. To leading order, and also to next order in Minkowski backgrounds, the equations of the effective theory are the same as soap-film equations, possibly up to a redshift factor. In particular, the Schwarzschild black hole is recovered as a spherical soap bubble. Less trivially, we find solutions for 'black droplets', ie black holes localized at the boundary of AdS, and for non-uniform black strings.

  16. Effective theory of black holes in the 1/D expansion

    Science.gov (United States)

    Emparan, Roberto; Shiromizu, Tetsuya; Suzuki, Ryotaku; Tanabe, Kentaro; Tanaka, Takahiro

    2015-06-01

    The gravitational field of a black hole is strongly localized near its horizon when the number of dimensions D is very large. In this limit, we can effectively replace the black hole with a surface in a background geometry (e.g. Minkowski or Anti-deSitter space). The Einstein equations determine the effective equations that this `black hole surface' (or membrane) must satisfy. We obtain them up to next-to-leading order in 1/ D for static black holes of the Einstein-(A)dS theory. To leading order, and also to next order in Minkowski backgrounds, the equations of the effective theory are the same as soap-film equations, possibly up to a redshift factor. In particular, the Schwarzschild black hole is recovered as a spherical soap bubble. Less trivially, we find solutions for `black droplets', i.e. black holes localized at the boundary of AdS, and for non-uniform black strings.

  17. Identification of a T1D Susceptibility Gene

    Directory of Open Access Journals (Sweden)

    Grant Morahan

    2001-01-01

    Full Text Available It is not known what causes type 1 diabetes (T1D, which affects over 1 million people in the U.S. alone. Each year, 30,000 young people in the U.S. develop this disease and depend on insulin injections thereafter. Because of the huge cost to the individual, the family, and to society in increased health care costs, it is important to find what makes these people susceptible. The disease process itself is clear: the individual’s immune system — T lymphocytes in particular — attack and destroy the body’s insulin-producing cells. But how and why this autoimmune process starts or proceeds unregulated is still not known.

  18. Microlens Masses from 1-D Parallaxes and Heliocentric Proper Motions

    CERN Document Server

    Gould, Andrew

    2014-01-01

    One-dimensional (1-D) microlens parallaxes can be combined with heliocentric lens-source relative proper motion measurements to derive the lens mass and distance, as suggested by Ghosh et al. (2004). Here I present the first mathematical anlysis of this procedure, which I show can be represented as a quadratic equation. Hence, it is formally subject to a two-fold degeneracy. I show that this degeneracy can be broken in many cases using the relatively crude 2-D parallax information that is often available for microlensing events. I also develop an explicit formula for the region of parameter space where it is more difficult to break this degeneracy. Although no mass/distance measurements have yet been made using this technique, it is likely to become quite common over the next decade.

  19. 1D-transport properties of single superconducting lead nanowires

    DEFF Research Database (Denmark)

    Michotte, S.; Mátéfi-Tempfli, Stefan; Piraux, L.

    2003-01-01

    We report on the transport properties of single superconducting lead nanowires grown by an electrodeposition technique, embedded in a nanoporous track-etched polymer membrane. The nanowires are granular, have uniform diameter of ̃40 nm and a very large aspect ratio (̃500). The diameter of the nan......We report on the transport properties of single superconducting lead nanowires grown by an electrodeposition technique, embedded in a nanoporous track-etched polymer membrane. The nanowires are granular, have uniform diameter of ̃40 nm and a very large aspect ratio (̃500). The diameter...... of the nanowire is small enough to ensure a 1D superconducting regime in a wide temperature range below T. The non-zero resistance in the superconducting state and its variation caused by fluctuations of the superconducting order parameter were measured versus temperature, magnetic field, and applied DC current...

  20. 1-D array of perforated diode neutron detectors

    Energy Technology Data Exchange (ETDEWEB)

    McNeil, Walter J. [Kansas State University, Mechanical and Nuclear Engineering Department, Manhattan, KS 66506 (United States)], E-mail: wjm4444@ksu.edu; Bellinger, Steven L.; Unruh, Troy C.; Henderson, Chris M.; Ugorowski, Phil; Morris-Lee, Bryce [Kansas State University, Mechanical and Nuclear Engineering Department, Manhattan, KS 66506 (United States); Taylor, Russell D. [Electronics Design Laboratory, Kansas State University, Manhattan, KS 66506 (United States); McGregor, Douglas S. [Kansas State University, Mechanical and Nuclear Engineering Department, Manhattan, KS 66506 (United States)], E-mail: mcgregor@ksu.edu

    2009-06-01

    Performance of a 4 cm long 64-pixel perforated diode neutron detector array is compared with an identical array of thin-film coated diodes. The perforated neutron detector design has been adapted to a 1-D pixel array capable of 120 {mu}m spatial resolution and counting efficiency greater than 12%. Deep vertical trenches filled with {sup 6}LiF provide outstanding improvement in efficiency over thin-film coated diode designs limited to only 4.5%. This work marks the final step towards the construction of a much larger array consisting of 1024 pixels spanning 10 cm. The larger detector array will be constructed with a sub-array of 64-pixel sensors, and will be used for small-angle neutron scattering experiments at the Spallation Neutron Source of Oak Ridge National Laboratory.

  1. Coherent thermal conductance of 1-D photonic crystals

    Energy Technology Data Exchange (ETDEWEB)

    Tschikin, Maria [Institut für Physik, Carl von Ossietzky Universität, D-26111 Oldenburg (Germany); Ben-Abdallah, Philippe [Laboratoire Charles Fabry, UMR 8501, Institut d' Optique, CNRS, Université Paris-Sud, 2, Avenue Augustin Fresnel, RD128, 91127 Palaiseau Cedex (France); Biehs, Svend-Age, E-mail: biehs@theorie.physik.uni-oldenburg.de [Institut für Physik, Carl von Ossietzky Universität, D-26111 Oldenburg (Germany)

    2012-10-01

    We present an exact calculation of coherent thermal conductance in 1-D multilayer photonic crystals using the S-matrix method. In particular, we study the thermal conductance in a bilayer structure of Si/vacuum or Al{sub 2}O{sub 3}/vacuum slabs by means of the exact radiative heat flux expression. Based on the results obtained for the Al{sub 2}O{sub 3}/vacuum structure we show by comparison with previous works that the material losses and (localized) surface modes supported by the inner layers play a fundamental role and cannot be omitted in the definition of thermal conductance. Our results could have significant implications in the conception of efficient thermal barriers.

  2. Data of evolutionary structure change: 1D6QA-2G4QA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D6QA-2G4QA 1D6Q 2G4Q A A KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYN...GRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTD-GSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQA...bID> A 2G4QA NRNTD-GS...> 1D6Q A 1D6QA

  3. Probing vacuum birefringence under a high-intensity laser field with gamma-ray polarimetry at the GeV scale

    CERN Document Server

    Nakamiya, Yoshihide; Moritaka, Toseo; Seto, Keita

    2015-01-01

    Probing vacuum structures deformed by high intense fields is of great interest in general. In the context of quantum electrodynamics (QED), the vacuum exposed by a linearly polarized high-intensity laser field is expected to show birefringence. We consider the combination of a 10 PW laser system to pump the vacuum and 1 GeV gamma-rays to probe the birefringent effect. The vacuum birefringence can be measured via the polarization flip of the probe gamma-rays. We discuss the design of the gamma-ray polarimeter and then evaluate the measurability of the reduction of the degree of linear polarization due to the appearance of birefringence. We found that the measurement is indeed feasible given a realistic set of laser parameters and achievable pulse statistics.

  4. Long period gratings and rocking filters written with a CO 2 laser in highly-birefringent boron-doped photonic crystal fibers for sensing applications

    Science.gov (United States)

    Carvalho, J. P.; Anuszkiewicz, A.; Statkiewicz-Barabach, G.; Baptista, J. M.; Frazão, O.; Mergo, P.; Santos, J. L.; Urbanczyk, W.

    2012-02-01

    In this work, we demonstrate the possibility of fabricating short-length long-period gratings and rocking filters in highly birefringent Photonic Crystal Fiber using a CO 2 laser. In our experiments both kinds of gratings were made in the same Boron doped highly birefringent PCF using similar exposure parameters. We also present the sensing capabilities of both fabricated gratings to temperature, strain and hydrostatic pressure by interrogation of the wavelength shifts at different resonances.

  5. Theory of the Sagnac's interferometer of low birefringence and twist fiber; Teoria del interferometro de Sagnac de fibra de baja birrefrigencia y torcida

    Energy Technology Data Exchange (ETDEWEB)

    Estudillo-Ayala, J. M.; Kuzin, E. A.; Ibarra-Escamilla, B. [Instituto Nacional de Astrofisica, Optica y Electronica, Puebla (Mexico); Rojas-Laguna, R. [Universidad de Guanajuato, Guanajuato (Mexico)

    2001-06-01

    The fibre Sagnac interferometer of low birefringence and twist in the lineal region is examined numerically, a method is shown to measure the birefringence in the fibers and rotation of the axes inside of the interferometer fibre loop. [Spanish] El interferometro de Sagnac de fibra de baja birrefrigencia y torcida en la region lineal es numericamente examinado, se muestra un metodo para medir la birrefrigencia en las fibras y rotacion de los ejes dentro de la fibra del lazo del interferometro.

  6. Design and optimization of highly nonlinear low-dispersion crystal fiber with high birefringence for four-wave mixing.

    Science.gov (United States)

    Zhang, Ya-Ni; Ren, Li-Yong; Gong, Yong-Kang; Li, Xiao-Hui; Wang, Lei-Ran; Sun, Chuan-Dong

    2010-06-01

    We have proposed a novel type of photonic crystal fiber (PCF) with low dispersion and high nonlinearity for four-wave mixing. This type of fiber is composed of a solid silica core and a cladding with a squeezed hexagonal lattice elliptical airhole along the fiber length. Its dispersion and nonlinearity coefficient are investigated simultaneously by using the full vectorial finite element method. Numerical results show that the proposed highly nonlinear low-dispersion fiber has a total dispersion as low as +/-2.5 ps nm(-1) km(-1) over an ultrabroad wavelength range from 1.43 to 1.8 microm, and the corresponding nonlinearity coefficient and birefringence are about 150 W(-1) km(-1) and 2.5x10(-3) at 1.55 microm, respectively. The proposed PCF with low ultraflattened dispersion, high nonlinearity, and high birefringence can have important application in four-wave mixing.

  7. The high-birefringence asymmetric SF57 glass microstructured optical fiber at 1060.0 μm

    Science.gov (United States)

    Pei, Ting-Hang; Zhang, Zhifeng; Zhang, Yilei

    2017-07-01

    Many high-birefringence asymmetric microstructured optical fibers (MOFs) have been numerically designed and analyzed, but the fabrication of asymmetric MOF is challenging, especially those with elliptical structures. In this work, we designed, fabricated and modelled an asymmetric glass MOF in which the structure is asymmetric and the air holes are elliptical. SF57 glass was selected due to the high refraction index and low absorption in the Terahertz region. From simulations based on the finite difference (FD) method at 1060.0 μm, the polarizations of the first two modes are perpendicular to each other and the effective refraction indices are different, which lead to the birefringence of this MOF as high as 0.090. The plane-wave expansion method was used to verify the FD calculations, where both results are consistent and the difference is about 0.1%.

  8. Combined density functional/polarizable continuum model study of magnetochiral birefringence: Can theory and experiment be brought to agreement?

    Science.gov (United States)

    Jansík, Branislav; Rizzo, Antonio; Frediani, Luca; Ruud, Kenneth; Coriani, Sonia

    2006-12-01

    The magnetic-field-induced axial birefringence (magnetochirality) of five closed-shell chiral molecules (three substituted oxiranes, carvone, and limonene) is studied at the density functional theory level using Becke's 3-parameter Lee-Yang-Parr functional and frequency-dependent quadratic response theory. The influence of the environment and the conformational distribution on the property is also studied. The environment effects are described by the polarizable continuum model in its integral-equation formulation. The effect of the conformational distribution is investigated by performing calculations on several conformers—for carvone and limonene—followed by Boltzmann averaging. The calculated values for the magnetochiral birefringence are compared to previous ab initio results and experimental data where available. The refined model presented here brings the ab initio values closer to experiment. Still, disagreements remain in some cases and it appears difficult to resolve these discrepancies.

  9. Ultrafast, low-power, all-optical switching via birefringent phase-matched transverse mode conversion in integrated waveguides

    CERN Document Server

    Hellwig, Tim; Schnack, Martin; Boller, Klaus -J; Fallnich, Carsten

    2015-01-01

    We demonstrate the potential of birefringence-based, all-optical, ultrafast conversion between the transverse modes in integrated optical waveguides by modelling the conversion process by numerically solving the multi-mode coupled nonlinear Schroedinger equations. The observed conversion is induced by a control beam and due to the Kerr effect, resulting in a transient index grating which coherently scatters probe light from one transverse waveguide mode into another. We introduce birefringent phase matching to enable efficient all-optically induced mode conversion at different wavelengths of the control and probe beam. It is shown that tailoring the waveguide geometry can be exploited to explicitly minimize intermodal group delay as well as to maximize the nonlinear coefficient, under the constraint of a phase matching condition. The waveguide geometries investigated here, allow for mode conversion with over two orders of magnitude reduced control pulse energy compared to previous schemes and thereby promise ...

  10. [Study on the axial strain sensor of birefringence photonic crystal fiber loop mirror based on the absolute integral of the monitoring peak].

    Science.gov (United States)

    Jiang, Ying; Zeng, Jie; Liang, Da-Kai; Wang, Xue-Liang; Ni, Xiao-Yu; Zhang, Xiao-Yan; Li, Ji-Feng; Luo, Wen-Yong

    2013-12-01

    In the present paper, the theoretical expression of the wavelength change and the axial strain of birefringence fiber loop mirror is developed. The theoretical result shows that the axial strain sensitivity of birefringence photonic crystal fiber loop mirror is much lower than conventional birefringence fiber loop mirror. It is difficult to measure the axial strain by monitoring the wavelength change of birefringence photonic crystal fiber loop mirror, and it is easy to cause the measurement error because the output spectrum is not perfectly smooth. The different strain spectrum of birefringence photonic crystal fiber loop mirror was measured experimentally by an optical spectrum analyzer. The measured spectrum was analysed. The results show that the absolute integral of the monitoring peak decreases with increasing strain and the absolute integral is linear versus strain. Based on the above results, it is proposed that the axial strain can be measured by monitoring the absolute integral of the monitoring peak in this paper. The absolute integral of the monitoring peak is a comprehensive index which can indicate the light intensity of different wavelength. This method of monitoring the absolute integral of the monitoring peak to measure the axial strain can not only overcome the difficulty of monitoring the wavelength change of birefringence photonic crystal fiber loop mirror, but also reduce the measurement error caused by the unsmooth output spectrum.

  11. Study of Collagen Birefringence in Different Grades of Oral Squamous Cell Carcinoma Using Picrosirius Red and Polarized Light Microscopy

    OpenAIRE

    2015-01-01

    Objectives. The present study was done to evaluate birefringence pattern of collagen fibres in different grades of oral squamous cell carcinoma using Picrosirius red stain and polarization microscopy and to determine if there is a change in collagen fibres between different grades of oral squamous cell carcinoma. Materials and Methods. Picrosirius red stained 5 μm thick sections of previously diagnosed different grades of squamous cell carcinoma and normal oral mucosa were studied under polar...

  12. Assembling carbon fiber-graphene-carbon fiber hetero-structures into 1D-2D-1D junction fillers and patterned structures for improved microwave absorption

    Science.gov (United States)

    Li, Huimin; Liu, Lin; Li, Hai-Bing; Song, Wei-Li; Bian, Xing-Ming; Zhao, Quan-Liang; Chen, Mingji; Yuan, Xujin; Chen, Haosen; Fang, Daining

    2017-04-01

    Since carbon-based structures of various dimensions, including one-dimensional (1D) carbon nanotubes, two-dimensional (2D) graphene and three-dimensional (3D) carbon foams, have attracted significant attention as microwave absorption fillers, we present an exceptional hetero-junction filler with a 1D-2D-1D feature, achieved by manipulating 2D graphene into 1D carbon fibers in the fiber-extruding process under the electric field. The as-fabricated 1D-2D-1D structural fillers exhibited much-improved dielectric properties and promoted microwave absorption performance in their composites, which is linked to the establishment of enhanced polarization capability, the generation of increased electric loss pathway and the creation of more favorable electromagnetic energy consumption conditions. The results suggest that employing 2D graphene in the 1D-2D-1D nanostructures played the critical role in tuning the electromagnetic response ability, because of its intrinsic electric advantages and dimensional features. To broaden the effective absorption bandwidth, periodic pattern-absorbing structures were designed, which showed combined absorption advantages for various thicknesses. Our strategy for fabricating 1D-2D-1D structural fillers illuminates a universal approach for manipulating dimensions and structures in the nanotechnology.

  13. Exploiting the relationship between birefringence and force to measure airway smooth muscle contraction with PS-OCT (Conference Presentation)

    Science.gov (United States)

    Adams, David C.; Hariri, Lida P.; Holz, Jasmin A.; Szabari, Margit V.; Harris, R. Scott; Cho, Jocelyn L.; Hamilos, Daniel L.; Luster, Andrew D.; Medoff, Benjamin D.; Suter, Melissa J.

    2016-03-01

    The ability to observe airway dynamics is fundamental to forming a complete understanding of pulmonary diseases such as asthma. We have previously demonstrated that Optical Coherence Tomography (OCT) can be used to observe structural changes in the airway during bronchoconstriction, but standard OCT lacks the contrast to discriminate airway smooth muscle (ASM) bands- ASM being responsible for generating the force that drives airway constriction- from the surrounding tissue. Since ASM in general exhibits a greater degree of birefringence than the surrounding tissue, a potential solution to this problem lies in the implementation of polarization sensitivity (PS) to the OCT system. By modifying the OCT system so that it is sensitive to the birefringence of tissue under inspection, we can visualize the ASM with much greater clarity and definition. In this presentation we show that the force of contraction can be indirectly measured by an associated increase in the birefringence signal of the ASM. We validate this approach by attaching segments of swine trachea to an isometric force transducer and stimulating contraction, while simultaneously measuring the exerted force and imaging the segment with PS-OCT. We then show how our results may be used to extrapolate the force of contraction of closed airways in absence of additional measurement devices. We apply this technique to assess ASM contractility volumetrically and in vivo, in both asthmatic and non-asthmatic human volunteers.

  14. Open source software for electric field Monte Carlo simulation of coherent backscattering in biological media containing birefringence.

    Science.gov (United States)

    Radosevich, Andrew J; Rogers, Jeremy D; Capoğlu, Ilker R; Mutyal, Nikhil N; Pradhan, Prabhakar; Backman, Vadim

    2012-11-01

    ABSTRACT. We present an open source electric field tracking Monte Carlo program to model backscattering in biological media containing birefringence, with computation of the coherent backscattering phenomenon as an example. These simulations enable the modeling of tissue scattering as a statistically homogeneous continuous random media under the Whittle-Matérn model, which includes the Henyey-Greenstein phase function as a special case, or as a composition of discrete spherical scatterers under Mie theory. The calculation of the amplitude scattering matrix for the above two cases as well as the implementation of birefringence using the Jones N-matrix formalism is presented. For ease of operator use and data processing, our simulation incorporates a graphical user interface written in MATLAB to interact with the underlying C code. Additionally, an increase in computational speed is achieved through implementation of message passing interface and the semi-analytical approach. Finally, we provide demonstrations of the results of our simulation for purely scattering media and scattering media containing linear birefringence.

  15. Study of Collagen Birefringence in Different Grades of Oral Squamous Cell Carcinoma Using Picrosirius Red and Polarized Light Microscopy

    Directory of Open Access Journals (Sweden)

    Pillai Arun Gopinathan

    2015-01-01

    Full Text Available Objectives. The present study was done to evaluate birefringence pattern of collagen fibres in different grades of oral squamous cell carcinoma using Picrosirius red stain and polarization microscopy and to determine if there is a change in collagen fibres between different grades of oral squamous cell carcinoma. Materials and Methods. Picrosirius red stained 5 μm thick sections of previously diagnosed different grades of squamous cell carcinoma and normal oral mucosa were studied under polarization microscopy for arrangement as well as birefringence of collagen fibres around tumour islands. Results. It was found that thin collagen fibres increased and thick collagen fibres decreased with dedifferentiation of OSCC (P<0.0001 . It was observed that there was change in polarization colours of thick fibres from yellowish orange to greenish yellow with dedifferentiation of OSCC indicating loosely packed fibres (P<0.0001. Conclusion. There was a gradual change of birefringence of collagen from yellowish orange to greenish yellow from well to poorly differentiated squamous cell carcinoma, indicating that there is a change from mature form of collagen to immature form as tumour progresses. Studying collagen fibres with Picrosirius red for stromal changes around tumour islands along with routine staining may help in predicting the prognosis of tumour.

  16. Photon-pair generation by intermodal spontaneous four-wave mixing in birefringent, weakly guiding optical fibers

    Science.gov (United States)

    Garay-Palmett, K.; Cruz-Delgado, D.; Dominguez-Serna, F.; Ortiz-Ricardo, E.; Monroy-Ruz, J.; Cruz-Ramirez, H.; Ramirez-Alarcon, R.; U'Ren, A. B.

    2016-03-01

    We present a theoretical and experimental study of the generation of photon pairs through the process of spontaneous four-wave mixing (SFWM) in a few-mode, birefringent fiber. Under these conditions, multiple SFWM processes are in fact possible, each associated with a different combination of transverse modes for the four waves involved. We show that in the weakly guiding regime, for which the propagation modes may be well approximated by linearly polarized modes, the departure from circular symmetry due to the fiber birefringence translates into conservation rules, which retain elements from azimuthal and rectangular symmetries: both OAM and parity must be conserved for a process to be viable. We have implemented a SFWM source based on a bowtie birefringent fiber, and have measured for a collection of pump wavelengths the SFWM spectra of each of the signal and idler photons in coincidence with its partner photon. We have used this information, together with knowledge of the transverse modes into which the signal and idler photons are emitted, as input for a genetic algorithm, which accomplishes two tasks: (i) the identification of the particular SFWM processes that are present in the source, and (ii) the characterization of the fiber used.

  17. Theoretical analysis of the background intensity distribution in X-ray Birefringence Imaging using synchrotron bending-magnet radiation

    Energy Technology Data Exchange (ETDEWEB)

    Sutter, John P., E-mail: john.sutter@diamond.ac.uk; Dolbnya, Igor P.; Collins, Stephen P. [Diamond Light Source Ltd., Chilton, Didcot, Oxfordshire OX11 0DE (United Kingdom); Harris, Kenneth D. M.; Edwards-Gau, Gregory R. [School of Chemistry, Cardiff University, Park Place, Cardiff CF10 3AT, Wales (United Kingdom); Palmer, Benjamin A. [Department of Structural Biology, Weizmann Institute of Science, 234 Herzl St., Rehovot 7610001 (Israel)

    2015-04-28

    In the recently developed technique of X-ray Birefringence Imaging, molecular orientational order in anisotropic materials is studied by exploiting the birefringence of linearly polarized X-rays with energy close to an absorption edge of an element in the material. In the experimental setup, a vertically deflecting high-resolution double-crystal monochromator is used upstream from the sample to select the appropriate photon energy, and a horizontally deflecting X-ray polarization analyzer, consisting of a perfect single crystal with a Bragg reflection at Bragg angle of approximately 45°, is placed downstream from the sample to measure the resulting rotation of the X-ray polarization. However, if the experiment is performed on a synchrotron bending-magnet beamline, then the elliptical polarization of the X-rays out of the electron orbit plane affects the shape of the output beam. Also, because the monochromator introduces a correlation between vertical position and photon energy to the X-ray beam, the polarization analyzer does not select the entire beam, but instead selects a diagonal stripe, the slope of which depends on the Bragg angles of the monochromator and the polarization analyzer. In the present work, the final background intensity distribution is calculated analytically because the phase space sampling methods normally used in ray traces are too inefficient for this setup. X-ray Birefringence Imaging data measured at the Diamond Light Source beamline B16 agree well with the theory developed here.

  18. Theoretical analysis of the background intensity distribution in X-ray Birefringence Imaging using synchrotron bending-magnet radiation

    Science.gov (United States)

    Sutter, John P.; Dolbnya, Igor P.; Collins, Stephen P.; Harris, Kenneth D. M.; Edwards-Gau, Gregory R.; Palmer, Benjamin A.

    2015-04-01

    In the recently developed technique of X-ray Birefringence Imaging, molecular orientational order in anisotropic materials is studied by exploiting the birefringence of linearly polarized X-rays with energy close to an absorption edge of an element in the material. In the experimental setup, a vertically deflecting high-resolution double-crystal monochromator is used upstream from the sample to select the appropriate photon energy, and a horizontally deflecting X-ray polarization analyzer, consisting of a perfect single crystal with a Bragg reflection at Bragg angle of approximately 45°, is placed downstream from the sample to measure the resulting rotation of the X-ray polarization. However, if the experiment is performed on a synchrotron bending-magnet beamline, then the elliptical polarization of the X-rays out of the electron orbit plane affects the shape of the output beam. Also, because the monochromator introduces a correlation between vertical position and photon energy to the X-ray beam, the polarization analyzer does not select the entire beam, but instead selects a diagonal stripe, the slope of which depends on the Bragg angles of the monochromator and the polarization analyzer. In the present work, the final background intensity distribution is calculated analytically because the phase space sampling methods normally used in ray traces are too inefficient for this setup. X-ray Birefringence Imaging data measured at the Diamond Light Source beamline B16 agree well with the theory developed here.

  19. In vivo glucose monitoring using dual-wavelength polarimetry to overcome corneal birefringence in the presence of motion.

    Science.gov (United States)

    Pirnstill, Casey W; Malik, Bilal H; Gresham, Vincent C; Coté, Gerard L

    2012-09-01

    Over the past 35 years considerable research has been performed toward the investigation of noninvasive and minimally invasive glucose monitoring techniques. Optical polarimetry is one noninvasive technique that has shown promise as a means to ascertain blood glucose levels through measuring the glucose concentrations in the anterior chamber of the eye. However, one of the key limitations to the use of optical polarimetry as a means to noninvasively measure glucose levels is the presence of sample noise caused by motion-induced time-varying corneal birefringence. In this article our group presents, for the first time, results that show dual-wavelength polarimetry can be used to accurately detect glucose concentrations in the presence of motion-induced birefringence in vivo using New Zealand White rabbits. In total, nine animal studies (three New Zealand White rabbits across three separate days) were conducted. Using the dual-wavelength optical polarimetric approach, in vivo, an overall mean average relative difference of 4.49% (11.66 mg/dL) was achieved with 100% Zone A+B hits on a Clarke error grid, including 100% falling in Zone A. The results indicate that dual-wavelength polarimetry can effectively be used to significantly reduce the noise due to time-varying corneal birefringence in vivo, allowing the accurate measurement of glucose concentration in the aqueous humor of the eye and correlating that with blood glucose.

  20. Dynamic decoupling in the presence of 1D random walk

    Science.gov (United States)

    Chakrabarti, Arnab; Chakraborty, Ipsita; Bhattacharyya, Rangeet

    2016-05-01

    In the recent past, many dynamic decoupling sequences have been proposed for the suppression of decoherence of spins connected to thermal baths of various natures. Dynamic decoupling schemes for suppressing decoherence due to Gaussian diffusion have also been developed. In this work, we study the relative performances of dynamic decoupling schemes in the presence of a non-stationary Gaussian noise such as a 1D random walk. Frequency domain analysis is not suitable to determine the performances of various dynamic decoupling schemes in suppressing decoherence due to such a process. Thus, in this work, we follow a time domain calculation to arrive at the following conclusions: in the presence of such a noise, we show that (i) the traditional Carr-Purcell-Meiboom-Gill (CPMG) sequence outperforms Uhrig’s dynamic decoupling scheme, (ii) CPMG remains the optimal sequence for suppression of decoherence due to random walk in the presence of an external field gradient. Later, the theoretical predictions are experimentally verified by using nuclear magnetic resonance spectroscopy on spin 1/2 particles diffusing in a liquid medium.

  1. 1-D Modeling of Massive Particle Injection (MPI) in Tokamaks

    Science.gov (United States)

    Wu, W.; Parks, P. B.; Izzo, V. A.

    2008-11-01

    A 1-D Fast Current Quench (FCQ) model is developed to study current evolution and runaway electron suppression under massive density increase. The model consists of coupled toroidal electric field and energy equations, and it is solved numerically for DIII-D and ITER operating conditions. Simulation results suggest that fast shutdown by D2 liquid jet/pellet injection is in principle achievable for the desired plasma cooling time (˜15 ms for DIII-D and ˜50 ms for ITER) under ˜150x or higher densification. The current density and pressure profile are practically unaltered during the initial phase of jet propagation when dilution cooling dominates. With subsequent radiation cooling, the densified discharge enters the strongly collisional regime where Pfirsch-Schluter thermal diffusion can inhibit current contraction on the magnetic axis. Often the 1/1 kink instability, addressed by Kadomtsev's magnetic reconnection model, can be prevented. Our results are compared with NIMROD simulations in which the plasma is suddenly densified by ˜100x and experiences instantaneous dilution cooling, allowing for use of actual (lower) Lundquist numbers.

  2. An implicit solver for 1D arterial network models.

    Science.gov (United States)

    Carson, Jason; Van Loon, Raoul

    2017-07-01

    In this study, the 1D blood flow equations are solved using a newly proposed enhanced trapezoidal rule method (ETM), which is an extension to the simplified trapezoidal rule method. At vessel junctions, the conservation of mass and conservation of total pressure are held as system constraints using Lagrange multipliers that can be physically interpreted as external flow rates. The ETM scheme is compared with published arterial network benchmark problems and a dam break problem. Strengths of the ETM scheme include being simple to implement, intuitive connection to lumped parameter models, and no restrictive stability criteria such as the Courant-Friedrichs-Lewy (CFL) number. The ETM scheme does not require the use of characteristics at vessel junctions, or for inlet and outlet boundary conditions. The ETM forms an implicit system of equations, which requires only one global solve per time step for pressure, followed by flow rate update on the elemental system of equations; thus, no iterations are required per time step. Consistent results are found for all benchmark cases, and for a 56-vessel arterial network problem, it gives very satisfactory solutions at a spatial and time discretization that results in a maximum CFL of 3, taking 4.44 seconds per cardiac cycle. By increasing the time step and element size to produce a maximum CFL number of 15, the method takes only 0.39 second per cardiac cycle with only a small compromise on accuracy. Copyright © 2016 John Wiley & Sons, Ltd.

  3. 1-D Numerical Analysis of RBCC Engine Performance

    Science.gov (United States)

    Han, Samuel S.

    1998-01-01

    An RBCC engine combines air breathing and rocket engines into a single engine to increase the specific impulse over an entire flight trajectory. Considerable research pertaining to RBCC propulsion was performed during the 1960's and these engines were revisited recently as a candidate propulsion system for either a single-stage-to-orbit (SSTO) or two-stage-to-orbit (TSTO) launch vehicle. There are a variety of RBCC configurations that had been evaluated and new designs are currently under development. However, the basic configuration of all RBCC systems is built around the ejector scramjet engine originally developed for the hypersonic airplane. In this configuration, a rocket engine plays as an ejector in the air-augmented initial acceleration mode, as a fuel injector in scramjet mode and the rocket in all rocket mode for orbital insertion. Computational fluid dynamics (CFD) is a useful tool for the analysis of complex transport processes in various components in RBCC propulsion systems. The objective of the present research was to develop a transient 1-D numerical model that could be used to predict flow behavior throughout a generic RBCC engine following a flight path.

  4. Towards a consistent picture for quasi-1D organic superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Doiron-Leyraud, N. [Departement de physique and RQMP, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1 (Canada); Auban-Senzier, P. [Laboratoire de Physique des Solides, UMR 8502, CNRS - Univ. Paris-Sud, Bat. 510, 91405 Orsay (France); Rene de Cotret, S. [Departement de physique and RQMP, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1 (Canada); Bechgaard, K. [Department of Chemistry, H.C. Orsted Institute, Copenhagen (Denmark); Jerome, D., E-mail: jerome@lps.u-psud.f [Laboratoire de Physique des Solides, UMR 8502, CNRS - Univ. Paris-Sud, Bat. 510, 91405 Orsay (France); Canadian Institute for Advanced Research, Toronto, Ontario, M5G 1Z8 (Canada); Taillefer, L. [Departement de physique and RQMP, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1 (Canada); Canadian Institute for Advanced Research, Toronto, Ontario, M5G 1Z8 (Canada)

    2010-06-01

    The electrical resistivity of the quasi-1D organic superconductor (TMTSF){sub 2}PF{sub 6} was recently measured at low temperature from the critical pressure needed to suppress the spin-density-wave state up to a pressure where superconductivity has almost disappeared. This data revealed a direct correlation between the onset of superconductivity at T{sub c} and the strength of a non-Fermi-liquid linear term in the normal-state resistivity, going as {rho}(T)={rho}{sub 0}+AT+BT{sup 2} at low temperature, so that A{yields}0 as T{sub c{yields}}0. Here we show that the contribution of low-frequency antiferromagnetic fluctuations to the spin-lattice relaxation rate is also correlated with this non-Fermi-liquid term AT in the resistivity. These correlations suggest that anomalous scattering and pairing have a common origin, both rooted in the low-frequency antiferromagnetic fluctuations measured by NMR. A similar situation may also prevail in the recently discovered iron-pnictide superconductors.

  5. Sulfur chemistry: 1D modeling in massive dense cores

    CERN Document Server

    Wakelam, V; Herpin, F

    2011-01-01

    The main sulfur-bearing molecules OCS, H2S, SO, SO2, and CS have been observed in four high mass dense cores (W43-MM1, IRAS 18264, IRAS 05358, and IRAS 18162). Our goal is to put some constraints on the relative evolutionary stage of these sources by comparing these observations with time-dependent chemical modeling. We used the chemical model Nahoon, which computes the gas-phase chemistry and gas-grain interactions of depletion and evaporation. Mixing of the different chemical compositions shells in a 1D structure through protostellar envelope has been included since observed lines suggest nonthermal supersonic broadening. Observed radial profiles of the temperature and density are used to compute the chemistry as a function of time. With our model, we underproduce CS by several orders of magnitude compared to the other S-bearing molecules, which seems to contradict observations, although some uncertainties in the CS abundance observed at high temperature remain. The OCS/SO2, SO/SO2, and H2S/SO2 abundance ra...

  6. Cavitation Influence in 1D Part-load Vortex Models

    Science.gov (United States)

    Dörfler, P. K.

    2016-11-01

    Residual swirl in the draft tube of Francis turbines may cause annoying low- frequency pulsation of pressure and power output, in particular during part-load operation. A 1D analytical model for these dynamic phenomena would enable simulation by some conventional method for computing hydraulic transients. The proper structure of such a model has implications for the prediction of prototype behaviour based on laboratory tests. The source of excitation as well as the dynamic transmission behaviour of the draft tube flow may both be described either by lumped or distributed parameters. The distributed version contains more information and, due to limited possibilities of identification, some data must be estimated. The distributed cavitation compliance is an example for this dilemma. In recent publications, the customary assumption of a constant wave speed has produced dubious results. The paper presents a more realistic model for distributed compressibility. The measured influence of the Thoma number is applied with the local cavitation factor. This concept is less sensitive to modelling errors and explains both the Thoma and Froude number influence. The possible effect of the normally unknown non-condensable gas content in the vortex cavity is shortly commented. Its measurement in future tests is recommended. It is also recommended to check the available analytical vortex models for possible dispersion effects.

  7. Nonclassical Particle Transport in 1-D Random Periodic Media

    CERN Document Server

    Vasques, Richard; Slaybaugh, Rachel N

    2016-01-01

    We investigate the accuracy of the recently proposed nonclassical transport equation. This equation contains an extra independent variable compared to the classical transport equation (the path-length $s$), and models particle transport taking place in homogenized random media in which a particle's distance-to-collision is not exponentially distributed. To solve the nonclassical equation one needs to know the $s$-dependent ensemble-averaged total cross section, $\\Sigma_t(\\mu,s)$, or its corresponding path-length distribution function, $p(\\mu,s)$. We consider a 1-D spatially periodic system consisting of alternating solid and void layers, randomly placed in the $x$-axis. We obtain an analytical expression for $p(\\mu,s)$ and use this result to compute the corresponding $\\Sigma_t(\\mu,s)$. Then, we proceed to numerically solve the nonclassical equation for different test problems in rod geometry; that is, particles can move only in the directions $\\mu=\\pm 1$. To assess the accuracy of these solutions, we produce ...

  8. Modeling of 1D Anomalous Diffusion in Fractured Nanoporous Media

    Directory of Open Access Journals (Sweden)

    Albinali Ali

    2016-07-01

    Full Text Available Fractured nanoporous reservoirs include multi-scale and discontinuous fractures coupled with a complex nanoporous matrix. Such systems cannot be described by the conventional dual-porosity (or multi-porosity idealizations due to the presence of different flow mechanisms at multiple scales. More detailed modeling approaches, such as Discrete Fracture Network (DFN models, similarly suffer from the extensive data requirements dictated by the intricacy of the flow scales, which eventually deter the utility of these models. This paper discusses the utility and construction of 1D analytical and numerical anomalous diffusion models for heterogeneous, nanoporous media, which is commonly encountered in oil and gas production from tight, unconventional reservoirs with fractured horizontal wells. A fractional form of Darcy’s law, which incorporates the non-local and hereditary nature of flow, is coupled with the classical mass conservation equation to derive a fractional diffusion equation in space and time. Results show excellent agreement with established solutions under asymptotic conditions and are consistent with the physical intuitions.

  9. Stokes-Mueller matrix polarimetry technique for circular dichroism/birefringence sensing with scattering effects

    Science.gov (United States)

    Phan, Quoc-Hung; Lo, Yu-Lung

    2017-04-01

    A surface plasmon resonance (SPR)-enhanced method is proposed for measuring the circular dichroism (CD), circular birefringence (CB), and degree of polarization (DOP) of turbid media using a Stokes-Mueller matrix polarimetry technique. The validity of the analytical model is confirmed by means of numerical simulations. The simulation results show that the proposed detection method enables the CD and CB properties to be measured with a resolution of 10-4 refractive index unit (RIU) and 10-5 RIU, respectively, for refractive indices in the range of 1.3 to 1.4. The practical feasibility of the proposed method is demonstrated by detecting the CB/CD/DOP properties of glucose-chlorophyllin compound samples containing polystyrene microspheres. It is shown that the extracted CB value decreases linearly with the glucose concentration, while the extracted CD value increases linearly with the chlorophyllin concentration. However, the DOP is insensitive to both the glucose concentration and the chlorophyllin concentration. Consequently, the potential of the proposed SPR-enhanced Stokes-Mueller matrix polarimetry method for high-resolution CB/CD/DOP detection is confirmed. Notably, in contrast to conventional SPR techniques designed to detect relative refractive index changes, the SPR technique proposed in the present study allows absolute measurements of the optical properties (CB/CD/DOP) to be obtained.

  10. Highly birefringent single mode spiral shape photonic crystal fiber based sensor for gas sensing applications

    Directory of Open Access Journals (Sweden)

    Md. Ibadul Islam

    2017-06-01

    Full Text Available This article represents a gas sensor based on spiral photonic crystal fiber (S-PCF for detecting harmful or colorless gasses and monitoring air pollution by metering gas condensate elements in production facilities. The proposed micro-structured S-PCF contains two layers porous core encircled by a spiral shape cladding. The geometrical parameters are tuned to fix the optimized S-PCF structure. The numerical analysis of the proposed S-PCF is performed by utilizing finite element method (FEM with circular perfectly match layer (C-PML. The relative sensitivity and birefringence of the recommended structure are 57.61% and 7.53 × 10−3 respectively at 1.33 μm wavelength on the absorption line of toxic gasses (methane and hydrogen fluoride. The exhibited beam divergence is about 4.1° at the same wavelength. Besides, beat length, nonlinear coefficient, effective area and V parameters are also described briefly for optimized S-PCF structure over broader wavelength range from 1 μm to 1.8 μm.

  11. Polarization-dependent intermodal four-wave mixing in a birefringent multimode photonic crystal fiber.

    Science.gov (United States)

    Yuan, Jinhui; Kang, Zhe; Li, Feng; Zhou, Guiyao; Sang, Xinzhu; Wu, Qiang; Yan, Binbin; Zhou, Xian; Zhong, Kangping; Wang, Liang; Wang, Kuiru; Yu, Chongxiu; Lu, Chao; Tam, Hwa Yaw; Wai, P K A

    2017-05-01

    In this Letter, polarization-dependent intermodal four-wave mixing (FWM) is demonstrated experimentally in a birefringent multimode photonic crystal fiber (BM-PCF) designed and fabricated in-house. Femtosecond pump pulses at wavelengths ∼800  nm polarized along one of the principal axes of the BM-PCF are coupled into a normal dispersion region away from the zero-dispersion wavelengths of the fundamental guided mode of the BM-PCF. Anti-Stokes and Stokes waves are generated in the 2nd guided mode at visible and near-infrared wavelengths, respectively. For pump pulses at an average input power of 500 mW polarized along the slow axis, the conversion efficiencies ηas and ηs of the anti-Stokes and Stokes waves generated at wavelengths 579.7 and 1290.4 nm are 19% and 14%, respectively. For pump pulses polarized along the fast axis, the corresponding ηas and ηs at 530.4 and 1627 nm are 23% and 18%, respectively. We also observed that fiber bending and intermodal walk-off have a small effect on the polarization-dependent intermodal FWM-based frequency conversion process.

  12. Axion-induced birefringence effects in laser driven nonlinear vacuum interaction

    CERN Document Server

    Villalba-Chávez, Selym

    2013-01-01

    The propagation of a probe electromagnetic field through a counterpropagating strong plane wave is investigated. The effects of the electromagnetic field-(pseudo)scalar axion field interaction and of the self-interaction of the electromagnetic field mediated by virtual electron-positron pairs in the effective Lagrangian approach are included. First, we show that if the strong field is circularly polarized, contrary to the leading-order nonlinear QED effects, the axion-photon interaction induces a chiral-like birefringence and a dichroism in the vacuum. The latter effect is explained by evoking the conservation of the total angular momentum along the common propagation direction of probe and the strong wave, which allows for real axion production only for probe and strong fields with the same helicity. Moreover, in the case of ultra-short strong pulses, it is shown that the absorption coefficients of probe photons depend on the form of the pulse and, in particular, on the carrier-envelope phase of the strong b...

  13. Collagen birefringence in skin repair in response to red polarized-laser therapy

    Science.gov (United States)

    da Silva, Daniela d. F. T.; Vidal, Benedicto d. C.; Zezell, Denise M.; Zorn, Telma M. T.; Núñez, Silvia C.; Ribeiro, Martha S.

    2006-03-01

    We use the optical path difference (OPD) technique to quantify the organization of collagen fibers during skin repair of full-thickness burns following low-intensity polarized laser therapy with two different polarization incidence vectors. Three burns are cryogenerated on the back of rats. Lesion L|| is irradiated using the electric field vector of the polarized laser radiation aligned in parallel with the rat's occipital-caudal direction. Lesion L⊥ is irradiated using the electric field vector of the polarized laser radiation aligned perpendicularly to the aforementioned orientation. Lesion C is untreated. A healthy area labeled H is also evaluated. The tissue samples are collected and processed for polarized light microscopy. The overall finding is that the OPD for collagen fibers depends on the electric field vector of the incident polarized laser radiation. No significant differences in OPDs are observed between L|| and H in the center, sides, and edges of the lesion. Lesions irradiated using the electric field vector of the polarized laser radiation aligned in parallel with the rat's occipital-caudal direction show higher birefringence, indicating that collagen bundles in these lesions are more organized.

  14. Narrow band pass filter using birefringence film and quarter-wave film

    Science.gov (United States)

    Lee, Dong-kun; Song, Jang-Kun

    2016-03-01

    While a pixel in a color image has three colorimetric information of RGB, that in a spectral image contains full spectral information, several tens times more information compared to the color image. Hence, the spectral image is widely applicable in biology, material science, and environmental science. Although several methods for spectral image acquisition have been suggested to date, those methods are expensive, bulky, or slow in actual device. In this work, we designed a novel type of tunable narrow band-pass filter using rotatable polarizer, quarter-wave plate, and birefringence films. Different from the conventional Lyot-Ohman type filter, we do not use a liquid crystal layer. The selection of wavelength is made by rotating the polarizer in our filter set, and adopted a piezoelectric rotational actuator for that. We simulated to find the optimal conditions of the filter set, and finally, fabricated a filter module. The minimum band width was 5 nm, which is suitable for usual spectral imaging and can be reduced further if necessary, and the wavelength of light passing through the filter set was continuously selectable. After setting the filter in a microscope, we obtained a spectral image set for a bio sample that contained full spectrum information in each pixel. Using image processing, we could demonstrate to read out the spectral information for any selected position.

  15. Optical birefringence and molecular orientation of crazed fibres utilizing the phase shifting interferometric technique

    Science.gov (United States)

    Sokkar, T. Z. N.; El-Farahaty, K. A.; El-Bakary, M. A.; Omar, E. Z.; Hamza, A. A.

    2017-09-01

    In this article, the features of the phase shifting interferometric technique were utilized to investigate the effect of the presence of crazes in both outer and inner layers on optical birefringence and molecular orientation of polypropylene fibres. The Pluta polarizing interference microscope was used as a phase shifting technique. This method includes adding a stepper motor with a control unit to the micrometer screw of the Pluta microscope. This optical system was calibrated to be used as a phase shifting interferometric technique. The advantage of this technique is that it can detect the crazes in both inner and outer layers of the sample under test. Via this method, the relation between the presence of the crazes (in both inner and outer layers) and the optical molecular orientation of polypropylene (PP) fibres was demonstrated. To clarify the role of this method, the spatial carrier frequency technique was used to show the effect of the presence of the crazes only in the outer layers on the phase distribution values and hence the structural properties of PP fibres.

  16. A hybrid tunable THz metadevice using a high birefringence liquid crystal

    Science.gov (United States)

    Chikhi, Nassim; Lisitskiy, Mikhail; Papari, Gianpaolo; Tkachenko, Volodymyr; Andreone, Antonello

    2016-01-01

    We investigate a hybrid re-configurable three dimensional metamaterial based on liquid crystal as tuning element in order to build novel devices operating in the terahertz range. The proposed metadevice is an array of meta-atoms consisting of split ring resonators having suspended conducting cantilevers in the gap region. Adding a “third dimension” to a standard planar device plays a dual role: (i) enhance the tunability of the overall structure, exploiting the birefringence of the liquid crystal at its best, and (ii) improve the field confinement and therefore the ability of the metadevice to efficiently steer the THz signal. We describe the design, electromagnetic simulation, fabrication and experimental characterization of this new class of tunable metamaterials under an externally applied small voltage. By infiltrating tiny quantities of a nematic liquid crystal in the structure, we induce a frequency shift in the resonant response of the order of 7–8% in terms of bandwidth and about two orders of magnitude change in the signal absorption. We discuss how such a hybrid structure can be exploited for the development of a THz spatial light modulator. PMID:27708395

  17. Observation of a different birefringence order at optical and THz frequencies in LBO crystal

    Science.gov (United States)

    Andreev, Yu. M.; Kokh, A. E.; Kokh, K. A.; Lanskii, G. V.; Litvinenko, K.; Mamrashev, A. A.; Molloy, J. F.; Murdin, B.; Naftaly, M.; Nikolaev, N. A.; Svetlichnyi, V. A.

    2017-04-01

    THz optical properties of lithium borate (LBO) crystals were measured using time-domain spectroscopy (TDS). The LBO crystal samples were of high optical quality and were cut and polished along the , and axes. Two independent measurements were performed in order to confirm the reproducibility and consistency of results. The contradictions in the previously published data on the THz optical properties of LBO were clarified. It was shown that the birefringence order at THz frequencies is nz nx nx

  18. Stokes-Mueller matrix polarimetry technique for circular dichroism/birefringence sensing with scattering effects.

    Science.gov (United States)

    Phan, Quoc-Hung; Lo, Yu-Lung

    2017-04-01

    A surface plasmon resonance (SPR)-enhanced method is proposed for measuring the circular dichroism (CD), circular birefringence (CB), and degree of polarization (DOP) of turbid media using a Stokes–Mueller matrix polarimetry technique. The validity of the analytical model is confirmed by means of numerical simulations. The simulation results show that the proposed detection method enables the CD and CB properties to be measured with a resolution of 10 ? 4 refractive index unit (RIU) and 10 ? 5 ?? RIU , respectively, for refractive indices in the range of 1.3 to 1.4. The practical feasibility of the proposed method is demonstrated by detecting the CB/CD/DOP properties of glucose–chlorophyllin compound samples containing polystyrene microspheres. It is shown that the extracted CB value decreases linearly with the glucose concentration, while the extracted CD value increases linearly with the chlorophyllin concentration. However, the DOP is insensitive to both the glucose concentration and the chlorophyllin concentration. Consequently, the potential of the proposed SPR-enhanced Stokes–Mueller matrix polarimetry method for high-resolution CB/CD/DOP detection is confirmed. Notably, in contrast to conventional SPR techniques designed to detect relative refractive index changes, the SPR technique proposed in the present study allows absolute measurements of the optical properties (CB/CD/DOP) to be obtained.

  19. Interference-based linear birefringence measurements of thermally induced changes in collagen

    Science.gov (United States)

    Maitland, Duncan J.; Walsh, Joseph T.

    1994-08-01

    Linear birefringence (LB) is a polarization-specific property of many semi-crystalline structures in tissue. Specifically, collagen, with its triple helix conformation, exhibits LB in its native state. Rat tail tendon (RTT) was chosen for the LB experiments because it is > 90% collagen and the collagen fiber alignment is nearly parallel with the RTT length. This alignment results in RTT exhibiting uniaxial characteristics such that two properly chosen optical axes display differing refractive indices ((Delta) n equals nslow - nfast). RTT, which has an elliptical cross section, has its slow axis parallel to the tendon's length and a fast axes along the tendon's cross section. Native RTT has a refractive index difference of (Delta) n equals 1.5 X 10-3. For a typical tendon thickness of 200 micrometers , the phase shift, (delta) equals n*d (d, diameter), is approximately equal to 300 nm (transmission measurement). Heating of RTT results in a repeatable loss of (delta) . If monochromatic light is used the sample's output intensity is proportional to sin2((delta) (pi) /(lambda) ) where (lambda) is the wavelength of the light. Thus, given the native phase shift, the incident light's wavelength may be chosen such that the sample's loss of LB with heating is intensity- mapped on the sample's image.

  20. Isochromate fringes simulation by Cassini-like curves for photoelastic analysis of birefringent crystals

    Energy Technology Data Exchange (ETDEWEB)

    Rinaldi, D. [Dipartimento di Fisica e Ingegneria dei Materiali e del Territorio, Universita Politecnica delle Marche, via Brecce Bianche, 60131 Ancona (Italy); INFN, Section of Perugia (Italy)], E-mail: d.rinaldi@univpm.it; Pietroni, P. [Dipartimento di Meccanica, Universita Politecnica delle Marche, via Brecce Bianche, 60131 Ancona (Italy); Davi, F. [Dipartimento di Architettura, Costruzioni e Strutture, Universita Politecnica delle Marche, via Brecce Bianche, 60131 Ancona (Italy)

    2009-05-21

    In optically birefringent uniaxial and biaxial crystals, analyzed by plane polariscope, isochromate interference fringes can be observed. By means of the classical electromagnetic theory a Cassini-like analytical equation of the isochromate fringes, depending on the refraction indexes, has been obtained. The proposed analytical equation is a useful tool to evaluate the internal stress state, as it is related to the isochromate shapes owing to the induced variation of the refraction indexes. Uniaxial crystals can assume complex biaxial behaviour due to particular stress configurations. PbWO{sub 4} (PWO) uniaxial scintillating crystals have been studied. The Cassini-like curves fit well experimental measurements in the case of uniaxial stress. In this research work, a simple model has been proved in the case of strong isochromate fringes distortion due to a stress gradient induced by the bending load. The model fits well the interference pattern, acquired experimentally. This study can pave the way for the quality control on scintillating crystals, used in the fields of high-energy detectors, security and biomedical applications, with complex internal stress state.

  1. Synthesis of 1-D ZnO nanorods and polypyrrole/1-D ZnO nanocomposites for photocatalysis and gas sensor applications

    Indian Academy of Sciences (India)

    PRITAM PATIL; GANESH GAIKWAD; D R PATIL; JITENDRA NAIK

    2016-06-01

    1-D ZnO nanorods and PPy/1-D ZnO nanocomposites were prepared by the surfactant-assisted precipitation and in situ polymerization method, respectively. The synthesized nanorods and nanocomposites were characterized by UV–Vis spectrophotometer, Fourier transform-infrared spectroscopy (FTIR), X-ray diffraction (XRD) and field emission scanning electron microscope (FE-SEM), which gave the evidence of 1-D ZnO nanorods, polymerization of pyrrole monomer and strong interaction between PPy and 1-D ZnO nanorods, respectively. Photocatalytic activity of 1-D ZnO nanorods was conducted by $3^3$ level full-factorial design to evaluate the effect of three independent process variables viz., dye concentration (crystal violet), catalyst concentration (1-D ZnO nanorods) and the reaction time on the preferred response: photodegradation efficiency (%). The PPy/1-D ZnO nanocompositeswere used for the sensing of NH$_3$, LPG, CO$_2$ and H$_2$S gases, respectively, at room temperature. It was observed that PPy/1-D ZnO nanocomposites with different 1-D ZnO nanorod weight ratios (15 and 25%) had better selectivity and sensitivity towards NH3 at room temperature.

  2. Absolute rate constant determinations for the deactivation of O/1D/ by time resolved decay of O/1D/ yields O/3P/ emission

    Science.gov (United States)

    Davidson, J. A.; Sadowski, C. M.; Schiff, H. I.; Howard, C. J.; Schmeltekopf, A. L.; Jennings, D. A.; Streit, G. E.

    1976-01-01

    Absolute rate constants for the deactivation of O(1D) atoms by some atmospheric gases have been determined by observing the time-resolved emission of O(1D) at 630 nm. O(1D) atoms were produced by the dissociation of ozone via repetitive laser pulses at 266 nm. Absolute rate constants for the relaxation of O(1D) at 298 K are reported for N2, O2, CO2, O3, H2, D2, CH4, HCl, NH3, H2O, N2O, and Ne. The results obtained are compared with previous relative and absolute measurements reported in the literature.

  3. Benchmarking of a 1D Scrape-off layer code SOLF1D with SOLPS and its use in modelling long-legged divertors

    CERN Document Server

    Havlickova, E; Subba, F; Coster, D; Wischmeier, M; Fishpool, G

    2013-01-01

    A 1D code modelling SOL transport parallel to the magnetic field (SOLF1D) is benchmarked with 2D simulations of MAST-U SOL performed via the SOLPS code for two different collisionalities. Based on this comparison, SOLF1D is then used to model the effects of divertor leg stretching in 1D, in support of the planned Super-X divertor on MAST. The aim is to separate magnetic flux expansion from volumetric power losses due to recycling neutrals by stretching the divertor leg either vertically or radially.

  4. Modeling shear band interaction in 1D torsion

    Science.gov (United States)

    Partom, Yehuda; Hanina, Erez

    2017-01-01

    When two shear bands are being formed at close distance from each other they interact, and further development of one of them may be quenched down. As a result there should be a minimum distance between shear bands. In the literature there are at least three analytical models for this minimum distance. Predictions of these models do not generally agree with each other and with test results. Recently we developed a 1D numerical scheme to predict the formation of shear bands in a torsion test of a thin walled pipe. We validated our code by reproducing results of the pioneering experiments of Marchand and Duffy, and then used it to investigate the mechanics of shear localization and shear band formation. We describe our shear band code in a separate publication, and here we use it only as a tool to investigate the interaction between two neighboring shear bands during the process of their formation. We trigger the formation of shear bands by specifying two perturbations of the initial strength. We vary the perturbations in terms of their amplitude and/or their width. Usually, the stronger perturbation triggers a faster developing shear band, which then prevails and quenches the development of the other shear band. We change the distance between the two shear bands and find, that up to a certain distance one of the shear bands becomes fully developed, and the other stays only partially developed. Beyond this distance the two shear bands are both fully developed. Finally, we check the influence of certain material and loading parameters on the interaction between the two shear bands, and compare the results to predictions of the analytical models from the literature.

  5. Evidence against dopamine D1/D2 receptor heteromers

    Science.gov (United States)

    Frederick, Aliya L.; Yano, Hideaki; Trifilieff, Pierre; Vishwasrao, Harshad D.; Biezonski, Dominik; Mészáros, József; Sibley, David R.; Kellendonk, Christoph; Sonntag, Kai C.; Graham, Devon L.; Colbran, Roger J.; Stanwood, Gregg D.; Javitch, Jonathan A.

    2014-01-01

    Hetero-oligomers of G-protein-coupled receptors have become the subject of intense investigation because their purported potential to manifest signaling and pharmacological properties that differ from the component receptors makes them highly attractive for the development of more selective pharmacological treatments. In particular, dopamine D1 and D2 receptors have been proposed to form hetero-oligomers that couple to Gαq proteins, and SKF83959 has been proposed to act as a biased agonist that selectively engages these receptor complexes to activate Gαq and thus phospholipase C. D1/D2 heteromers have been proposed as relevant to the pathophysiology and treatment of depression and schizophrenia. We used in vitro bioluminescence resonance energy transfer (BRET), ex vivo analyses of receptor localization and proximity in brain slices, and behavioral assays in mice to characterize signaling from these putative dimers/oligomers. We were unable to detect Gαq or Gα11 protein coupling to homomers or heteromers of D1 or D2 receptors using a variety of biosensors. SKF83959-induced locomotor and grooming behaviors were eliminated in D1 receptor knockout mice, verifying a key role for D1-like receptor activation. In contrast, SKF83959-induced motor responses were intact in D2 receptor and Gαq knockout mice, as well as in knock-in mice expressing a mutant Ala286-CaMKIIα, that cannot autophosphorylate to become active. Moreover, we found that in the shell of the nucleus accumbens, even in neurons in which D1 and D2 receptor promoters are both active, the receptor proteins are segregated and do not form complexes. These data are not compatible with SKF83959 signaling through Gαq or through a D1–D2 heteromer and challenge the existence of such a signaling complex in the adult animals that we used for our studies. PMID:25560761

  6. Spatio-temporal stability of 1D Kerr cavity solitons

    Science.gov (United States)

    Gelens, L.; Parra-Rivas, P.; Leo, F.; Gomila, D.; Matias, Manuel A.; Coen, S.

    2014-05-01

    The Lugiato-Lefever equation (LLE) has been extensively studied since its derivation in 1987, when this meanfield model was introduced to describe nonlinear optical cavities. The LLE was originally derived to describe a ring cavity or a Fabry-Perot resonator with a transverse spatial extension and partially filled with a nonlinear medium but it has also been shown to be applicable to other types of cavities, such as fiber resonators and microresonators. Depending on the parameters used, the LLE can present a monostable or bistable input-output response curve. A large number of theoretical studies have been done in the monostable regime, but the bistable regime has remained widely unexplored. One of the reasons for this was that previous experimental setups were not able to works in such regimes of the parameter space. Nowadays the possibility of reaching such parameter regimes experimentally has renewed the interest in the LLE. In this contribution, we present an in-depth theoretical study of the different dynamical regimes that can appear in parameter space, focusing on the dynamics of localized solutions, also known as cavity solitons (CSs). We show that time-periodic oscillations of a 1D CS appear naturally in a broad region of parameter space. More than this oscillatory regime, which has been recently demonstrated experimentally,1 we theoretically report on several kinds of chaotic dynamics. We show that the existence of CSs and their dynamics is related with the spatial dynamics of the system and with the presence of a codimension-2 point known as a Fold-Hopf bifurcation point. These dynamical regimes can become accessible by using devices such as microresonators, for instance widely used for creating optical frequency combs.

  7. Restrained dark U (1 )d at low energies

    Science.gov (United States)

    Correia, Fagner C.; Fajfer, Svjetlana

    2016-12-01

    We investigate a spontaneously broken U (1 )d gauge symmetry with a muon-specific dark Higgs. Our first goal is to verify how the presence of a new dark Higgs, ϕ , and a dark gauge boson, V , can simultaneously face the anomalies from the muon magnetic moment and the proton charge radius. Second, by assuming that V must decay to an electron-positron pair, we explore the corresponding parameter space determined with the low-energy constraints coming from K →μ X , electron (g -2 )e, K →μ νμe+e-, K →μ νμμ+μ-, and τ →ντμ νμe+e-. We focus on the scenario where the V mass is below ˜2 mμ and the ϕ mass runs from few MeV to 250 MeV, with V -photon mixing of the order ˜O (10-3). Among weak process at low energies, we check the influence of the new light vector on kaon decays as well as on the scattering e+e-→μ+μ-e+e- and discuss the impact of the dark Higgs on e+e-→μ+μ-μ+μ-. Finally, we consider contributions of the V -photon mixing in the decays π0→γ e+e-, η →γ e+e-, ρ →π e+e-, K*→K e+e-, and ϕ (1020 )→η e+e-.

  8. Resolution-optimized NMR measurement of (1)D(CH), (1)D(CC) and (2)D(CH) residual dipolar couplings in nucleic acid bases.

    Science.gov (United States)

    Boisbouvier, Jérôme; Bryce, David L; O'neil-Cabello, Erin; Nikonowicz, Edward P; Bax, Ad

    2004-11-01

    New methods are described for accurate measurement of multiple residual dipolar couplings in nucleic acid bases. The methods use TROSY-type pulse sequences for optimizing resolution and sensitivity, and rely on the E.COSY principle to measure the relatively small two-bond (2)D(CH) couplings at high precision. Measurements are demonstrated for a 24-nt stem-loop RNA sequence, uniformly enriched in (13)C, and aligned in Pf1. The recently described pseudo-3D method is used to provide homonuclear (1)H-(1)H decoupling, which minimizes cross-correlation effects and optimizes resolution. Up to seven (1)H-(13)C and (13)C-(13)C couplings are measured for pyrimidines (U and C), including (1)D(C5H5), (1)D(C6H6), (2)D(C5H6), (2)D(C6H5), (1)D(C5C4), (1)D(C5C6), and (2)D(C4H5). For adenine, four base couplings ((1)D(C2H2), (1)D(C8H8), (1)D(C4C5), and (1)D(C5C6)) are readily measured whereas for guanine only three couplings are accessible at high relative accuracy ((1)D(C8H8), (1)D(C4C5), and (1)D(C5C6)). Only three dipolar couplings are linearly independent in planar structures such as nucleic acid bases, permitting cross validation of the data and evaluation of their accuracies. For the vast majority of dipolar couplings, the error is found to be less than +/-3% of their possible range, indicating that the measurement accuracy is not limiting when using these couplings as restraints in structure calculations. Reported isotropic values of the one- and two-bond J couplings cluster very tightly for each type of nucleotide.

  9. Data of evolutionary structure change: 1D3AB-1LLDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D3AB-1LLDA 1D3A 1LLD B A -TKVSVVGAAGTVGAAAGYNIALRDIADEVVFVDIPDKE...PNAIYMLITNPVDIATHVAQKLTGLPENQIFGSGTNLDSARLRFLIAQQTGVNVKNVHAYIAGEHGDSEVPLWESATIGGVPMSDWTPLPGHDPLDADKREEIHQEVK... 1LLD A 1LLDA...> 1 1LLD A 1LLDA

  10. From nonfinite to finite 1D arrays of origami tiles.

    Science.gov (United States)

    Wu, Tsai Chin; Rahman, Masudur; Norton, Michael L

    2014-06-17

    average solution structures for blocks is more readily achieved using computer models than using direct imaging methods. The development of scalable 1D-origami arrays composed of uniquely addressable components is a logical, if not necessary, step in the evolution of higher order fully addressable structures. Our research into the fabrication of arrays has led us to generate a listing of several important areas of future endeavor. Of high importance is the re-enforcement of the mechanical properties of the building blocks and the organization of multiple arrays on a surface of technological importance. While addressing this short list of barriers to progress will prove challenging, coherent development along each of these lines of inquiry will accelerate the appearance of commercial scale molecular manufacturing.

  11. Data of evolutionary structure change: 1D0GD-2RJLA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D0GD-2RJLA 1D0G 2RJL D A PQRVAAHITGTRGEKALGRKINSWESSRSGHSFLS-NLH...LRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTS-YPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDM-DHEASFFGAFLVG GD...KPRAHLTVVRQTPTQFPALHWEHEL--GLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRG--------MKPDSITVVITKVTDS...YPEPTQLLMGTKSVS-EVG-SNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL- ...D0G D 1D0GD HSFLS-NLHLR

  12. Two-dimensional refractive index and birefringence profiles of a graded index bent optical fibre

    Science.gov (United States)

    Ramadan, W. A.; Wahba, H. H.; Shams El-Din, M. A.

    2017-07-01

    A theory to recover refractive index profile of the bent graded index (GRIN) optical fibre, in core region, is proposed. This theory is applied to the bent GRIN optical fibre when it is located orthogonal in the light path of the object arm in digital holographic phase shifting interferometer; like Mach-Zehnder interferometer. In the experiment, the fibre is bent with two different bending radii and fixed on a microscope slide keeping it immersed in matching liquid. The produced phase shifted holograms, with the presence of the fibre, are recorded using an attached CCD camera. Two different processes controlling the index profile shape of the bent GRIN optical fibre are assumed. In the first process, a linear index variation is evolved from stresses in the direction of the bent radius. In the second one, there is a release of these stresses near the fibre surface, which depends on the fibre's radius. This will affect the outer free surface of the cladding. Based on these assumptions, we are able to construct the index profile in two dimensions normal to the optical axis. We propose two functions to describe the refractive index profiles in cladding and the core regions of the bent GRIN optical fibre. The recorded phase shifted holograms are combined, reconstructed and analyzed to get the phase map of the bent GRIN optical fibre. Comparing the extracted optical phase differences with the calculated ones, a good agreement between them is found. This means that the used two dimensional proposed functions, which are describing cladding and the core indices profiles, are the most proper in this situation. Thus, we are able to determine a realistic induced birefringence profile inside the fibre which is generated by a bending operation, not only in the cladding but also in graded index core region as well.

  13. Analysis of the rotational structure in the high-resolution infrared spectra of trans-hexatriene-1,1-d2 and -cis-1-d1

    Science.gov (United States)

    Craig, Norman C.; Fuson, Hannah A.; Tian, Hengfeng; Blake, Thomas A.

    2012-09-01

    Mixtures of trans-hexatriene-1,1-d2, -cis-1-d1, and -trans-1-d1 have been synthesized. Anharmonic frequencies and harmonic intensities were predicted with the B3LYP/cc-pVTZ model for the out-of-plane (a″) modes of the three isotopologues. Assignments are proposed for most of the a″ vibrational modes above 500 cm-1. Ground state (GS) rotational constants have been determined for the 1,1-d2 and cis-1-d1 species from the analysis of rotational structure of C-type bands in the high-resolution (0.0015 cm-1) infrared spectra in a mixture of the three isotopologues. The GS constants for the 1,1-d2 species are A0 = 0.8018850(6), B0 = 0.0418540(6), and C0 = 0.0397997(4) cm-1. The GS constants for the cis-1-d1 species are A0 = 0.809388(1), B0 = 0.043532(2), and C0 = 0.041320(1) cm-1. Small inertial defects confirm planarity for both species. These ground state rotational constants are intended for use in determining a semiexperimental equilibrium structure and evaluating the influence of chain length on π-electron delocalization in polyenes.

  14. Linear birefringence and dichroism measurement in oil-based Fe{sub 3}O{sub 4} magnetic nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Jing-Fung, E-mail: jacklin@cc.feu.edu.tw [Graduate School of Computer Application Engineering, Far East University, Tainan 74448, Taiwan (China); Wang, Chia-Hung [Department of Automation and Control Engineering, Far East University, Tainan 74448, Taiwan (China); Lee, Meng-Zhe [Graduate School of Computer Application Engineering, Far East University, Tainan 74448, Taiwan (China)

    2013-04-15

    To prepare dispersed Fe{sub 3}O{sub 4} magnetic nanoparticles (MNPs), we adopt a co-precipitation method and consider surfactant amount, stirring speed, dispersion mode, and molar ratio of Fe{sup 3+}/Fe{sup 2+}. Via transmission electronic microscopy and X-ray diffractometry, we characterize the dispersibility and size of the products and determine the appropriate values of experimental parameters. The stirring speed is 1000 rpm in titration. There is simultaneous ultrasonic vibration and mechanical stirring in the titration and surface coating processes. The surfactant amount of oleic acid is 1.2 ml for molar ratios of Fe{sup 3+}/Fe{sup 2+} as 1.7:1, 1.8:1, and 1.9:1. The average diameters of these Fe{sub 3}O{sub 4} MNPs are 11 nm, and the ratios of saturation magnetization for these MNPs to that of bulk magnetite range from 45% to 65%, with remanent magnetization close to zero and low coercivity. Above all, the linear birefringence and dichroism measurements of the kerosene-based ferrofluid (FF) samples are investigated by a Stokes polarimeter. The influences of particle size distribution and magnetization in the birefringence and dichroism measurements of FFs are discussed. - Highlights: ► Dispersed Fe{sub 3}O{sub 4} magnetic nanoparticles (MNPs) are produced by a co-precipitation method. ► Simultaneous ultrasonic vibration and mechanical stirring are used in titration and coating. ► Diameters of Fe{sub 3}O{sub 4} MNPs are determined as 11 nm with maximum magnetization as 54.27 emu/g. ► Birefringence and dichroism of ferrofluids are obtained by a Stokes polarimeter successfully.

  15. Dark soliton interaction in optical time division multiplexed system with randomly varying birefringence and random dispersion map

    Institute of Scientific and Technical Information of China (English)

    Hong Li(李宏); Tiejun Wang(王铁军); Dexiu Huang(黄德修)

    2004-01-01

    Correlated perturbations caused by both randomly varying birefringence and random dispersion map are considered in optical time division multiplexed dispersion-managed dark soliton system, and their effects on soliton interaction are investigated numerically. These perturbations enhance soliton interaction, and their effects relate to the strength of perturbation, separation, and pulse width. The correlation plays an important role and reinforces these effects. Moreover, there is a stochastic limit between two perturbations in the system, where the effect is the largest and the corresponding interaction distance is the shortest.

  16. Temperature behavior of thermal expansion and birefringence of In x Tl1- x I-substitution solid solutions

    Science.gov (United States)

    Franiv, A. V.; Stadnyk, V. Y.; Kashuba, A. I.; Brezvin, R. S.; Bovgira, O. V.; Futei, A. V.

    2017-07-01

    Results of studying the optical properties of In x Tl1- x I solid solutions in the concentration domain of 0.4 ≤ x ≤ 0.9 are presented. The dependence of relative linear expansion of In x Tl1- x I crystals ( T = 300-520 K) has been obtained. In x Tl1- x I crystals ( T = 300-520 K). Based on this, the temperature dependence of thermal-expansion coefficient α has been found. Dependence of birefringence Δ n i on temperature and concentration of the TlI component in the solid solution has been studied.

  17. Few-cycle solitons in the medium with permanent dipole moment under conditions of the induced birefringence

    Science.gov (United States)

    Sazonov, S. V.

    2016-12-01

    Propagation of electromagnetic pulse in the birefringent medium consisting of symmetric and asymmetrical molecules is investigated. Stationary quantum states of asymmetrical molecules have the permanent dipole moment. Under considered conditions the ordinary pulse component excites quantum transitions between stationary states. The extraordinary component, besides, causes a dynamic chirp of frequencies of these transitions. The new solitonic modes of propagation of the half- and single-period pulses are found. The solitonic mechanism of simultaneous generation of the second and zero harmonics in the modes of "bright" and "dark" solitons is analyzed.

  18. Electrical induction and optical erasure of birefringence in the isotropic liquid phase of a dichiral azobenzene liquid-crystalline compound (Presentation Recording)

    Science.gov (United States)

    Yamamoto, Takahiro; Nishiyama, Isa

    2015-10-01

    Liquid crystal is a representative soft matter, which has physical properties between those of conventional liquid and those of crystal in a temperature range above a melting point. A liquid-crystal display (LCD) employs the response of the liquid-crystal alignment to the electric field and is a key device of an information display. For common LCDs, the precise control of the initial alignment of LC molecules is needed so that a good dark state, thus a high contrast ratio, can be obtained. If the birefringence can be induced in the liquid phase by the application of electric field, it is of great use as a material for the LCD application. In this study, we will report a unique property of dichiral azobenzene liquid crystals: an electric induction of birefringence in a liquid phase of an antiferroelectric dichiral azobenzene liquid crystal. The optically isotropic texture changes into the homogenous birefringent texture by the application of the in-plane electric field above the clearing temperature of the liquid crystal. We find that one of the possible reasons of the induction of the birefringence in the isotropic phase is the electrically-induced increase of the phase transition temperature between the antiferroelectric liquid-crystalline and "liquid" phases, i.e., increase in the clearing temperature. The resulting birefringence can be disappeared by the irradiation of UV light, due to the photoinduced isomerization of the azobenzene compound, thus dual control of the birefringent structure, by the irradiation of light and/or by the application of the electric field, is achieved.

  19. Acute exercise and physiological insulin induce distinct phosphorylation signatures on TBC1D1 and TBC1D4 in human skeletal muscle

    DEFF Research Database (Denmark)

    Treebak, Jonas Thue; Pehmøller, Christian; Kristensen, Jonas Møller

    2014-01-01

    We investigated the phosphorylation signatures of two Rab GTPase activating proteins TBC1D1 and TBC1D4 in human skeletal muscle in response to physical exercise and physiological insulin levels induced by a carbohydrate rich meal using a paired experimental design. Eight healthy male volunteers...... in response to physiological stimuli in human skeletal muscle and support the idea that Akt and AMPK are upstream kinases. TBC1D1 phosphorylation signatures were comparable between in vitro contracted mouse skeletal muscle and exercised human muscle, and we show that AMPK was regulating phosphorylation...... of these sites in mouse muscle. Contraction and exercise elicited a different phosphorylation pattern of TBC1D4 in mouse compared with human muscle, and although different circumstances in our experimental setup may contribute to this difference, the observation exemplifies that transferring findings between...

  20. Zerumbone modulates CD1d expression and lipid antigen presentation pathway in breast cancer cells.

    Science.gov (United States)

    Shyanti, Ritis K; Sehrawat, Anuradha; Singh, Shivendra V; Mishra, J P N; Singh, Rana P

    2017-10-01

    Natural Killer T (NKT) cells based cancer immunotherapy is an evolving area of cancer therapy, but tumors escape from this treatment modality by altering CD1d expression and its antigen presentation pathway. Here, we have studied the relation of CD1d expression in various breast cancer cell lines to their viability and progression. We observed a novel phenomenon that CD1d expression level increases with the progressive stage of the cancer. A small molecule, zerumbone (ZER) caused down-regulation of CD1d that was accompanied by breast cancer cell growth in vitro. The growth inhibitory effect of ZER against breast cancer cells was augmented by treatment with anti-CD1d mAb. This effect was mediated by G1-phase cell cycle arrest and apoptosis induction coupled with an increase in mitochondrial membrane depolarization. CD1d expression and cell proliferation were inhibited by both CD1d siRNA and ZER. The α-galactosylceramide, a ligand for CD1d, showed increased CD1d expression as well as cell proliferation which was opposite to the effects of ZER. This study shows that, CD1d overexpression is associated with the progressive stages of breast cancer and ZER could be an adjuvant to potentiate cancer immunotherapy. Copyright © 2017. Published by Elsevier Ltd.

  1. Model and Simulation of a Tunable Birefringent Fiber Using Capillaries Filled with Liquid Ethanol for Magnetic Quasiphase Matching In-Fiber Isolator

    Directory of Open Access Journals (Sweden)

    Clint Zeringue

    2010-01-01

    Full Text Available A technique to tune a magnetic quasi-phase matching in-fiber isolator through the application of stress induced by two mutually orthogonal capillary tubes filled with liquid ethanol is investigated numerically. The results show that it is possible to “tune” the birefringence in these fibers over a limited range depending on the temperature at which the ethanol is loaded into the capillaries. Over this tuning range, the thermal sensitivity of the birefringence is an order-of-magnitude lower than conventional fibers, making this technique well suited for magnetic quasi-phase matching.

  2. Mueller matrix analysis for all optical fiber co-existence of birefringence-polarization dependent gain-mode coupling at a single wavelength

    Institute of Scientific and Technical Information of China (English)

    Shang Chio; Wu Chong-Qing; Li Zheng-Yong; Yang Shuang-Shou; Gao Kai-Qiang; Yu Kuang-Lu; Feng Zhen

    2011-01-01

    Birefringence (polarization-related phase-shift),polarization dependent gain (PDG) and mode coupling are three factors that may synchronously influence the transmission of single-wavelength polarized light in optical fibers.This paper obtains a new Mueller matrix analysis,which can be used under conditions that all these three factors are existing and changing.According to our transmission model,the state of polarization (SOP) changes along an optical microstructure fiber with co-existence of birefringence-PDG-mode coupling were simulated. The simulated results,which show the phenomena of SOP constringency,are in good agreement with previous theoretical analyses.

  3. Wide-field imaging of birefringent synovial fluid crystals using lens-free polarized microscopy for gout diagnosis

    Science.gov (United States)

    Zhang, Yibo; Lee, Seung Yoon Celine; Zhang, Yun; Furst, Daniel; Fitzgerald, John; Ozcan, Aydogan

    2016-06-01

    Gout is a form of crystal arthropathy where monosodium urate (MSU) crystals deposit and elicit inflammation in a joint. Diagnosis of gout relies on identification of MSU crystals under a compensated polarized light microscope (CPLM) in synovial fluid aspirated from the patient’s joint. The detection of MSU crystals by optical microscopy is enhanced by their birefringent properties. However, CPLM partially suffers from the high-cost and bulkiness of conventional lens-based microscopy, and its relatively small field-of-view (FOV) limits the efficiency and accuracy of gout diagnosis. Here we present a lens-free polarized microscope which adopts a novel differential and angle-mismatched polarizing optical design achieving wide-field and high-resolution holographic imaging of birefringent objects with a color contrast similar to that of a standard CPLM. The performance of this computational polarization microscope is validated by imaging MSU crystals made from a gout patient’s tophus and steroid crystals used as negative control. This lens-free polarized microscope, with its wide FOV (>20 mm2), cost-effectiveness and field-portability, can significantly improve the efficiency and accuracy of gout diagnosis, reduce costs, and can be deployed even at the point-of-care and in resource-limited clinical settings.

  4. Design of a birefringent Michelson interferometer-based interleaver with ultra-low dispersion and low cost.

    Science.gov (United States)

    Hu, Haocheng; Zheng, Baozhong; Liu, Qingming; Li, Yang; Wu, Li; Gu, Shijie

    2011-11-21

    We design and demonstrate a birefringent Michelson interferometer based interleaver with ultra-low dispersion and low cost. The interleaver consists of polarizing beam splitters (PBS's) and quarter-wave plates and half-wave plates. The PBS's based Michelson interferometers provide the optical path difference for interference between the two orthogonal polarization components and the half-wave plates provide the birefringent needed to minimize ripple of output. The designed interleaver with two-stage interferometer in a 50 GHz channel spacing application exhibits a 0.5 dB passband and a 25 dB stopband both 27 GHz; a channel isolation higher than 35 dB and chromatic dispersion less than ±5 ps/nm within 0.5 dB passband; 1.3 dB insertion loss and 0.3 dB PDL; 0.04 GHz/°C thermal stability. Since all of the optical components can be optically bonded together, the device is robust and easy to be aligned, which reduces labor cost.

  5. Ultrafast, low-power, all-optical switching via birefringent phase-matched transverse mode conversion in integrated waveguides.

    Science.gov (United States)

    Hellwig, Tim; Epping, Jörn P; Schnack, Martin; Boller, Klaus-J; Fallnich, Carsten

    2015-07-27

    We demonstrate the potential of birefringence-based, all-optical, ultrafast conversion between the transverse modes in integrated optical waveguides by modelling the conversion process by numerically solving the multi-mode coupled nonlinear Schroedinger equations. The observed conversion is induced by a control beam and due to the Kerr effect, resulting in a transient index grating which coherently scatters probe light from one transverse waveguide mode into another. We introduce birefringent phase matching to enable efficient all-optically induced mode conversion at different wavelengths of the control and probe beam. It is shown that tailoring the waveguide geometry can be exploited to explicitly minimize intermodal group delay as well as to maximize the nonlinear coefficient, under the constraint of a phase matching condition. The waveguide geometries investigated here, allow for mode conversion with over two orders of magnitude reduced control pulse energy compared to previous schemes and thereby promise nonlinear mode switching exceeding efficiencies of 90% at switching energies below 1 nJ.

  6. The Rab-GTPase-activating protein TBC1D1 regulates skeletal muscle glucose metabolism

    DEFF Research Database (Denmark)

    Szekeres, Ferenc; Chadt, Alexandra; Tom, Robby Z

    2012-01-01

    The Rab-GTPase-activating protein TBC1D1 has emerged as a novel candidate involved in metabolic regulation. Our aim was to determine whether TBC1D1 is involved in insulin as well as energy-sensing signals controlling skeletal muscle metabolism. TBC1D1-deficient congenic B6.SJL-Nob1.10 (Nob1.10(SJL...... be explained partly by a 50% reduction in GLUT4 protein, since proximal signaling at the level of Akt, AMPK, and acetyl-CoA carboxylase (ACC) was unaltered. Paradoxically, in vivo insulin-stimulated 2-deoxyglucose uptake was increased in EDL and tibialis anterior muscle from TBC1D1-deficient mice....... In conclusion, TBC1D1 plays a role in regulation of glucose metabolism in skeletal muscle. Moreover, functional TBC1D1 is required for AICAR- or contraction-induced metabolic responses, implicating a role in energy-sensing signals....

  7. Expression of CD1d protein in human testis showing normal and abnormal spermatogenesis.

    Science.gov (United States)

    Adly, Mohamed A; Abdelwahed Hussein, Mahmoud-Rezk

    2011-05-01

    CD1d is a member of CD1 family of transmembrane glycoproteins, which represent antigen-presenting molecules. Immunofluorescent staining methods were utilized to examine expression pattern of CD1d in human testicular specimens. In testis showing normal spermatogenesis, a strong CD1d cytoplasmic expression was seen the Sertoli cells, spermatogonia, and Leydig cells. A moderate expression was observed in the spermatocytes. In testes showing maturation arrest, CD1d expression was strong in the Sertoli cells and weak in spermatogonia and spermatocytes compared to testis with normal spermatogenesis. In Sertoli cell only syndrome, CD1d expression was strong in the Sertoli and Leydig cells. This preliminary study displayed testicular infertility-related changes in CD1d expression. The ultrastructural changes associated with with normal and abnormal spermatogenesis are open for further investigations.

  8. TBC1D24 genotype-phenotype correlation: Epilepsies and other neurologic features

    OpenAIRE

    Balestrini, S; Milh, M.; Castiglioni, C.; Lüthy, K.; Finelli, M. J.; Verstreken, P.; Cardon, A; Stražišar, B. G.; Holder, J. L.; Lesca, G; Mancardi, M. M.; Poulat, A. L.; Repetto, G. M.; Banka, S.; Bilo, L.

    2016-01-01

    Objective: To evaluate the phenotypic spectrum associated with mutations in TBC1D24. Methods: We acquired new clinical, EEG, and neuroimaging data of 11 previously unreported and 37 published patients. TBC1D24 mutations, identified through various sequencing methods, can be found online (http://lovd.nl/TBC1D24). Results: Forty-eight patients were included (28 men, 20 women, average age 21 years) from 30 independent families. Eighteen patients (38%) had myoclonic epilepsies. The other patients...

  9. Examination of 1D Solar Cell Model Limitations Using 3D SPICE Modeling: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    McMahon, W. E.; Olson, J. M.; Geisz, J. F.; Friedman, D. J.

    2012-06-01

    To examine the limitations of one-dimensional (1D) solar cell modeling, 3D SPICE-based modeling is used to examine in detail the validity of the 1D assumptions as a function of sheet resistance for a model cell. The internal voltages and current densities produced by this modeling give additional insight into the differences between the 1D and 3D models.

  10. The Planar Sandwich and Other 1D Planar Heat Flow Test Problems in ExactPack

    Energy Technology Data Exchange (ETDEWEB)

    Singleton, Jr., Robert [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-01-24

    This report documents the implementation of several related 1D heat flow problems in the verification package ExactPack [1]. In particular, the planar sandwich class defined in Ref. [2], as well as the classes PlanarSandwichHot, PlanarSandwichHalf, and other generalizations of the planar sandwich problem, are defined and documented here. A rather general treatment of 1D heat flow is presented, whose main results have been implemented in the class Rod1D. All planar sandwich classes are derived from the parent class Rod1D.

  11. Tunable Design of Structural Colors Produced by Pseudo-1D Photonic Crystals of Graphene Oxide.

    Science.gov (United States)

    Tong, Liping; Qi, Wei; Wang, Mengfan; Huang, Renliang; Su, Rongxin; He, Zhimin

    2016-07-01

    It is broadly observed that graphene oxide (GO) films appear transparent with a thickness of about several nanometers, whereas they appear dark brown or almost black with thickness of more than 1 μm. The basic color mechanism of GO film on a sub-micrometer scale, however, is not well understood. This study reports on GO pseudo-1D photonic crystals (p1D-PhCs) exhibiting tunable structural colors in the visible wavelength range owing to its 1D Bragg nanostructures. Striking structural colors of GO p1D-PhCs could be tuned by simply changing either the volume or concentration of the aqueous GO dispersion during vacuum filtration. Moreover, the quantitative relationship between thickness and reflection wavelength of GO p1D-PhCs has been revealed, thereby providing a theoretical basis to rationally design structural colors of GO p1D-PhCs. The spectral response of GO p1D-PhCs to humidity is also obtained clearly showing the wavelength shift of GO p1D-PhCs at differently relative humidity values and thus encouraging the integration of structural color printing and the humidity-responsive property of GO p1D-PhCs to develop a visible and fast-responsive anti-counterfeiting label. The results pave the way for a variety of potential applications of GO in optics, structural color printing, sensing, and anti-counterfeiting.

  12. Analysis of Rotational Structure in the High-Resolution Infrared Spectra of the TRANS-HEXATRIENE-1,1-D2 and -CIS-1-D1 Species

    Science.gov (United States)

    Craig, Norman C.; Fuson, Hannah A.; Tian, Hengfeng; Blake, Thomas A.

    2011-06-01

    Hexatriene-1,1-D2 with some admixture of the cis-1-D1 and trans-1-D1 species was synthesized by reaction of 2,4-pentadienal and (methyl-D3)-triphenylphosphonium iodide (Wittig reagent). The trans isomer was isolated by preparative gas chromatography, and the high-resolution (0.0015 Cm-1) infrared spectrum was recorded on a Bruker IFS 125HR instrument. The rotational structure in two C-type bands for the 1,1-D2 species was analyzed. For this species the bands at 902.043 and 721.864 Cm-1 yielded composite ground state rotational constants of A0 = 0.801882(1), B0 = 0.041850(2), and C0 = 0.039804(1) Cm-1. For the cis-1-D1 species the C-type band at 803.018 Cm-1 gave A0 = 0.809384(2), B0 = 0.043530(3), and C0 = 0.041321(2) Cm-1. By iodine-catalyzed isomerization, we have obtained some of the much less favored cis isomer and hope to obtain microwave spectra for its three deuterium-substituted species. The rotational constants reported here contribute to data needed for determining a semi-experimental structure for trans-hexatriene, which should show that the structural consequences of pi-electron delocalization increase with the chain length of polyenes.

  13. Mapping of the serotonin 5-HT{sub 1D{alpha}} autoreceptor gene (HTR1D) on chromosome 1 using a silent polymorphism in the coding region

    Energy Technology Data Exchange (ETDEWEB)

    Ozaki, N.; Lappalainen, J.; Linnoila, M. [National Institute on Alcohol Abuse and Alcoholism, Rockville, MD (United States)] [and others

    1995-04-24

    Serotonin (5-HT){sub ID} receptors are 5-HT release-regulating autoreceptors in the human brain. Abnormalities in brain 5-HT function have been hypothesized in the pathophysiology of various psychiatric disorders, including obsessive-compulsive disorder, autism, mood disorders, eating disorders, impulsive violent behavior, and alcoholism. Thus, mutations occurring in 5-HT autoreceptors may cause or increase the vulnerability to any of these conditions. 5-HT{sub 1D{alpha}} and 5-HT{sub 1D{Beta}} subtypes have been previously localized to chromosomes 1p36.3-p34.3 and 6q13, respectively, using rodent-human hybrids and in situ localization. In this communication, we report the detection of a 5-HT{sub 1D{alpha}} receptor gene polymorphism by single strand conformation polymorphism (SSCP) analysis of the coding sequence. The polymorphism was used for fine scale linkage mapping of 5-HT{sub 1D{alpha}} on chromosome 1. This polymorphism should also be useful for linkage studies in populations and in families. Our analysis also demonstrates that functionally significant coding sequence variants of the 5-HT{sub 1D{alpha}} are probably not abundant either among alcoholics or in the general population. 14 refs., 1 fig., 1 tab.

  14. Potent neutralizing anti-CD1d antibody reduces lung cytokine release in primate asthma model.

    Science.gov (United States)

    Nambiar, Jonathan; Clarke, Adam W; Shim, Doris; Mabon, David; Tian, Chen; Windloch, Karolina; Buhmann, Chris; Corazon, Beau; Lindgren, Matilda; Pollard, Matthew; Domagala, Teresa; Poulton, Lynn; Doyle, Anthony G

    2015-01-01

    CD1d is a receptor on antigen-presenting cells involved in triggering cell populations, particularly natural killer T (NKT) cells, to release high levels of cytokines. NKT cells are implicated in asthma pathology and blockade of the CD1d/NKT cell pathway may have therapeutic potential. We developed a potent anti-human CD1d antibody (NIB.2) that possesses high affinity for human and cynomolgus macaque CD1d (KD ∼100 pM) and strong neutralizing activity in human primary cell-based assays (IC50 typically <100 pM). By epitope mapping experiments, we showed that NIB.2 binds to CD1d in close proximity to the interface of CD1d and the Type 1 NKT cell receptor β-chain. Together with data showing that NIB.2 inhibited stimulation via CD1d loaded with different glycolipids, this supports a mechanism whereby NIB.2 inhibits NKT cell activation by inhibiting Type 1 NKT cell receptor β-chain interactions with CD1d, independent of the lipid antigen in the CD1d antigen-binding cleft. The strong in vitro potency of NIB.2 was reflected in vivo in an Ascaris suum cynomolgus macaque asthma model. Compared with vehicle control, NIB.2 treatment significantly reduced bronchoalveolar lavage (BAL) levels of Ascaris-induced cytokines IL-5, IL-8 and IL-1 receptor antagonist, and significantly reduced baseline levels of GM-CSF, IL-6, IL-15, IL-12/23p40, MIP-1α, MIP-1β, and VEGF. At a cellular population level NIB.2 also reduced numbers of BAL lymphocytes and macrophages, and blood eosinophils and basophils. We demonstrate that anti-CD1d antibody blockade of the CD1d/NKT pathway modulates inflammatory parameters in vivo in a primate inflammation model, with therapeutic potential for diseases where the local cytokine milieu is critical.

  15. Utility of birefringence changes due to collagen thermal denaturation rate process analysis: vessel wall temperature estimation for new short term heating balloon angioplasty

    Science.gov (United States)

    Kaneko, Kenji; Shimazaki, Natsumi; Gotoh, Maya; Nakatani, Eriko; Arai, Tsunenori

    2007-02-01

    Our photo thermal reaction heating architecture balloon realizes less than 10 s short term heating that can soften vessel wall collagen without damaging surrounding tissue thermally. New thermal balloon angioplasty, photo-thermo dynamic balloon angioplasty (PTDBA) has experimentally shown sufficient opening with 2 atm low pressure dilation and prevention of chronic phase restenosis and acute phase thrombus in vivo. Even though PTDBA has high therapeutic potential, the most efficient heating condition is still under study, because relationship of treatment and thermal dose to vessel wall is not clarified yet. To study and set the most efficient heating condition, we have been working on establishment of temperature history estimation method from our previous experimental results. Heating target of PTDBA, collagen, thermally denatures following rate process. Denaturation is able to be quantified with measured collagen birefringence value. To express the denaturation with equation of rate process, the following ex vivo experiments were performed. Porcine extracted carotid artery was soaked in two different temperature saline baths to enforce constant temperature heating. Higher temperature bath was set to 40 to 80 degree Celsius and soaking duration was 5 to 40 s. Samples were observed by a polarizing microscope and a scanning electron microscope. The birefringence was measured by polarizing microscopic system using Brace-Koehler compensator 1/30 wavelength. The measured birefringence showed temperature dependency and quite fit with the rate process equation. We think vessel wall temperature is able to be estimated using the birefringence changes due to thermal denaturation.

  16. Data of evolutionary structure change: 1B99C-2AZ1D [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available GSDS--VESAN >E --HHHHH> ATOM 316...>D 2AZ1D HGSDHEDEGANE >E HHH...pdbID>1B99 C 1B99C EELLT-EVKPN ...> - > ATOM 3319 CA GLU C 141 17.330 5.755...DChain>2AZ1D DELVDWDRDAS re>GG EEGGHcture

  17. A rational route to SCM materials based on a 1-D cobalt selenocyanato coordination polymer.

    Science.gov (United States)

    Boeckmann, Jan; Näther, Christian

    2011-07-07

    Thermal annealing of a discrete complex with terminal SeCN anions and monodentate coligands enforces the formation of a 1D cobalt selenocyanato coordination polymer that shows slow relaxation of the magnetization. Therefore, this approach offers a rational route to 1D materials that might show single chain magnetic behaviour.

  18. Data of evolutionary structure change: 1D07A-2PSEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D07A-2PSEA 1D07 2PSE A A ---------GA----KPFGEKKFIEIKGRRMAYIDEGTG...MPI-EWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGT-PADVVAIARDYAGWLSESP-IPKLF...entryChain> 2PSE A 2PSEA VAL CA 328 2PSE A 2PSEA...dbChain> 2PSEA LRASDDLPKLF HH EEE

  19. Quasiperiodicity and 2D topology in 1D charge-ordered materials

    NARCIS (Netherlands)

    Flicker, F.; van Wezel, J.

    2015-01-01

    The mathematical description of 1D quasicrystals has recently been linked to that of 2D quantum Hall states. The topological classification of 1D quasicrystals and the corresponding interpretation of their observed charge transport have been widely discussed. We demonstrate the equivalence of both 1

  20. Data of evolutionary structure change: 1D7EA-1OTAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D7EA-1OTAA 1D7E 1OTA A A ---VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNI...ne>VAL CA 559 PHE CA 524 1OTA A 1OTAA KKALSGDSYWVF E EE...9981689453 7.820000171661377 tion> 0.8790000081062...1399 0.36500000953674316 -0.3330000042915344 -0.25200000405311584 -0.9089999794960022

  1. Molecular cloning, sequence analysis and pharmacological properties of the porcine 5-HT(1D) receptor.

    NARCIS (Netherlands)

    P.L. Bhalla (Pankaj); H.S. Sharma (Hari); T. Wurch (Thierry); P.J. Pauwels (Petrus); P.R. Saxena (Pramod Ranjan)

    2000-01-01

    textabstractA cDNA encoding the full-length 5-HT(1D) receptor derived from porcine cerebral cortex was amplified, cloned and sequenced, using guinea-pig 5-HT(1D) receptor coding sequence oligonucleotide primers in reverse transcription-polymerase chain reaction (RT - PC

  2. Data of evolutionary structure change: 1D5IL-2GJJA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1D5IL-2GJJA 1D5I 2GJJ L A -DIKMTQSPSSMYASLGERVTITCKASQDIN------SY... 219 ALA CA 310 SER CA 336 2GJJ A 2GJJA PEVVKTGASVK 5.283660888671875 1 2GJJ... A 2GJJA RLEIK----RGEVQ

  3. Data of evolutionary structure change: 1D5NC-1UNFX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available msd> 1.0891029834747314 EVID> 1 1UNF...1D5NC-1UNFX 1D5N 1UNF C X ----SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYV...NNANAALESL----PEFANLPVEELITKLDQLPADKKTVL---------RNNAGGHANHSLFWKGLKKGT--TLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGW...HH EVID> 0 TRP CA 380 1UNF X 1UNF

  4. Data of evolutionary structure change: 1D5ND-1UNFX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1.0915240049362183 EVID> 1 1UNF...1D5ND-1UNFX 1D5N 1UNF D X ----SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYV...NNANAALESL----PEFANLPVEELITKLDQLPADKKTVL---------RNNAGGHANHSLFWKGLKKGTT--LQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGW...H EVID> 0 TRP CA 379 1UNF X 1UNF

  5. Analysis of the interaction proteins of PIH1D1%与PIH1D1相互作用的蛋白分析

    Institute of Scientific and Technical Information of China (English)

    章元; 张业

    2016-01-01

    目的 分析细胞中与PIH1D1相互作用的蛋白.方法 构建稳定表达FLAG-HA双标签标记的PIH1D1蛋白的HEK293T细胞株,利用FLAG-HA串联亲和纯化(TAP)双标签纯化实验,对目的条带进行质谱分析.结果 成功构建稳定表达FLAG-HA双标签标记的PIH1D1细胞株.通过质谱分析得到了PIH1D1相互作用的蛋白数据,包括细胞质内RNA PolⅡ组装复合物成员RPAP3、UXT、PFD2和PFD6等,凋亡复合物成员MONAD/WDR92等,钙调蛋白信号通路中的PIP和CALM1以及代谢通路中的PKM和LCN1等.结论 PIH1D1与细胞中RPAP3、UXT、PFD2、PFD6、MONAD/WDR92、PIP、CALM1、PKM和LCN1等相互作用,提示PIH1D1可能参与细胞中RNApol Ⅱ组装、细胞凋亡、钙调蛋白通路等多种生理过程.

  6. Alternative spliced CD1d transcripts in human bronchial epithelial cells.

    Directory of Open Access Journals (Sweden)

    Kambez Hajipouran Benam

    Full Text Available CD1d is a MHC I like molecule which presents glycolipid to natural killer T (NKT cells, a group of cells with diverse but critical immune regulatory functions in the immune system. These cells are required for optimal defence against bacterial, viral, protozoan, and fungal infections, and control of immune-pathology and autoimmune diseases. CD1d is expressed on antigen presenting cells but also found on some non-haematopoietic cells. However, it has not been observed on bronchial epithelium, a site of active host defence in the lungs. Here, we identify for the first time, CD1D mRNA variants and CD1d protein expression on human bronchial epithelial cells, describe six alternatively spliced transcripts of this gene in these cells; and show that these variants are specific to epithelial cells. These findings provide the basis for investigations into a role for CD1d in lung mucosal immunity.

  7. Influence of lipid rafts on CD1d presentation by dendritic cells

    DEFF Research Database (Denmark)

    Peng, Wei; Martaresche, Cecile; Escande-Beillard, Nathalie

    2011-01-01

    corresponding to lipid rafts and we describe that alpha-GalCer enhanced CD1d amount in the low density detergent insoluble fraction. We conclude that the membrane environment of CD1d can influence antigen presentation mainly when the endocytic pathway is required. Flow cytometry analysis can provide additional...... information on lipid rafts in plasma membranes and allows a dynamics follow-up of lipid rafts partitioning. Using this method, we showed that CD1d plasma membrane expression was sensitive to low concentrations of detergent. This may suggest either that CD1d is associated with lipid rafts mainly......Our main objective was to analyze the role of lipid rafts in the activation of Valpha-14(-) and Valpha-14(+) T hybridomas by dendritic cells. We showed that activation of Valpha-14(+) hybridomas by dendritic cells or other CD1d-expressing cells was altered by disruption of lipid rafts...

  8. Tctex1d2 Is a Negative Regulator of GLUT4 Translocation and Glucose Uptake.

    Science.gov (United States)

    Shimoda, Yoko; Okada, Shuichi; Yamada, Eijiro; Pessin, Jeffrey E; Yamada, Masanobu

    2015-10-01

    Tctex1d2 (Tctex1 domain containing 2) is an open reading frame that encodes for a functionally unknown protein that contains a Tctex1 domain found in dynein light chain family members. Examination of gene expression during adipogenesis demonstrated a marked increase in Tctex1d2 protein expression that was essentially undetectable in preadipocytes and markedly induced during 3T3-L1 adipocyte differentiation. Tctex1d2 overexpression significantly inhibited insulin-stimulated glucose transporter 4 (GLUT4) translocation and 2-deoxyglucose uptake. In contrast, Tctex1d2 knockdown significantly increased insulin-stimulated GLUT4 translocation and 2-deoxyglucose uptake. However, acute insulin stimulation (up to 30 min) in 3T3-L1 adipocytes with overexpression or knockdown of Tctex1d2 had no effect on Akt phosphorylation, a critical signal transduction target required for GLUT4 translocation. Although overexpression of Tctex1d2 had no significant effect on GLUT4 internalization, Tctex1d2 was found to associate with syntaxin 4 in an insulin-dependent manner and inhibit Doc2b binding to syntaxin 4. In addition, glucose-dependent insulinotropic polypeptide rescued the Tctex1d2 inhibition of insulin-stimulated GLUT4 translocation by suppressing the Tctex1d2-syntaxin 4 interaction and increasing Doc2b-Synatxin4 interactions. Taking these results together, we hypothesized that Tctex1d2 is a novel syntaxin 4 binding protein that functions as a negative regulator of GLUT4 plasma membrane translocation through inhibition of the Doc2b-syntaxin 4 interaction.

  9. A Note on the Analysis of Electrodynamic Fields Radiated by Time-Harmonic Sources Within Non-Birefringent Anisotropic Media

    CERN Document Server

    Sainath, Kamalesh

    2015-01-01

    We address a challenge concerning the spectral-domain-based analysis of electromagnetic fields produced by time-harmonic current sources within planar-layered media, which arises specifically when sources are embedded inside non-birefringent anisotropic medium (NBAM) layers. In NBAM, the highly symmetric permeability and permittivity tensors can induce directionally-dependent, but polarization independent, propagation properties supporting "degenerate" characteristic polarizations. That is to say, the considered NBAM support four linearly independent field polarization eigenvectors associated with only two (rather than four) unique, non-defective eigenvalues. We explain problems that can arise when the source(s) specifically reside within NBAM planar layers when using canonical field expressions as well as obtain alternative expressions, immune to such problems, that form the foundation for a robust eigenfunction-based analysis of electromagnetic radiation and scattering within planar-layered media.

  10. Precision Controlling of Frequency Difference for Elastic-Stress Birefringence He-Ne Dual-Frequency Lasers

    Institute of Scientific and Technical Information of China (English)

    ZHOU Lu-Fei; ZHANG Shu-Lian; GUO Hong; REN Zhou

    2007-01-01

    Birefringence-Zeeman dual frequency lasers are capable of producing frequency difference from several kilohertz to hundreds of megahertz, but the precision of giving and stabilizing of the beat frequency still needs improvement to the range of ±200 kHz. We design a new elastic force-exerting device comprised of the bottom part, two arms and two pieces of force-exerting sheets. The frequency difference smoothly tuning is realized with this device in a large range of 2 MHz to 20 MHz. Power-balance frequency stabilization system is used to investigate characters of the temperature, frequency difference and laser power. The precision of the frequency difference has reach up to JrlOO kHz after system temperature balance. Analyses of the laser frequency difference and power character are carried out.

  11. High-birefringence photonic crystal fiber Michelson interferometer with cascaded fiber Bragg grating for pressure and temperature discrimination

    Science.gov (United States)

    Tan, Xiaoling; Geng, Youfu; Li, Xuejin

    2016-09-01

    A simple and compact interferometer for temperature and pressure discrimination is proposed and demonstrated experimentally. It consists of a short section of high-birefringence photonic crystal fiber (Hi-Bi PCF) and a cascaded fiber Bragg grating (FBG). In the Hi-Bi PCF, two orthogonal polarized modes are employed as optical arms to construct, such as a Michelson interferometer. Combined with a cascaded FBG, pressure and temperature measurements are discriminated by a matrix method, and the pressure sensitivity of Hi-Bi PCF is determined to be around 3.65 nm/MPa. The proposed Michelson interferometer is easy-to-fabricate, flexible, and low-cost, which shows great potential in future applications of remote sensing.

  12. Polarized supercontinuum in birefringent photonic crystal fibre pumped at 1064 nm and application to tuneable visible/UV generation.

    Science.gov (United States)

    Xiong, C; Wadsworth, W J

    2008-02-18

    We generate a flat, polarized and single mode supercontinuum (SC) spanning 450-1750 nm in a highly birefringent photonic crystal fibre (PCF) pumped by a 1064 nm microchip laser. More than 99% of the total power is kept in a single linear polarization. The measured power coupling penalty due to the elliptical core is less than 6% (0.25 dB). As one of its applications, we demonstrate tuneable visible/UV generation in the nonlinear crystal BIBO pumped by this polarized SC source. A tuneable range of 400-525 nm is obtained by critical phase matching in BIBO. We also show the results of visible/UV generation in BIBO pumped by the signal wavelength of polarized four-wave mixing (FWM) in PCF.

  13. Generation of radially and azimuthally polarized beams in Yb:YAG laser with intra-cavity lens and birefringent crystal.

    Science.gov (United States)

    Thirugnanasambandam, Manasadevi P; Senatsky, Yuri; Ueda, Ken-ichi

    2011-01-31

    We demonstrated the operation of cw diode-pumped Yb:YAG laser in radial or azimuthal polarized (RP or AP) beams using a combination of birefringent uniaxial crystal (c-cut YVO4 or α-BBO) and lens as intra-cavity elements. RP and AP doughnut modes (M2 = 2-2.5, polarization extinction ratio 50-100:1) with output power up to 60 mW were generated. Apart from doughnut modes, RP or AP ring-like off-axis oscillations and multi-ring beams with mixed RP and AP were also observed at the output of this laser scheme. Using intra-cavity short focus lenses with spherical aberrations AP or RP modes of higher orders was obtained. Mechanism of mode selection in the laser is discussed. The large variety of beams with axially symmetric polarizations from the output of the proposed laser scheme may find applications in different fields.

  14. A novel fiber-laser-based fiber Bragg grating strain sensor with high-birefringence Sagnac fiber loop mirror

    Institute of Scientific and Technical Information of China (English)

    Ou Xu; Shaohua Lu; Suchun Feng; Shuisheng Jian

    2008-01-01

    A novel fiber-laser-based strain sensor is proposed and experimentally demonstrated. The laser cavity is composed of a high-birefringence Sagnac fiber loop mirror (HiBi-SFLM) and a fiher Bragg grating (FBG) which also acts as a strain-sensing element. In the linear region of the HiBi-SFI,M reflection spectrum, when the strain applied on the FBG makes the Bragg grating wavelength shift,, the laser output power changes due to reflectivity variation of the HiBi-SFLM. Experimental results show that the laser output power varies ahnost linearly with the applied strain. The measurement of the output power can be performed by a conventional photo-detector.

  15. Linear to Circular Polarisation Conversion using Birefringent Properties of Aligned Crystals for Multi-GeV Photons

    CERN Document Server

    Apyan, A; Badelek, B; Ballestrero, S; Biino, C; Birol, I; Cenci, P; Connell, S H; Eichblatt, S; Fonseca, T; Freund, A; Gorini, B; Groess, R; Ispirian, K; Ketel, T; Kononets, Yu V; López, A; Mangiarotti, A; Sellschop, J P Friedel; Shieh, M; Sona, P; Strakhovenko, V M; Uggerhøj, Erik; Uggerhøj, U; Van Rens, B; Velasco, M; Vilakazi, Z Z; Wessely, O; Ünel, G; Kononets, Yu.V.

    2003-01-01

    We present the first experimental results on the use of a thick aligned Si crystal acting as a quarter wave plate to induce a degree of circular polarisation in a high energy linearly polarised photon beam. The linearly polarised photon beam is produced from coherent bremsstrahlung radiation by 178 GeV unpolarised electrons incident on an aligned Si crystal, acting as a radiator. The linear polarisation of the photon beam is characterised by measuring the asymmetry in electron-positron pair production in a Ge crystal, for different crystal orientations. The Ge crystal therefore acts as an analyser. The birefringence phenomenon, which converts the linear polarisation to circular polarisation, is observed by letting the linearly polarised photons beam pass through a thick Si quarter wave plate crystal, and then measuring the asymmetry in electron-positron pair production again for a selection of relative angles between the crystallographic planes of the radiator, analyser and quarter wave plate. The systematics...

  16. Coherent Pair Production by Photons in the 20-170 GeV Energy Range Incident on Crystals and Birefringence

    CERN Document Server

    Apyan, A; Badelek, B; Ballestrero, S; Biino, C; Birol, I; Cenci, P; Connell, S H; Eichblatt, S; Fonseca, T; Freund, A; Gorini, B; Groess, R; Ispirian, K; Ketel, T; Kononets, Yu V; López, A; Mangiarotti, A; Sellschop, J P Friedel; Shieh, M; Sona, P; Strakhovenko, V M; Uggerhøj, Erik; Uggerhøj, U; Van Rens, B; Velasco, M; Vilakazi, Z Z; Wessely, O; Ünel, G; Kononets, Yu.V.

    2003-01-01

    The cross section for coherent pair production by linearly polarised photons in the 20-170 GeV energy range was measured for photon aligned incidence on ultra-high quality diamond and germanium crystals. The theoretical description of coherent bremsstrahlung and coherent pair production phenomena is an area of active theoretical debate and development. However, under our experimental conditions, the theory predicted the combined cross section and polarisation experimental observables very well indeed. In macroscopic terms, our experiment measured a birefringence effect in pair production in a crystal. This study of this effect also constituted a measurement of the energy dependent linear polarisation of photons produced by coherent bremsstrahlung in aligned crystals. New technologies for manipulating high energy photon beams can be realised based on an improved understanding of QED phenomena at these energies. In particular, this experiment demonstrates an efficient new polarimetry technique. The pair product...

  17. Tunable multiwavelength erbium-doped fiber laser based on nonlinear optical loop mirror and birefringence fiber filter

    Science.gov (United States)

    Li, Yuan; Quan, Mingran; Tian, Jiajun; Yao, Yong

    2015-05-01

    A tunable multiwavelength erbium-doped fiber laser (MWEDFL) based on nonlinear optical loop mirror (NOLM) and tunable birefringence fiber filter (BFF) is proposed and demonstrated. By combination of intensity-dependent loss modulation induced by NOLM and pump power adjustment, the proposed laser can achieve independent control over the number of lasing lines, without affecting other important characteristics such as channel spacing and peak location. In addition, the laser allows wavelength tuning with both the peak location and the spectral range of lasing lines controllable. Specifically, the peak location of lasing lines can be controlled to scan the whole spectral range between adjacent channels of comb filter by adjusting the BFF. Moreover, the spectral range of lasing lines can be controlled by adjusting NOLM. This tunable MWEDFL may be useful for fiber-optic communication and fiber-optic sensing.

  18. Stimulated Brillouin scattering in highly birefringent multimode tapered chalcogenide photonic crystal fiber for distributed optical sensors (Retraction Notice)

    Science.gov (United States)

    Baili, Amira; Cherif, Rim; Zghal, Mourad

    2016-09-01

    This paper, originally published on September 15, 2016, was retracted from the SPIE Digital Library on October 5, 2016, due to a high degree of similarity between specific portions of the text of the paper to the following publications: J. Tchahame, J. Beugnot, A. Kudlinski, and T. Sylvestre, "Multimode Brillouin spectrum in a long tapered birefringent photonic crystal fiber," Opt. Lett. 40, 4281-4284 (2015). doi: 10.1364/OL.40.004281 W. W. Ke, X. J. Wang and X. Tang, "Stimulated Brillouin Scattering Model in Multi-Mode Fiber Lasers," in IEEE Journal of Selected Topics in Quantum Electronics, vol. 20, no. 5, pp. 305-314, Sept.-Oct. 2014. doi: 10.1109/JSTQE.2014.2303256.

  19. Polarization of an electromagnetic wave in a randomly birefringent medium: a stochastic theory of the Stokes parameters.

    Science.gov (United States)

    Botet, Robert; Kuratsuji, Hiroshi

    2010-03-01

    We present a framework for the stochastic features of the polarization state of an electromagnetic wave propagating through the optical medium with both deterministic (controlled) and disordered birefringence. In this case, the Stokes parameters obey a Langevin-type equation on the Poincaré sphere. The functional integral method provides for a natural tool to derive the Fokker-Planck equation for the probability distribution of the Stokes parameters. We solve the Fokker-Planck equation in the case of a random anisotropic active medium submitted to a homogeneous electromagnetic field. The possible dissipation and relaxation phenomena are studied in general and in various cases, and we give hints about how to validate experimentally the corresponding phenomenological equations.

  20. Towards the development of a fully coupled arterial-venous 1D model: suitability of using a 1D finite volume method with staggered spatial discretization

    CSIR Research Space (South Africa)

    Bogaers, Alfred EJ

    2012-07-01

    Full Text Available In this paper we outline the development of a 1D finite volume model to solve for blood flow through the arterial system. The model is based on a staggered spatial discretization which leads to a stable solution scheme. This scheme can accurately...

  1. Structure and Catalytic Mechanism of Human Steroid 5-Reductase (AKR1D1)

    Energy Technology Data Exchange (ETDEWEB)

    Costanzo, L.; Drury, J; Christianson, D; Penning, T

    2009-01-01

    Human steroid 5{beta}-reductase (aldo-keto reductase (AKR) 1D1) catalyzes reduction of {Delta}{sup 4}-ene double bonds in steroid hormones and bile acid precursors. We have reported the structures of an AKR1D1-NADP{sup +} binary complex, and AKR1D1-NADP{sup +}-cortisone, AKR1D1-NADP{sup +}-progesterone and AKR1D1-NADP{sup +}-testosterone ternary complexes at high resolutions. Recently, structures of AKR1D1-NADP{sup +}-5{beta}-dihydroprogesterone complexes showed that the product is bound unproductively. Two quite different mechanisms of steroid double bond reduction have since been proposed. However, site-directed mutagenesis supports only one mechanism. In this mechanism, the 4-pro-R hydride is transferred from the re-face of the nicotinamide ring to C5 of the steroid substrate. E120, a unique substitution in the AKR catalytic tetrad, permits a deeper penetration of the steroid substrate into the active site to promote optimal reactant positioning. It participates with Y58 to create a 'superacidic' oxyanion hole for polarization of the C3 ketone. A role for K87 in the proton relay proposed using the AKR1D1-NADP{sup +}-5{beta}-dihydroprogesterone structure is not supported.

  2. Use of optimized 1D TOCSY NMR for improved quantitation and metabolomic analysis of biofluids

    Energy Technology Data Exchange (ETDEWEB)

    Sandusky, Peter [Eckerd College, Department of Chemistry (United States); Appiah-Amponsah, Emmanuel; Raftery, Daniel, E-mail: raftery@purdue.edu [Purdue University, Department of Chemistry (United States)

    2011-04-15

    One dimensional selective TOCSY experiments have been shown to be advantageous in providing improved data inputs for principle component analysis (PCA) (Sandusky and Raftery 2005a, b). Better subpopulation cluster resolution in the observed scores plots results from the ability to isolate metabolite signals of interest via the TOCSY based filtering approach. This report reexamines the quantitative aspects of this approach, first by optimizing the 1D TOCSY experiment as it relates to the measurement of biofluid constituent concentrations, and second by comparing the integration of 1D TOCSY read peaks to the bucket integration of 1D proton NMR spectra in terms of precision and accuracy. This comparison indicates that, because of the extensive peak overlap that occurs in the 1D proton NMR spectra of biofluid samples, bucket integrals are often far less accurate as measures of individual constituent concentrations than 1D TOCSY read peaks. Even spectral fitting approaches have proven difficult in the analysis of significantly overlapped spectral regions. Measurements of endogenous taurine made over a sample population of human urine demonstrates that, due to background signals from other constituents, bucket integrals of 1D proton spectra routinely overestimate the taurine concentrations and distort its variation over the sample population. As a result, PCA calculations performed using data matrices incorporating 1D TOCSY determined taurine concentrations produce better scores plot subpopulation cluster resolution.

  3. Growth and Magnetic Characterization of 1D Permalloy Nanowires Using Self Developed Anodic Aluminium Oxide Templates.

    Science.gov (United States)

    Singh, Ashutosh K; Mandal, Kalyan

    2016-01-01

    1D Permalloy refers to arrays of nanowires (NWs) made of an alloy of Ni and Fe with 80 and 20 at% composition respectively. In the present work 1 D Permalloy NWs arrays were fabricated into the pores of self engineered Anodic Aluminium Oxide (AAO) templates by a simple electrodeposition technique (EDT). By varying the anodization voltage and parameters of the electrolyte solutions we developed AAO templates with different average pore diameters (40 nm to 70 nm) and developed 1D Permalloy NWs within them. Structural characterization of AAO templates and 1D Permalloy NWs were performed by Transmission and Scanning Electron Microscopy (TEM and SEM respectively). X-ray diffraction (XRD) studies of 1D Permalloy NWs showed their fcc crystalline structure and the AAO template was found to be amorphous in nature. Magnetic studies showed the 1D Permalloy NWs arrays to have strong shape anisotropy, and the easy axis was found to be parallel to the NWs axis. We studied the angular dependence of magnetic properties of the NWs. Coercivity (Hc) and remanence (Mr/Ms) measured along the NWs axis were found to be higher than those measured in a direction perpendicular to the NWs axis. 1D Permalloy NWs developed in this work have the potential to be used in magnetic recording devices.

  4. On the Current Drive Capability of Low Dimensional Semiconductors: 1D versus 2D

    Science.gov (United States)

    Zhu, Y.; Appenzeller, J.

    2015-10-01

    Low-dimensional electronic systems are at the heart of many scaling approaches currently pursuit for electronic applications. Here, we present a comparative study between an array of one-dimensional (1D) channels and its two-dimensional (2D) counterpart in terms of current drive capability. Our findings from analytical expressions derived in this article reveal that under certain conditions an array of 1D channels can outperform a 2D field-effect transistor because of the added degree of freedom to adjust the threshold voltage in an array of 1D devices.

  5. TCTEX1D2 mutations underlie Jeune asphyxiating thoracic dystrophy with impaired retrograde intraflagellar transport

    Science.gov (United States)

    Schmidts, Miriam; Hou, Yuqing; Cortés, Claudio R.; Mans, Dorus A.; Huber, Celine; Boldt, Karsten; Patel, Mitali; van Reeuwijk, Jeroen; Plaza, Jean-Marc; van Beersum, Sylvia E. C.; Yap, Zhi Min; Letteboer, Stef J. F.; Taylor, S. Paige; Herridge, Warren; Johnson, Colin A.; Scambler, Peter J.; Ueffing, Marius; Kayserili, Hulya; Krakow, Deborah; King, Stephen M.; Beales, Philip L.; Al-Gazali, Lihadh; Wicking, Carol; Cormier-Daire, Valerie; Roepman, Ronald; Mitchison, Hannah M.; Witman, George B.; Al-Turki, Saeed; Anderson, Carl; Anney, Richard; Antony, Dinu; Asimit, Jennifer; Ayub, Mohammad; Barrett, Jeff; Barroso, Inês; Bentham, Jamie; Bhattacharya, Shoumo; Blackwood, Douglas; Bobrow, Martin; Bochukova, Elena; Bolton, Patrick; Boustred, Chris; Breen, Gerome; Brion, Marie-Jo; Brown, Andrew; Calissano, Mattia; Carss, Keren; Chatterjee, Krishna; Chen, Lu; Cirak, Sebhattin; Clapham, Peter; Clement, Gail; Coates, Guy; Collier, David; Cosgrove, Catherine; Cox, Tony; Craddock, Nick; Crooks, Lucy; Curran, Sarah; Daly, Allan; Danecek, Petr; Smith, George Davey; Day-Williams, Aaron; Day, Ian; Durbin, Richard; Edkins, Sarah; Ellis, Peter; Evans, David; Farooqi, I. Sadaf; Fatemifar, Ghazaleh; Fitzpatrick, David; Flicek, Paul; Floyd, Jamie; Foley, A. Reghan; Franklin, Chris; Futema, Marta; Gallagher, Louise; Gaunt, Tom; Geschwind, Daniel; Greenwood, Celia; Grozeva, Detelina; Guo, Xiaosen; Gurling, Hugh; Hart, Deborah; Hendricks, Audrey; Holmans, Peter; Huang, Jie; Humphries, Steve E.; Hurles, Matt; Hysi, Pirro; Jackson, David; Jamshidi, Yalda; Jewell, David; Chris, Joyce; Kaye, Jane; Keane, Thomas; Kemp, John; Kennedy, Karen; Kent, Alastair; Kolb-Kokocinski, Anja; Lachance, Genevieve; Langford, Cordelia; Lee, Irene; Li, Rui; Li, Yingrui; Ryan, Liu; Lönnqvist, Jouko; Lopes, Margarida; MacArthur, Daniel G.; Massimo, Mangino; Marchini, Jonathan; Maslen, John; McCarthy, Shane; McGuffin, Peter; McIntosh, Andrew; McKechanie, Andrew; McQuillin, Andrew; Memari, Yasin; Metrustry, Sarah; Min, Josine; Moayyeri, Alireza; Morris, James; Muddyman, Dawn; Muntoni, Francesco; Northstone, Kate; O'Donovan, Michael; O'Rahilly, Stephen; Onoufriadis, Alexandros; Oualkacha, Karim; Owen, Michael; Palotie, Aarno; Panoutsopoulou, Kalliope; Parker, Victoria; Parr, Jeremy; Paternoster, Lavinia; Paunio, Tiina; Payne, Felicity; Perry, John; Pietilainen, Olli; Plagnol, Vincent; Quail, Michael A.; Quaye, Lydia; Raymond, Lucy; Rehnström, Karola; Brent Richards, J.; Ring, Sue; Ritchie, Graham R S; Savage, David B.; Schoenmakers, Nadia; Semple, Robert K.; Serra, Eva; Shihab, Hashem; Shin, So-Youn; Skuse, David; Small, Kerrin; Smee, Carol; Soler, Artigas María; Soranzo, Nicole; Southam, Lorraine; Spector, Tim; St Pourcain, Beate; St. Clair, David; Stalker, Jim; Surdulescu, Gabriela; Suvisaari, Jaana; Tachmazidou, Ioanna; Tian, Jing; Timpson, Nic; Tobin, Martin; Valdes, Ana; van Kogelenberg, Margriet; Vijayarangakannan, Parthiban; Wain, Louise; Walter, Klaudia; Wang, Jun; Ward, Kirsten; Wheeler, Ellie; Whittall, Ros; Williams, Hywel; Williamson, Kathy; Wilson, Scott G.; Wong, Kim; Whyte, Tamieka; ChangJiang, Xu; Zeggini, Eleftheria; Zhang, Feng; Zheng, Hou-Feng

    2015-01-01

    The analysis of individuals with ciliary chondrodysplasias can shed light on sensitive mechanisms controlling ciliogenesis and cell signalling that are essential to embryonic development and survival. Here we identify TCTEX1D2 mutations causing Jeune asphyxiating thoracic dystrophy with partially penetrant inheritance. Loss of TCTEX1D2 impairs retrograde intraflagellar transport (IFT) in humans and the protist Chlamydomonas, accompanied by destabilization of the retrograde IFT dynein motor. We thus define TCTEX1D2 as an integral component of the evolutionarily conserved retrograde IFT machinery. In complex with several IFT dynein light chains, it is required for correct vertebrate skeletal formation but may be functionally redundant under certain conditions. PMID:26044572

  6. Spatial and frequency domain effects of defects in 1D photonic crystal

    CERN Document Server

    Rudziński, A; Szczepański, P; 10.1007/s11082-007-9095-3

    2009-01-01

    The aim of this paper is to present the analysis of influence of defects in 1D photonic crystal (PC) on the density of states and simultaneously spontaneous emission, in both spatial and frequency domains. In our investigations we use an analytic model of 1D PC with defects. Our analysis reveals how presence of a defect causes a defect mode to appear. We show that a defect in 1D PC has local character, being negligible in regions of PC situated far from the defected elementary cell. We also analyze the effect of multiple defects, which lead to photonic band gap splitting.

  7. On the Current Drive Capability of Low Dimensional Semiconductors: 1D versus 2D.

    Science.gov (United States)

    Zhu, Y; Appenzeller, J

    2015-12-01

    Low-dimensional electronic systems are at the heart of many scaling approaches currently pursuit for electronic applications. Here, we present a comparative study between an array of one-dimensional (1D) channels and its two-dimensional (2D) counterpart in terms of current drive capability. Our findings from analytical expressions derived in this article reveal that under certain conditions an array of 1D channels can outperform a 2D field-effect transistor because of the added degree of freedom to adjust the threshold voltage in an array of 1D devices.

  8. Ruthenium and osmium complexes of hemilabile chiral monophosphinite ligands derived from 1D-pinitol or 1D-chiro-inositol as catalysts for asymmetric hydrogenation reactions.

    Science.gov (United States)

    Slade, Angela T; Lensink, Cornelis; Falshaw, Andrew; Clark, George R; Wright, L James

    2014-12-07

    The monophosphinite ligands, 1D-1,2;5,6-di-O-cyclopentylidene-3-O-methyl-4-O-diphenylphosphino-chiro-inositol (D-P1), 1D-1,2;5,6-di-O-isopropylidene-3-O-methyl-4-O-diphenylphosphino-chiro-inositol (D-P2), 1D-1,2;5,6-di-O-cyclohexylidene-3-O-methyl-4-O-diphenylphosphino-chiro-inositol (D-P3), and 1D-1,2;5,6-di-O-cyclopentylidene-3-O-ethyl-4-O-diphenylphosphino-chiro-inositol (D-P4), can be conveniently prepared from the chiral natural products 1D-pinitol or 1D-chiro-inositol. On treatment of toluene solutions of RuCl2(PPh3)3 with two mole equivalents of the ligands D-PY (Y = 1-4) the complexes RuCl2(D-P1)2 (1), RuCl2(D-P2)2 (4), RuCl2(D-P3)2 (5), or RuCl2(D-P4)2 (6), respectively, are formed. Similarly, treatment of OsCl2(PPh3)3 with D-P1 gives OsCl2(D-P1)2 (7). The single crystal X-ray structure determination of 1 reveals that each D-P1 ligand coordinates to ruthenium through phosphorus and the oxygen atom of the methoxyl group. Treatment of 1 with excess LiBr or LiI results in metathesis of the chloride ligands and RuBr2(D-P1)2 (2) or RuI2(D-P1)2 (3), respectively, are formed. Exposure of a solution of 1 to carbon monoxide results in the very rapid formation of RuCl2(CO)2(D-P1)2 (8), thereby demonstrating the ease with which the oxygen donors are displaced from the metal and hence the hemilabile nature of the two bidentate D-P1 ligands in 1. Preliminary studies indicate that 1-7 act as catalysts for the asymmetric hydrogenation reactions of acetophenone and 3-quinuclidinone to give the corresponding alcohols in generally high conversions but low enantiomeric excesses.

  9. Derivative expansion and the induced Chern-Simons term in N=1, d=3 superspace

    CERN Document Server

    Gama, F S; Petrov, A Yu

    2015-01-01

    In this paper we apply a supersymmetric generalization of the method of derivative expansion to compute the induced non-Abelian Chern-Simons term in $\\mathcal{N}=1$, $d=3$ superspace, for an arbitrary gauge group.

  10. Experimental Conditions: SE24_S1_M1_D1 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available rometry with 13C‑Labeling for Chemical Assignment of Sulfur-Containing Metabolites ...SE24_S1_M1_D1 SE24 Combination of Liquid Chromatography-Fourier Transform Ion Cyclotron Resonance-Mass Spect

  11. Vorticity and Λ polarization in event-by-event (3+1)D viscous hydrodynamics

    Science.gov (United States)

    Pang, Long-Gang; Fang, Ren-Hong; Petersen, Hannah; Wang, Qun; Wang, Xin-Nian

    2017-01-01

    We visualized the vortical fluid in fluctuating QGP using (3+1)D viscous hydrodynamics, computed the spin distribution and correlation of hyperons and estimated the polarization splitting between Λ and .

  12. Quasi-one dimensional (Q1D) nanostructures: Synthesis, integration and device application

    Science.gov (United States)

    Chien, Chung-Jen

    Quasi-one-dimensional (Q1D) nanostructures such as nanotubes and nanowires have been widely regarded as the potential building blocks for nanoscale electronic, optoelectronic and sensing devices. In this work, the content can be divided into three categories: Nano-material synthesis and characterizations, alignment and integration, physical properties and application. The dissertation consists of seven chapters as following. Chapter 1 will give an introduction to low dimensional nano-materials. Chapter 2 explains the mechanism how Q1D nanostructure grows. Chapter 3 describes the methods how we horizontally and vertically align the Q1D nanostructure. Chapter 4 and 5 are the electrical and optical device characterization respectively. Chapter 6 demonstrates the integration of Q1D nanostructures and the device application. The last chapter will discuss the future work and conclusion of the thesis.

  13. Structural resistance of chemically modified 1-D nanostructured titanates in inorganic acid environment

    Energy Technology Data Exchange (ETDEWEB)

    Marinkovic, Bojan A., E-mail: bojan@puc-rio.br [Departamento de Engenharia de Materiais, Pontificia Universidade Catolica de Rio de Janeiro-PUC-Rio, Rua Marques de Sao Vicente 225, Gavea, RJ (Brazil); Fredholm, Yann C. [Nanogavea-Nanotecnologia Sustentavel Ltda, Av. Padre Leonel Franca 150, Gavea, RJ (Brazil); Morgado, Edisson [PETROBRAS S.A./CENPES, Research and Development Centre, Av. Horacio Macedo, 950, Cidade Universitaria, 21941-915, Rio de Janeiro, RJ (Brazil); Jardim, Paula M.; Rizzo, Fernando [Departamento de Engenharia de Materiais, Pontificia Universidade Catolica de Rio de Janeiro-PUC-Rio, Rua Marques de Sao Vicente 225, Gavea, RJ (Brazil)

    2010-10-15

    Sodium containing one-dimensional nanostructured layered titanates (1-D NSLT) were produced both from commercial anatase powder and Brazilian natural rutile mineral sands by alkali hydrothermal process. The 1-D NSLT were chemically modified with proton, cobalt or iron via ionic exchange and all products were additionally submitted to intensive inorganic acid aging (pH = 0.5) for 28 days. The morphology and crystal structure transformations of chemically modified 1-D NSLT were followed by transmission electron microscopy, powder X-ray diffraction, selected area electron diffraction and energy dispersive spectroscopy. It was found that the original sodium rich 1-D NSLT and cobalt substituted 1-D NSLT were completely converted to rutile nanoparticles, while the protonated form was transformed in a 70%-30% (by weight) anatase-rutile nanoparticles mixture, very similar to that of the well-known TiO{sub 2}-photocatalyst P25 (Degussa). The iron substituted 1-D NSLT presented better acid resistance as 13% of the original structure and morphology remained, the rest being converted in rutile. A significant amount of remaining 1-D NSLT was also observed after the acid treatment of the product obtained from rutile sand. The results showed that phase transformation of NSLT into titanium dioxide polymorph in inorganic acid conditions were controllable by varying the exchanged cations. Finally, the possibility to transform, through acid aging, 1-D NSLT obtained from Brazilian natural rutile sand into TiO{sub 2}-polymorphs was demonstrated for the first time to the best of authors' knowledge, opening path for producing TiO{sub 2}-nanoproducts with different morphologies through a simple process and from a low cost precursor.

  14. One-Dimensional (1D) ZnS Nanomaterials and Nanostructures

    Institute of Scientific and Technical Information of China (English)

    Xiaosheng FANG; Lide ZHANG

    2006-01-01

    One-dimensional (1D) nanomaterials and nanostructures have received much attention due to their potential interest for understanding fundamental physical concepts and for applications in constructing nanoscale electric and optoelectronic devices. Zinc sulfide (ZnS) is an important semiconductor compound of Ⅱ-Ⅵ group,and the synthesis of 1D ZnS nanomaterials and nanostructures has been of growing interest owing to their promising application in nanoscale optoelectronic devices. This paper reviews the recent progress on 1D ZnS nanomaterials and nanostructures, including nanowires, nanowire arrays, nanorods, nanobelts or nanoribbons,nanocables, and hierarchical nanostructures etc. This article begins with a survey of various methods that have been developed for generating 1D nanomaterials and nanostructures, and then mainly focuses on structures,synthesis, characterization, formation mechanisms and optical property tuning, and luminescence mechanisms of 1D ZnS nanomaterials and nanostructures. Finally, this review concludes with personal views towards future research on 1D ZnS nanomaterials and nanostructures.

  15. The structure of nanocomposite 1D cationic conductor crystal@SWNT.

    Science.gov (United States)

    Kiselev, N A; Kumskov, A S; Zakalyukin, R M; Vasiliev, A L; Chernisheva, M V; Eliseev, A A; Krestinin, A V; Freitag, B; Hutchison, J L

    2012-06-01

    Nanocomposites consisting of one-dimensional (1D) crystals of the cationic conductors CuI, CuBr and AgBr inside single-walled carbon nanotubes, mainly (n, 0), were obtained using the capillary technique. 1D crystal structure models were proposed based on the high resolution transmission electron microscopy performed on a FEI Titan 80-300 at 80 kV with aberration correction. According to the models and image simulations there are two modifications of 1D crystal: hexagonal close-packed bromine (iodine) anion sublattice (growth direction ) and 1D crystal cubic structure (growth direction ) compressed transversely to the nanotube (D(m) ∼1.33 nm) axis. Tentatively this kind of 1D crystal can be considered as monoclinic. One modification of the anion sublattice reversibly transforms into the other inside the nanotube, probably initiated by electron beam heating. As demonstrated by micrographs, copper or silver cations can occupy octahedral positions or are statistically distributed across two tetrahedral positions. A 1DAgBr@SWNT (18, 0; 19, 0) pseudoperiodic 'lattice distortion' is revealed resulting from convolution of the nanotube wall function image with 1D cubic crystal function image.

  16. HERMES Precision Results on g1p, g1d and g1n and the First Measurement of the Tensor Structure Function b1d

    CERN Document Server

    Riedl, C; Akopov, Z; Amarian, M; Ammosov, V V; Andrus, A; Aschenauer, E C; Augustyniak, W; Avakian, R; Avetisian, A; Avetissian, E; Bailey, P; Baturin, V; Baumgarten, C; Beckmann, M; Belostotskii, S; Bernreuther, S; Bianchi, N; Blok, H P; Böttcher, Helmut B; Borisov, A; Bouwhuis, M; Brack, J; Brüll, A; Bryzgalov, V V; Capitani, G P; Chiang, H C; Ciullo, G; Contalbrigo, M; Dalpiaz, P F; De Leo, R; De Nardo, L; De Sanctis, E; Devitsin, E G; Di Nezza, P; Düren, M; Ehrenfried, M; Elalaoui-Moulay, A; Elbakian, G M; Ellinghaus, F; Elschenbroich, U; Ely, J; Fabbri, R; Fantoni, A; Feshchenko, A; Felawka, L; Fox, B; Franz, J; Frullani, S; Gärber, Y; Gapienko, G; Gapienko, V; Garibaldi, F; Garrow, K; Garutti, E; Gaskell, D; Gavrilov, G E; Karibian, V; Graw, G; Grebenyuk, O; Greeniaus, L G; Hafidi, K; Hartig, M; Hasch, D; Heesbeen, D; Henoch, M; Hertenberger, R; Hesselink, W H A; Hillenbrand, A; Hoek, M; Holler, Y; Hommez, B; Iarygin, G; Ivanilov, A; Izotov, A; Jackson, H E; Jgoun, A; Kaiser, R; Kinney, E; Kiselev, A; Königsmann, K C; Kopytin, M; Korotkov, V A; Kozlov, V; Krauss, B; Krivokhizhin, V G; Lagamba, L; Lapikas, L; Laziev, A; Lenisa, P; Liebing, P; Lindemann, T; Lipka, K; Lorenzon, W; Lü, J; Maiheu, B; Makins, N C R; Marianski, B; Marukyan, H O; Masoli, F; Mexner, V; Meyners, N; Miklukho, O; Miller, C A; Miyachi, Y; Muccifora, V; Nagaitsev, A; Nappi, E; Naryshkin, Yu; Nass, A; Negodaev, M A; Nowak, Wolf-Dieter; Oganessyan, K; Ohsuga, H; Orlandi, G; Pickert, N; Potashov, S Yu; Potterveld, D H; Raithel, M; Reggiani, D; Reimer, P E; Reischl, A; Reolon, A R; Rith, K; Airapetian, A; Rosner, G; Rostomyan, A; Rubacek, L; Ryckbosch, D; Salomatin, Yu I; Sanjiev, I; Savin, I; Scarlett, C; Schäfer, A; Schill, C; Schnell, G; Schüler, K P; Schwind, A; Seele, J; Seidl, R; Seitz, B; Shanidze, R G; Shearer, C; Shibata, T A; Shutov, V B; Simani, M C; Sinram, K; Stancari, M D; Statera, M; Steffens, E; Steijger, J J M; Stewart, J; Stösslein, U; Tait, P; Tanaka, H; Taroian, S P; Tchuiko, B; Terkulov, A R; Tkabladze, A V; Trzcinski, A; Tytgat, M; Vandenbroucke, A; Van der Nat, P B; van der Steenhoven, G; Vetterli, Martin C; Vikhrov, V; Vincter, M G; Visser, J; Vogel, C; Vogt, M; Volmer, J; Weiskopf, C; Wendland, J; Wilbert, J; Ybeles-Smit, G V; Yen, S; Zihlmann, B; Zohrabyan, H G; Zupranski, P; Riedl, Caroline

    2005-01-01

    Final HERMES results on the proton, deuteron and neutron structure function g1 are presented in the kinematic range 0.00211d are presented.

  17. Stable Interacting $(2 + 1)d$ Conformal Field Theories at the Boundary of a class of $(3 + 1)d$ Symmetry Protected Topological Phases

    CERN Document Server

    Bi, Zhen; BenTov, Yoni; Xu, Cenke

    2016-01-01

    Motivated by recent studies of symmetry protected topological (SPT) phases, we explore the possible gapless quantum disordered phases in the $(2+1)d$ nonlinear sigma model defined on the Grassmannian manifold $\\frac{U(N)}{U(n)\\times U(N - n)}$ with a Wess-Zumino-Witten (WZW) term at level $k$, which is the effective low energy field theory of the boundary of certain $(3+1)d$ SPT states. With $k = 0$, this model has a well-controlled large-$N$ limit, $i.e.$ its renormalization group equations can be computed exactly with large-$N$. However, with the WZW term, the large-$N$ and large-$k$ limit alone is not sufficient for a reliable study of the nature of the quantum disordered phase. We demonstrate that at least for $n = 1$, through a combined large-$N$, large-$k$ and $3-\\epsilon$ generalization, a stable fixed point in the quantum disordered phase can be reliably located, which corresponds to a $(2+1)d$ strongly interacting conformal field theory. Extension of our method to $n > 1$ will also be discussed.

  18. Enhanced pulse compression induced by the interaction between the third-order dispersion and the cross-phase modulation in birefringent fibres

    Institute of Scientific and Technical Information of China (English)

    徐文成; 陈伟成; 张书敏; 罗爱平; 刘颂豪

    2002-01-01

    In this paper, we report on the enhanced pulse compression due to the interaction between the positive third-order dispersion (TOD) and the nonlinear effect (cross-phase modulation effect) in birefringent fibres. Polarization soliton compression along the slow axis can be enhanced in a birefringent fibre with positive third-order dispersion. while the polarization soliton compression along the fast axis can be enhanced in the fibre with negative third-order dispersion.Moreover, there is an optimal third-order dispersion parameter for obtaining the optimal pulse compression.Redshifted initial chirp is helpful to the pulse compression, while blueshifted chirp is detrimental to the pulse compression. There is also an optimal chirp parameter to reach maximum pulse compression. The optimal pulse compression for TOD parameters under different N-order solitons is also found.

  19. Nematic/smectic-a transition (NS{sub A}), location of tri critical point (TCP) in nO.m series. A birefringence study

    Energy Technology Data Exchange (ETDEWEB)

    Pisipati, Venkata G.K.M.; Latha, Divi Madhavi; Madhav, Boddapati T.P. [Liquid Crystal Research Centre, ECE Dept., Koneru Lakshmaiah Univ., Vaddeswaram (India); Datta Prasad, Potapragada V. [Dept. of Physics, The Hindu Coll., Machilipatnam (India)

    2010-04-15

    The tri critical point (TCP), where the second-order transition transforms to first order has been located in nO.m homologous series. The order parameter has been estimated from the birefringence {delta}n, from the refractive indices and from birefringence data available in literature and from those obtained at our laboratory on a number of nO.m compounds. The compounds in the nO.m series exhibit both second and first-order nematic/smectic-A (NS{sub A}) transition depending on the McMillan ratio (T{sub NA}/T{sub IN}) which in turn depends on the nematic and smectic-A thermal ranges. The data presented are compared with the body of the data available on this homologous series obtained with other techniques. (orig.)

  20. Phase-resolved functional optical coherence tomography: simultaneous imaging of in situ tissue structure, blood flow velocity, standard deviation, birefringence, and Stokes vectors in human skin

    Science.gov (United States)

    Ren, Hongwu; Ding, Zhihua; Zhao, Yonghua; Miao, Jianjun; Nelson, J. Stuart; Chen, Zhongping

    2002-10-01

    We describe a phase-resolved functional optical coherence tomography system that can simultaneously yield in situ images of tissue structure, blood flow velocity, standard deviation, birefringence, and the Stokes vectors in human skin. Multifunctional images were obtained by processing of analytical interference fringe signals derived from two perpendicular polarization-detection channels. The blood flow velocity and standard deviation images were obtained by comparison of the phases from pairs of analytical signals in neighboring A-lines in the same polarization state. The analytical signals from two polarization-diversity detection channels were used to determine the four Stokes vectors for four reference polarization states. From the four Stokes vectors, the birefringence image, which is not sensitive to the orientation of the optical axis in the sample, was obtained. Multifunctional in situ images of a port wine stain birthmark in human skin are presented.