WorldWideScience

Sample records for bioz kf beginn

  1. Quantum Physics for Beginners.

    Science.gov (United States)

    Strand, J.

    1981-01-01

    Suggests a new approach for teaching secondary school quantum physics. Reviews traditional approaches and presents some characteristics of the three-part "Quantum Physics for Beginners" project, including: quantum physics, quantum mechanics, and a short historical survey. (SK)

  2. Liferay Beginner's Guide

    CERN Document Server

    Chen, Robert; Bhatt, Samir

    2011-01-01

    Part of Packt's Beginner's Guide series, each chapter follows the creation of a fictional neighbourhood site to demonstrate an aspect of Liferay portal with practical examples, screenshots, and step-by-step instructions. All you need in order to benefit from the Liferay Beginner's Guide is programming experience. No prior knowledge of Liferay is required, although experienced Liferay portal programmers who need to get up to speed with its latest features will also find this book useful.

  3. PrimeFaces beginner's guide

    CERN Document Server

    Reddy, K Siva Prasad

    2013-01-01

    A guide for beginner's with step-by-step instructions and an easy-to-follow approach.PrimeFaces Beginners Guide is a simple and effective guide for beginners, wanting to learn and implement PrimeFaces in their JSF-based applications. Some basic JSF and jQuery skills are required before you start working through the book.

  4. Joomla! 25 Beginner's Guide

    CERN Document Server

    Tiggeler, Eric

    2012-01-01

    Written with a fast-paced but friendly and engaging approach, this Packt Beginner's guide is designed to be placed alongside the computer as your guide and mentor. Step-by-step tutorials are bolstered by explanations of the reasoning behind what you are doing. You will quickly pick up the necessary skills, tips, and tricks for building a successful Joomla! website. This book is written for beginners to website design. By the end of the book you will have built a complete custom content managed website, and be ready to build any kind of website.

  5. JBoss ESB Beginner's Guide

    CERN Document Server

    DiMaggio, Len; Magesh, Kumar

    2012-01-01

    Part of Packt's Beginner's Guide series, each chapter contains practical examples with step-by-step instructions and plenty of screenshots to guide you through the implementation of JBoss ESB. This book is intended for Java programmers although you don't need previous experience with middleware such as application servers or ESBs.

  6. concrete5 Beginner's Guide

    CERN Document Server

    Laubacher, Remo

    2011-01-01

    This book is part of Packt's Beginner's Guide series. You will be guided through the set up of a Concrete5 site with step-by-step practical examples. This book is ideal for developers who would like to build their first site with Concrete5. Some k

  7. Railo 3 Beginner's Guide

    CERN Document Server

    Drew, Mark

    2011-01-01

    Part of Packt's Beginner's Guide series, this book uses practical examples and screenshots to steadily guide the reader through setting up and using Railo. If you want to develop your own dynamic web applications using CFML, then this book is for you. No prior experience with Railo or CFML is required, although you will be expected to have some web application development experience and knowledge of HTML.

  8. Joomla! 3 beginner's guide

    CERN Document Server

    Tiggeler, Eric

    2014-01-01

    An easy to use, step-by-step guide to creating professional, mobile-friendly websites with the free Joomla CMS. The Joomla! 3 Beginner's Guide Second Edition is the ultimate guide for web developers who wish to build upon their skills and knowledge on creating websites. Even if you're new to this subject, you won't have any difficulty understanding the clear and friendly instructions and explanations. No prior knowledge of HTML and CSS is required.

  9. French courses for Beginners

    CERN Multimedia

    HR Department

    2009-01-01

    French courses for beginners (level 0) will take place from 13 July to 27 August 2009. •\tTimetable: Mondays, Tuesdays, Wednesdays, Thursdays (11:00 to 13:00 or 13:30 to 15:30) •\tDuration: 56 hours (8 hours a week) •\tPrice: 728 CHF For registration and further information on the courses, please consult our Web pages: http://cern.ch/Training or contact Mrs. Dumeaux, tel. 78144.

  10. French courses for Beginners

    CERN Multimedia

    HR Department

    2009-01-01

    French courses for beginners (level 0) will take place from 13 July to 27 August 2009. •\tTimetable: Mondays, Tuesdays, Wednesdays, Thursdays (11:00 to 13:00 or 13:30 to 15:30) •\tDuration: 56 hours (8 hours a week) •\tPrice: 728 CHF For registration and further information on the courses, please consult our Web pages: http://cern.ch/Training or contact Mrs. Dumeaux: Tel. 78144.

  11. French courses for Beginners

    CERN Multimedia

    HR Department

    2009-01-01

    French courses for beginners (level 0) will take place from 13 July to 27 August 2009. •\tTimetable: Mondays, Tuesdays, Wednesdays, Thursdays (11.00 to 13.00 or 13.30 to 15.30) •\tDuration: 56 hours (8 hours a week) •\tPrice: 728 CHF For registration and further information on the courses, please consult our Web pages: http://cern.ch/Training or contact Mrs. Dumeaux : Tel. 78144.

  12. French courses for Beginners

    CERN Multimedia

    HR Department

    2010-01-01

    French courses for beginners (level 0) will take place from 12 July to 27 August 2010. Timetable: Mondays, Tuesdays, Wednesdays, Thursdays (11.00 to 13.00 or 13.30 to 15.30; Duration: 56 hours (8 hours a week); Price: 728 CHF. For registration and further information on the courses, please consult our Web pages: http://cern.ch/Training or contact Mrs. Dumeaux : Tel. 78144.

  13. Android NDK Beginner's Guide

    CERN Document Server

    Ratabouil, Sylvain

    2012-01-01

    This beginner's guide focuses on getting you through all the major learning points in a smooth, logical order. You'll also see how to avoid some common pitfalls. Are you an Android Java programmer who needs more performance? Are you a C/C++ developer who doesn't want to bother with Java stuff and its out-of-control garbage collector? Do you want to create fast intensive multimedia applications or games? Answer yes to any of the above and this book is for you. With some general knowledge of C/C++ development, you will be able to dive head first into native Android development.

  14. CFEngine 3 Beginner's Guide

    CERN Document Server

    Rajneesh

    2011-01-01

    Part of Packt's Beginner's Guide series, this book guides you through setting up Cfengine to maximizing its potential. This book focuses on getting you through all the major learning points in a smooth, logical order. You'll also learn how to avoid some common pitfalls. If you are a System Administrator or Configuration manager with a growing infrastructure and if you are looking for a dependable tool to manage your infrastructure, then this book is for you. If your infrastructure is already big with hundreds and thousands of nodes and you are looking for a secure, versatile and stable configu

  15. Stochastic cooling for beginners

    International Nuclear Information System (INIS)

    Moehl, D.

    1984-01-01

    These two lectures have been prepared to give a simple introduction to the principles. In Part I we try to explain stochastic cooling using the time-domain picture which starts from the pulse response of the system. In Part II the discussion is repeated, looking more closely at the frequency-domain response. An attempt is made to familiarize the beginners with some of the elementary cooling equations, from the 'single particle case' up to equations which describe the evolution of the particle distribution. (orig.)

  16. qooxdoo Beginner's Guide

    CERN Document Server

    Raffi, Mohamed

    2011-01-01

    This is a Packt beginner's guide. The unique style of the book is to set the requirements for an application, Team Twitter, in the first chapter and apply the concepts in the application as you learn in the following chapters. When you complete this book, you would have developed a complete application. Although the scope of this book is only on the Qooxdoo framework, which is a client side framework, we have explained how to set up one of the RPC servers and demonstrated the end to end application in the Team Twitter. This book is intended for the client side developers who design and develop

  17. French courses for Beginners

    CERN Multimedia

    2008-01-01

    French courses for beginners (level 0) will take place from 14 July to 28 August 2008. •\tTimetable: Mondays, Tuesdays, Wednesdays, Thursdays (13.00 to 15.00 or 15.30 to 17.30) •\tDuration: 56 hours (8 hours a week) •\tPrice: 728 CHF For registration and further information on the courses, please consult our Web pages: http://cern.ch/Training or contact Nathalie Dumeaux : Tel. 78144. Language Training French Training Nathalie Dumeaux - 78144 mailto:nathalie.dumeaux@cern.ch

  18. French courses for Beginners

    CERN Multimedia

    2008-01-01

    French courses for beginners (level 0) will take place from 14 July to 28 August 2008. •\tTimetable: Mondays, Tuesdays, Wednesdays, Thursdays (13.00 to 15.00 or 15.30 to 17.30) •\tDuration: 56 hours (8 hours a week) •\tPrice: 728 CHF For registration and further information on the courses, please consult our Web pages: http://cern.ch/Training or contact Mrs. Dumeaux : Tel. 78144. Language Training French Training Nathalie Dumeaux - 78144 mailto:nathalie.dumeaux@cern.ch

  19. EnKF-C user guide

    OpenAIRE

    Sakov, Pavel

    2014-01-01

    EnKF-C provides a compact generic framework for off-line data assimilation into large-scale layered geophysical models with the ensemble Kalman filter (EnKF). It is coded in C for GNU/Linux platform and can work either in EnKF or ensemble optimal interpolation (EnOI) mode.

  20. Astronomy for beginners

    CERN Document Server

    Becan, Jeff

    2008-01-01

    Astronomy For Beginners is a friendly and accessible guide to our universe, our galaxy, our solar system and the planet we call home. Each year as we cruise through space on this tiny blue-green wonder, a number of amazing and remarkable events occur. For example, like clockwork, we'll run head-on into asteroid and cometary debris that spreads shooting stars across our skies. On occasion, we'll get to watch the disk of the Moon passing the Sun, casting its shadow on the face of the Earth, and sometimes we'll get to watch our own shadow as it glides across the face of the Moon. The Sun's path w

  1. French courses for beginners

    CERN Multimedia

    Françoise Benz

    2006-01-01

    If you wish to participate in one of the following courses, please tell to your supervisor and apply electronically from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an 'application for training'form available from your Departmental Secretariat or from your DTO (Departmental Training Officer). Applications will be accepted in the order in which they are received. French courses for beginners (level 0) From 17 July to 31 August 2006. Mondays, Tuesdays, Wednesdays and Thursdays(8 hours a week / between 11.00 and 15.30) Duration: 56 hours Price: 728 CHF For registration and further information on the courses, please consult our Web pages: http://cern.ch/Training or contact Mrs. Benz: Tel. 73127.

  2. Manga studio 5 beginner's guide

    CERN Document Server

    Rhodes, Richard

    2014-01-01

    Using a step-by-step approach, this book will lead you through the process of building up complex, multi-page comic/Manga art, along with industry insights along the way. ""Manga Studio Beginner's Guide"" is for beginners in comic creation. The more you know about how comics are made, the better you will be, but it's not essential to get the most out of this book. Even if you're a professional comic artist, this book will get you up to speed on using Manga Studio 5.

  3. KF-1 ubiquitin ligase: anxiety suppressor model.

    Science.gov (United States)

    Hashimoto-Gotoh, Tamotsu; Iwabe, Naoyuki; Tsujimura, Atsushi; Nakagawa, Masanori; Marunaka, Yoshinori

    2011-06-01

    Anxiety disorders are the most popular psychiatric disease in any human societies irrespective of nation, culture, religion, economics or politics. Anxiety expression mediated by the amygdala may be suppressed by signals transmitted from the prefrontal cortex and hippocampus. KF-1 is an endoplasmic reticulum (ER)-based E3-ubiquitin (Ub) ligase with a RING-H2 finger motif at the C-terminus. The kf-1 gene expression is up-regulated in the frontal cortex and hippocampus in rats after anti-depressant treatments. The kf-1 null mice show no apparent abnormalities, but exhibit selectively pronounced anxiety-like behaviors or increased timidity-like responses. The kf-1 orthologous genes had been generated after the Poriferan emergence, and are found widely in all animals except insects, arachnids and threadworms such as Drosophila, Ixodes and Caenorhabditis, respectively. This suggests that the kf-1 gene may be relevant to some biological functions characteristic to animals. Based on these observations, the Anxiety Suppressor Model has been proposed, which assumes that KF-1 Ub ligase may suppress the amygdala-mediated anxiety by degrading some anxiety promoting protein(s), such as a neurotransmitter receptor, through the ER-associated degradation pathway in the frontal cortex and hippocampus. According to this model, the emotional sensitivity to environmental stresses may be regulated by the cellular protein level of KF-1 relative to that of the putative anxiety promoter. The kf-1 null mice should be useful in elucidating the molecular mechanisms of the anxiety regulation and for screening novel anxiolytic compounds, which may block the putative anxiety promoter.

  4. TestNG beginner's guide

    CERN Document Server

    Menon, Varun

    2013-01-01

    This book is written in a friendly, beginner's guide style with plenty of step-by-step instructions with appropriate examples.This book is great for developers and testers who are new to TestNg and want to learn how to use TestNG for writing their application as well as functional tests. This book assumes that you have experience in Java and OOPs concepts and have worked with certain IDE.

  5. Aldous Huxley: a beginner's guide

    OpenAIRE

    O'Hara, Kieron

    2012-01-01

    Author of Brave New World and The Doors of Perception, and inventor of the term 'psychedelic', Aldous Huxley was a global trend-setter ahead of his time. Charting his transformation from society satirist to Californian guru-mystic, Aldous Huxley: A Beginner's Guide shows how his ideas evolved and why his writing is still vitally relevant today - from detailing the lures of consumerism to exploring individual responsibility in a globalised world. With biographical notes on Huxley's extraordina...

  6. KF-1 Ubiquitin Ligase: An Anxiety Suppressor.

    Science.gov (United States)

    Hashimoto-Gotoh, Tamotsu; Iwabe, Naoyuki; Tsujimura, Atsushi; Takao, Keizo; Miyakawa, Tsuyoshi

    2009-05-01

    Anxiety is an instinct that may have developed to promote adaptive survival by evading unnecessary danger. However, excessive anxiety is disruptive and can be a basic disorder of other psychiatric diseases such as depression. The KF-1, a ubiquitin ligase located on the endoplasmic reticulum (ER), may prevent excessive anxiety; kf-1(-/-) mice exhibit selectively elevated anxiety-like behavior against light or heights. It is surmised that KF-1 degrades some target proteins, responsible for promoting anxiety, through the ER-associated degradation pathway, similar to Parkin in Parkinson's disease (PD). Parkin, another ER-ubiquitin ligase, prevents the degeneration of dopaminergic neurons by degrading the target proteins responsible for PD. Molecular phylogenetic studies have revealed that the prototype of kf-1 appeared in the very early phase of animal evolution but was lost, unlike parkin, in the lineage leading up to Drosophila. Therefore, kf-1(-/-) mice may be a powerful tool for elucidating the molecular mechanisms involved in emotional regulation, and for screening novel anxiolytic/antidepressant compounds.

  7. GeoServer beginner's guide

    CERN Document Server

    Youngblood, Brian

    2013-01-01

    Step-by-step instructions are included and the needs of a beginner are totally satisfied by the book. The book consists of plenty of examples with accompanying screenshots and code for an easy learning curve. You are a web developer with knowledge of server side scripting, and have experience with installing applications on the server. You have a desire to want more than Google maps, by offering dynamically built maps on your site with your latest geospatial data stored in MySQL, PostGIS, MsSQL or Oracle. If this is the case, this book is meant for you.

  8. Android 30 Animations Beginner's Guide

    CERN Document Server

    Shaw, Alex

    2011-01-01

    Written in Packt's Beginner's Guide series, this book takes a step-by-step approach with each chapter made up of three to five tutorials that introduce and explain different animation concepts. All concepts are explained with real-world examples that are fun to read and work with. If you are familiar with developing Android applications and want to bring your apps to life by adding smashing animations, then this book is for you. The book assumes that you are comfortable with Java development and have familiarity with creating Android Views in XML and Java. The tutorials assume that you will wa

  9. NET 40 Generics Beginner's Guide

    CERN Document Server

    Mukherjee, Sudipta

    2012-01-01

    This is a concise, practical guide that will help you learn Generics in .NET, with lots of real world and fun-to-build examples and clear explanations. It is packed with screenshots to aid your understanding of the process. This book is aimed at beginners in Generics. It assumes some working knowledge of C# , but it isn't mandatory. The following would get the most use out of the book: Newbie C# developers struggling with Generics. Experienced C++ and Java Programmers who are migrating to C# and looking for an alternative to other generic frameworks like STL and JCF would find this book handy.

  10. Result of KF606 radon monitor in NRPB 2000 intercomparison

    CERN Document Server

    Yang Ming Li

    2002-01-01

    The KF606 passive radon monitor developed in Radon Laboratory of RIUM joined the 2000 NRPB intercomparison of passive radon detectors. The information of the intercomparison is introduced, and the result of KF606 is analyzed according to the intercomparison report

  11. Development of Comprehension Monitoring in Beginner Readers

    Science.gov (United States)

    Yeomans-Maldonado, Gloria

    2017-01-01

    The current study was designed to understand the development of comprehension monitoring among beginner readers from first to third grade, and to determine the extent to which first graders' comprehension monitoring predicts reading comprehension in grade three. Participants were 113 children (57% female) from four US states who were followed from…

  12. Transforming beginner teacher mentoring interventions for social ...

    African Journals Online (AJOL)

    This article reports on an investigation into the use of action research for beginner teachers' professional development through the use of peer mentoring. Action research principles were applied by the mentor and the participating mentees/peers, forming a scholarly community of practice. The mentees were empowered to ...

  13. PhoneGap 3 beginner's guide

    CERN Document Server

    Natili, Giorgio

    2013-01-01

    Written in a friendly, example-driven Beginner's Guide format, there are plenty of step-by-step instructions to help you get started with PhoneGap.If you are a web developer or mobile application developer interested in an examples-based approach to learning mobile application development basics with PhoneGap, then this book is for you.

  14. Python 3 Web Development Beginner's Guide

    CERN Document Server

    Anders, Michel

    2011-01-01

    Part of Packt's Beginner's Guide Series, this book follows a sample application, with lots of screenshots, to help you get to grips with the techniques as quickly as possible. Moderately experienced Python programmers who want to learn how to create fairly complex, database-driven, cross browser compatible web apps that are maintainable and look good will find this book of most use. All key technologies except for Python 3 are explained in detail.

  15. Visual media processing using Matlab beginner's guide

    CERN Document Server

    Siogkas, George

    2013-01-01

    Written in a friendly, Beginner's Guide format, showing the user how to use the digital media aspects of Matlab (image, video, sound) in a practical, tutorial-based style.This is great for novice programmers in any language who would like to use Matlab as a tool for their image and video processing needs, and also comes in handy for photographers or video editors with even less programming experience wanting to find an all-in-one tool for their tasks.

  16. RavenDB 2.x beginner's guide

    CERN Document Server

    Tannir, Khaled

    2013-01-01

    Written in a friendly, example-driven Beginner's Guide format, there are plenty of step-by-step instructions and examples that are designed to help you get started with RavenDB. If you are a .NET developer, new to document-oriented databases, and you wish to learn how to build applications using NoSQL databases, then this book is for you. Experience with relational database systems will be helpful, but not necessary.

  17. iAd Production Beginner's Guide

    CERN Document Server

    Collier, Ben

    2012-01-01

    This beginner's guide focuses on getting you through all the major learning points in a smooth, logical order. You'll also see how to avoid some common pitfalls. This book is for brands, advertisers and developers who want to create compelling, emotive, iAd advertisements that generate revenue and increase brand awareness. You don't need previous experience of creating adverts or apps for iPhone and iPad, as you'll be taken through the entire process to make motion-rich, beautiful ads.

  18. Eclipse plugin development by example beginner's guide

    CERN Document Server

    Blewitt, Alex

    2013-01-01

    A Beginner's Guide following the ""by Example"" approach. There will be 5-8 major examples that will be used in the book to develop advanced plugins with the Eclipse IDE.This book is for Java developers who are familiar with Eclipse as a Java IDE and are interested in learning how to develop plug-ins for Eclipse. No prior knowledge of Eclipse plug-in development or OSGi is necessary, although you are expected to know how to create, run, and debug Java programs in Eclipse.

  19. Colloquial French the complete course for beginners

    CERN Document Server

    Demouy, Valérie

    2015-01-01

    Colloquial French: The Complete Course for Beginners has been carefully developed by an experienced teacher to provide a step-by-step course to French as it is written and spoken today. Combining a clear, practical and accessible style with a methodical and thorough treatment of the language, it equips learners with the essential skills needed to communicate confidently and effectively in French in a broad range of situations. No prior knowledge of the language is required. Colloquial French is exceptional; each unit presents a wealth of grammatical points that are reinforced with a wide range

  20. THE USE OF KF STYLE FLANGES IN LOW PARTICULATE APPLICATIONS

    Energy Technology Data Exchange (ETDEWEB)

    Kendziora, K. R. [Fermilab; Angelo, J. [Fermilab; Baffes, C. [Fermilab; Franck, D. [Fermilab; Kellett, R. [Fermilab

    2016-10-05

    As SCRF particle accelerator technology advances the need for “low particulate” and “particle free” vacuum sys-tems becomes greater and greater. In the course of the op-eration of these systems, there comes a time when various instruments have to be temporarily attached for diagnostic purposes: RGAs, leak detectors, and additional pumps. In an effort to make the additions of these instruments easier and more time effective, we propose to use KF style flanges for these types of temporary diagnostic connec-tions. This document will describe the tests used to com-pare the particles generated using the assembly of the, widely accepted for “particle free” use, conflat flange to the proposed KF style flange, and demonstrate that KF flanges produce comparable or even less particles

  1. Ubiquitin ligase Kf-1 is involved in the endoplasmic reticulum-associated degradation pathway.

    Science.gov (United States)

    Maruyama, Yoshiaki; Yamada, Misa; Takahashi, Kou; Yamada, Mitsuhiko

    2008-10-03

    Kf-1 was first identified as a gene showing enhanced expression in the cerebral cortex of a sporadic Alzheimer's disease patient. To date, however, the functional properties of Kf-1 protein remain unknown. In this study, immunohistochemical analysis showed that Kf-1 immunoreactivity was detected in rat hippocampus and cerebral cortex neurons. Interestingly, it was colocalized with endoplasmic reticulum (ER) marker. To investigate the specific function of Kf-1 protein, we generated Myc tagged wild type Kf-1 (Myc-Kf-1WT) and RING finger domain deletion mutant of Kf-1 (Myc-Kf-1DeltaR), and then transfected in HEK293 cells. Myc-Kf-1WT displayed a reticular pattern typical of ER localization, with large perinuclear aggregates and colocalized with ER marker, calnexin. Myc-Kf-1WT facilitated ubiquitination of endogenous proteins, whereas Myc-Kf-1DeltaR did not show ubiquitin ligase activity. In addition, we found that Kf-1 interacted with components of the ER-associated degradation (ERAD) pathway, including Derlin-1 and VCP. Taken together, these properties suggest that Kf-1 is an ER ubiquitin ligase involved in the ERAD pathway.

  2. Cu-catalyzed fluorination of diaryliodonium salts with KF.

    Science.gov (United States)

    Ichiishi, Naoko; Canty, Allan J; Yates, Brian F; Sanford, Melanie S

    2013-10-04

    A mild Cu-catalyzed nucleophilic fluorination of unsymmetrical diaryliodonium salts with KF is described. This protocol preferentially fluorinates the smaller aromatic ligand on iodine(III). The reaction exhibits a broad substrate scope and proceeds with high chemoselectivity and functional group tolerance. DFT calculations implicate a Cu(I)/Cu(III) catalytic cycle.

  3. Language Training: French course for beginners

    CERN Multimedia

    Françoise Benz

    2004-01-01

    If you wish to participate in one of the following courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. A French course for beginners (level 0) will take place from 12 July to 27 August. Timetable: not yet fixed Duration: 54 hours / 2 hours a day Price: CHF 702 Please enrol as soon as possible through the Web: http://cern.ch/Training FORMATION EN LANGUES LANGUAGE TRAINING Françoise Benz 73127 language.training@cern.ch

  4. Language Training: French course for beginners

    CERN Multimedia

    Françoise Benz

    2004-01-01

    If you wish to participate in one of the following courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. A French course for beginners (level 0) will take place from 12 July to 27 August. Timetable: not yet fixed Duration: 54 hours / 2 hours a day Price: 702 SF Please enrol as soon as possible through the Web: http://cern.ch/Training FORMATION EN LANGUES LANGUAGE TRAINING Françoise Benz 73127 language.training@cern.ch

  5. Relativity and quantum physics for beginners

    CERN Document Server

    Manly, Steven L

    2009-01-01

    As we humans have expanded our horizons to see things vastly smaller, faster, larger, and farther than ever before, we have been forced to confront preconceptions born of the human experience and create wholly new ways of looking at the world around us. The theories of relativity and quantum physics were developed out of this need and have provided us with phenomenal, mind-twisting insights into the strange and exciting reality show of our universe.Relativity and Quantum Physics For Beginners is an entertaining and accessible introduction to the bizarre concepts that fueled the scientific revolution of the 20th century and led to amazing advances in our understanding of the universe.

  6. jQuery for designers beginner's guide

    CERN Document Server

    MacLees, Natalie

    2014-01-01

    A step-by-step guide that spices up your web pages and designs them in the way you want using the most widely used JavaScript library, jQuery. The beginner-friendly and easy-to-understand approach of the book will help get to grips with jQuery in no time. If you know the fundamentals of HTML and CSS, and want to extend your knowledge by learning to use JavaScript, then this is just the book for you. jQuery makes JavaScript straightforward and approachable - you'll be surprised at how easy it can be to add animations and special effects to your beautifully designed pages.

  7. Mice lacking the kf-1 gene exhibit increased anxiety- but not despair-like behavior.

    Science.gov (United States)

    Tsujimura, Atsushi; Matsuki, Masato; Takao, Keizo; Yamanishi, Kiyofumi; Miyakawa, Tsuyoshi; Hashimoto-Gotoh, Tamotsu

    2008-01-01

    KF-1 was originally identified as a protein encoded by human gene with increased expression in the cerebral cortex of a patient with Alzheimer's disease. In mouse brain, kf-1 mRNA is detected predominantly in the hippocampus and cerebellum, and kf-1 gene expression is elevated also in the frontal cortex of rats after chronic antidepressant treatments. KF-1 mediates E2-dependent ubiquitination and may modulate cellular protein levels as an E3 ubiquitin ligase, though its target proteins are not yet identified. To elucidate the role of kf-1 in the central nervous system, we generated kf-1 knockout mice by gene targeting, using Cre-lox recombination. The resulting kf-1(-/-) mice were normal and healthy in appearance. Behavioral analyses revealed that kf-1(-/-) mice showed significantly increased anxiety-like behavior compared with kf-1(+/+) littermates in the light/dark transition and elevated plus maze tests; however, no significant differences were observed in exploratory locomotion using the open field test or in behavioral despair using the forced swim and tail suspension tests. These observations suggest that KF-1 suppresses selectively anxiety under physiological conditions probably through modulating protein levels of its unknown target(s). Interestingly, kf-1(-/-) mice exhibited significantly increased prepulse inhibition, which is usually reduced in human schizophrenic patients. Thus, the kf-1(-/-) mice provide a novel animal model for elucidating molecular mechanisms of psychiatric diseases such as anxiety/depression, and may be useful for screening novel anxiolytic/antidepressant compounds.

  8. Irrlicht 17 Realtime 3D Engine Beginner's Guide

    CERN Document Server

    Stein, Johannes

    2011-01-01

    A beginner's guide with plenty of screenshots and explained code. If you have C++ skills and are interested in learning Irrlicht, this book is for you. Absolutely no knowledge of Irrlicht is necessary for you to follow this book!

  9. X-ray diffuse scattering study of 2 kF and 4 kF anomalies in strongly irradiated TTF-TCNQ

    OpenAIRE

    Forró, L.; Bouffard, S.; Pouget, J.P.

    1984-01-01

    We report an X-ray diffuse scattering study of the CDW fluctuations in strongly irradiated TTF-TCNQ. The 2 kF and 4 kF CDW become onedimensional for 5.0 mol % of introduced defects, even at the lowest temperature (28 K). At the concentration level of 15 mol % the 2 kF anomaly disappears, while a temperature independent 4 kF distortion is stabilized. These results are compared with those for the alloy TTF0.97TSF0.03TCNQ and for TMTSF-DMTCNQ.

  10. Effective monoallylation of anilines catalyzed by supported KF.

    Science.gov (United States)

    Pace, Vittorio; Martínez, Fernando; Fernández, María; Sinisterra, Jose V; Alcántara, Andrés R

    2007-07-05

    A mild and straightforward monoallylation procedure for different anilines is described using the efficient, inexpensive, noncorrosive, and environmentally friendly reagent KF-Celite. By using only a 1/1.2 stoichiometric ratio of electrophilic reagent to aniline, in very short reaction times, the monoallylated products are obtained in high isolated yields via this procedure, which works very effectively regardless of the electronic nature of the substituent on the ring, although electron withdrawing groups make the reactions go even faster.

  11. Permanent draft genome sequence of Comamonas testosteroni KF-1.

    Science.gov (United States)

    Weiss, Michael; Kesberg, Anna I; Labutti, Kurt M; Pitluck, Sam; Bruce, David; Hauser, Loren; Copeland, Alex; Woyke, Tanja; Lowry, Stephen; Lucas, Susan; Land, Miriam; Goodwin, Lynne; Kjelleberg, Staffan; Cook, Alasdair M; Buhmann, Matthias; Thomas, Torsten; Schleheck, David

    2013-01-01

    Comamonas testosteroni KF-1 is a model organism for the elucidation of the novel biochemical degradation pathways for xenobiotic 4-sulfophenylcarboxylates (SPC) formed during biodegradation of synthetic 4-sulfophenylalkane surfactants (linear alkylbenzenesulfonates, LAS) by bacterial communities. Here we describe the features of this organism, together with the complete genome sequence and annotation. The 6,026,527 bp long chromosome (one sequencing gap) exhibits an average G+C content of 61.79% and is predicted to encode 5,492 protein-coding genes and 114 RNA genes.

  12. Sucrose and KF quenching system for solution phase parallel synthesis.

    Science.gov (United States)

    Chavan, Sunil; Watpade, Rahul; Toche, Raghunath

    2016-01-01

    The KF, sucrose (table sugar) exploited as quenching system in solution phase parallel synthesis. Excess of electrophiles were covalently trapped with hydroxyl functionality of sucrose and due to polar nature of sucrose derivative was solubilize in water. Potassium fluoride used to convert various excess electrophilic reagents such as acid chlorides, sulfonyl chlorides, isocyanates to corresponding fluorides, which are less susceptible for hydrolysis and subsequently sucrose traps these fluorides and dissolves them in water thus removing them from reaction mixture. Various excess electrophilic reagents such as acid chlorides, sulfonyl chlorides, and isocyanates were quenched successfully to give pure products in excellent yields.

  13. Poly(vinylpyrrolidone)/KF electrolyte membranes for facilitated CO(2) transport.

    Science.gov (United States)

    Oh, Je Hyun; Kang, Yong Soo; Kang, Sang Wook

    2013-10-03

    In this study, we show for the first time that potassium fluoride (KF) can be utilized as a carrier for facilitated CO2 transport. A polymer electrolyte membrane was prepared by incorporating KF through coordinate covalent bonding with the amide groups of poly(vinylpyrrolidone) (PVP). The resulting PVP/KF electrolyte membrane showed enhanced CO2 separation performance compared with neat PVP. The selectivity ratio CO2/N2 increased to 4.1 with a CO2 permeance of 28 GPU. This enhanced separation performance was attributable to the reversible interaction of KF with CO2 molecules, resulting in the increase of CO2 transport. The interaction between KF and the amide groups of PVP was confirmed by FT-IR spectroscopy and X-ray photoelectron spectroscopy (XPS). The coordination of potassium ions with the amide groups caused the free ions in KF to be increased, resulting in the favorable interaction with CO2 molecules.

  14. Shifting ontologies of a serious game and its relationships with English education for beginners

    DEFF Research Database (Denmark)

    Hansbøl, Mikala; Meyer, Bente

    2011-01-01

    an actor in English education for beginners. The virtual universe provides an online environment for students beginning to learn English in schools and at home. This paper will focus on the shifting ontologies of Mingoville and teaching and learning situations in beginners' English. This paper takes its......) may offer a different and useful approach to understanding how Mingoville becomes a multiple actor. It reveals that such an actor both influences, and is influenced by, manifold constitutive entanglements involved in organizing English teaching and learning activities for beginners. Theoretically...... and learning situations of English for beginners. Keywords: Entanglement approach, relational ontology, serious games, teaching and learning English for beginners, educational technology research...

  15. Beginner teacher professional development: An action research and ...

    African Journals Online (AJOL)

    Tanya

    work by scholars, who investigate beginner teacher behaviour. Research studies in North American school ..... the mentor to work with visual representations, metaphors and overviews. - discovering new meaning. - freedom to .... preferences when I am experiencing stress. My pro- file is quite different from most of that of the.

  16. Machine Translation-Assisted Language Learning: Writing for Beginners

    Science.gov (United States)

    Garcia, Ignacio; Pena, Maria Isabel

    2011-01-01

    The few studies that deal with machine translation (MT) as a language learning tool focus on its use by advanced learners, never by beginners. Yet, freely available MT engines (i.e. Google Translate) and MT-related web initiatives (i.e. Gabble-on.com) position themselves to cater precisely to the needs of learners with a limited command of a…

  17. AppleWorks for Educators. A Beginner's Workbook.

    Science.gov (United States)

    Rathje, Linda

    This self-paced workbook presents basic information about features of the "AppleWorks" software package, provides practice materials for beginners, discusses features available in an integrated three-application package, and provides guided hands-on activities. The applications include the spreadsheet, the word processor, printer options…

  18. Selecting literature for beginner readers in South Africa

    Directory of Open Access Journals (Sweden)

    Hibbert, Liesel

    2011-12-01

    Full Text Available This article explores complexities of choosing appropriate reading material which may provide maximum engagement for beginner readers in Southern Africa, with the aim of instilling a lifelong love of reading. The article presents a case in favour of literary criteria as base line for choices of reading material for beginner readers. Furthermore, the article outlines general characteristics of reading material for beginner readers, as well as specific criteria to be considered in the Southern African context, taking into account the linguistic diversity which exists in formal education and the vast literacy backlog in the region. Furthermore, it is argued that translated children’s stories should ideally be adapted rather than literally translated, in order to meet the requirements of what is universally regarded as good children’s literature for beginner readers. A culture of reading can only be instilled by adhering to the following criteria, i.e. ensuring affective engagement, maximum meaning-making potential, delight, the engagement of the imagination for the purposes of developing the creative mind, and strong identification with the material for the purposes of developing a sense of agency.

  19. Design Practices and Misconceptions: Helping Beginners in Engineering Design

    Science.gov (United States)

    Crismond, David

    2013-01-01

    This article describes beginner habits and misconceptions related to design practices. Once teachers are aware of these habits and misconceptions, they can more easily recognize them and work to remedy them through instruction. Presented herein are eight practice habits. Each item begins with the practice, describes a related design habit or…

  20. NumPy 1.5 Beginner's Guide

    CERN Document Server

    Idris, Ivan

    2011-01-01

    The book is written in beginner's guide style with each aspect of NumPy demonstrated by real world examples. There is appropriate explained code with the required screenshots thrown in for the novice. This book is for the programmer, scientist or engineer, who has basic Python knowledge and would like to be able to do numerical computations with Python.

  1. R statistical application development by example : beginner's guide

    CERN Document Server

    Tattar, Narayanachart Prabhanjan

    2013-01-01

    Full of screenshots and examples, this Beginner's Guide by Example will teach you practically everything you need to know about R statistical application development from scratch. You will begin learning the first concepts of statistics in R which is vital in this fast paced era and it is also a bargain as you do not need to do a preliminary course on the subject.

  2. Transforming Beginner Teacher Mentoring Interventions for Social Reform

    Science.gov (United States)

    Smit, Tanya; du Toit, Pieter H.

    2016-01-01

    This article reports on an investigation into the use of action research for beginner teachers' professional development through the use of peer mentoring. Action research principles were applied by the mentor and the participating mentees/peers, forming a scholarly community of practice. The mentees were empowered to transform their teaching…

  3. Type KF606B Rn/γ personal dosimeter

    International Nuclear Information System (INIS)

    Yang Mingli

    2007-01-01

    A kind of Rn/γ passive personal dosimeter named type KF606B has been developed in BRICEM. The dosimeter adopts CR39 for Rn measurement and TLD(Mg, Cu, P) for γ measurement. Some special designs of the dosimeter have been made including Rn switch (to proof environmental Rn exposure while not in use), water and dust proof, etc. The dosimeter was tested in laboratory and in underground mines, some advantages are presented of suitable sensitivity, lower detection limit, wide environment applicability, pocket size and easy to use, etc. The dosimeter has widely been applying to personal dose monitoring for Uranium miners, coal miners and radon survey in dwellings in China. (authors)

  4. Probiotic Mixture KF Attenuates Age-Dependent Memory Deficit and Lipidemia in Fischer 344 Rats.

    Science.gov (United States)

    Jeong, Jin-Ju; Kim, Kyung-Ah; Ahn, Young-Tae; Sim, Jae-Hun; Woo, Jae-Yeon; Huh, Chul-Sung; Kim, Dong-Hyun

    2015-09-01

    To investigate the memory-enhancing effect of lactic acid bacteria, we selected the probiotic mixture KF, which consisted of Lactobacillus plantarum KY1032 and Lactobacillus curvatus HY7601 (1 × 10(11) CFU/g of each strain), and investigated its antilipidemic and memoryenhancing effects in aged Fischer 344 rats. KF (1 × 10(10) CFU/rat/day), which was administered orally once a day (6 days per week) for 8 weeks, significantly inhibited age-dependent increases of blood triglyceride and reductions of HDL cholesterol (p KF restored agereduced spontaneous alternation in the Y-maze task to 94.4% of that seen in young rats (p KF treatment slightly, but not significantly, shortened the escape latency daily for 4 days. Oral administration of KF restored age-suppressed doublecortin and brain-derived neurotrophic factor expression in aged rats. Orally administered KF suppressed the expression of p16, p53, and cyclooxygenase-2, the phosphorylation of Akt and mTOR, and the activation of NF-κB in the hippocampus of the brain. These findings suggest that KF may ameliorate age-dependent memory deficit and lipidemia by inhibiting NF-κB activation.

  5. Mitigating Observation Perturbation Sampling Errors in the Stochastic EnKF

    KAUST Repository

    Hoteit, Ibrahim

    2015-03-17

    The stochastic ensemble Kalman filter (EnKF) updates its ensemble members with observations perturbed with noise sampled from the distribution of the observational errors. This was shown to introduce noise into the system and may become pronounced when the ensemble size is smaller than the rank of the observational error covariance, which is often the case in real oceanic and atmospheric data assimilation applications. This work introduces an efficient serial scheme to mitigate the impact of observations’ perturbations sampling in the analysis step of the EnKF, which should provide more accurate ensemble estimates of the analysis error covariance matrices. The new scheme is simple to implement within the serial EnKF algorithm, requiring only the approximation of the EnKF sample forecast error covariance matrix by a matrix with one rank less. The new EnKF scheme is implemented and tested with the Lorenz-96 model. Results from numerical experiments are conducted to compare its performance with the EnKF and two standard deterministic EnKFs. This study shows that the new scheme enhances the behavior of the EnKF and may lead to better performance than the deterministic EnKFs even when implemented with relatively small ensembles.

  6. CS Circles: An In-Browser Python Course for Beginners

    OpenAIRE

    Pritchard, David; Vasiga, Troy

    2012-01-01

    Computer Science Circles is a free programming website for beginners that is designed to be fun, easy to use, and accessible to the broadest possible audience. We teach Python since it is simple yet powerful, and the course content is well-structured but written in plain language. The website has over one hundred exercises in thirty lesson pages, plus special features to help teachers support their students. It is available in both English and French. We discuss the philosophy behind the cour...

  7. Zend framework 2.0 by example beginner's guide

    CERN Document Server

    Shasankar, Krishna

    2013-01-01

    Zend Framework 2.0 by Example: Beginner's Guide is a step-by-step guide that aims to empower you to build web applications packed with some really exciting features using Zend Framework 2.0.If you are a PHP Developer who is new to Zend Framework, but you want to get hands-on with the product quickly, this book is for you. Basic knowledge of object oriented programming with PHP is expected.

  8. New KF-PP-SVM classification method for EEG in brain-computer interfaces.

    Science.gov (United States)

    Yang, Banghua; Han, Zhijun; Zan, Peng; Wang, Qian

    2014-01-01

    Classification methods are a crucial direction in the current study of brain-computer interfaces (BCIs). To improve the classification accuracy for electroencephalogram (EEG) signals, a novel KF-PP-SVM (kernel fisher, posterior probability, and support vector machine) classification method is developed. Its detailed process entails the use of common spatial patterns to obtain features, based on which the within-class scatter is calculated. Then the scatter is added into the kernel function of a radial basis function to construct a new kernel function. This new kernel is integrated into the SVM to obtain a new classification model. Finally, the output of SVM is calculated based on posterior probability and the final recognition result is obtained. To evaluate the effectiveness of the proposed KF-PP-SVM method, EEG data collected from laboratory are processed with four different classification schemes (KF-PP-SVM, KF-SVM, PP-SVM, and SVM). The results showed that the overall average improvements arising from the use of the KF-PP-SVM scheme as opposed to KF-SVM, PP-SVM and SVM schemes are 2.49%, 5.83 % and 6.49 % respectively.

  9. Nuclear fusion project. Semi-annual report of the Association KfK/EURATOM

    International Nuclear Information System (INIS)

    1986-11-01

    Nuclear fusion is one of the main activities of the Karlsruhe Nuclear Research Center (KfK). It is organized as a project under the Directorate of Reactor Development and Safety. The work of KfK concentrates on technology aspects of nuclear fusion with magnetic confinement. It is part of the European Fusion Programme where KfK participates as an association to EURATOM. Close links have been established to the Max Planck Institute for Plasma Physics (IPP). In the Entwicklungsgemeinschaft Kernfusion KfK and IPP cooperate for the development of future fusion experiments joining the experience gained in plasma physics (IPP) and materials, safety, and nuclear technology (KfK), respectively. As in the present strategy of the European Fusion Programme the Next European Tokamak (NET) is foreseen as the major next step, most of the activities of KfK address this subject. In addition to the contributions to NET, studies are carried out to innovate INTOR, the worldwide cooperation for an experimental reactor under the auspices of IAEA. Furthermore, the Entwicklungsgemeinschaft Kernfusion has evaluated the feasibility of a fusion reactor with a stellarator confinement. (orig./GG)

  10. Discovering SQL A Hands-On Guide for Beginners

    CERN Document Server

    Kriegel, Alex

    2011-01-01

    Teaching the SQL skills that businesses demand when hiring programmers If you're a SQL beginner, you don't just want to learn SQL basics, you also want to get some practical SQL skills you can use in the job market. This book gives you both. Covering the basics through intermediate topics with clear explanations, hands-on exercises, and helpful solutions, this book is the perfect introduction to SQL. Topics include both the current SQL:2008 standards, the upcoming SQL:2011 standards, and also how to use SQL against current releases of the most popular commercial SQL databases, such as Oracle,

  11. iClone 431 3D Animation Beginner's Guide

    CERN Document Server

    McCallum, MD

    2011-01-01

    This book is a part of the Beginner's guide series, wherein you will quickly start doing tasks with precise instructions. Then the tasks will be followed by explanation and then a challenging task or a multiple choice question about the topic just covered. Do you have a story to tell or an idea to illustrate? This book is aimed at film makers, video producers/compositors, vxf artists or 3D artists/designers like you who have no previous experience with iClone. If you have that drive inside you to entertain people via the internet on sites like YouTube or Vimeo, create a superb presentation vid

  12. Vaadin 7 UI design by example beginner's guide

    CERN Document Server

    Duarte, Alejandro

    2013-01-01

    This book is a hands-on Beginner's Guide for developers who are new to Vaadin and/or Vaadin UI components. The book will teach readers through examples to use each of the exciting components to build and add various aspects of the user interface to their web apps.If you have experience with the Java language and want to create web applications that look good without having to deal with HTML, XML, and JavaScript, this book is for you. Basic Java programming skills are required, but no web development knowledge is needed at all.

  13. A Proposal of a Color Music Notation System on a Single Melody for Music Beginners

    Science.gov (United States)

    Kuo, Yi-Ting; Chuang, Ming-Chuen

    2013-01-01

    Music teachers often encounter obstructions in teaching beginners in music reading. Conventional notational symbols require beginners to spend significant amount of time in memorizing, which discourages learning at early stage. This article proposes a newly-developed color music notation system that may improve the recognition of the staff and the…

  14. Genomic characteristics and comparative genomics analysis of Penicillium chrysogenum KF-25.

    Science.gov (United States)

    Peng, Qin; Yuan, Yihui; Gao, Meiying; Chen, Xupeng; Liu, Biao; Liu, Pengming; Wu, Yan; Wu, Dandan

    2014-02-21

    Penicillium chrysogenum has been used in producing penicillin and derived β-lactam antibiotics for many years. Although the genome of the mutant strain P. chrysogenum Wisconsin 54-1255 has already been sequenced, the versatility and genetic diversity of this species still needs to be intensively studied. In this study, the genome of the wild-type P. chrysogenum strain KF-25, which has high activity against Ustilaginoidea virens, was sequenced and characterized. The genome of KF-25 was about 29.9 Mb in size and contained 9,804 putative open reading frames (orfs). Thirteen genes were predicted to encode two-component system proteins, of which six were putatively involved in osmolarity adaption. There were 33 putative secondary metabolism pathways and numerous genes that were essential in metabolite biosynthesis. Several P. chrysogenum virus untranslated region sequences were found in the KF-25 genome, suggesting that there might be a relationship between the virus and P. chrysogenum in evolution. Comparative genome analysis showed that the genomes of KF-25 and Wisconsin 54-1255 were highly similar, except that KF-25 was 2.3 Mb smaller. Three hundred and fifty-five KF-25 specific genes were found and the biological functions of the proteins encoded by these genes were mainly unknown (232, representing 65%), except for some orfs encoding proteins with predicted functions in transport, metabolism, and signal transduction. Numerous KF-25-specific genes were found to be associated with the pathogenicity and virulence of the strains, which were identical to those of wild-type P. chrysogenum NRRL 1951. Genome sequencing and comparative analysis are helpful in further understanding the biology, evolution, and environment adaption of P. chrysogenum, and provide a new tool for identifying further functional metabolites.

  15. Influence of KF substitution on the ferroelectric phase transition of lead titanate single crystals studied by Brillouin light scattering

    Directory of Open Access Journals (Sweden)

    Seonhyeop Shin

    2015-06-01

    Full Text Available The elastic properties of KF-substituted perovskite lead titanate (PbTiO3 were investigated by dielectric measurements and Brillouin light scattering. The ferroelectric phase transition occurred at substantially lower temperature due to KF substitution, which was attributed to the modification of the covalency in Pb–O and Ti–O bonds. The longitudinal acoustic (LA mode of KF-substituted PbTiO3 showed a frequency softening in the paraelectric phase, which was accompanied by increasing acoustic damping. This indicated that polarization fluctuations responsible for the acoustic anomalies were enhanced by KF substitution.

  16. Thermal conductivity of molten alkali metal fluorides (LiF, NaF, KF) and their mixtures.

    Science.gov (United States)

    Ishii, Yoshiki; Sato, Keisuke; Salanne, Mathieu; Madden, Paul A; Ohtori, Norikazu

    2014-03-27

    The thermal conductivities of molten alkali fluorides (LiF, NaF, and KF) and their mixtures (LiF-NaF, LiF-KF, and NaF-KF binaries and LiF-NaF-KF ternary) are predicted using molecular dynamics simulation with the Green-Kubo method. A polarizable ion model is used to describe the interionic interactions. All the systems except LiF-KF and LiF-NaF-KF mixtures follow a scaling law: it is proportionnal to mA (-1/2)(N/V)(2/3), where mA is the arithmetic average of the ionic species masses in a given melt and N is the total number of ions included in the system volume V. In LiF-KF and LiF-NaF-KF mixtures a significant departure from the scaling law is observed. By examining separately the effects of the cation mass and size asymmetry in LiF-KF mixtures, we show that both of them account for half of the deviation. Finally, we observe that the temperature dependence of the thermal conductivity is very small in these molten fluorides.

  17. Research on Warehouse Target Localization and Tracking Based on KF and WSN

    Directory of Open Access Journals (Sweden)

    Guang-Rong BIAN

    2014-01-01

    Full Text Available This paper firstly established the model of warehouse targeting and tracking system based on Wireless Sensor Networks (WSN. The principle of Location and tracking is based on the maximum likelihood estimation method of multilateral measurement. According to monitoring motion trajectory of the same unknown target node within a continuous period of time, the motion equation can be established. It can achieve the effective tracking of warehouse target that KF algorithm is applied to carrying out the state estimation of warehouse target motion equation. Simulation results show that, while the warehouse target tracking system state equations are linear, using KF algorithm can obtain satisfactory tracking accuracy.

  18. A guide to MATLAB for beginners and experienced users

    CERN Document Server

    Hunt, Brian R; Rosenberg, Jonathan M

    2014-01-01

    Now in its third edition, this outstanding textbook explains everything you need to get started using MATLAB®. It contains concise explanations of essential MATLAB commands, as well as easily understood instructions for using MATLAB's programming features, graphical capabilities, simulation models, and rich desktop interface. MATLAB 8 and its new user interface is treated extensively in the book. New features in this edition include: a complete treatment of MATLAB's publish feature; new material on MATLAB graphics, enabling the user to master quickly the various symbolic and numerical plotting routines; and a robust presentation of MuPAD® and how to use it as a stand-alone platform. The authors have also updated the text throughout, reworking examples and exploring new applications. The book is essential reading for beginners, occasional users and experienced users wishing to brush up their skills. Further resources are available from the authors' website at www-math.umd.edu/schol/a-guide-to-matlab.html.

  19. Draft Genome Sequence of Cupriavidus pauculus Strain KF709, a Biphenyl-Utilizing Bacterium Isolated from Biphenyl-Contaminated Soil.

    Science.gov (United States)

    Watanabe, Takahito; Yamazoe, Atsushi; Hosoyama, Akira; Fujihara, Hidehiko; Suenaga, Hikaru; Hirose, Jun; Futagami, Taiki; Goto, Masatoshi; Kimura, Nobutada; Furukawa, Kensuke

    2015-03-26

    We report the draft genome sequence of Cupriavidus pauculus strain KF709, which comprises 6,826,799 bp with 6,272 coding sequences. The strain KF709 utilizes biphenyl and degrades low-chlorinated biphenyls; however, it possesses fewer coding sequences involved in the degradation of aromatic compounds than other strains belonging to the Betaproteobacteria. Copyright © 2015 Watanabe et al.

  20. Draft Genome Sequence of Cupriavidus pauculus Strain KF709, a Biphenyl-Utilizing Bacterium Isolated from Biphenyl-Contaminated Soil

    OpenAIRE

    Watanabe, Takahito; Yamazoe, Atsushi; Hosoyama, Akira; Fujihara, Hidehiko; Suenaga, Hikaru; Hirose, Jun; Futagami, Taiki; Goto, Masatoshi; Kimura, Nobutada; Furukawa, Kensuke

    2015-01-01

    We report the draft genome sequence of Cupriavidus pauculus strain KF709, which comprises 6,826,799 bp with 6,272 coding sequences. The strain KF709 utilizes biphenyl and degrades low-chlorinated biphenyls; however, it possesses fewer coding sequences involved in the degradation of aromatic compounds than other strains belonging to the Betaproteobacteria.

  1. Draft Genome Sequence of Paenibacillus polymyxa KF-1, an Excellent Producer of Microbicides.

    Science.gov (United States)

    Li, Yumei; Li, Qiang; Li, Yamei; Gao, Juan; Fan, Xiangyu

    2016-08-04

    We report here the draft genome sequence of Paenibacillus polymyxa KF-1, which exhibits excellent antimicrobial activity. It encodes the synthase of bacitracin, kalimantacin, bacillomycin, iturin, fusaricidin, tridecaptin, and pelgipeptin and biosynthetic pathways of antiviral curldan and levan polysaccharides. Also, a novel prophage is involved in this genome that contains endolysin-encoding genes. Copyright © 2016 Li et al.

  2. Solubility of KF and NaCl in water by molecular simulation.

    Science.gov (United States)

    Sanz, E; Vega, C

    2007-01-07

    The solubility of two ionic salts, namely, KF and NaCl, in water has been calculated by Monte Carlo molecular simulation. Water has been modeled with the extended simple point charge model (SPC/E), ions with the Tosi-Fumi model and the interaction between water and ions with the Smith-Dang model. The chemical potential of the solute in the solution has been computed as the derivative of the total free energy with respect to the number of solute particles. The chemical potential of the solute in the solid phase has been calculated by thermodynamic integration to an Einstein crystal. The solubility of the salt has been calculated as the concentration at which the chemical potential of the salt in the solution becomes identical to that of the pure solid. The methodology used in this work has been tested by reproducing the results for the solubility of KF determined previously by Ferrario et al. [J. Chem. Phys. 117, 4947 (2002)]. For KF, it was found that the solubility of the model is only in qualitative agreement with experiment. The variation of the solubility with temperature for KF has also been studied. For NaCl, the potential model used predicts a solubility in good agreement with the experimental value. The same is true for the hydration chemical potential at infinite dilution. Given the practical importance of solutions of NaCl in water the model used in this work, whereas simple, can be of interest for future studies.

  3. Complete Genome Sequences of Edwardsiella tarda-Lytic Bacteriophages KF-1 and IW-1.

    Science.gov (United States)

    Yasuike, Motoshige; Sugaya, Emi; Nakamura, Yoji; Shigenobu, Yuya; Kawato, Yasuhiko; Kai, Wataru; Fujiwara, Atushi; Sano, Motohiko; Kobayashi, Takanori; Nakai, Toshihiro

    2013-01-01

    We report the complete genome sequences of two Edwardsiella tarda-lytic bacteriophages isolated from flounder kidney (KF-1) and seawater (IW-1). These newly sequenced phage genomes provide a novel resource for future studies on phage-host interaction mechanisms and various applications of the phages for control of edwardsiellosis in aquaculture.

  4. Nuclear fusion project. Semi-annual report of the Association KfK/EURATOM

    International Nuclear Information System (INIS)

    Kast, G.

    1988-07-01

    Short communications give a survey of 38 technology tasks, the development of ECRH power sources at 150 GHz, and 9 NET study are listed in the appendices I and II, respectively, while the KfK departments contributing to the Fusion Project and the Fusion Project Management Staff are listed in appendices III and IV, respectively. (GG)

  5. OXIDATION OF POLYCHLORINATED BIPHENYLS BY PSEUDOMONAS SP. STRAIN LB400 AND PSEUDOMONAS PSEUDOALCALIGENES KF707

    Science.gov (United States)

    Biphenyl-grown cells and cell extracts prepared from biphenyl-grown cells of Pseudomonas sp. strain LB400 oxidize a much wider range of chlorinated biphenyls than do analogous preparations from Pseudomonas pseudoalcaligenes KF707. These results are attributed to differences in th...

  6. KfK-seminar series on supercomputing und visualization from May till September 1992

    International Nuclear Information System (INIS)

    Hohenhinnebusch, W.

    1993-05-01

    During the period of may 1992 to september 1992 a series of seminars was held at KfK on several topics of supercomputing in different fields of application. The aim was to demonstrate the importance of supercomputing and visualization in numerical simulations of complex physical and technical phenomena. This report contains the collection of all submitted seminar papers. (orig./HP) [de

  7. Joint Parametric Fault Diagnosis and State Estimation Using KF-ML Method

    DEFF Research Database (Denmark)

    Sun, Zhen; Yang, Zhenyu

    2014-01-01

    The paper proposes a new method for a kind of parametric fault online diagnosis with state estimation jointly. The considered fault affects not only the deterministic part of the system but also the random circumstance. The proposed method first applies Kalman Filter (KF) and Maximum Likelihood (...

  8. What are the important manoeuvres for beginners to minimize surgical time in primary total knee arthroplasty?

    Science.gov (United States)

    Harato, Kengo; Maeno, Shinichi; Tanikawa, Hidenori; Kaneda, Kazuya; Morishige, Yutaro; Nomoto, So; Niki, Yasuo

    2016-08-01

    It was hypothesized that surgical time of beginners would be much longer than that of experts. Our purpose was to investigate and clarify the important manoeuvres for beginners to minimize surgical time in primary total knee arthroplasty (TKA) as a multicentre study. A total of 300 knees in 248 patients (averaged 74.6 years) were enrolled. All TKAs were done using the same instruments and the same measured resection technique at 14 facilities by 25 orthopaedic surgeons. Surgeons were divided into three surgeon groups (four experts, nine medium-volume surgeons and 12 beginners). The surgical technique was divided into five phases. Detailed surgical time and ratio of the time in each phase to overall surgical time were recorded and compared among the groups in each phase. A total of 62, 119, and 119 TKAs were done by beginners, medium-volume surgeons, and experts, respectively. Significant differences in surgical time among the groups were seen in each phase. Concerning the ratio of the time, experts and medium-volume surgeons seemed cautious in fixation of the permanent component compared to other phases. Interestingly, even in ratio, beginners and medium-volume surgeons took more time in exposure of soft tissue compared to experts. (0.14 in beginners, 0.13 in medium-volume surgeons, 0.11 in experts, P time in exposure and closure of soft tissue compared to experts. Improvement in basic technique is essential to minimize surgical time among beginners. First of all, surgical instructors should teach basic techniques in primary TKA for beginners. Therapeutic studies, Level IV.

  9. The Development of a Hybrid EnKF-3DVAR Algorithm for Storm-Scale Data Assimilation

    Directory of Open Access Journals (Sweden)

    Jidong Gao

    2013-01-01

    Full Text Available A hybrid 3DVAR-EnKF data assimilation algorithm is developed based on 3DVAR and ensemble Kalman filter (EnKF programs within the Advanced Regional Prediction System (ARPS. The hybrid algorithm uses the extended alpha control variable approach to combine the static and ensemble-derived flow-dependent forecast error covariances. The hybrid variational analysis is performed using an equal weighting of static and flow-dependent error covariance as derived from ensemble forecasts. The method is first applied to the assimilation of simulated radar data for a supercell storm. Results obtained using 3DVAR (with static covariance entirely, hybrid 3DVAR-EnKF, and the EnKF are compared. When data from a single radar are used, the EnKF method provides the best results for the model dynamic variables, while the hybrid method provides the best results for hydrometeor related variables in term of rms errors. Although storm structures can be established reasonably well using 3DVAR, the rms errors are generally worse than seen from the other two methods. With two radars, the results from 3DVAR are closer to those from EnKF. Our tests indicate that the hybrid scheme can reduce the storm spin-up time because it fits the observations, especially the reflectivity observations, better than the EnKF and the 3DVAR at the beginning of the assimilation cycles.

  10. Moving forward: Revisiting the Spanish for High Beginners course

    Directory of Open Access Journals (Sweden)

    Flavia Belpoliti

    2015-08-01

    Full Text Available This paper presents a case study on the redesign of a Spanish for High Beginners (SHB course at a large metropolitan university in Texas, USA. The first section presents a discussion on the diverse nature of students who can benefit from an intensive first-year Spanish course and the challenges that these learners’ mixed abilities pose for instruction. The second section describes the redesign process of the SHB course, including placement procedures, the Spanish Language Program sequence, and changes in the syllabus to integrate communicative and transcultural competences by implementing a combination of focused instruction, collaborative learning and task-based approaches. The last section introduces a short presentation of four activities implemented in the redesigned course, which provide paths for future development of advanced beginners’ integrative tasks. The final section focuses on the results of an exit survey measuring students’ perceptions of the course. The successful implementation of changes and its outcomes demonstrate that this course could be a relevant solution for Spanish programs at tertiary institutions with diverse populations, helping to solve challenges of placement, articulation, and time-to-graduation effectiveness.

  11. A stargazing program for beginners a pocket field guide

    CERN Document Server

    Carter, Jamie

    2015-01-01

     By investing just an hour a week and $50 in binoculars, it’s possible to learn a few simple techniques and quickly gain a real insight into the night sky's ever-changing patterns – and what they tell us about Earth, the seasons and ourselves. Searching more for a learned appreciation of nature and our exact place within the cosmos than academic scientific knowledge, science and travel writer Jamie Carter takes the reader on a 12 month tour of the night sky's incredible annual rhythms that say so much about Earth. During the journey he learns about the celestial mechanics at work in the skies above that are – to the beginner – almost beyond belief. As well as the vital constellations and clusters, and the weird and wonderful nebulas, he searches out “dark sky destinations” across the globe that help increase knowledge and give a new perspective on familiar night sky sights. On the journey he witnesses a solar eclipse and grapples with star-charts, binoculars, smartphone apps, telescopes, spots sa...

  12. TOPICAL CASUAL TALKS AS RESPONSIVE LISTENING AND SPEAKING PERFORMANCES OF BEGINNERS

    Directory of Open Access Journals (Sweden)

    Taranindya Zulhi Amalia

    2017-04-01

    Full Text Available Global communication concern brings human to be familiar with English as early as possible. Nowadays beginner students started English orally in elementary school even kindergarten. At this moment, they dealth with listening and speaking skills and put them into practice. When they came down to English, some beginners feel uncomfortable in their learning because of facing formal situation. The beginners who were typically keen on playing and having fun comfortably could not be treated in teaching-learning that was usually presented to intermediate level or adult. Teachers had to create informal situation so that they were more relaxed and got chemistry one another. Dealing with comfortable zone put into informal situation in listening and speaking practices for the beginners, this study focused on topical casual talks. It set up a relaxed spot in order to explore effective communication related to their subject matters. The teachers/tutors could apply one of classroom listening and speaking performance types, responsive. This study used qualitative approach. While it refered to library research. The primary source was Elementary School Silabus. Whereas the secondary data sources were English teaching-learning books. This issue discussed about listening and speaking skills for beginners. The beginners classified into age 6-8. In listening section, the students processed teacher talk instantly. Afterwards in speaking, suitable direct short response answered the teacher talk. This action could be assessed by subjective test in the form of wh-questions and short answers test. Ultimately, the next comparable studies may converse different competences and performances for beginners or any levels.

  13. Spectroscopic and thermal investigations of the fluoroaluminate complex formation in NaF-KF and LiF-NaF-KF eutectics.

    Science.gov (United States)

    von Barner, J H; Bessada, C; Berg, R W

    2003-03-24

    The dissolution and complex formation of fluoroaluminates in two eutectic alkalifluoride mixtures, NaF-KF (FNAK) and LiF-NaF-KF (FLINAK), have been investigated by Raman, NMR, and thermal analysis. Melting and dissolution took place stepwise. The eutectic alkalifluoride mixtures with minor amounts of dissolved fluoroaluminate salts started melting at around 460 and 740 degrees C for FLINAK and FNAK mixtures, respectively. Total melting/dissolution of mixtures with 9-11 mol % aluminum fluoro salts added took place near 780 degrees C in the FLINAK solvent and at approximately 900 degrees C for FNAK solutions. The solidified melts were characterized by Raman bands at 561 (nu(1)), 391 (nu(2)), and 328 cm(-1) (nu(5)) and a (27)Al NMR chemical shift near 0 ppm originating from isolated AlF(6)(3-) octahedral ions. The Raman and NMR signals due to AlF(6)(3-) were also observed at temperatures where the samples were only partly melted. Upon total melting, a pronounced dissociation of AlF(6)(3-) into AlF(5)(2-) and fluoride ions took place. At even higher temperatures, the equilibrium was displaced in favor of AlF(5)(2-) in the FNAK solvent. The AlF(5)(2-) ion was characterized by an intensive Raman band at 558 cm(-1) and an increasingly positive (27)Al chemical shift with raising temperature, e.g., of 16 ppm at 935 degrees C.

  14. Velocity of sound in, and adiabatic compressibility of, Molten LiF-NaF, LiF-KF, NaF-KF mixtures

    International Nuclear Information System (INIS)

    Minchenko, V.I.; Konovalov, Y.V.; Smirnov, M.V.

    1986-01-01

    The authors measured the velocity of sound as a function of temperature at 1.5 zHM frequency in LiF-NaF, NaF-KF, LiF-KF melts over the entire range of their compositions. The measurements were made by comparison of the phases of a reference pulse signal and a signal reflected from the bottom of the crucible. The specified temperatures were maintained constant within plus or minus 1 degree. The sound conductor consisted of a cylindrical rod of sintered beryllium oxide, which does not interact with test melts. The study shows that the velocity of sound decreases linearly with increase of the temperature. The values of the constants of the empirical equations are presented in a table, with indication of the temperature range. The dependence of the velocity of sound on composition of the melts is shown, where isotherms for 1250 K are given as an example. Variation of the composition by 1-2 mole % leads to increase or decrease of the velocity of sound by 5-10 m

  15. KF addition to Cu2SnS3 thin films prepared by sulfurization process

    Science.gov (United States)

    Nakashima, Mitsuki; Fujimoto, Junya; Yamaguchi, Toshiyuki; Sasano, Junji; Izaki, Masanobu

    2017-04-01

    Cu2SnS3 thin films were fabricated by sulfurization with KF addition and applied to photovoltaic devices. Two methods, two-stage annealing and the use of four-layer precursors, were employed, and the quantity of NaF and KF and the annealing temperature were changed. By electron probe microanalysis (EPMA), the Cu/Sn mole ratio was found to range from 0.81 to 1.51. The X-ray diffraction (XRD) patterns and Raman spectra indicated that the fabricated thin films had a monoclinic Cu2SnS3 structure. The Cu2SnS3 thin films fabricated by two-stage annealing had a close-packed structure and a pinhole-free surface morphology. The best solar cell in this study showed V oc of 293 mV, which surpassed the previously reported value.

  16. Electric conductivity of molten mixtures of ternary mutual KF-KCl-ZrF4 system

    International Nuclear Information System (INIS)

    Darienko, S.E.; Raspopin, S.P.; Chervinskij, Yu.F.

    1988-01-01

    Using the relative capillary method at the frequency of 50 kHz the specific electric conductivity of molten mixtures of the KF-KCl-ZnF 4 system is measured. All the measurements were made in the atmosphere of purified argon. Temperature dependence of electric conductivity of the mixtures studied (800-1260 K) is described by the equations of exponential type with sufficient accuracy. Curves of identical specific electric conductivity of the three-component system are presented. With an increase in zirconium tetrachloride concentration in the mixtures electric conductivity of the melts decreases. On the basis of the measurement results of KF-ZrF 4 and KCl-ZrF 4 molten mixture specific electric conductivity and data on the melt density the values of molar electric conductivity at 1200 K are calculated

  17. Nuclear Fusion Project. Semi-annual report of the Association KfK/EURATOM

    International Nuclear Information System (INIS)

    Kast, G.

    1987-12-01

    Short communications give a survey of 38 technology tasks, the development of ECRH power sources at 150 GHz, and 8 NET study contracts. The fusion technology contracts and the NET contracts are listed in the appendices I and II, respectively, while the KfK departments contributing to the Fusion Project and the Fusion Project Management Staff are listed in appendices III and IV, respectively. (GG)

  18. Nuclear fusion project. Semi-annual report of the Association KfK/EURATOM

    International Nuclear Information System (INIS)

    Kast, G.

    1987-05-01

    This semi-annual report gives 36 short descriptions of the work done in the framework of the Nuclear Fusion Project and outlines studies for NET/INTOR and for ECRH power sources at 150 GHz. Tables of fusion technology contracts, of NET contracts, of KfK departments contributing to the Fusion Project, and of the Fusion Project management staff complete this report. (GG)

  19. Ensemble singular vectors and their use as additive inflation in EnKF

    Directory of Open Access Journals (Sweden)

    Shu-Chih Yang

    2015-07-01

    Full Text Available Given an ensemble of forecasts, it is possible to determine the leading ensemble singular vector (ESV, that is, the linear combination of the forecasts that, given the choice of the perturbation norm and forecast interval, will maximise the growth of the perturbations. Because the ESV indicates the directions of the fastest growing forecast errors, we explore the potential of applying the leading ESVs in ensemble Kalman filter (EnKF for correcting fast-growing errors. The ESVs are derived based on a quasi-geostrophic multi-level channel model, and data assimilation experiments are carried out under framework of the local ensemble transform Kalman filter. We confirm that even during the early spin-up starting with random initial conditions, the final ESVs of the first analysis with a 12-h window are strongly related to the background errors. Since initial ensemble singular vectors (IESVs grow much faster than Lyapunov Vectors (LVs, and the final ensemble singular vectors (FESVs are close to convergence to leading LVs, perturbations based on leading IESVs grow faster than those based on FESVs, and are therefore preferable as additive inflation. The IESVs are applied in the EnKF framework for constructing flow-dependent additive perturbations to inflate the analysis ensemble. Compared with using random perturbations as additive inflation, a positive impact from using ESVs is found especially in areas with large growing errors. When an EnKF is ‘cold-started’ from random perturbations and poor initial condition, results indicate that using the ESVs as additive inflation has the advantage of correcting large errors so that the spin-up of the EnKF can be accelerated.

  20. Preparation of diethylene glycol monomethyl ether monolaurate catalyzed by active carbon supported KF/CaO.

    Science.gov (United States)

    Lou, Shengfeng; Jia, Lihua; Guo, Xiangfeng; Wu, Ping; Gao, Lianbing; Wang, Jianjun

    2015-01-01

    Diethylene glycol monomethyl ether monolaurate (DGMEML) was synthesized via the reaction of diethylene glycol monomethyl ether (DGME) with methyl laurate (ML) by a new solid base catalyst of KF/CaO/AC, which was prepared by impregnation method using active carbon as carrier. The catalysts were characterized by X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FT-IR), scanning electron microscopy (SEM), nitrogen physisorption-desorption and Hammett indicator methods; the effect of the mole ratio of KF to CaO, DGME to ML molar ratio, amount of catalyst, reaction time and temperature on the yield of DGMEML were studied; and the relationship between the structure of the catalyst and the yield of DGMEML was investigated. The formed KCaF3 and K2O were acting as the main active components in the catalytic transesterification; the highest yield of 96.3 % was obtained as KF-to-CaO molar ratio of 2.0, DGME to ML molar ratio of 4.0, catalyst amount of 5 wt%, and reaction time of 30 min at 75 °C; and the catalyst displayed good stability in the transesterification.

  1. A Systematic Comparison of Particle Filter and EnKF in Assimilating Time-Averaged Observations

    Science.gov (United States)

    Liu, Huaran; Liu, Zhengyu; Lu, Feiyu

    2017-12-01

    The particle filter (PF) and the ensemble Kalman filter (EnKF) are two promising and popularly adopted types of ensemble-based data assimilation methods for paleoclimate reconstruction. However, no systematic comparison between them has been attempted. We compare these two uncertainty based methods in pseudoproxy experiments where synthetic seasonal mean sea surface temperature observations are assimilated. Their skills are evaluated with regards to local, hemispherically averaged and globally averaged analysis error, and their ability to capture large-scale modes of variability. It is found that the EAKF (Ensemble Adjustment Kalman filter, a variant of EnKF) performs better than the PF with only one third of the ensemble size, despite PF's theoretical superiority in allowing for non-Gaussian statistics and nonlinear dynamics. The success of the EAKF is attributed to the facts that (1) Gaussian assumption is somewhat appropriate for this application; (2) The EAKF is less sensitive to sampling errors than the PF due to the different methodological natures. Sixteen members are enough to estimate accurate covariance for the EAKF, but 48 (even 96) members still underrepresent the state space of high-dimensional system for the PF. Our study highlights the importance of a large localization radius in the application of the EnKF to paleoclimate reconstruction due to the sparse proxy network and suggests that additional techniques, such as localization or clustered particle filter, are needed to improve the PF for paleoclimate reconstruction, in addition to the simple importance resampling currently adopted by most research.

  2. Getting started with taiji: investigating students expectations and teachers appraisals of taiji beginners courses.

    Science.gov (United States)

    Nedeljkovic, Marko; Bürgler, Christina; Wirtz, Petra H; Seiler, Roland; Streitberger, Konrad M; Ausfeld-Hafter, Brigitte

    2012-01-01

    In recent years, Taiji has been frequently investigated and considered as a stress management intervention. Although health care providers' appraisals and consumers' expectations are regarded as essential for treatment outcome, little attention has been drawn to this issue in Taiji research. In our study we have conducted two surveys to explore beginners' (n = 74) expectations and teachers' (n = 136) appraisals of their Taiji courses in general as well as more particularly related to stress management. Qualitative data analysis revealed that beginners mainly expected to learn a new method that is applicable in their daily life to foster peace of mind and to enhance their stress management. Congruently moderate-to-high improvements in stress management have also been found in quantitative analysis, whereby a lower educational level predicted higher expectations (P = 0.016). Taiji-teachers stated body- and mind-related benefits most frequently and appraised moderate-to-high improvements in stress management. Higher appraisals were predicted by a shorter teaching experience (P = 0.024). Our results inform about beginners' expectations and teachers' appraisals related to a Taiji-beginners course and highlight the role of educational background and teaching experience in shaping stress-management-related beginners' expectations and teachers' appraisals.

  3. Three stitch hernioplasty: A novel technique for beginners

    Science.gov (United States)

    Patchayappan, Manikandan; Narayanasamy, Sangara Narayanan; Duraisamy, Nagarajan

    2015-01-01

    Objective: To analyze mesh fixation with minimum sutures and postoperative complications. Study Design: Prospective study. Place and Duration of Study: Department of General Surgery, Thanjavur Medical College and Hospital, Tamil Nadu, from July 2010 to June 2012. Materials and Methods: All inguinal hernia patients, who fulfilled the sample selection criteria, were admitted and planned for surgery. The prolene mesh is fashioned as in Lichtenstein's repair, placed and fixed only by three prolene stitches. The first stitch is made in the periosteum of pubic tubercle. The second stitch is taken in the inguinal ligament (1.5 cm lateral to the pubic tubercle) and the third stitch is from the medial most part of the conjoint tendon, that is, the mesh is fixed in the medial aspect alone. Results: Majority of the patients fall between the age group of 40 and 60 (72%) years and all are male patients. Of the total cases, 50% were right sided, 25% were left sided, and 25% were bilateral. Of the postoperative complications, 12% had seroma, 4% had hematoma, 2% developed surgical site infection, 2% developed chronic groin pain, 1% presented with recurrence, and none developed foreign body sinus. Conclusion: The incidence of long-term complications of three stitch hernioplasty are comparable to that of the other standard, tension-free open hernia repair as well as other laparoscopic procedures. Moreover, the three stitch hernioplasty method is a simple method, easy for the beginners to adopt, has less foreign body reaction, less time consuming, causes less tissue trauma, and lesser chance for vascular injury. PMID:26629464

  4. Evaluation of EnKF and Variants on the PUNQ-S3 Case Évaluation de l’EnKF et des variantes du cas PUNQ-S3

    Directory of Open Access Journals (Sweden)

    Valestrand R.

    2012-11-01

    Full Text Available Over the last decade the ensemble Kalman filter (EnKF has attracted attention as a promising method for solving the reservoir history matching problem: updating model parameters so that the model output matches the measured production data. The method possesses unique qualities, such as; it provides real-time updates and uncertainty quantification of the estimate, it can estimate any physical property at hand and it is easy to implement. The method does, however, have its limitations; in particular, it is derived based on an assumption of a Gaussian distribution of variables and measurement errors. Several refinements have been proposed to overcome the shortcomings of the EnKF. These refinements are, however, mainly tested on synthetic cases addressing one shortcoming at a time, not containing or combining the complexity and the high nonlinearity of a real field case. In this paper, we investigate some of the refined methods on a nonlinear reservoir, the 3D, three-phase, PUNQ-S3 model. We compare the performance of the original EnKF with the performance of the ensemble square root filter (EnSRF, an EnKF method with localization, which is named the hierarchical ensemble Kalman filter (HEnKF and the newly proposed Adaptive Gaussian Mixture filter (AGM. To the best of our knowledge, this is the first time the EnKF and the EnSRF have been compared on a high-dimensional nonlinear field case. Overall, we see that the AGM and HEnKF work better than the EnSRF and EnKF. The EnSRF seems to have a slightly better performance than the EnKF. However, the introduction of a localization procedure (as in the HEnKF seems to be much more influential than replacing the EnKF with the EnSRF. Comparing the top two methods, the AGM is preferable over the HEnKF, both when it comes to preserving the initial geology of the ensemble and to the consistency of the predictions. Au cours de la dernière décennie, le filtre de Kalman d’Ensemble (EnKF, Ensemble Kalman

  5. Oracle Data Guard 11gR2 administration beginner's guide

    CERN Document Server

    Baransel, Emre

    2013-01-01

    Using real-world examples and hands-on tasks, Oracle Data Guard 11gR2 Administration Beginner's Guide will give you a solid foundation in Oracle Data Guard. It has been designed to teach you everything you need to know to successfully create and operate Data Guard environments with maximum flexibility, compatibility, and effectiveness.If you are an Oracle database administrator who wants to configure and administer Data Guard configurations, then ""Oracle Data Guard 11gR2 Administration Beginner's Guide"" is for you. With a basic understanding of Oracle database administration, you'll be able

  6. A beginner's guide to 3D printing 14 simple toy designs to get you started

    CERN Document Server

    Rigsby, Mike

    2014-01-01

    A Beginner''s Guide to 3D Printing is the perfect resource for those who would like to experiment with 3D design and manufacturing, but have little or no technical experience with the standard software. Author Mike Rigsby leads readers step-by-step through 15 simple toy projects, each illustrated with screen caps of Autodesk 123D Design, the most common free 3D software available. The projects are later described using Sketchup, another free popular software package. Beginning with basics projects that will take longer to print than design, readers are then given instruction on more advanced t

  7. Teaching Norwegian to Beginners: Six Principles to Guide Lesson Planning

    Directory of Open Access Journals (Sweden)

    Anna Krulatz

    2014-01-01

    Full Text Available Teaching a foreign language is no simple task. There are several factors to consider, from curriculum design, to material selection and lesson implementation, to assessment. The challenge, however, is even greater, if you are teaching a less commonly taught language such as Norwegian – a language spoken by fewer than six million native speakers, used almost exclusively in one country, and with a limited number of available pedagogical materials. Under such circumstances, the task of preparing high quality communicative lessons is immense, even for an experienced language instructor. The goal of this article is to present how a successful language lesson can be developed even if one is using a textbook that does not foster communicative competence. As an example, I am using a unit from a Norwegian textbook for beginners: På vei, often used in Norwegian as a second language course for adults in Norway. The lesson focuses on routines and times of the day, and it concludes with the students comparing and contrasting their daily routines with a partner. Prior to this lesson, students have learned to provide basic information about themselves (where they come from, what languages they speak, what they do for work, expressions for greetings and goodbyes, basic verbs relating to daily activities such as ‘snakker’ (to speak, ‘kjører’ (to drive, ‘kjøpper’ (to buy, ‘jobber’ (to work, ‘leser’ (to read, ‘scriver’ (to write, ordinal numerals, meals, some food items, some basic prepositions and locations, words for family members, and subject and object pronouns for all persons. If you were to closely follow the textbook in teaching this unit, you would begin by teaching the students how to tell time, then briefly go over some verbs to express daily routines, listen to and read a text titled ‘Jeg står opp klokka seks,’ a narrative about Monica’s day (Monica is one of the characters in the book, and finally ask the students

  8. Plutonium isotopic assay of reprocessing product solutions in the KfK K-edge densitometer

    International Nuclear Information System (INIS)

    Eberle, H.; Ottmar, H.; Matussek, P.

    1985-04-01

    The KfK K-edge densiometer, designed for accurate element concentration measurements using the technique of X-ray absorptiometry at the K absorption edge, provides as an additional option the possibility to determine the isotopic composition of freshly separated plutonium from an gamma-spectrometric analysis of its self-radiation. This report describes the underlying methodology and experimental procedures for the isotopic analysis in the K-edge densitometer. The paper also presents and discusses the experimental results so far obtained from routine measurements on reprocessing product solutions. (orig.)

  9. Copper-Mediated Radiofluorination of Arylstannanes with [18F]KF.

    Science.gov (United States)

    Makaravage, Katarina J; Brooks, Allen F; Mossine, Andrew V; Sanford, Melanie S; Scott, Peter J H

    2016-10-10

    A copper-mediated nucleophilic radiofluorination of aryl- and vinylstannanes with [ 18 F]KF is described. This method is fast, uses commercially available reagents, and is compatible with both electron-rich and electron-deficient arene substrates. This method has been applied to the manual synthesis of a variety of clinically relevant radiotracers including protected [ 18 F]F-phenylalanine and [ 18 F]F-DOPA. In addition, an automated synthesis of [ 18 F]MPPF is demonstrated that delivers a clinically validated dose of 200 ± 20 mCi with a high specific activity of 2400 ± 900 Ci/mmol.

  10. Generating a Two-Phase Lesson for Guiding Beginners to Learn Basic Dance Movements

    Science.gov (United States)

    Yang, Yang; Leung, Howard; Yue, Lihua; Deng, Liqun

    2013-01-01

    In this paper, an automated lesson generation system for guiding beginners to learn basic dance movements is proposed. It analyzes the dance to generate a two-phase lesson which can provide a suitable cognitive load thus offering an efficient learning experience. In the first phase, the dance is divided into small pieces which are patterns, and…

  11. A Case Study: Writing a Spanish Dictionary as a Collaborative Task among Beginner Students

    Science.gov (United States)

    Lopez, Nuria

    2016-01-01

    This article reports a small-scale study carried out in a beginners' Spanish class of second year undergraduate students. The purpose of the study was to investigate the effectiveness of a vocabulary task in terms of its impact on vocabulary acquisition, the learners' approach to vocabulary learning and their motivation and engagement. The task…

  12. English Idioms and Iranian Beginner Learners: A Focus on Short Stories and Pictures

    Science.gov (United States)

    Mehrpour, Saeed; Mansourzadeh, Nurullah

    2017-01-01

    Idiomatic expressions are among the most difficult and challenging aspects in the realm of lexicon. The focus of the present study was on investigating the effect of short stories and pictures on learning idiomatic expressions by beginner EFL learners. For this aim, 52 Iranian EFL learners were chosen and assigned to three groups randomly: two…

  13. Language Learning Shifts and Attitudes towards Language Learning in an Online Tandem Program for Beginner Writers

    Science.gov (United States)

    Tolosa, Constanza; Ordóñez, Claudia Lucía; Guevara, Diana Carolina

    2017-01-01

    We present findings of a project that investigated the potential of an online tandem program to enhance the foreign language learning of two groups of school-aged beginner learners, one learning English in Colombia and the other learning Spanish in New Zealand. We assessed the impact of the project on students' learning with a free writing…

  14. THE FORECAST OF VALUES FOR EVALUATION IN COORDINATIVE CAPACITY AT ALPINE SKIERS BEGINNERS

    Directory of Open Access Journals (Sweden)

    Elena Rată

    2009-06-01

    Full Text Available The paper proposes itself to present some methods of forecasting the values of coordinative capacities,evaluated through equilibrium and motor memory tests, during training programs of alpine skiers in the beginner class. These studies have lead to new methods and techniques of mathematical approximation of data usingpolynomial functions of result apportionment for the analyzed groups.

  15. Enhancing Beginners' Second Language Learning through an Informal Online Environment

    Science.gov (United States)

    Chakowa, Jessica

    2018-01-01

    Web 2.0 tools are used increasingly to support second language learning, but there have been limited studies involving beginner learners, multiple technologies, and informal settings. This current study addresses this gap and investigates the factors affecting students' interest in a nongraded online learning environment and what kinds of tools,…

  16. Collection Development for the School Library Media Program: A Beginner's Guide

    Science.gov (United States)

    Kerby, Mona

    2006-01-01

    A valuable resource for new or experienced school librarians, "Collection Development for the School Library Media Program: A Beginner's Guide" is an easy-to-use guide to collection development. It provides practical and relevant information about collection development issues such as: the school users, policies, selection criteria and sources,…

  17. Mnemonics Are an Effective Tool for Adult Beginners Learning Plant Identification

    Science.gov (United States)

    Stagg, Bethan C.; Donkin, Maria E.

    2016-01-01

    Most beginners are introduced to plant diversity through identification keys, which develop differentiation skills but not species memorisation. We propose that mnemonics, memorable "name clues" linking a species name with morphological characters, are a complementary learning tool for promoting species memorisation. In the first of two…

  18. EnKF vs. EnOI in the Red Sea and Sensitivity to Atmospheric Forcing

    Science.gov (United States)

    Zhan, P.; Toye Mahamadou Kele, H.; Gopalakrishnan, G.; Ltaief, H.; Kartadikaria, A. R.; Hoteit, I.

    2016-02-01

    We present our efforts to build an ensemble data assimilation and forecasting system for the Red Sea. The system is composed of the MIT general circulation model (MITgcm) to simulate ocean circulation and of the Data Research Testbed (DART) for data assimilation. In this version, the MITgcm is configured with a horizontal resolution of 4 km and 40 depth-varying vertical layers and nested in larger 10km resolution domain covering all Arabian Seas. The model is forced with real time atmospheric products from the National Center for Environmental Prediction (NCEP), the European Centre for Medium-Range Weather Forecasts (ECMWF) and high-resolution assimilated Weather Research Forecasting (WRF) Red Sea fields. DART has been configured to integrate all members of the ensemble Kalman filter (EnKF) in parallel, and for testing with an invariant ensemble, i.e. an ensemble Optimal Interpolation (EnOI). To deal with the strong seasonal variability of the Red Sea, the EnOI ensemble is seasonally selected from climatology of long-term model outputs. Observations of Sea surface height (SSH) and sea surface temperature (SST) are assimilated every three days. We examine the behaviors of the EnKF and EnOI and compare their performances. We further investigate the impacts of the different atmospheric forcings on the results of the assimilation system.

  19. KF polymerase-based fluorescence aptasensor for the label-free adenosine detection.

    Science.gov (United States)

    Liao, Dongli; Jiao, Huping; Wang, Bin; Lin, Quan; Yu, Cong

    2012-02-21

    We have developed a simple, inexpensive, and label-free method for the selective detection of adenosine. Klenow fragment polymerase (KF polymerase) is a commonly-used 5' to 3' DNA polymerase, it also has 3' to 5' exonuclease activity that can digest single-stranded DNA. An adenosine binding DNA aptamer was employed, the aptamer was split into two pieces of single-stranded DNA (aptamer-A1 + aptamer-A2). Without the addition of adenosine, aptamer-A1 and aptamer-A2 existed as single-stranded DNA which could be efficiently degraded by the exonuclease activity of KF polymerase. Much reduced background fluorescence was obtained when SYBR Green dye was added. However, in the presence of adenosine, aptamer-A1 and aptamer-A2 bound to adenosine, and hybridization of the complementary sequences resulted in the formation of a duplex DNA structure, which could initiate DNA polymerization. The addition of SYBR Green dye resulted in a very high fluorescence enhancement, which could be used for the quantification of adenosine.

  20. KfK analysis of the SUPER-PHENIX-1 control rod experiments. Pt. 1

    International Nuclear Information System (INIS)

    Giese, H.

    1991-03-01

    As proposed by the SPX-1 analysis task force, MSM (modified source multiplication) correction factors have been produced for a series of control rod configurations established in the first critical core C1D with minimum fissile loading and in the fully loaded core CMP. The report gives a complete description of the method used at KfK to produce these correction factors and summarises the evaluated experimental results obtained. The KfK method is characterized by a 'two-step-adjustment': A basic reactivity scale adjustment and a subsequent rod worth adjustment. The first adjustment was achieved by 'tuning' either the axialbuckling in the leakage term D B 2 or the average number of neutrons per fission in the production term so that the excess reactivity of the so-called 'Follower-core' with all control rods fully raised was properly reproduced. As this excess reactivity could not be directly determined by an experiment, it had to be assessed from the shut-down worth of the main control system in combination with measured fractions of the S-curve of this system. In the second adjustment, the absorber cross sections were tuned to reproduce experimental rod worths. While for the analysis of the C1D experiments, MSM correction factor calculations were performed in 2D centre-plane geometry only, the analysis of the CMP measurements employed both 2D and 3D calculations. (orig./HP)

  1. The Solubility of Aluminum in Cryolite-Based Electrolyte-Containing KF

    Science.gov (United States)

    Zhang, Yu; Yu, Jiangyu; Gao, Bingliang; Liu, Yibai; Hu, Xianwei; Shi, Zhongning; Wang, Zhaowen

    2016-04-01

    The solubility of aluminum in NaF-AlF3-CaF2-KF-A12O3 electrolyte system at 1253 K (980 °C) has been measured by the analysis of quenched samples saturated with aluminum. The content of the dissolved metal in the quenched melt was determined by collecting the volume of hydrogen gas when a finely crushed sample is treated with HCl. Addition of 0 to 5 pct KF has no obvious effect on the solubility of aluminum in cryolite-based melts with molar ratio of NaF/AlF3 (cryolite ratio) ranging from 2.2 to 3.0. The solubility of aluminum increases from 0.015 to 0.026 wt pct with cryolite ratio increases from 2.2 to 4.0 in the NaF-AlF3-5 wt pct CaF2-3 wt pct A12O3 electrolyte at 1253 K (980 °C). Aluminum solubility was affected by both chemical replacement reaction of Al + 3NaF = AlF3 + 3Na and physical dissolution.

  2. Real-time reservoir geological model updating using the hybrid EnKF and geostatistical technique

    Energy Technology Data Exchange (ETDEWEB)

    Li, H.; Chen, S.; Yang, D. [Regina Univ., SK (Canada). Petroleum Technology Research Centre

    2008-07-01

    Reservoir simulation plays an important role in modern reservoir management. Multiple geological models are needed in order to analyze the uncertainty of a given reservoir development scenario. Ideally, dynamic data should be incorporated into a reservoir geological model. This can be done by using history matching and tuning the model to match the past performance of reservoir history. This study proposed an assisted history matching technique to accelerate and improve the matching process. The Ensemble Kalman Filter (EnKF) technique, which is an efficient assisted history matching method, was integrated with a conditional geostatistical simulation technique to dynamically update reservoir geological models. The updated models were constrained to dynamic data, such as reservoir pressure and fluid saturations, and approaches geologically realistic at each time step by using the EnKF technique. The new technique was successfully applied in a heterogeneous synthetic reservoir. The uncertainty of the reservoir characterization was significantly reduced. More accurate forecasts were obtained from the updated models. 3 refs., 2 figs.

  3. Micro-arc oxidization of a novel Mg–1Ca alloy in three alkaline KF electrolytes: Corrosion resistance and cytotoxicity

    Energy Technology Data Exchange (ETDEWEB)

    Jia, Z.J.; Li, M.; Liu, Q.; Xu, X.C. [Center for Biomedical Materials and Tissue Engineering, Academy for Advanced Interdisciplinary Studies, Peking University, Beijing 100871 (China); Cheng, Y., E-mail: chengyan@pku.edu.cn [Center for Biomedical Materials and Tissue Engineering, Academy for Advanced Interdisciplinary Studies, Peking University, Beijing 100871 (China); Zheng, Y.F. [Center for Biomedical Materials and Tissue Engineering, Academy for Advanced Interdisciplinary Studies, Peking University, Beijing 100871 (China); Department of Advanced Materials and Nanotechnology, College of Engineering, Peking University, Beijing 100871 (China); Xi, T.F. [Center for Biomedical Materials and Tissue Engineering, Academy for Advanced Interdisciplinary Studies, Peking University, Beijing 100871 (China); Wei, S.C. [Center for Biomedical Materials and Tissue Engineering, Academy for Advanced Interdisciplinary Studies, Peking University, Beijing 100871 (China); Department of Oral and Maxillofacial Surgery, School and Hospital of Stomatology, Peking University, Beijing 100871 (China)

    2014-02-15

    A newly-developed Mg–1Ca (wt%) alloy was treated by micro-arc oxidization (MAO) in KF-silicate- (Si coating), KF-phosphate- (P coating) and KF-silicate-phosphate (SiP coating) electrolytes. The microstructure, composition and corrosion resistance of the resultant MAO coatings were investigated using scanning electron microscopy (SEM), X-ray photoelectron spectroscopy (XPS), and X-ray diffractometry (XRD). Electrochemical analysis and immersion test in Hanks’ solution and MTT assay for in-vitro toxicity against MG63 cells were subsequently carried out. Results showed that all the three MAO coatings contributed to the improvement of corrosion resistance and cytocompatibility of substrate; however, P coating outperformed the two others due to its specific microstructure and composition.

  4. Induction of kf-1 after repeated electroconvulsive treatment and chronic antidepressant treatment in rat frontal cortex and hippocampus.

    Science.gov (United States)

    Nishioka, G; Yamada, M; Kudo, K; Takahashi, K; Kiuchi, Y; Higuchi, T; Momose, K; Kamijima, K; Yamada, M

    2003-03-01

    It has been proposed that signaling pathways involved in adaptive neural plasticity are long-term targets for the action of electroconvulsive treatment (ECT), which is widely used in the treatment of drug-resistant depression. We have previously performed EST analysis to identify some molecular machinery responsible for antidepressant effect. One of the cDNA fragments identified as antidepressant related genes/ESTs was identified as kf-1 which has a RING-H2 finger motif at the carboxy-terminus. In the present study, we have demonstrated the induction of kf-1 in rat frontal cortex and hippocampus not only after chronic antidepressant treatment, but also after a single and repeated ECT. RING finger proteins are proposed to play some important roles in the ubiquitin-proteasome system. In conclusion, the current investigation has identified kf-1 as a novel molecular target for antidepressants and ECT.

  5. Efficient KF loaded on MgCaAl hydrotalcite-like compounds in the transesterification of Jatropha curcas oil

    Energy Technology Data Exchange (ETDEWEB)

    Guzmán-Vargas, Ariel, E-mail: aguzmanv@ipn.mx [ESIQIE-IPN, Departamento de Ingeniería Química, Laboratorio de Investigación en Materiales Porosos, Catálisis Ambiental y Química Fina, UPALM Edif.7 P.B. Zacatenco, México D.F. 07738 (Mexico); Santos-Gutiérrez, Teresa [ESIQIE-IPN, Departamento de Ingeniería Química, Laboratorio de Investigación en Materiales Porosos, Catálisis Ambiental y Química Fina, UPALM Edif.7 P.B. Zacatenco, México D.F. 07738 (Mexico); Lima, Enrique [IIM-Universidad Nacional Autónoma de México, Circuito exterior s/n, Cd. Universitaria, 04510 México DF (Mexico); Flores-Moreno, Jorge L. [UAM-Azcapotzalco, Área de Química de Materiales, Av. San Pablo 180, Col. Reynosa Tamaulipas, 02200 México DF (Mexico); Oliver-Tolentino, Miguel A.; Martínez-Ortiz, María de J. [ESIQIE-IPN, Departamento de Ingeniería Química, Laboratorio de Investigación en Materiales Porosos, Catálisis Ambiental y Química Fina, UPALM Edif.7 P.B. Zacatenco, México D.F. 07738 (Mexico)

    2015-09-15

    Highlights: • MgCaAl hydrotalcite-like compounds were synthetized. • After KF impregnation and calcination fluorinated species were detected. • Fluorinated species were stables and actives. • LDH composition and KF load effect were evaluated in biodiesel production. - Abstract: In this work a series of MgCaAl hydrotalcite-like compounds were synthetized by coprecipitation method at constant pH. In order to obtain the catalysts, the samples were modified with KF by incipient wetness impregnation at different wt%, after that, they were dried and calcined to obtain the mixed oxides. The effect of divalent cations ratio and KF load were studied in the transesterification reaction of Jatropha curcas oil to obtain biodiesel employing an inedible oil. XRD analysis showed typical diffraction patterns of LDH, by nitrogen physisorption the LDH mesoporous structure was also confirmed, {sup 27}Al NMR spectra showed bands at 10 and 88 ppm attributed to the Al coordination before and after thermal treatment. While for the impregnated samples after calcination the profiles exhibited the mixed oxide formation, in addition, another peaks appeared associated to the formation of various fluorinated species as shown by XRD, additionally, {sup 19}F NMR showed a main signal at −180 ppm indicating the presence of active tetrahedral aluminum fluoride species. The reaction evolution was monitoring calculating the oil conversion to biodiesel by integration of the signal spectra using {sup 1}H NMR spectroscopy. The results of catalytic tests in transesterification reaction showed a direct correlation between Mg/Ca ratio and KF content in the oil conversion to biodiesel, the higher conversion was achieved (90%) when Mg/Ca = 1 and KF load was 30 wt%.

  6. Production of a Biofuel that Keeps the Glycerol as a Monoglyceride by Using Supported KF as Heterogeneous Catalyst

    OpenAIRE

    Juan Calero; Gema Cumplido; Diego Luna; Enrique D. Sancho; Carlos Luna; Alejandro Posadillo; Felipa M. Bautista; Antonio A. Romero; Cristóbal Verdugo-Escamilla

    2014-01-01

    This study describes the results obtained in the synthesis of a biofuel that avoids the production of glycerol by applying supported KF as alkaline heterogeneous catalyst, to generate two moles of fatty acid methyl esters and one mole of monoglyceride from one mol of triglyceride. In this respect, the selective transesterification process of sunflower oil with methanol was carried out with KF (10 wt%) supported on three different solids, Al2O3, ZnO and MgO. The standard experimental condition...

  7. Interaction between SiO2 and a KF-KCl-K2SiF6 Melt.

    Science.gov (United States)

    Zaykov, Yurii P; Isakov, Andrey V; Zakiryanova, Irina D; Reznitskikh, Olga G; Chemezov, Oleg V; Redkin, Alexander A

    2014-02-13

    The solubility mechanism of silica in a fluoride-chloride melt has been determined in situ using Raman spectroscopy. The spectroscopy data revealed that the silica solubility process involved Si-O bond breakage and Si-F bond formation. The process results in the formation of silicate complexes, fluorine-bearing silicate complexes, and silicon tetrafluoride in the melt. Mass spectrometry of the vapor phase over the KF-KCl-K2SiF6 and KF-KCl-K2SiF6-SiO2 melts and differential scanning calorimetry coupled with thermal gravimetric analysis of these melts were performed to verify the silica solubility mechanism.

  8. Grundwassermodellbildung – Hydrostratigraphische Bewertungen mittels GCI-PetroKf, Datenbank- und Geoinformationssystemen

    DEFF Research Database (Denmark)

    Koch, Alexander; Fuchs, Sven; Göbel, Patricia

    reimportiert und für die Verwendung in Geoinformationssystemen (i.e. ArcGIS) weiter aufbereitet. Über Interpolationsverfahren konnte innerhalb des Programmes ArcGIS ein lateraler Bezug zwischen den verschiedenen Mächtigkeiten hergestellt werden, um so auf weitere Inhomogenitäten im Aufbau des Grundwasserleiter......-Systems schließen zu können. Anschließend wurden mittels ArcGIS die Quartärbasis des Modellraums konstruiert, sowie Grundwasserisolinien- und Grundwasserdifferenzenkarten berechnet. Die Grundwasserdifferenzenkarten reproduzieren gut die Grundwasserabsenkungen im Bereich von lokalen Tagebauen. Insgesamt zeigen sich...... gute Übereinstimmungen mit früheren hydrogeologischen Untersuchungen im Projektgebiet. Die Kombination des PetroKf-Algorithmus mit der Aufbereitung in einer Datenbank, sowie der Weiterverarbeitung in ArcGIS, zeigt einen praktikablen Weg zur Entwicklung und Parametrisierung eines hydrogeologischen...

  9. Electrochemical behavior of boron in LiF-NaF-KF- melts

    DEFF Research Database (Denmark)

    Polyakova, L.P.; Bukatova, G.A.; Polyakova, E.G.

    1996-01-01

    The electrochemical reduction of B(III) to B(0) in KBF4-LiF-NaF-KF melts has been studied by voltammetric and chronopotentiometric methods, Glassy carbon, Pt, and Ag were used as working electrode materials. Only in the case of Ag was the reduction not complicated by interaction between boron...... and the electrode material. On a silver electrode B(III) was reduced to B(0) in a single irreversible step in the KBF4 concentration range up to 5.7 x 10(-2) mole percent (m/o). The cathodic half-wave potential was -1.34 V us, an Ag/AgCl reference electrode at 700 degrees C. The diffusion coefficient of BF4- at 700...

  10. Preparation of biodiesel catalysed by KF/CaO with ultrasound.

    Science.gov (United States)

    Chen, Xi; Qian, Wei-Wei; Lu, Xiao-Ping; Han, Ping-Fang

    2012-01-01

    Biodiesel, chemically consists of fatty acid methyl ester (FAME) produced by methanolysis of natural triglycerides, such as animal fats and vegetable oils, is a kind of biomass energy, which is renewable and ecofriendly. In this article, KF/CaO was used as solid base catalyst for transesterification of soya bean oil and methanol, while ultrasound as supplementary means. Compared to mechanical stirring, ultrasound treatment is an effective method to increase the yield of FAME and shorten reaction time. By single-factor method, the optimisation of reaction conditions has been studied. The research showed that the optimum reaction conditions were: w(catalyst)/w(oil): 3%, reaction temperature: 65°C, n(methanol)/n(oil): 12, reaction time: 1 h, sound intensity: 1.01 W cm(-2), frequency: 20 kHz, the yield of FAME could be 97%.

  11. Multiscale KF Algorithm for Strong Fractional Noise Interference Suppression in Discrete-Time UWB Systems

    Directory of Open Access Journals (Sweden)

    Liyun Su

    2011-01-01

    Full Text Available In order to suppress the interference of the strong fractional noise signal in discrete-time ultrawideband (UWB systems, this paper presents a new UWB multi-scale Kalman filter (KF algorithm for the interference suppression. This approach solves the problem of the narrowband interference (NBI as nonstationary fractional signal in UWB communication, which does not need to estimate any channel parameter. In this paper, the received sampled signal is transformed through multiscale wavelet to obtain a state transition equation and an observation equation based on the stationarity theory of wavelet coefficients in time domain. Then through the Kalman filter method, fractional signal of arbitrary scale is easily figured out. Finally, fractional noise interference is subtracted from the received signal. Performance analysis and computer simulations reveal that this algorithm is effective to reduce the strong fractional noise when the sampling rate is low.

  12. Nano-magnetic catalyst KF/CaO-Fe3O4 for biodiesel production

    International Nuclear Information System (INIS)

    Hu, Shengyang; Guan, Yanping; Wang, Yun; Han, Heyou

    2011-01-01

    A nano-magnetic catalyst KF/CaO-Fe 3 O 4 was prepared by a facile impregnation method. The magnetic property of the catalyst was studied by vibrating sample magnetometer (VSM). The results demonstrated that the catalyst was ferromagnetic, and it could be recovered by magnetic separation. The nano-magnetic catalyst was also characterized by transmission electron microscopy (TEM), X-ray diffraction (XRD) and BET surface area analyzer. It was found that the catalyst possessed a unique porous structure with an average particle diameter of ca. 50 nm. Besides, the factors affecting biodiesel yield were investigated, and a desired fatty acid methyl esters yield over 95% was obtained under the optimal conditions.

  13. An adaptive hybrid EnKF-OI scheme for efficient state-parameter estimation of reactive contaminant transport models

    KAUST Repository

    El Gharamti, Mohamad

    2014-09-01

    Reactive contaminant transport models are used by hydrologists to simulate and study the migration and fate of industrial waste in subsurface aquifers. Accurate transport modeling of such waste requires clear understanding of the system\\'s parameters, such as sorption and biodegradation. In this study, we present an efficient sequential data assimilation scheme that computes accurate estimates of aquifer contamination and spatially variable sorption coefficients. This assimilation scheme is based on a hybrid formulation of the ensemble Kalman filter (EnKF) and optimal interpolation (OI) in which solute concentration measurements are assimilated via a recursive dual estimation of sorption coefficients and contaminant state variables. This hybrid EnKF-OI scheme is used to mitigate background covariance limitations due to ensemble under-sampling and neglected model errors. Numerical experiments are conducted with a two-dimensional synthetic aquifer in which cobalt-60, a radioactive contaminant, is leached in a saturated heterogeneous clayey sandstone zone. Assimilation experiments are investigated under different settings and sources of model and observational errors. Simulation results demonstrate that the proposed hybrid EnKF-OI scheme successfully recovers both the contaminant and the sorption rate and reduces their uncertainties. Sensitivity analyses also suggest that the adaptive hybrid scheme remains effective with small ensembles, allowing to reduce the ensemble size by up to 80% with respect to the standard EnKF scheme. © 2014 Elsevier Ltd.

  14. A mild and efficient method for the selective deprotection of silyl ethers using KF in the presence of tetraethylene glycol.

    Science.gov (United States)

    Yan, Hailong; Oh, Joong-Suk; Song, Choong Eui

    2011-12-07

    A mild and efficient protocol for the deprotection of silyl ethers using KF in tetraethylene glycol is reported. A wide range of alcoholic silyl ethers can be selectively cleaved in high yield in the presence of certain acid- and base-labile functional groups. Moreover, the phenolic silyl ethers were cleaved exclusively, without affecting the alcoholic silyl ethers, at room temperature.

  15. Production of a Biofuel that Keeps the Glycerol as a Monoglyceride by Using Supported KF as Heterogeneous Catalyst

    Directory of Open Access Journals (Sweden)

    Juan Calero

    2014-06-01

    Full Text Available This study describes the results obtained in the synthesis of a biofuel that avoids the production of glycerol by applying supported KF as alkaline heterogeneous catalyst, to generate two moles of fatty acid methyl esters and one mole of monoglyceride from one mol of triglyceride. In this respect, the selective transesterification process of sunflower oil with methanol was carried out with KF (10 wt% supported on three different solids, Al2O3, ZnO and MgO. The standard experimental conditions employed in the heterogeneous selective methanolysis reaction were: 12 mL of sunflower oil, 2.7 mL of methanol, 0.8 g of catalyst, at 65 °C temperature and one hour of reaction time. In all cases 100% conversion was obtained, with high selectivity values, greater than 90%, and quite suitable viscosity values, 4.5–8.5 cSt. In this way, the best catalytic behavior in the first use was obtained by using Al2O3 as support. However, although in the five consecutive reuses all catalysts exhibited a continuous decrease in their catalytic activities; the lower one was for KF catalyst using MgO as support. In summary, these three KF supported catalysts are very suitable to obtain a new biofuel, similar to conventional biodiesel, applicable to diesel engines.

  16. Synthesis of biodiesel using potassium fluoride (KF) supported by hydrotalcite and process optimization by Box-Behnken design

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Bhaskar; Sharma, Yogesh C. [Banaras Hindu University, Department of Applied Chemistry, Institute of Technology, Varanasi (India); Birla, Ashish; Upadhyay, S.N. [Banaras Hindu University, Department of Chemical Engineering and Technology, Institute of Technology, Varanasi (India); Yaakob, Zahira [Universiti Kebangsaan Malaysia, Department of Chemical and Process Engineering, Selangor (Malaysia)

    2012-12-15

    Biodiesel has been developed using a heterogeneous catalyst potassium fluoride (KF) supported on hydrotalcite (HT) and waste frying oil (WFO) as feedstock. Hydrotalcite was synthesized by co-precipitation method using mixture of Mg(NO{sub 3}){sub 2}.6H{sub 2}O and Al(NO{sub 3}){sub 2}.9H{sub 2}O slowly added to a solution containing NaOH and Na{sub 2}CO{sub 3} and calcined at 500 C. KF was impregnated on hydrotalcite at KF/HT load ratio of 80:100 by addition of a small amount of water. Biodiesel was developed using KF/HT as heterogeneous catalyst by transesterification. Box-Behnken Design using Minitab 15.1 Statistical Software and Design-Expert (Demo version 8.0.6.1) software were used as statistical tool for design of experiments and optimization of fatty acid methyl ester yield. A high yield and conversion of biodiesel was obtained by optimization of variables affecting the reaction. The variables affected the reaction in the priority order of: catalyst amount >> molar ratio (methanol to oil) > reaction time. A 12:1 methanol to WFO molar ratio, 2.5 wt.% of catalyst at 60 C in 1 h reaction time gave a high fatty acid methyl ester yield of >98 %. The quantitative analysis of the product (i.e., biodiesel) was done on a Fourier-transform-nuclear magnetic resonance spectrometer. (orig.)

  17. Synthesis of Al-Zr Alloys Via ZrO2 Aluminum-Thermal Reduction in KF-AlF3-Based Melts

    Science.gov (United States)

    Pershin, Pavel S.; Kataev, A. A.; Filatov, A. A.; Suzdaltsev, A. V.; Zaikov, Yu. P.

    2017-08-01

    Physical-chemical investigations of KF-AlF3 melts were carried out in order to develop the scientific basis of the technology for Al-Zr alloy synthesis. The possibility of Al-Zr alloy synthesis via the aluminum-thermal method was shown. The liquidus temperatures of KF-AlF3 and KF-NaF-AlF3 melts with additions of Al2O3 and ZrO2 were determined using the thermal analysis method in the temperature range from 873 K to 1173 K (600 °C to 900 °C). The dependency of the solubility of ZrO2 in KF-AlF3 and KF-NaF-AlF3 melts on Al2O3 concentration was measured.

  18. KF and CsF recognition and extraction by a calix[4]crown-5 strapped calix[4]pyrrole multitopic receptor.

    Science.gov (United States)

    Kim, Sung Kuk; Lynch, Vincent M; Young, Neil J; Hay, Benjamin P; Lee, Chang-Hee; Kim, Jong Seung; Moyer, Bruce A; Sessler, Jonathan L

    2012-12-26

    On the basis of (1)H NMR spectroscopic analyses and single crystal X-ray crystal structural data, the ion-pair receptor 1, bearing a calix[4]pyrrole for anion binding and calix[4]arene crown-5 for cation recognition, was found to act as a receptor for both CsF and KF ion-pairs. Both substrates are bound strongly but via different binding modes and with different complexation dynamics. Specifically, exposure to KF in 10% CD(3)OD in CDCl(3) leads first to complexation of the K(+) cation by the calix[4]arene crown-5 moiety. As the relative concentration of KF increases, then the calix[4]pyrrole subunit binds the F(-) anion. Once bound, the K(+) cation and the F(-) anion give rise to a stable 1:1 ion-pair complex that generally precipitates from solution. In contrast to what is seen with KF, the CsF ion-pair interacts with receptor 1 in two different modes in 10% CD(3)OD in CDCl(3). In the first of these, the Cs(+) cation interacts with the calix[4]arene crown-5 ring weakly. In the second interaction mode, which is thermodynamically more stable, the Cs(+) cation and the counteranion, F(-), are simultaneously bound to the receptor framework. Further proof that system 1 acts as a viable ion-pair receptor came from the finding that receptor 1 could extract KF from an aqueous phase into nitrobenzene, overcoming the high hydration energies of the K(+) and F(-) ions. It was more effective in this regard than a 1:1 mixture of the constituent cation and anion receptors (4 and 5).

  19. Unusual kinetic behavior in cathodic H2 evolution from KF.2HF melts at mild-steel and alloy electrodes

    Directory of Open Access Journals (Sweden)

    Conway Con B.E.

    2004-01-01

    Full Text Available Apart from its interest as a "model" process for kinetic studies of gas-evolving electrode reactions, the cathodic hydrogen evolution reaction (her is involved in several processes that are of importance in applied electrochemistry, e.g., as the cathodic co-reactions in the commercial production of C12 and F2, in electrolyses for production of hydrogen, in electrochemical hydrogenation and, indirectly, as the partial process in corrosion of base metals in the absence of oxygen. The present paper reports several aspects of the unusual behavior of the her that is involved as the co-reaction to electrolytic production of F2 from KF/HF melts using carbon anodes and Fe or mild-steel cathodes. Anomalous anodic polarization behavior that arises in electrolytic generation of F2 from KF/HF melts at carbon electrodes is well known. It is characterized by very high Tafel slopes associated with "CF" film formation and by sluggish F2 bubble disengagement from the electrode. Interest in such effects has, however, tended to overshadow rather similar, so-called "hyper polarization" effects that also arise in the cathodic reaction, but for different reasons. The origins and nature of such effects are described and characterized in the present paper, and comparisons are made between behavior of Hz evolution from KF.2HF and that from the aquo-system analogue, KOH.2H2O. An important aspect is the very different interfacial behavior in KF/HF or KF.2HF melts from that in the corresponding aquo-system. Effects of As-species in HF feeds is investigated in terms of electro catalysis and poisoning effects on the her.

  20. Effects of long-term heat-light soaking on Cu(In,Ga)Se2 solar cells with KF postdeposition treatment

    Science.gov (United States)

    Nishinaga, Jiro; Koida, Takashi; Ishizuka, Shogo; Kamikawa, Yukiko; Takahashi, Hideki; Iioka, Masayuki; Higuchi, Hirofumi; Ueno, Yuko; Shibata, Hajime; Niki, Shigeru

    2017-09-01

    The effects of long-term heat-light soaking on Cu(In,Ga)Se2 (CIGS) solar cells with KF postdeposition treatment (KF-PDT) have been investigated. CIGS solar cells with KF-PDT frequently deteriorate after storage in the dark because of decreasing hole concentrations in the CIGS layers. Although light soaking improves hole concentrations, the resulting increase in conversion efficiency is not significant. In contrast, we found that long-term heat-light soaking effectively increases conversion efficiency, since the saturation current density and ideality factor are clearly improved by passivating the recombination centers at CdS/CIGS interfaces.

  1. Solvent-free and time-efficient Suzuki-Miyaura reaction in a ball mill: the solid reagent system KF-Al(2)O(3) under inspection.

    Science.gov (United States)

    Bernhardt, Franziska; Trotzki, Ronald; Szuppa, Tony; Stolle, Achim; Ondruschka, Bernd

    2010-01-22

    Although a plethora of synthetic procedures mediated by KF-loaded aluminas is available in the literature, there is almost no data concerning the influence of parameters such as alumina modification or KF-loading on experimental results. Hence, the Pd-catalyzed, solvent-free Suzuki-Miyaura reaction was chosen as model reaction to investigate the effect of the above mentioned parameters on the results of coupling reactions. The results from ball milling experiments led to the conclusion that self-prepared and commercially available KF-Al₂O ₃differ in water content. The higher the residual water content, the higher are the product yields.

  2. Rainfall Simulations of Typhoon Morakot with Controlled Translation Speed Based on EnKF Data Assimilation

    Directory of Open Access Journals (Sweden)

    Tzu-Hsiung Yen

    2011-01-01

    Full Text Available Typhoon Morakot produced record-breaking accumulated rainfall over southern Taiwan in August 2009. The combination of several factors resulted in this extreme weather event: the steep terrain in Taiwan, the prevailing south-westerly flow in the monsoon trough, Typhoon Goni over the northern South China Sea, and the slow translation speed of Morakot itself over Taiwan. In this study, the influence of the translation speed is particularly emphasized. Based on the EnKF data assimilation, an innovative method is applied to perform ensemble simulations with several designated translation speeds of Morakot using the WRF model. Thus the influence of the translation speed on the amount of accumulated rainfall over Taiwan can be quantitatively evaluated. In the control simulation with observed translation speed, the maximum amount and geographic pattern of accumulated rainfall during the landfall period of Morakot are generally consistent with the observations, though the detailed overall distributions of accumulated rainfall is mostly underestimated, resulting in the low bias of the frequency distribution of the accumulated rainfall. In a simulation with nearly-doubled translation speed of Morakot, the maximum accumulated rainfall is decreased by 33% than that in the control simulation, while the rainfall distribution over Taiwan remains similar. In addition, the 28 ensemble members can further provide additional information in terms of their spread and other statistics. The results from ensemble members reveal the usefulness of ensemble simulations for the quantitative precipitation forecast.

  3. KfK-analysis of the SUPER-PHENIX-1 control rod experiments. Pt. 2

    International Nuclear Information System (INIS)

    Giese, H.

    1992-10-01

    Using standard data and codes, this first analysis campaign led to results that drastically overestimated measured control rod worths with C/E ratios ranging from 1.17 to 1.28. These findings were in sharp contrast to the results of the majority of earlier control rod experiments in zero-power facilities, where C/E ratios were usually comprised between 1.0 and 1.1. Investigations were then launched to identify the origin of this discrepancy. By comparison with the calculation methods employed by the other working groups engaging in the analysis of the SPX-1 experiments it was found that the principal problem arose from the KfK/BN-procedure used for the homogenization of control rod absorber cross sections. The specific failure of this standard procedure in the case of the SPX-1 analysis is ascribed to the extremely heterogeneous structure of the SPX-1 control rods. In an attempt to improve on this point, a new method for the production of homogenized absorber cross sections was developed and applied to the SPX-1 analysis. The report concludes with a description of this method and a survey of the results obtained for SPX-1. It is found that this revised analysis leads to a significantly improved agreement of measured and calculated control rod worths and to a better consistency with the results of earlier control rod experiments in zero-power facilities. (orig.)

  4. Electrochemical separation of uranium in the molten system LiF-NaF-KF-UF4

    Science.gov (United States)

    Korenko, M.; Straka, M.; Szatmáry, L.; Ambrová, M.; Uhlíř, J.

    2013-09-01

    This article is focused on the electrochemical investigation (cyclic voltammetry and related studies) of possible reduction of U4+ ions to metal uranium in the molten system LiF-NaF-KF(eut.)-UF4 that can provide basis for the electrochemical extraction of uranium from molten salts. Two-step reduction mechanism for U4+ ions involving one electron exchange in soluble/soluble U4+/U3+ system and three electrons exchange in the second step were found on the nickel working electrode. Both steps were found to be reversible and diffusion controlled. Based on cyclic voltammetry, the diffusion coefficients of uranium ions at 530 °C were found to be D(U4+) = 1.64 × 10-5 cm2 s-1 and D(U3+) 1.76 × 10-5 cm2 s-1. Usage of the nickel spiral electrode for electrorefining of uranium showed fairly good feasibility of its extraction. However some oxidant present during the process of electrorefining caused that the solid deposits contained different uranium species such as UF3, UO2 and K3UO2F5.

  5. Excited-state proton transfer in methanol-doped ice in the presence of KF.

    Science.gov (United States)

    Uritski, Anna; Huppert, Dan

    2008-05-15

    Steady-state and time-resolved emission techniques were employed to study the photoprotolytic cycle of an excited photoacid in ice in the presence of a low concentration of a weak base-like F(-). In previous studies we found that the photoprotolytic cycle in methanol-doped ice (1% mol fraction) is too slow to be observed at temperatures below 190 K. In this study we found that at temperatures below 240 K an additional proton-transfer process occurs in ice doped with 10 mM KF. We attributed this reaction to the creation of a mobile L-defect by F(-) ions. We used a diffusion-assisted reaction model, based on the Debye-Smoluchowski equation, to account for the direct reaction of the L-defect with the excited photoacid at temperatures below T < 240 K. Below 160 K the spectroscopic properties as well as the photoprotolytic cycle change dramatically. We propose that below 160 K the sample enters a new phase. The excited-state proton-transfer (ESPT) process was observed and followed down to a liquid nitrogen temperature of approximately 78 K. In the low-temperature phase the ESPT rate is almost twice as much as at 180 K and the temperature dependence of the rate is very small. The kinetic isotope effect of the ESPT at the low-temperature phase is small of about 1.3.

  6. Ethanol production from kitchen waste using the flocculating yeast Saccharomyces cerevisiae strain KF-7

    International Nuclear Information System (INIS)

    Tang, Y.-Q.; Koike, Yoji; Liu Kai; An, M.-Z.; Morimura, Shigeru; Wu Xiaolei; Kida, Kenji

    2008-01-01

    A process for producing ethanol from kitchen waste was developed in this study. The process consists of freshness preservation of the waste, saccharification of the sugars in the waste, continuous ethanol fermentation of the saccharified liquid, and anaerobic treatment of the saccharification residue and the stillage. Spraying lactic acid bacteria (LCB) on the kitchen waste kept the waste fresh for over 1 week. High glucose recovery (85.5%) from LCB-sprayed waste was achieved after saccharification using Nagase N-40 glucoamylase. The resulting saccharified liquid was used directly for ethanol fermentation, without the addition of any nutrients. High ethanol productivity (24.0 g l -1 h -1 ) was obtained when the flocculating yeast strain KF-7 was used in a continuous ethanol fermentation process at a dilution rate of 0.8 h -1 . The saccharification residue was mixed with stillage and treated in a thermophilic anaerobic continuous stirred tank reactor (CSTR); a VTS loading rate of 6 g l -1 d -1 with 72% VTS digestion efficiency was achieved. Using this process, 30.9 g ethanol, and 65.2 l biogas with 50% methane, was produced from 1 kg of kitchen waste containing 118.0 g total sugar. Thus, energy in kitchen waste can be converted to ethanol and methane, which can then be used as fuels, while simultaneously treating kitchen waste

  7. Synthesis, phase evolution and optical properties of Tb(3+)-doped KF-YbF3 system materials.

    Science.gov (United States)

    Cao, Chunyan; Cao, Renping; Guo, Siling; Xie, An; Noh, Hyeon Mi; Jeong, Jung Hyun

    2015-08-01

    KF-YbF3 system materials have been synthesized by a hydrothermal method without any surfactant or template. By controlling the reactant ratios of KF:Yb(3+), the hydrothermal temperature and the pH of the prepared solutions, the final products can evolve among the orthorhombic phase of YbF3, the cubic phase of KYb3F10 and the cubic phase of KYbF4. The X-ray diffraction (XRD) patterns of the samples prove the phase evolution of the final products. The morphologies of the samples were characterized using field emission scanning electron microscopy (FE-SEM) images and the evolution of the morphology is consistent with that of the crystalline phases. The optical properties of Tb(3+) in the samples were characterized by PL excitation and emission spectra, as well as luminescent decay curves. Copyright © 2014 John Wiley & Sons, Ltd.

  8. Separating DDTs in edible animal fats using matrix solid-phase dispersion extraction with activated carbon filter, Toyobo-KF.

    Science.gov (United States)

    Furusawa, Naoto

    2006-09-01

    A technique is presented for the economical, routine, and quantitative analysis of contamination by dichloro-diphenyl-trichloroethanes (DDTs) [pp'-DDT, pp'-dichlorodiphenyl dichloroethylene, and pp'-dichlorodiphenyl dichloreothane in beef tallow and chicken fat samples, based on their separation using matrix solid-phase dispersion (MSPD) extraction with Toyobo-KF, an activated carbon fiber. Toyobo-KF is a newly applied MSPD sorbent, and it is followed by reversed-phase high-performance liquid chromatography (HPLC) with a photodiode array detector. The resulting analytical performance parameters [recoveries of spiked DDTs (0.1, 0.2, and 0.4 microg/g) > or = 81%, with relative standard deviations of < or = 8% (n = 5), and quantitation limits < or = 0.03 microg/g], with minimal handling and cost-efficiency, indicate that the present MSPD-HPLC method may be a useful tool for routine monitoring of DDT contamination in meat.

  9. Electrochemical investigation on the redox chemistry of niobium in LiCl-KCl-KF-Na2O melts

    DEFF Research Database (Denmark)

    Gillesberg, Bo; Bjerrum, Niels; Barner, Jens H. Von

    1997-01-01

    The system LiCl-KCl-KF-1 mole percent K2NbF7 (molar ration F-/Nb = 8) has been investigated in-the temperature range 370 to 725 degrees C by cyclic and square wave voltammetry. In the temperature range from 370 to 520 degrees C Nb(V) was reduced to Nb(III) in two reversible steps: Nb(V) --> Nb...

  10. Language Learning Shifts and Attitudes Towards Language Learning in an Online Tandem Program for Beginner Writers

    Directory of Open Access Journals (Sweden)

    Constanza Tolosa

    2017-01-01

    Full Text Available We present findings of a project that investigated the potential of an online tandem program to enhance the foreign language learning of two groups of school-aged beginner learners, one learning English in Colombia and the other learning Spanish in New Zealand. We assessed the impact of the project on students’ learning with a free writing activity done as pretest and posttest and used a semi-structured interview to explore their attitudes towards language learning and their perceived development of their native language. Data analysis indicated statistically significant gains in foreign language writing and positive attitudinal changes toward foreign and native language learning.

  11. Adobe Flash 11 Stage3D (Molehill) Game Programming Beginner's Guide

    CERN Document Server

    Kaitila, Christer

    2011-01-01

    Written in an informal and friendly manner, the style and approach of this book will take you on an exciting adventure. Piece by piece, detailed examples help you along the way by providing real-world game code required to make a complete 3D video game. Each chapter builds upon the experience and achievements earned in the last, culminating in the ultimate prize - your game! If you ever wanted to make your own 3D game in Flash, then this book is for you. This book is a perfect introduction to 3D game programming in Adobe Molehill for complete beginners. You do not need to know anything about S

  12. Shifting ontologies of a serious game and its relationships with English education for beginners

    DEFF Research Database (Denmark)

    Hansbøl, Mikala; Meyer, Bente

    2011-01-01

      This paper takes its point of departure in a language project, which is a subproject under the larger ongoing (2007-2011) research project Serious Games on a Global Market Place. The language project follows how the virtual universe known as Mingoville ( http://www.mingoville.com/ ) becomes...... point of departure in neither Mingoville as part of the media ecologies of the classroom, nor in the epistemological ramifications of Mingoville. Instead, it suggests that opening up the shifting ontologies of Mingoville (i.e. what mediates Mingoville and its relationships with doing beginners English...

  13. FusionCharts Beginner's Guide The Official Guide for FusionCharts Suite

    CERN Document Server

    Nadhani, Sanket; Bhattacharya, Shamasis

    2012-01-01

    The book is written as a practical, step-by-step guide to using FusionCharts Suite. The book not only teaches you the fundamentals and implementation of FusionCharts Suite, but also makes you the data visualization guru among your friends and colleagues by teaching how to select the right chart type and usability tips. Filled with examples, code samples and practical tips in a no-nonsense way, the book is a breeze to read.This book is both for beginners and advanced web developers who need to create interactive charts for their web applications. No previous knowledge of FusionCharts Suite is a

  14. A New Approach to Programming Language Education for Beginners with Top-Down Learning

    Directory of Open Access Journals (Sweden)

    Daisuke Saito

    2013-12-01

    Full Text Available There are two basic approaches in learning new programming language: a bottom-up approach and a top-down approach. It has been said that if a learner has already acquired one language, the top-down approach is more efficient to learn another while, for a person who has absolutely no knowledge of any programming languages; the bottom-up approach is preferable. The major problem of the bottom-up approach is that it requires longer period to acquire the language. For quicker learning, this paper applies a top-down approach for a beginners who has not yet acquired any programming languages.

  15. (Oxo)(Fluoro)-Aluminates in KF-Al2O3System: Thermal Stability and Structural Correlation.

    Science.gov (United States)

    Šimko, František; Rakhmatullin, Aydar; Florian, Pierre; Kontrík, Martin; Korenko, Michal; Netriová, Zuzana; Danielik, Vladimír; Bessada, Catherine

    2017-11-06

    Precise investigation of part of the phase diagram of KF-Al 2 O 3 system was performed in an experiment combining different techniques. Solidified mixtures of KF-Al 2 O 3 were studied by X-ray powder diffraction and high-field solid-state NMR spectroscopy over a wide range of compositions. To help with the interpretation of the NMR spectra of the solidified samples found as complex admixtures, we synthesized the following pure compounds: KAlO 2 , K 2 Al 22 O 34 , α-K 3 AlF 6 , KAlF 4 , and K 2 Al 2 O 3 F 2 . These compounds were then characterized using various solid-state NMR techniques, including MQ-MAS and D-HMQC. NMR parameters of the pure compounds were finally determined using first-principles density functional theory calculations. The phase diagram of KF-Al 2 O 3 with the alumina content up to 30 mol % was determined by means of thermal analysis. Thermal analysis was also used for the description of the thermal stability of one synthesized compound, K 2 Al 2 O 3 F 2 .

  16. Nuclear Fusion Project. Semi-annual report of the Association KfK/EURATOM

    International Nuclear Information System (INIS)

    Kast, G.

    1989-04-01

    Report on technology tasks: Blanket design studies; development of computational tools for neutronics; corrosion and fatigue of structural materials in flowing Pb-17Li; tritium extraction from liquid Pb-17Li by the use of solid getters; ceramic breeder materials; high field composite conductors; superconducting poloidal field coil development; design and construction of a poloidal field coil for TORE SUPRA as NET-prototype coil; structural materials fatigue characterization at 4 K; low electrical conductivity structural development; MANET 1; pre- and post-irradiation fatigue properties of 1.4914 martensitic steel; in-pile creep-fatigue testing of type 316 and 1.4914 steel; ceramics for first-wall protection and for RF windows; fatigue under dual beam irradiation; low activation ferritic-martensitic steels; plasma facing components; procedures and tools for structural design evaluation; remote maintenance; mechanical component assembly; handling equipment for in-vessel components; safety aspects of the cryosystem and of superconducting magnets; safety guidelines for the design of NET; generic environmental impact assessment for a fusion facility; large components for plasma exhaust pumping; optimization of cryogenic vacuum pumping of He; solid particle separators for plasma exhaust; plasma exhaust purification; adsorption of DT on heated metal beds other than U; catalyst development for the exhaust purification process; ECRH power sources; vacuum and exhaust performance of NET; NET TF pancake tests; CAD DATA exchange between NET and KfK; catalytic plasma exhaust gas clean-up facility for NET; NET blanket handling device; electrical connectors for remote handling. (orig./HP)

  17. SUPPRESSION DES REFLEXIONS MULTIPLES PAR FILTRAGE NON LINEAIRE DANS LE DOMAINE (k,f

    Directory of Open Access Journals (Sweden)

    R SELLAM

    2002-12-01

    Full Text Available La suppression des réflexions multiples, dans le domaine (k, f par le filtrage conventionnel, donne des résultats satisfaisants pour les offsets lointains. Se basant sur la différence des vitesses apparentes des réflexions primaire et multiple, ses limites apparaissent vite lorsque il y a superposition des énergies de ces réflexions. De même, on peut avoir dans le domaine (k, f le chevauchement de ces énergies ou un repliement du spectre. On a alors une partie de l’énergie du multiple qui est préservée, ou une distorsion  de l’énergie de la réflexion primaire. De plus, le filtre k-f conventionnel donne une réponse impulsionnelle pauvre, causée par le phénomène de Gibbs. Le filtre non linéaire pallie à cette difficulté. Il permet de définir automatiquement la zone du domaine (k, f à rejeter, plutôt que de remettre à zéro (brutalement la partie non désirée du spectre. Nous avons utilisé le modèle de données original (réflexions primaires et multiples et celui (prédit par équation d’onde des multiples. La fonction utilisée pour comparer les énergies est la fonction de Butterworth. L’application du filtre non linéaire donne de meilleurs résultats en utilisant le modèle multiple prédit.

  18. -Genomic data mining of the marine actinobacteriaStreptomycessp. H-KF8 unveils insights into multi-stress related genes and metabolic pathways involved in antimicrobial synthesis.

    Science.gov (United States)

    Undabarrena, Agustina; Ugalde, Juan A; Seeger, Michael; Cámara, Beatriz

    2017-01-01

    Streptomyces sp. H-KF8 is an actinobacterial strain isolated from marine sediments of a Chilean Patagonian fjord. Morphological characterization together with antibacterial activity was assessed in various culture media, revealing a carbon-source dependent activity mainly against Gram-positive bacteria ( S. aureus and L. monocytogenes ). Genome mining of this antibacterial-producing bacterium revealed the presence of 26 biosynthetic gene clusters (BGCs) for secondary metabolites, where among them, 81% have low similarities with known BGCs. In addition, a genomic search in Streptomyces  sp. H-KF8 unveiled the presence of a wide variety of genetic determinants related to heavy metal resistance (49 genes), oxidative stress (69 genes) and antibiotic resistance (97 genes). This study revealed that the marine-derived Streptomyces sp. H-KF8 bacterium has the capability to tolerate a diverse set of heavy metals such as copper, cobalt, mercury, chromate and nickel; as well as the highly toxic tellurite, a feature first time described for Streptomyces . In addition, Streptomyces sp. H-KF8 possesses a major resistance towards oxidative stress, in comparison to the soil reference strain Streptomyces violaceoruber A3(2). Moreover, Streptomyces sp. H-KF8 showed resistance to 88% of the antibiotics tested, indicating overall, a strong response to several abiotic stressors. The combination of these biological traits confirms the metabolic versatility of Streptomyces sp. H-KF8, a genetically well-prepared microorganism with the ability to confront the dynamics of the fjord-unique marine environment.

  19. Effect of the KF post-deposition treatment on grain boundary properties in Cu(In, Ga)Se2thin films.

    Science.gov (United States)

    Nicoara, N; Lepetit, Th; Arzel, L; Harel, S; Barreau, N; Sadewasser, S

    2017-01-27

    Significant power conversion efficiency improvements have recently been achieved for thin-film solar cells based on a variety of polycrystalline absorbers, including perovskites, CdTe, and Cu(In,Ga)Se 2 (CIGS). The passivation of grain boundaries (GBs) through (post-deposition) treatments is a crucial step for this success. For the case of CIGS, the introduction of a potassium fluoride post-deposition treatment (KF-PDT) has boosted their power conversion efficiency to the best performance of all polycrystalline solar cells. Direct and indirect effects of potassium at the interface and interface-near region in the CIGS layer are thought to be responsible for this improvement. Here, we show that also the electronic properties of the GBs are beneficially modified by the KF-PDT. We used Kelvin probe force microscopy to study the effect of the KF-PDT on the CIGS surface by spatially resolved imaging of the surface potential. We find a clear difference for the GB electronic properties: the KF-PDT increases the band bending at GBs by about 70% and results in a narrower distribution of work function values at the GBs. This effect of the KF-PDT on the GB electronic properties is expected to contribute to the improved efficiency values observed for CIGS thin-film solar cells with KF-PDT.

  20. Development of a Portable Training Tool for Simulating Visceral Angiographic Procedures for Beginners

    International Nuclear Information System (INIS)

    Yamagami, Takuji; Osuga, Keigo; Yoshimatsu, Rika; Matsumoto, Tomohiro; Miura, Hiroshi; Terayama, Koshi; Anai, Hiroshi; Takahashi, Masahide; Hasebe, Terumitsu; Nishimura, Tsunehiko

    2009-01-01

    The purpose of this study was to evaluate the usefulness of a tool that we developed to simulate performance of visceral angiography to train beginners in the field of splanchnic angiography. Seven residents and two fellows who were rotating within the Division of Interventional Radiology at our institution between June and August 2008 participated in the evaluation of this tool. They had no experience in performing visceral angiography as an operator. Time for selection of arterial branches arising from the celiac axis on the model was measured before and after training. After such training, the participants performed actual visceral angiography as an operator with instructors beside them. Success of the trainees in selecting visceral arterial branches was evaluated in these real-life cases. In the first test using the model, seven of nine trainees (77.8%) succeeded in selecting all required arteries, while the remaining two failed to select all required arteries. After training using the model, all trainees succeeded in selecting all required arteries just before the actual angiographic study. In the actual angiography, the catheter was successfully inserted from the femoral artery and advanced to the superior mesenteric, celiac, splenic, common hepatic, gastroduodenal, and right and left hepatic arteries by all trainees with only two exceptions. In conclusion, this tool is helpful for training beginners in visceral angiographic procedures.

  1. Peculiarities of mathematics instruction for beginners for children with disabilities in regular primary schools

    Directory of Open Access Journals (Sweden)

    Jablan Branka

    2010-01-01

    Full Text Available The paper studies the issue of education of visually impaired children, hearing impaired children and children with intellectual disabilities in regular primary schools in the context of mathematics instruction for beginners. The authors state the basic characteristics of mathematics instruction for beginners with respect to the contents studied in the first four grades of primary school, as well as the key problems and educational needs of visually impaired children, hearing impaired children and children with intellectual disabilities. The basic characteristics of inclusive education and the key role of teacher in this process are pointed out. Starting from the developmental peculiarities of children with disabilities, the authors emphasize the importance of applying an individualized approach in teaching mathematics. Possible didactic and methodical solutions are discussed, as well as different approaches in teaching this subject that can facilitate learning of mathematical contents to visually impaired children, hearing impaired children and children with intellectual disabilities. Bearing in mind the peculiarities of inclusive education, i.e. the need for the children with disabilities to participate in common activities with the other children in the class, the authors emphasize the importance of encouraging interaction and communication among children in the process of learning mathematical contents.

  2. Using Reciprocal Peer Teaching to Develop Learner Autonomy: An Action Research Project with a Beginners' Chinese Class

    Science.gov (United States)

    Liu, Weiming; Devitt, Ann

    2014-01-01

    Peer teaching has been used as a mechanism for promoting learner autonomy in a range of language learning contexts. This article explores how absolute beginners in a Chinese class can engage in reciprocal peer teaching (RPT) from the start of their language learning experience and how this contributes to the development of their autonomy as…

  3. Task-Based Language Teaching for Beginner-Level Learners of L2 French: An Exploratory Study

    Science.gov (United States)

    Erlam, Rosemary; Ellis, Rod

    2018-01-01

    This study investigated the effect of input-based tasks on the acquisition of vocabulary and grammar by beginner-level learners of L2 French and reported the introduction of task-based teaching as an innovation in a state secondary school. The experimental group (n = 19) completed a series of focused input-based language tasks, taught by their…

  4. Food Ration and Mental Training for the Improvement of the Free Throw Performance in Congolese Beginners Basketball Players

    Science.gov (United States)

    Bouhika, Eddie Janvier; Moussouami, Simplice Innocent; Tsiama Portejoie, Jean Aimé; Bazaba Kayilou, Jean Michel; Moyen, Rachel; Mizere Moungondo, Martin; Maouene, Michel; Mbemba, François

    2016-01-01

    Objective: Through an experimental study, the present work aims at testing the effectiveness of diet and mental imagery on the success of free throw in Congolese beginners Basketball Players. Method: 45 players participated in this experimental study in Brazzaville (Congo). These subjects were divided into 3 groups. Group I (n = 15), made up of…

  5. Analysis of Spelling Errors of Saudi Beginner Learners of English Enrolled in an Intensive English Language Program

    Science.gov (United States)

    Alhaisoni, Eid M.; Al-Zuoud, Khalid M.; Gaudel, Daya Ram

    2015-01-01

    This study reports the types of spelling errors made by the beginner learners of English in the EFL context as well as the major sources underpinning such errors in contextual writing composition tasks. Data were collected from written samples of 122 EFL students (male and female) enrolled in the intensive English language programme during the…

  6. Factors That Contribute to Transfer and Bachelor's Degree Attainment of Low-Income Community College Beginners

    Science.gov (United States)

    Felder, Andrea Darlene

    2016-01-01

    Transfer and bachelor's degree attainment rates of low-income community college beginners lag behind their middle- and high-income peers. As community college continues to be an affordable and accessible route to higher education, consideration should be given to how to close the gap in transfer and bachelor's degree attainment rates of low-income…

  7. Degradation of sulfur mustard on KF/Al2O3 supports: insights into the products and the reactions mechanisms.

    Science.gov (United States)

    Zafrani, Yossi; Goldvaser, Michael; Dagan, Shai; Feldberg, Liron; Mizrahi, Dana; Waysbort, Daniel; Gershonov, Eytan; Columbus, Ishay

    2009-11-06

    The degradation of the warfare agent sulfur mustard (HD) adsorbed onto KF/Al(2)O(3) sorbents is described. These processes were explored by MAS NMR, using (13)C-labeled sulfur mustard (HD*) and LC-MS techniques. Our study on the detoxification of this blister agent showed the formation of nontoxic substitution and less-toxic elimination products (t(1/2) = 3.5-355 h). Interestingly, the reaction rates were found to be affected by MAS conditions, i.e., by a centrifugation effect. The products and the mechanisms of these processes are discussed.

  8. Supernova 2009kf: An Ultraviolet Bright Type IIP Supernova Discovered With Pan-Starrs 1 and Galex

    Science.gov (United States)

    2010-07-01

    reserved. Printed in the U.S.A. SUPERNOVA 2009kf: AN ULTRAVIOLET BRIGHT TYPE IIP SUPERNOVA DISCOVERED WITH PAN-STARRS 1 AND GALEX M. T. Botticella1, C...January 29; accepted 2010 May 12; published 2010 June 16 ABSTRACT We present photometric and spectroscopic observations of a luminous Type IIP Supernova ...magnitude MNUV = −21.5 ± 0.5 mag suggests such SNe could be discovered out to z ∼ 2.5 in the PS1 survey. Key words: stars: evolution – supernovae

  9. The Beginner's Guide to Wind Tunnels with TunnelSim and TunnelSys

    Science.gov (United States)

    Benson, Thomas J.; Galica, Carol A.; Vila, Anthony J.

    2010-01-01

    The Beginner's Guide to Wind Tunnels is a Web-based, on-line textbook that explains and demonstrates the history, physics, and mathematics involved with wind tunnels and wind tunnel testing. The Web site contains several interactive computer programs to demonstrate scientific principles. TunnelSim is an interactive, educational computer program that demonstrates basic wind tunnel design and operation. TunnelSim is a Java (Sun Microsystems Inc.) applet that solves the continuity and Bernoulli equations to determine the velocity and pressure throughout a tunnel design. TunnelSys is a group of Java applications that mimic wind tunnel testing techniques. Using TunnelSys, a team of students designs, tests, and post-processes the data for a virtual, low speed, and aircraft wing.

  10. Review of The Atheist’s Primer and Atheism for Beginners

    Directory of Open Access Journals (Sweden)

    Andrew J Bissette

    2014-05-01

    Full Text Available The New Atheists are occasionally accused of lacking nuance and sophistication, or of existing in an intellectual vacuum. To some it may seem that Dawkins 'et al'. are naïve logical positivists; this perspective may be reinforced by recent authors’ explicit rejection of the value of philosophy and other non-scientific approaches to knowledge (cf. Lawrence Krauss, Stephen Hawking. Into the fray steps Michael Palmer, offering his attempt to popularise a version of atheism that is underpinned by a long tradition of philosophical inquiry. 'The Atheist’s Primer', a condensed version of Palmer’s previous work, is aptly named: it is a crash course on the history and major arguments of atheism from a firmly philosophical angle. Its companion text, 'Atheism For Beginners', is a coursebook aimed at tutors seeking to teach this material.

  11. Data analysis using SPSS for Windows, versions 8 - 10 a beginner's guide

    CERN Document Server

    Foster, Jeremy J, Dr

    2001-01-01

    A new edition of this best-selling introductory book to cover the latest SPSS versions 8.0 - 10.0 This book is designed to teach beginners how to use SPSS for Windows, the most widely used computer package for analysing quantitative data. Written in a clear, readable and non-technical style the author explains the basics of SPSS including the input of data, data manipulation, descriptive analyses and inferential techniques, including; - creating using and merging data files - creating and printing graphs and charts - parametric tests including t-tests, ANOVA, GLM - correlation, regression and factor analysis - non parametric tests and chi square reliability - obtaining neat print outs and tables - includes a CD-Rom containing example data files, syntax files, output files and Excel spreadsheets.

  12. 101 amazing sights of the night sky a guided tour for beginners

    CERN Document Server

    Moromisato, George

    2017-01-01

    Is there anything more wondrous and alluring than the night sky? You've seen the stars, and you know about the constellations--but there's so much more to discover! George Moromisato's magnificent full-color guide introduces you to 101 amazing sights, from Saturn's famous rings to the Andromeda Galaxy. Learn what to look for and when and where to find it! This astronomy book is perfect for beginners, so many objects can be seen with the unaided eye or binoculars, while others simply require a small telescope. Book Features: Guide to 101 phenomena and objects of the night sky, ranked by beauty, accessibility and historical importance Information about equipment needed, from binoculars to small telescopes Full-color photographs, including many from NASA Astrophotography tips on taking pictures of the night sky, such as snapping shots with a phone through a telescope Charts to know when to look for solar eclipses, meteor showers and other notable events.

  13. Objective-C for Absolute Beginners iPhone and Mac Programming Made Easy

    CERN Document Server

    Bennett, Gary; Fisher, Mitchell

    2010-01-01

    It seems as if everyone is writing applications for Apple's iPhone and iPad, but how do they all do it? It's best to learn Objective-C, the native language of both the iOS and Mac OS X, but where to begin? Right here, even if you've never programmed before! Objective-C for Absolute Beginners will teach you how to write software for your Mac, iPhone,or iPad using Objective-C, an elegant and powerful language with a rich set of developer tools. Using a hands-on approach, you'll learn to think in programming terms, how to use Objective-C to build program logic, and how to write your own applicati

  14. Optical spectra of phthalocyanines and related compounds a guide for beginners

    CERN Document Server

    Isago, Hiroaki

    2015-01-01

    This book displays how optical (absorption, emission, and magnetic circular dichroism) spectra of phthalocyanines and related macrocyclic dyes can be varied from their prototypical ones depending on conditions. As these compounds can be involved in colorful chemistry (which might be driven by impurities in solvents), their spectra behave like the sea-god Proteus in their mutability. Therefore, those who have been engaged with phthalocyanines for the first time, including even educated professional researchers and engineers, may have been embarrassed by the deceptive behavior of their compounds and could have, in the worst cases, given up their projects. This book is aimed not merely at reviewing the optical spectra, but also at helping such people, particularly beginners, to figure them out by showing some examples of their prototypical spectra and their variations in several situations. For the purpose of better understanding, the book also provides an introduction to their theoretical backgrounds as graphic...

  15. Joint DEnKF-albedo assimilation scheme that considers the common land model subgrid heterogeneity and a snow density-based observation operator for improving snow depth simulations

    Science.gov (United States)

    Xu, Jianhui; Zhang, Feifei; Zhao, Yi; Shu, Hong; Zhong, Kaiwen

    2016-07-01

    For the large-area snow depth (SD) data sets with high spatial resolution in the Altay region of Northern Xinjiang, China, we present a deterministic ensemble Kalman filter (DEnKF)-albedo assimilation scheme that considers the common land model (CoLM) subgrid heterogeneity. In the albedo assimilation of DEnKF-albedo, the assimilated albedos over each subgrid tile are estimated with the MCD43C1 bidirectional reflectance distribution function (BRDF) parameters product and CoLM calculated solar zenith angle. The BRDF parameters are hypothesized to be consistent over all subgrid tiles within a specified grid. In the SCF assimilation of DEnKF-albedo, a DEnKF combining a snow density-based observation operator considers the effects of the CoLM subgrid heterogeneity and is employed to assimilate MODIS SCF to update SD states over all subgrid tiles. The MODIS SCF over a grid is compared with the area-weighted sum of model predicted SCF over all the subgrid tiles within the grid. The results are validated with in situ SD measurements and AMSR-E product. Compared with the simulations, the DEnKF-albedo scheme can reduce errors of SD simulations and accurately simulate the seasonal variability of SD. Furthermore, it can improve simulations of SD spatiotemporal distribution in the Altay region, which is more accurate and shows more detail than the AMSR-E product.

  16. KF post-deposition treatment of industrial Cu(In, Ga)(S, Se)2 thin-film surfaces: Modifying the chemical and electronic structure

    Science.gov (United States)

    Mezher, Michelle; Mansfield, Lorelle M.; Horsley, Kimberly; Blum, Monika; Wieting, Robert; Weinhardt, Lothar; Ramanathan, Kannan; Heske, Clemens

    2017-08-01

    The chemical and electronic structures of industrial chalcopyrite photovoltaic absorbers after KF post-deposition treatment (KF-PDT) are investigated using electron spectroscopies to probe the occupied and unoccupied electronic states. In contrast to a variety of recent publications on the impact of KF-PDT, this study focuses on industrial Cu(In,Ga)(S,Se)2 absorbers that also contain sulfur at the surface. We find that the KF-PDT removes surface adsorbates and oxides and also observe a change in the S/Se ratio. Furthermore, the KF-PDT leads to a Cu reduction at the surface but to a much lower degree than the strongly Cu-depleted or even Cu-free surfaces reported for (non-industrial) sulfur-free Cu(In,Ga)Se2 absorbers. The valence band maximum at the surface is found at a lower energy compared to the untreated absorber, and the conduction band minimum is found at a higher energy, overall revealing a widening of the bandgap in the surface region.

  17. Is Contrast Enhanced Ultrasonography a useful tool in a beginner's hand? How much can a Computer Assisted Diagnosis prototype help in characterizing the malignancy of focal liver lesions?

    Science.gov (United States)

    Moga, Tudor Voicu; Popescu, Alina; Sporea, Ioan; Danila, Mirela; David, Ciprian; Gui, Vasile; Iacob, Nicoleta; Miclaus, Gratian; Sirli, Roxana

    2017-08-23

    Contrast enhanced ultrasound (CEUS) improved the characterization of focal liver lesions (FLLs), but is an operatordependent method. The goal of this paper was to test a computer assisted diagnosis (CAD) prototype and to see its benefit in assisting a beginner in the evaluation of FLLs. Our cohort included 97 good quality CEUS videos[34% hepatocellular carcinomas (HCC), 12.3% hypervascular metastases (HiperM), 11.3% hypovascular metastases (HipoM), 24.7% hemangiomas (HMG), 17.5% focal nodular hyperplasia (FNH)] that were used to develop a CAD prototype based on an algorithm that tested a binary decision based classifier. Two young medical doctors (1 year CEUS experience), two experts and the CAD prototype, reevaluated 50 FLLs CEUS videos (diagnosis of benign vs. malignant) first blinded to clinical data, in order to evaluate the diagnostic gap beginner vs. expert. The CAD classifier managed a 75.2% overall (benign vs. malignant) correct classification rate. The overall classification rates for the evaluators, before and after clinical data were: first beginner-78%; 94%; second beginner-82%; 96%; first expert-94%; 100%; second expert-96%; 98%. For both beginners, the malignant vs. benign diagnosis significantly improved after knowing the clinical data (p=0.005; p=0,008). The expert was better than the beginner (p=0.04) and better than the CAD (p=0.001). CAD in addition to the beginner can reach the expert diagnosis. The most frequent lesions misdiagnosed at CEUS were FNH and HCC. The CAD prototype is a good comparing tool for a beginner operator that can be developed to assist the diagnosis. In order to increase the classification rate, the CAD system for FLL in CEUS must integrate the clinical data.

  18. KF/Al2O3 as a Recyclable Basic Catalyst for 1,3-Dipolar Cycloaddition Reaction: Synthesis of Indolizine-1-Carbonitrile Derivatives

    Directory of Open Access Journals (Sweden)

    Abaszadeh Mehdi

    2017-07-01

    Full Text Available KF/Al2O3 as a green and efficient catalyst has been used for synthesis of indolizine-1-carbonitrile derivatives. It can be proceeded by using 1,3-dipolar cycloaddition reaction of 1-alkyl-2-chloropyridinium bromides, malononitrile and benzaldehyde in ethanol, at reflux. The great advantage of this catalyst is the ease of handling. KF/Al2O3 can be used and removed by filtration, avoiding cumbersome aqueous workups and decreasing solvent waste handling issues. High conversions, short reaction times and a cleaner reaction profiles are some of the outstanding advantages of this method.

  19. Make use of dynamic data - a constraint based EnKF for SAGD reservoir characterization and production management

    Energy Technology Data Exchange (ETDEWEB)

    Gul, Ali; Nejadi, Siavash; Shah, Sirish L; Trivedi, Japan J [University of Alberta (Canada)

    2011-07-01

    Steam assisted gravity drainage (SAGD) is a thermal recovery process widely used in the Athabasca oil sands, the largest bitumen reservoir in the world. In order to optimize the process, an accurate characterization of the reservoir heterogeneity and identification of the potential steam barriers is necessary. The aim of this paper was to assess the potential of constraint based ensemble Kalman filter (EnKF) approach with localization to address these issues. Data records from observation, production and injection wells were used and the method was tested on a twin well SAGD process and a single well SAGD model with hybrid grids. Results showed a better characterization of the reservoir's heterogeneity and a reduction of uncertainty in the prediction of steam chamber growth. The technique developed herein provides accurate information about the steam chamber and the reservoir heterogeneity and can be used for planning and decision making of other field development strategies.

  20. Gaussian anamorphosis in the analysis step of the EnKF: a joint state-variable/observation approach

    Directory of Open Access Journals (Sweden)

    Javier Amezcua

    2014-09-01

    Full Text Available The analysis step of the (ensemble Kalman filter is optimal when (1 the distribution of the background is Gaussian, (2 state variables and observations are related via a linear operator, and (3 the observational error is of additive nature and has Gaussian distribution. When these conditions are largely violated, a pre-processing step known as Gaussian anamorphosis (GA can be applied. The objective of this procedure is to obtain state variables and observations that better fulfil the Gaussianity conditions in some sense. In this work we analyse GA from a joint perspective, paying attention to the effects of transformations in the joint state-variable/observation space. First, we study transformations for state variables and observations that are independent from each other. Then, we introduce a targeted joint transformation with the objective to obtain joint Gaussianity in the transformed space. We focus primarily in the univariate case, and briefly comment on the multivariate one. A key point of this paper is that, when (1–(3 are violated, using the analysis step of the EnKF will not recover the exact posterior density in spite of any transformations one may perform. These transformations, however, provide approximations of different quality to the Bayesian solution of the problem. Using an example in which the Bayesian posterior can be analytically computed, we assess the quality of the analysis distributions generated after applying the EnKF analysis step in conjunction with different GA options. The value of the targeted joint transformation is particularly clear for the case when the prior is Gaussian, the marginal density for the observations is close to Gaussian, and the likelihood is a Gaussian mixture.

  1. Quantitative Analysis of KF-LiF-ZrF4 Molten Salt by Probe Assisted in-situ LIBS Systems

    International Nuclear Information System (INIS)

    Kim, S.H.; Moon, J.H.; Kim, D.H.; Hwang, I.S.; Lee, J.H.

    2015-01-01

    Full text of publication follows: Pyro-processing draws attention as a recycling process of spent nuclear fuel for future nuclear reactor. In the aspect of process control and safeguards of the pyro-processing, it requires a technology to measure the concentration of molten salt in real-time. The existing technologies measure the concentration by chemical analysis of sampled molten salt in the hot cell but it is disadvantageous in the aspects of cost, safety and time. The LIBS (Laser-Induced Breakdown Spectroscopy) is a form of atomic emission spectroscopy in which a pulsed laser is used as the excitation source. LIBS technology is appropriate to measure sensitive nuclear materials in hot cell because it is capable of measuring specimen quantitatively and qualitatively by exited atom by laser. Spectrum obtained from plasma is largely influenced by laser operation conditions and physical properties of specimens. Also, plasma induction is limited on the surface of specimen, so analysis of composition inside of the molten salt is extremely difficult. Thus, several restrictions should be overcome in order to apply LIBS for the measurement of molten salt (KF-LiF-ZrF 4 ) composition in real-time. In this study probe assisted LIBS system will be introduced with KF-LiF-ZrF 4 to quantitatively measure molten salt composition. Echelle spectrometer was used and the measurable wavelength area was 250-400 nm, the range of UV ray. NIST atomic spectra database measured the wavelength for molten salt composition, and each element was selected high signal intensity and wavelength range that is not overlapped by other elements. (authors)

  2. Simultaneous morphology manipulation and upconversion luminescence enhancement of β-NaYF4:Yb3+/Er3+ microcrystals by simply tuning the KF dosage.

    Science.gov (United States)

    Ding, Mingye; Chen, Daqin; Yin, Shilong; Ji, Zhenguo; Zhong, Jiasong; Ni, Yaru; Lu, Chunhua; Xu, Zhongzi

    2015-08-03

    A strategy has been adopted for simultaneous morphology manipulation and upconversion luminescence enhancement of β-NaYF4:Yb(3+)/Er(3+) microcrystals by simply tuning the KF dosage. X-ray power diffraction (XRD), field emission scanning electron microscopy (FE-SEM), transmission electron microscopy (TEM), X-ray photoelectron spectroscopy (XPS) and photoluminescence spectra (PL) were used to characterize the samples. The influence of molar ratio of KF to Y(3+) on the crystal phase and morphology has been systematically investigated and discussed. It is found that the molar ratio of KF to Y(3+) can strongly control the morphology of the as-synthesized β-NaYF4 samples because of the different capping effect of F(-) ions on the different crystal faces. The possible formation mechanism has been proposed on the basis of a series of time-dependent experiments. More importantly, the upconversion luminescence of β-NaYF4:Yb(3+)/Er(3+) was greatly enhanced by increasing the molar ratio of KF to RE(3+) (RE = Y, Yb, Er), which is attributed to the distortion of local crystal field symmetry around lanthanide ions through K(+) ions doping. This synthetic methodology is expected to provide a new strategy for simultaneous morphology control and remarkable upconversion luminescence enhancement of yttrium fluorides, which may be applicable for other rare earth fluorides.

  3. The importance of localization in the assimilation of 4D seismic data in the data assimilation process using the EnKF

    NARCIS (Netherlands)

    Trani, M.; Arts, R.; Leeuwenburgh, O.; Brouwer, J.; Douma, S.

    2009-01-01

    The Ensemble Kaiman Filter (EnKF) is considered a fast and efficient algorithm in the data assimilation process to estimate reservoir properties from measured data. 4D seismics is an important source of information for the reservoir monitoring and the improvement of the geological model. The use of

  4. Shaping your Identity as a Speaker of English: The Struggles of a Beginner Language Learner

    Directory of Open Access Journals (Sweden)

    Janeth María Ortiz Medina

    2017-08-01

    Full Text Available In Colombia, political and educational campaigns have promoted English as the language of success and as a fundamental requirement to comply with the demands of a globalized world; nevertheless, little attention has been paid to the individual experiences of Colombians as they learn this language or to what happens to their identities during this process. This paper reports on a study that explored how three young adult learners of English constructed their identities as speakers of English through their positioning in oral tasks in an English class. It focuses on the story of one of the participants: a beginner female English learner. Data collection methods included class video and audio-recordings, interviews, and diaries kept by the participants. Findings indicated that learners’ positioning in spoken interactions not only directly affected their use of English, but also led them to non-linear transformations of their identities as speakers of English. These results pinpoint the need to gain awareness of the centrality of students’ identities in both their learning process and in language teaching practices and the need to observe how positioning operates in the language classroom.

  5. USABILITY TESTING OF JAPANESE CAPTIONS SEGMENTATION SYSTEM TO SCAFFOLD BEGINNERS TO COMPREHEND JAPANESE VIDEOS

    Directory of Open Access Journals (Sweden)

    Ya-Fei Yang

    2013-06-01

    Full Text Available A major learning difficulty of Japanese foreign language (JFL learners is the complex composition of two syllabaries, hiragana and katakana, and kanji characters adopted from logographic Chinese ones. As the number of Japanese language learners increases, computer-assisted Japanese language education gradually gains more attention. This study aimed to adopt a Japanese word segmentation system to help JFL learners overcome literacy problems. This study adopted MeCab, a Japanese morphological analyzer and part-of-speech (POS tagger, to segment Japanese texts into separate morphemes by adding spaces and to attach POS tags to each morpheme for beginners. The participants were asked to participate in three experimental activities involvingwatching two Japanese videos with general or segmented Japanese captions and complete the Nielsen’s Attributes of Usability (NAU survey and the After Scenario Questionnaire (ASQ to evaluate the usability of the learning activities. The results of the system evaluation showed that the videos with the segmented captions could increase the participants’ learning motivation and willingness to adopt the word segmentation system to learn Japanese.

  6. HOLISTIC APPROACH TO DEVELOPING TEXTBOOKS FOR CHILDREN-BEGINNERS IN PIANO PLAYING

    Directory of Open Access Journals (Sweden)

    Zīmele – Šteina Ineta

    2012-06-01

    Full Text Available The paper presents a summary of a four-year long research on the text books in piano playing for the beginners. On the one hand, today, changes in paradigms are discussed much about (child-centered education, national standards are defined and author programmes have been developed by teachers; on the other hand, teaching aids adequate to the new paradigm and aimed at promoting 5-7 year old children’s education in piano playing do not exist. The Aim of the Study is to formulate holistic approach-based principles that would underlie the development of a contemporary, scientifically valid teaching aid in piano playing for 5-7 year old children. Research subject: holistic approach to the development of a teaching aid in piano playing for 5-7 year old children. Research object: principles of developing a teaching aid. The research results in defining the holistic approach-based principles for developing a teaching aid: gradualness, visuality, musical diversity, compactness, regularity, esthetics, national/ multinational principle, perceptibility, adequacy to the age, self-creation and scientific principle. On the basis of these principles, a text book for 5-7 year old children has been designed by the author and assessed by experts. The research data are analyzed both qualitatively (surveys of teachers and pupils’ parents and quantitatively (method of experts’ conclusions. A textbook could help to comprehend what is happening at music lessons and easier join the piano training process, and it could also make the piano training process, whose participants are children, teachers and parents, more diverse and creative.

  7. Predictability over the North Atlantic ocean in hindcast ensembles of MPI-ESM initialized by EnKF and three nudging systems

    Science.gov (United States)

    Brune, Sebastian; Pohlmann, Holger; Düsterhus, Andre; Kröger, Jürgen; Müller, Wolfgang; Baehr, Johanna

    2016-04-01

    We investigate hindcast skill for surface air temperature and upper ocean heat content (0-700m) in the North Atlantic for yearly mean values from 1960 to 2014 in four prediction systems based on the global coupled Max Planck Institute for Meteorology Earth System Model (MPI-ESM). We find that in the North Atlantic and within the four prediction systems under consideration only the EnKF initialized hindcasts reproduce the variability of the reference data well both in terms of anomaly correlation and representation of the probability density function. The systems under consideration only differ in the method how they incorporate surface and sub-surface oceanic temperatures and salinities during assimilation: ensemble Kalman Filter (EnKF), anomaly nudging of ORA reanalysis (BS-1), full field nudging of ORA and GECCO reanalysis, respectively (PT-ORA, PT-GEC). We assess the hindcast skill of each prediction system with reference to HadCRUT4 near surface air temperature data (Morice et al. 2012) and NOAA OC5 upper ocean heat content data (Levitus et al. 2012) using anomaly correlation (ACC) and by analysing the interquartile range (IQR) of the probability density function (PDF). Firstly, we calculate hindcast skill in terms of ACC and IQR against reference data over the whole time period. Here, the hindcast skills of EnKF and BS-1 are better for both ACC and IQR in lead years 2 to 5 when compared to PT-ORA and PT-GEC, their hindcast skill drops off after lead year 1. Secondly, the PDF of the reference data is not uniformly distributed over time. We therefore calculate ACC and IQR for a 20 year moving window. We find hindcast skill in terms of ACC for EnKF and BS-1 in the 1960s and from the 1990s onwards, up to eight lead years in advance, with almost no skill for the time period inbetween. In contrast, there is no skill for PT-ORA and PT-GEC in any period after lead year one. The IQR of reference data is best captured by the EnKF, in the 1960s and 1990s up to lead year

  8. The redox chemistry of niobium(V) fluoro and oxofluoro complexes in LiF-NaF-KF melts

    DEFF Research Database (Denmark)

    Matthiesen, Flemming; Christensen, Erik; Barner, Jens H. Von

    1996-01-01

    The electrochemical behavior of niobium(V) fluoro and oxofluoro complexes in eutectic LiF-NaF-KF (FLINAK) melts at 700 degrees C has been studied by cyclic voltammetry. The fluoro complexes NbF72-, introduced into the melt by the addition of K2NbF7, can be reduced to niobium metal in two reversible...... the conversion is more nearly complete than at 700 degrees C, while the presence of NbOFn(n-3-) complexes cannot be identified in cyclic voltammograms obtained at 795 degrees C. It is concluded that the degree of conversion decreases with increasing temperature. At Na2O/K2NbF7 molar ratios equal to three......, electroactivity is still observed in the melt, indicating the presence of solute species. The products of reduction of the oxofluoro complexes have not been identified because the reduction of NbOFn((n-3)-) ions cannot be obtained without simultaneous reduction of Nb(IV)F-x((x-4)-) ions, and at Na2O/K2NbF7 molar...

  9. Metabolomics reveals differences of metal toxicity in cultures of Pseudomonas pseudoalcaligenes KF707 grown on different carbon sources

    Directory of Open Access Journals (Sweden)

    Sean Cameron Booth

    2015-08-01

    Full Text Available Co-contamination of metals and organic pollutants is a global problem as metals interfere with the metabolism of complex organics by bacteria. Based on a prior observation that metal tolerance was altered by the sole carbon source being used for growth, we sought to understand how metal toxicity specifically affects bacteria using an organic pollutant as their sole carbon source. To this end metabolomics was used to compare cultures of Pseudomonas pseudoalcaligenes KF707 grown on either biphenyl or succinate as the sole carbon source in the presence of either aluminum or copper. Using multivariate statistical analysis it was found that the metals caused perturbations to more cellular processes in the cultures grown on biphenyl than those grown on succinate. Aluminum induced many changes that were indicative of increased oxidative stress as metabolites involved in DNA damage and protection, the Krebs cycle and anti-oxidant production were altered. Copper also caused metabolic changes that were indicative of similar stress, as well as appearing to disrupt other key enzymes such as fumarase. Additionally, both metals caused the accumulation of biphenyl degradation intermediates indicating that they interfered with biphenyl metabolism. Together these results provide a basic understanding of how metal toxicity specifically affects bacteria at a biochemical level during the degradation of an organic pollutant and implicate the catabolism of this carbon source as a major factor that exacerbates metal toxicity.

  10. Binary and ternary binding affinities between exonuclease-deficient Klenow fragment (Kf-exo(-)) and various arylamine DNA lesions characterized by surface plasmon resonance.

    Science.gov (United States)

    Vaidyanathan, V G; Xu, Lifang; Cho, Bongsup P

    2012-08-20

    We used surface plasmon resonance (SPR) to characterize the binding interactions between the exonulease-free Klenow fragment (Kf-exo(-)) and unmodified and modified dG adducts derived from arylamine carcinogens: fluorinated 2-aminofluorene (FAF), 2-acetylaminofluorene (FAAF), and 4-aminobiphenyl (FABP). Tight polymerase binding was detected with unmodified dG and the correct dCTP. The discrimination of correct versus incorrect nucleotides was pronounced with K(D) values in the order of dCTP ≪ dTTP Kf-exo(-) binding tighter to the FAAF (k(off): 0.02 s(-1)) and FABP (k(off): 0.01 s(-1)) lesions than to FAF (k(off): 0.04 s(-1)).

  11. Effect of single flame retardant aluminum tri-hydroxide and boric acid against inflammability and biodegradability of recycled PP/KF composites

    Science.gov (United States)

    Suharty, Neng Sri; Dihardjo, Kuncoro; Handayani, Desi Suci; Firdaus, Maulidan

    2016-03-01

    Composites rPP/DVB/AA/KF had been reactively synthesized in melt using starting material: recycled polypropylene (rPP), kenaf fiber (KF), multifunctional compound acrylic acid (AA), compatibilizer divinyl benzene (DVB). To improve the inflammability of composites, single flame retardant aluminum tri-hydroxide (ATH) and boric acid (BA) as an additive was added. The inflammability of the composites was tested according to ASTM D635. By using 20% ATH and 5% BA additive in the composites it is effectively inhibiting its time to ignition (TTI). Its burning rate (BR) can be reduced and its heat realease (%HR) decreases. The biodegradability of composites was quantified by its losing weight (LW) of composites after buried for 4 months in the media with rich cellulolytic bacteria. The result shows that the LW of composites in the presence 20% ATH and 5% BA is 6.3%.

  12. Thermodynamic Assessment of Hot Corrosion Mechanisms of Superalloys Hastelloy N and Haynes 242 in Eutectic Mixture of Molten Salts KF and ZrF4

    Energy Technology Data Exchange (ETDEWEB)

    Michael V. Glazoff

    2012-02-01

    The KF - ZrF4 system was considered for the application as a heat exchange agent in molten salt nuclear reactors (MSRs) beginning with the work carried out at ORNL in early fifties. Based on a combination of excellent properties such as thermal conductivity, viscosity in the molten state, and other thermo-physical and rheological properties, it was selected as one of possible candidates for the nuclear reactor secondary heat exchanger loop.

  13. Sono-synthesis of biodiesel from soybean oil by KF/γ-Al₂O₃ as a nano-solid-base catalyst.

    Science.gov (United States)

    Shahraki, H; Entezari, M H; Goharshadi, E K

    2015-03-01

    In this work, biodiesel has successfully prepared via ultrasonic method in a short time and low temperature by nano-solid-base catalyst (KF/γ-Al₂O₃). The catalyst was obtained by calcination of a mixture of KF and γ-Al₂O₃ m(KF)/m(γ-Al₂O₃) at 500 °C for 3 h. Nano-solid-base catalyst was characterized with scanning electron microscopy (SEM), transmission electron microscope (TEM), X-ray diffraction (XRD), Fourier transform infrared (FT-IR), thermal gravimetry (TG) and the Hammett indicator methods. The TEM image depicted nanoparticles and uniform dispersion of active phase over alumina. The XRD analysis confirmed the formation of potassium aluminum fluoride (K₃AlF₆) and potassium oxide, active catalyst for transesterification. The transesterification of soybean oil with methanol was performed by using both low frequency ultrasonic reactor (20 kHz) and mechanical stirring in the presence of KF/γ-Al₂O₃. The influence of various parameters such as ultrasonic power, oil/methanol molar ratio, catalyst concentration, time, and temperature were studied on the biodiesel formation. The maximum yield (95%) was achieved by applying 45 W acoustic power, molar ratio of alcohol to oil at 12:1, catalyst concentration of 2.0 wt%, 40 min sonication, and temperature of 50 °C. The transesterification was performed in 360 min using mechanical stirring with 76% yield. The results confirm that ultrasound significantly accelerates the transesterification reaction in comparison with the mechanical stirring. Copyright © 2014 Elsevier B.V. All rights reserved.

  14. A practical and green approach toward synthesis of N3-substituted dihydropyrimidinones: using Aza-Michael addition reaction catalyzed by KF/Al2O3.

    Science.gov (United States)

    Wang, Xicun; Quan, Zhengjun; Wang, Jun-Ke; Zhang, Zhang; Wang, Mangang

    2006-09-01

    A simple and efficient method for the synthesis of N3-substituted 3,4-dihydropyrimidinones by aza-Michael addition reactions of 3,4-dihydropyrimidinones to alpha,beta-ethylenic compounds catalyzed by KF/Al(2)O(3) is described. The advantage of this method is high regioselectivity, high purity, and the use of a cheaper, milder, and efficient catalyst for the hetero-Michael addition reaction.

  15. Effect of cyclical thermal to mechanical properties of Hybrid Laminate Composites (HLC) with skin recycle polypropylene/natural fiber/halloysite and core PP/KF composites

    Science.gov (United States)

    Sri Suharty, Neng; Ismail, Hanafi; Suci Handayani, Desi; Diharjo, Kuncoro; Rachman Wibowo, Fajar; Arnita Wuri, Margaretha

    2016-02-01

    This research has successfully synthesized six hybrid laminate composites (HLC). These HLC consist of two layers skin composites and one layer of core PP/KF composites. There are sticked with epoxy adhesive by using cold press method. In this research 6 types of skin are used, namely the rPP (recycled polypropylene, HC1); rPP/DVB/PP-g-AA/KF (HC2); rPP/DVB/PP-g-AA/Hall (HC3); rPP/DVB/PP-g-AA/Hall+ZB (HC4); rPP/DVB/PP-g-AA/KF/Hall (HC5) and rPP/DVB/PP-g-AA/KF/Hall+ZB (HC6) composites. The mechanical properties assessment tensile strength (TS) of various HLC before and after cyclical thermal (CT) was done by ASTM D638. While testing the flame retardant: such as time to ignition (TTI) and burning rate (BR) was done by ASTM D635. Heat stability of HLC can be recognized by conducting the CT treatment. It is to determine the effect of fluctuating heat loads on mechanical properties of HLC materials. The TS result of five HLCs (HC2, HC3, HC4, HC5 and HC6) before CT treatment were higher than HC1 (blank HLC). Those five HLC are also able to increase the TTI and reduce the BR compared to HC1. The CT treatment conditions performed at 45 oC as much as 125 times. After CT treatment, the TS values only slightly decline compared to before CT treatment.

  16. A Prototype Regional GSI-based EnKF-Variational Hybrid Data Assimilation System for the Rapid Refresh Forecasting System: Dual-Resolution Implementation and Testing Results

    Science.gov (United States)

    Pan, Yujie; Xue, Ming; Zhu, Kefeng; Wang, Mingjun

    2018-05-01

    A dual-resolution (DR) version of a regional ensemble Kalman filter (EnKF)-3D ensemble variational (3DEnVar) coupled hybrid data assimilation system is implemented as a prototype for the operational Rapid Refresh forecasting system. The DR 3DEnVar system combines a high-resolution (HR) deterministic background forecast with lower-resolution (LR) EnKF ensemble perturbations used for flow-dependent background error covariance to produce a HR analysis. The computational cost is substantially reduced by running the ensemble forecasts and EnKF analyses at LR. The DR 3DEnVar system is tested with 3-h cycles over a 9-day period using a 40/˜13-km grid spacing combination. The HR forecasts from the DR hybrid analyses are compared with forecasts launched from HR Gridpoint Statistical Interpolation (GSI) 3D variational (3DVar) analyses, and single LR hybrid analyses interpolated to the HR grid. With the DR 3DEnVar system, a 90% weight for the ensemble covariance yields the lowest forecast errors and the DR hybrid system clearly outperforms the HR GSI 3DVar. Humidity and wind forecasts are also better than those launched from interpolated LR hybrid analyses, but the temperature forecasts are slightly worse. The humidity forecasts are improved most. For precipitation forecasts, the DR 3DEnVar always outperforms HR GSI 3DVar. It also outperforms the LR 3DEnVar, except for the initial forecast period and lower thresholds.

  17. Application of the Gaussian anamorphosis to assimilation in a 3-D coupled physical-ecosystem model of the North Atlantic with the EnKF: a twin experiment

    Directory of Open Access Journals (Sweden)

    E. Simon

    2009-11-01

    Full Text Available We consider the application of the Ensemble Kalman Filter (EnKF to a coupled ocean ecosystem model (HYCOM-NORWECOM. Such models, especially the ecosystem models, are characterized by strongly non-linear interactions active in ocean blooms and present important difficulties for the use of data assimilation methods based on linear statistical analysis. Besides the non-linearity of the model, one is confronted with the model constraints, the analysis state having to be consistent with the model, especially with respect to the constraints that some of the variables have to be positive. Furthermore the non-Gaussian distributions of the biogeochemical variables break an important assumption of the linear analysis, leading to a loss of optimality of the filter. We present an extension of the EnKF dealing with these difficulties by introducing a non-linear change of variables (anamorphosis function in order to execute the analysis step in a Gaussian space, namely a space where the distributions of the transformed variables are Gaussian. We present also the initial results of the application of this non-Gaussian extension of the EnKF to the assimilation of simulated chlorophyll surface concentration data in a North Atlantic configuration of the HYCOM-NORWECOM coupled model.

  18. Controlling instabilities along a 3DVar analysis cycle by assimilating in the unstable subspace: a comparison with the EnKF

    Directory of Open Access Journals (Sweden)

    A. Carrassi

    2008-07-01

    Full Text Available A hybrid scheme obtained by combining 3DVar with the Assimilation in the Unstable Subspace (3DVar-AUS is tested in a QG model, under perfect model conditions, with a fixed observational network, with and without observational noise. The AUS scheme, originally formulated to assimilate adaptive observations, is used here to assimilate the fixed observations that are found in the region of local maxima of BDAS vectors (Bred vectors subject to assimilation, while the remaining observations are assimilated by 3DVar. The performance of the hybrid scheme is compared with that of 3DVar and of an EnKF. The improvement gained by 3DVar-AUS and the EnKF with respect to 3DVar alone is similar in the present model and observational configuration, while 3DVar-AUS outperforms the EnKF during the forecast stage. The 3DVar-AUS algorithm is easy to implement and the results obtained in the idealized conditions of this study encourage further investigation toward an implementation in more realistic contexts.

  19. EnKF assimilation of simulated spaceborne Doppler observations of vertical velocity: impact on the simulation of a supercell thunderstorm and implications for model-based retrievals

    Directory of Open Access Journals (Sweden)

    W. E. Lewis

    2006-01-01

    Full Text Available Recently, a number of investigations have been made that point to the robust effectiveness of the Ensemble Kalman Filter (EnKF in convective-scale data assimilation. These studies have focused on the assimilation of ground-based Doppler radar observations (i.e. radial velocity and reflectivity. The present study differs from these investigations in two important ways. First, in anticipation of future satellite technology, the impact of assimilating spaceborne Doppler-retrieved vertical velocity is examined; second, the potential for the EnKF to provide an alternative to instrument-based microphysical retrievals is investigated. It is shown that the RMS errors of the analyzed fields produced by assimilation of vertical velocity alone are in general better than those obtained in previous studies: in most cases assimilation of vertical velocity alone leads to analyses with small errors (e.g. <1 ms-1 for velocity components after only 3 or 4 assimilation cycles. The microphysical fields are notable exceptions, exhibiting lower errors when observations of reflectivity are assimilated together with observations of vertical velocity, likely a result of the closer relationship between reflectivity and the microphysical fields themselves. It is also shown that the spatial distribution of the error estimates improves (i.e. approaches the true errors as more assimilation cycles are carried out, which could be a significant advantage of EnKF model-based retrievals.

  20. Structural aspects of the formation of solid solutions in the NaF-KF-AlF3 system

    Science.gov (United States)

    Samoilo, Alexander S.; Zaitseva, Yulia N.; Dubinin, Peter S.; Piksina, Oksana E.; Ruzhnikov, Sergei G.; Yakimov, Igor S.; Kirik, Sergei D.

    2017-08-01

    The formation of solid solutions in the ternary system NaF-KF-AlF3 has been studied by X-ray diffraction and thermal analysis. Chiolite has been shown to form solid solutions with the composition (Na(5-x)Kx)Al3F14, in the limited range of 0

  1. Assessing Verbal Functioning in South African School Beginners from Diverse Socioeconomic Backgrounds: A Comparison between Verbal Working Memory and Vocabulary Measures

    Science.gov (United States)

    Cockcroft, Kate; Bloch, Lauren; Moolla, Azra

    2016-01-01

    This study investigated whether measures of verbal working memory are less sensitive to children's socioeconomic background than traditional vocabulary measures. Participants were 120 school beginners, divided into high and low socioeconomic groups. The groups contained equal numbers of English first-language and second-language speakers. All were…

  2. A Comparison between Verbal Working Memory and Vocabulary in Bilingual and Monolingual South African School Beginners: Implications for Bilingual Language Assessment

    Science.gov (United States)

    Cockcroft, Kate

    2016-01-01

    This study compared bilingual and monolingual school beginners on measures of simple and complex verbal working memory and receptive and expressive vocabulary. The aim was to determine whether the tests of working memory are fairer measures of language ability than the vocabulary tests for bilingual children when tested in their second language.…

  3. An Argument for the Use of Authentic Texts with Beginners of Japanese as a Foreign Language. CLCS Occasional Paper No. 58.

    Science.gov (United States)

    Ruddock, Karen

    This paper argues that the use of Japanese authentic texts in the Japanese second language classroom is superior to using texts written for pedagogical purposes. Authentic texts are very useful teaching tools, even for beginners. They are more interesting, because they have been written for a communicative purpose and their content promotes the…

  4. KF05 METAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

  5. KF70 METAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

  6. KF46 METAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

  7. KF44 METAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

  8. Catalytic effect of KF-846 on the reforming of the primary intermediates from the co-pyrolysis of pubescens and LDPE

    International Nuclear Information System (INIS)

    Liu, Wen-wu; Hu, Chang-wei; Tong, Dong-mei; Yang, Yu; Li, Gui-ying; Zhu, Liang-fang; Tang, Jin-Qiang

    2014-01-01

    Highlights: • Reforming reactions were inhibited by H 2 , decrease of acidity and low temperature. • There was a synergistic effect on producing hydrogen between Ni and Mo. • The lattice oxygen over catalyst employed might transfer into the intermediates. • Co-pyrolysis, low temperature and N 2 could restrain oxygen transfer to some extent. - Abstract: Co-pyrolysis is regarded as an effective approach to upgrade the quality of pyrolysis products. In this work the activity of KF-846 was evaluated by co-pyrolysis of pubescens and low density polyethylene under different experimental conditions including catalytic mode, pyrolytic atmosphere and temperature, etc. The results showed that the fresh KF-846 exerted strong effects of cyclization, aromatization, hydrogen transfer and vapor-catalytic reforming reactions on the primary intermediates from the co-pyrolysis. The hydrogen-rich gases indicated a synergistic effect between Ni and Mo over KF-846 on producing hydrogen. More importantly, the reforming reactions might be inhibited to some extent by H 2 atmosphere, the low temperature and the decrease of acidity over catalyst. Furthermore, it was deduced that the oxygen over the lattice of catalyst or some intermediates might transfer into other intermediates, possibly resulting in more products with high oxygen content, but it was presumed that the low temperature, co-pyrolysis process and N 2 atmosphere could repress the trend to a certain degree. The mass and energy balance of co-pyrolysis were analyzed, and the main reaction pathways were also proposed. The interference in pyrolysis by regulating the catalytic mode, pyrolytic atmosphere and temperature, acidity over catalyst might posses a certain guiding significance for the pyrolytic technology and the design/selection of catalysts employed

  9. The impact of covariance localization on the performance of an ocean EnKF system assimilating glider data in the Ligurian Sea

    Science.gov (United States)

    Falchetti, Silvia; Alvarez, Alberto

    2018-04-01

    Data assimilation through an ensemble Kalman filter (EnKF) is not exempt from deficiencies, including the generation of long-range unphysical correlations that degrade its performance. The covariance localization technique has been proposed and used in previous research to mitigate this effect. However, an evaluation of its performance is usually hindered by the sparseness and unsustained collection of independent observations. This article assesses the performance of an ocean prediction system composed of a multivariate EnKF coupled with a regional configuration of the Regional Ocean Model System (ROMS) with a covariance localization solution and data assimilation from an ocean glider that operated over a limited region of the Ligurian Sea. Simultaneous with the operation of the forecast system, a high-quality data set was repeatedly collected with a CTD sensor, i.e., every day during the period from 5 to 20 August 2013 (approximately 4 to 5 times the synoptic time scale of the area), located on board the NR/V Alliance for model validation. Comparisons between the validation data set and the forecasts provide evidence that the performance of the prediction system with covariance localization is superior to that observed using only EnKF assimilation without localization or using a free run ensemble. Furthermore, it is shown that covariance localization also increases the robustness of the model to the location of the assimilated data. Our analysis reveals that improvements are detected with regard to not only preventing the occurrence of spurious correlations but also preserving the spatial coherence in the updated covariance matrix. Covariance localization has been shown to be relevant in operational frameworks where short-term forecasts (on the order of days) are required.

  10. Solvent Effects on the Reactions of the Nerve Agent VX with KF/Al2O3: Heterogeneous or Homogeneous Decontamination?

    Science.gov (United States)

    Fridkin, Gil; Yehezkel, Lea; Columbus, Ishay; Zafrani, Yossi

    2016-03-04

    Solvent effects on the reactions of the extremely toxic nerve agent VX with KF/Al2O3 powder were explored. Small quantities of water or methanol (5-10 wt %), which effectively mobilized all components while maintaining the heterogeneous nature of the reaction, promoted much faster rates than those obtained with larger quantities. Any amount of acetonitrile resulted in extremely slow transformations. Surprisingly, 5-50 wt % of heptane led to fast reactions due to the combination of its ability to mediate fast diffusion of VX and a MAS centrifugation effect.

  11. Interfacial phenomena in the reactions of Al-B, Al-Ti-B, and Al-Zr-B alloys with KF-AlF3 and NaF-AlF3 melts

    International Nuclear Information System (INIS)

    Lee, M.S.; Terry, B.S.; Grieveson, P.

    1993-01-01

    The interfacial phenomena occurring during the contacting of liquid Al-B, Al-Ti-B, and Al-Zr-B melts with KF-AlF 3 liquid fluxes have been investigated by optical examination of quenched metal drops previously immersed in the liquid fluxes. Reactions in the Al-B/KF-AlF 3 system involve the formation of metastable AlB 12 at the metal/flux interface. At high KBF 4 levels in the flux, the AlB 12 is dispersed in the flux and also at low KBF 4 levels in the metal. Reactions in the Al-Ti-B/KF-AlF 3 system involve the formation of TiB 2 , which may be dispersed in either the metal or the flux depending upon the composition of the flux. The results obtained for the Al-Ti-B/NaF-AlF 3 and Al-Zr-B/KF-AlF 3 systems were similar to those observed for the Al-Ti-B/KF-AlF 3 system

  12. Adenosine A{sub 2A} receptor imaging with [{sup 11}C]KF18446 PET in the rat brain after quinolinic acid lesion. Comparison with the dopamine receptor imaging

    Energy Technology Data Exchange (ETDEWEB)

    Ishiwata, Kiichi; Ogi, Nobuo; Hayakawa, Nobutaka [Tokyo Metropolitan Inst. of Gerontology, Tokyo (Japan). Positron Medical Center] [and others

    2002-11-01

    We proposed [{sup 11}C]KF18446 as a selective radioligand for mapping the adenosine A{sub 2A} receptors being highly enriched in the striatum by positron emission tomography (PET). In the present study, we investigated whether [{sup 11}C]KF18446 PET can detect the change in the striatal adenosine A{sub 2A} receptors in the rat after unilateral injection of an excitotoxin quinolinic acid into the striatum, a Huntington's disease model, to demonstrate the usefulness of [{sup 11}C]KF18446. The extent of the striatal lesion was identified based on MRI, to which the PET was co-registered. The binding potential of [{sup 11}C]KF18446 significantly decreased in the quinolinic acid-lesioned striatum. The decrease was comparable to the decrease in the potential of [{sup 11}C] raclopride binding to dopamine D{sub 2} receptors in the lesioned striatum, but seemed to be larger than the decrease in the potential of [{sup 11}C]SCH23390 binding to dopamine D{sub 1} receptors. Ex vivo and in vitro autoradiography validated the PET signals. We concluded that [{sup 11}C]KF18446 PET can detect change in the adenosine A{sub 2A} receptors in the rat model, and will provide a new diagnostic tool for characterizing post-synaptic striatopallidal neurons in the stratum. (author)

  13. Structuring scientific works in the “Introduction, Methods, Results and Discussion” format – what a beginner ought to know

    Directory of Open Access Journals (Sweden)

    N. V. Avdeeva

    2016-01-01

    Full Text Available Reference materials about the “Introduction, Methods, Results and Discussion”, which is a commonly used international format for scientific works, have become available for Russian authors nowadays, still lack of knowledge about the format would pop up here or there, especially when we speak about beginners. The faults which would appear regularly in work structuring prompted the present research, the aim of which is to compare the information about the IMRAD format with the specific difficulties beginning authors would often face when preparing their works for publication.The main materials to be studied were sources in Russian and in English published mostly in 2010s and devoted to the problems of structuring works according to the meant above format. Besides, the present research considered the results of plagiarism tests (such tests used to be carried out at the Russia State Library within the period of 2013 – 2015 with the help of software “Automated system of specialized processing of textual documents”. The main methods of our research would remain structural and comparative analysis of texts.As a result, our research revealed the fact of inconsistency of the available information on the IMRAD structure. It would often demand deep thinking and explanations. Different authors of reference editions would as a rule differ one from another in their interpretation of the degree of necessity of this or that composition element, of the amount of details in descriptions, etc. Moreover, the very structure of scientific work looks differently for different authors. More often the structure supposes the integrity of the contents and its form, still sometimes its description would be replaced by outer elements, such as, for example, language clichés. The analysis of the most common faults in text structuring points that authors do not often have a clear idea of how to understand the different demands which are so obscurely described

  14. On the efficiency of the hybrid and the exact second-order sampling formulations of the EnKF: a reality-inspired 3-D test case for estimating biodegradation rates of chlorinated hydrocarbons at the port of Rotterdam

    Directory of Open Access Journals (Sweden)

    M. E. Gharamti

    2016-11-01

    Full Text Available This study considers the assimilation problem of subsurface contaminants at the port of Rotterdam in the Netherlands. It involves the estimation of solute concentrations and biodegradation rates of four different chlorinated solvents. We focus on assessing the efficiency of an adaptive hybrid ensemble Kalman filter and optimal interpolation (EnKF-OI and the exact second-order sampling formulation (EnKFESOS for mitigating the undersampling of the estimation and observation errors covariances, respectively. A multi-dimensional and multi-species reactive transport model is coupled to simulate the migration of contaminants within a Pleistocene aquifer layer located around 25 m below mean sea level. The biodegradation chain of chlorinated hydrocarbons starting from tetrachloroethene and ending with vinyl chloride is modeled under anaerobic environmental conditions for 5 decades. Yearly pseudo-concentration data are used to condition the forecast concentration and degradation rates in the presence of model and observational errors. Assimilation results demonstrate the robustness of the hybrid EnKF-OI, for accurately calibrating the uncertain biodegradation rates. When implemented serially, the adaptive hybrid EnKF-OI scheme efficiently adjusts the weights of the involved covariances for each individual measurement. The EnKFESOS is shown to maintain the parameter ensemble spread much better leading to more robust estimates of the states and parameters. On average, a well tuned hybrid EnKF-OI and the EnKFESOS respectively suggest around 48 and 21 % improved concentration estimates, as well as around 70 and 23 % improved anaerobic degradation rates, over the standard EnKF. Incorporating large uncertainties in the flow model degrades the accuracy of the estimates of all schemes. Given that the performance of the hybrid EnKF-OI depends on the quality of the background statistics, satisfactory results were obtained only when the uncertainty imposed on

  15. On the efficiency of the hybrid and the exact second-order sampling formulations of the EnKF: a reality-inspired 3-D test case for estimating biodegradation rates of chlorinated hydrocarbons at the port of Rotterdam

    KAUST Repository

    El Gharamti, Mohamad

    2016-11-15

    This study considers the assimilation problem of subsurface contaminants at the port of Rotterdam in the Netherlands. It involves the estimation of solute concentrations and biodegradation rates of four different chlorinated solvents. We focus on assessing the efficiency of an adaptive hybrid ensemble Kalman filter and optimal interpolation (EnKF-OI) and the exact second-order sampling formulation (EnKFESOS) for mitigating the undersampling of the estimation and observation errors covariances, respectively. A multi-dimensional and multi-species reactive transport model is coupled to simulate the migration of contaminants within a Pleistocene aquifer layer located around 25 m below mean sea level. The biodegradation chain of chlorinated hydrocarbons starting from tetrachloroethene and ending with vinyl chloride is modeled under anaerobic environmental conditions for 5 decades. Yearly pseudo-concentration data are used to condition the forecast concentration and degradation rates in the presence of model and observational errors. Assimilation results demonstrate the robustness of the hybrid EnKF-OI, for accurately calibrating the uncertain biodegradation rates. When implemented serially, the adaptive hybrid EnKF-OI scheme efficiently adjusts the weights of the involved covariances for each individual measurement. The EnKFESOS is shown to maintain the parameter ensemble spread much better leading to more robust estimates of the states and parameters. On average, a well tuned hybrid EnKF-OI and the EnKFESOS respectively suggest around 48 and 21 % improved concentration estimates, as well as around 70 and 23 % improved anaerobic degradation rates, over the standard EnKF. Incorporating large uncertainties in the flow model degrades the accuracy of the estimates of all schemes. Given that the performance of the hybrid EnKF-OI depends on the quality of the background statistics, satisfactory results were obtained only when the uncertainty imposed on the background

  16. ­Genomic data mining of the marine actinobacteria Streptomyces sp. H-KF8 unveils insights into multi-stress related genes and metabolic pathways involved in antimicrobial synthesis

    Directory of Open Access Journals (Sweden)

    Agustina Undabarrena

    2017-02-01

    Full Text Available Streptomyces sp. H-KF8 is an actinobacterial strain isolated from marine sediments of a Chilean Patagonian fjord. Morphological characterization together with antibacterial activity was assessed in various culture media, revealing a carbon-source dependent activity mainly against Gram-positive bacteria (S. aureus and L. monocytogenes. Genome mining of this antibacterial-producing bacterium revealed the presence of 26 biosynthetic gene clusters (BGCs for secondary metabolites, where among them, 81% have low similarities with known BGCs. In addition, a genomic search in Streptomyces sp. H-KF8 unveiled the presence of a wide variety of genetic determinants related to heavy metal resistance (49 genes, oxidative stress (69 genes and antibiotic resistance (97 genes. This study revealed that the marine-derived Streptomyces sp. H-KF8 bacterium has the capability to tolerate a diverse set of heavy metals such as copper, cobalt, mercury, chromate and nickel; as well as the highly toxic tellurite, a feature first time described for Streptomyces. In addition, Streptomyces sp. H-KF8 possesses a major resistance towards oxidative stress, in comparison to the soil reference strain Streptomyces violaceoruber A3(2. Moreover, Streptomyces sp. H-KF8 showed resistance to 88% of the antibiotics tested, indicating overall, a strong response to several abiotic stressors. The combination of these biological traits confirms the metabolic versatility of Streptomyces sp. H-KF8, a genetically well-prepared microorganism with the ability to confront the dynamics of the fjord-unique marine environment.

  17. ESTUDO DA ESTABILIDADE TÉRMICA DE FIBRA QUERATINA (KF DE PENAS DE FRANGO PARA OBTENÇÃO DE CARBONO (CF

    Directory of Open Access Journals (Sweden)

    Débora Damasceno Belarmino

    2012-07-01

    Full Text Available A fibra de queratina de penas de frango foi submetida à análise térmica (TG em sua forma natural e carbonizada, aumentando assim a expansão do reaproveitamento de materiais desperdiçados no Brasil. A partir das curvas obtidas por TG/DTG da pena natural (KF e tratadas (KFNaOH, SCFC e SCFD buscou-se um melhor ciclo de carbonização (pirólise para esse tipo de precursor. O trabalho também trata como um dos focos, o estudo comparativo do comportamento térmico desses materiais. Uma parte da KF foi tratada com hidróxido de sódio (NaOH, e observou-se pelo o resultado TG/DTG que a resistência térmica do material não foi influenciada. Outra parte de KF foi semicarbonizada (220°C sem controle do ambiente térmico e taxas de aquecimento e resfriamento, apresentando colorações diferentes, mais clara (SCFC e mais escura (SCFD. Foi constatado nas curvas de TG/DTG, que esse tratamento de carbonização não é ideal para a obtenção de carbono. Também foi verificado nas curvas de TG/DTG que na CF houve um aumento da estabilidade térmica comparada a todas as outras amostras. Essa pesquisa é uma inovação no que diz respeito à preparação e avaliação de fibras de penas de frango na obtenção de fibras sintetizadas, que atualmente são, em larga escala, derivados do petróleo, lembrando-se da diminuição das reservas de petróleo e da poluição que os mesmos geram ao meio ambiente.

  18. Gas-liquid countercurrent integration process for continuous biodiesel production using a microporous solid base KF/CaO as catalyst.

    Science.gov (United States)

    Hu, Shengyang; Wen, Libai; Wang, Yun; Zheng, Xinsheng; Han, Heyou

    2012-11-01

    A continuous-flow integration process was developed for biodiesel production using rapeseed oil as feedstock, based on the countercurrent contact reaction between gas and liquid, separation of glycerol on-line and cyclic utilization of methanol. Orthogonal experimental design and response surface methodology were adopted to optimize technological parameters. A second-order polynomial model for the biodiesel yield was established and validated experimentally. The high determination coefficient (R(2)=98.98%) and the low probability value (PrKF/CaO and 105.98kPa system pressure. Under these conditions, the average yield of triplicate experiments was 93.7%, indicating the continuous-flow process has good potential in the manufacture of biodiesel. Copyright © 2012 Elsevier Ltd. All rights reserved.

  19. Continuous monitoring of a magma chamber's pressure changes using geodetic data: Time-dependent inversion with Ensemble Kalman Filter (EnKF)

    Science.gov (United States)

    Munekane, H.; Oikawa, J.

    2017-12-01

    It is important to monitor pressure changes of a magma chamber to forecast eruptions and mitigate volcanic hazard. The time-dependent inversion of geodetic data such as GNSS and InSAR allows us to continuously monitor a pressure change of a magma chamber if its shape and location are fixed. On the other hand, when a chamber changes its location or shape sequentially, the ordinary time-dependent inversion cannot be directly applied since the pressure non-linearly relate to the deformation. Here we developed a new variant of the time-dependent inversion which involves the Ensemble Kalman Filter (EnKF) instead of linear Kalman filter. We first applied the method to the synthetic GNSS time series generated under the assumption that a tri-axial ellipsoidal magma chamber gradually changes its shape, depth, and pressure (volume) and successfully retrieved parameters such as pressure (volume) changes, depth, and shape factors (axis ratio). Then we applied the method to the observed GNSS data taken at the volcanic crisis in Miyakejima, Japan in 2000. We found that 1) first the change rate of the chamber's pressure exponentially converged to a constant negative value, and then showed sudden increase in response to the caldera collapse, and 2) the chamber migrated upward in response to the caldera collapse. The developed method may easily be adopted to volcano monitoring with real-time/near real-time GNSS data, and in the future may be adopted to eruption prediction if a successful physics-based simulation model is used as a prediction model in the EnKF.

  20. Two enzymes of a complete degradation pathway for linear alkylbenzenesulfonate (LAS) surfactants: 4-sulfoacetophenone Baeyer-Villiger monooxygenase and 4-sulfophenylacetate esterase in Comamonas testosteroni KF-1.

    Science.gov (United States)

    Weiss, Michael; Denger, Karin; Huhn, Thomas; Schleheck, David

    2012-12-01

    Complete biodegradation of the surfactant linear alkylbenzenesulfonate (LAS) is accomplished by complex bacterial communities in two steps. First, all LAS congeners are degraded into about 50 sulfophenylcarboxylates (SPC), one of which is 3-(4-sulfophenyl)butyrate (3-C(4)-SPC). Second, these SPCs are mineralized. 3-C(4)-SPC is mineralized by Comamonas testosteroni KF-1 in a process involving 4-sulfoacetophenone (SAP) as a metabolite and an unknown inducible Baeyer-Villiger monooxygenase (BVMO) to yield 4-sulfophenyl acetate (SPAc) from SAP (SAPMO enzyme); hydrolysis of SPAc to 4-sulfophenol and acetate is catalyzed by an unknown inducible esterase (SPAc esterase). Transcriptional analysis showed that one of four candidate genes for BVMOs in the genome of strain KF-1, as well as an SPAc esterase candidate gene directly upstream, was inducibly transcribed during growth with 3-C(4)-SPC. The same genes were identified by enzyme purification and peptide fingerprinting-mass spectrometry when SAPMO was enriched and SPAc esterase purified to homogeneity by protein chromatography. Heterologously overproduced pure SAPMO converted SAP to SPAc and was active with phenylacetone and 4-hydroxyacetophenone but not with cyclohexanone and progesterone. SAPMO showed the highest sequence homology to the archetypal phenylacetone BVMO (57%), followed by steroid BVMO (55%) and 4-hydroxyacetophenone BVMO (30%). Finally, the two pure enzymes added sequentially, SAPMO with NADPH and SAP, and then SPAc esterase, catalyzed the conversion of SAP via SPAc to 4-sulfophenol and acetate in a 1:1:1:1 molar ratio. Hence, the first two enzymes of a complete LAS degradation pathway were identified, giving evidence for the recruitment of members of the very versatile type I BVMO and carboxylester hydrolase enzyme families for the utilization of a xenobiotic compound by bacteria.

  1. Effect of peripheral vision training on the attack of beginner indoor soccer players: a study during competition

    Directory of Open Access Journals (Sweden)

    Nelson Kautzner Marques Junior

    2009-01-01

    Full Text Available This study was conducted within the context of Human Motor Skill Science, in the area of Biophysical Dimension and following the research line of the Study of Learning Mechanisms and Processes and of Motor Conduct within the epistemological construct of phenomenological explanation. The objective of this study was to investigate peripheral vision training (PVT and its effect on attack runs during indoor soccer, taking into account dominant laterality (brain hemisphere function in both learning speed andoffensive skills. Ten beginner indoor soccer players aged 10.4 ± 2.31 years, from Lar da Criança Padre Franz Neumair, Ititioca, Niterói, Rio de Janeiro, Brazil, participated in the study. The boys were divided into an experimental group (EG, n = 5 and a controlgroup (CG, n = 5 with similar dominant laterality (brain hemisphere function (H (EG: 80% left H and 20% right H, CG: 60% left H and 40% right H. The players underwent nine training sessions, followed by a championship, and then six additional sessions, followed by a second championship. Each championship was filmed for scoutvideo analysis. Two-way ANOVA revealed a significant difference in peripheral vision during offensive runs between CG and EG, with marked acquisition of peripheral vision in EG. The quality of the attack runs was significant (two-way ANOVA. EG was the better team at the beginning of the attack runs and during attack development, whereas CG was better at attack finalization during the first championship. EG showed more competence in attack run finalization during the second championship. No significant difference in the number of goals scored was observed between the two groups (two-wayANOVA, p>0.05. The frequency of participation in the training sessions was significant (t-test for independent samples, p≤0.05, with EG attending more sessions. In conclusion, EG acquired peripheral vision, a finding suggesting that PVT improves the attack capacity of indoor soccer

  2. [Obstetrical ultrasound simulator as a tool for improving teaching strategies for beginners: Pilot study and review of the literature].

    Science.gov (United States)

    Chalouhi, G E; Quibel, T; Lamourdedieu, C; Hajal, N J; Gueneuc, A; Benzina, N; Bernardi, V; Ville, Y

    2016-11-01

    The aim of this study was to evaluate the obstetrical ultrasound simulator as an initiation tool for teaching obstetrical ultrasound scanning for beginners. Twenty medical students with no experience in ultrasound scan (US) received a basic theoretical ultrasonography course on US principles and 2nd trimester biometrical measurements. The participants were then divided into 2 groups (A, B). Only group A received a practical 2nd trimester scan training session on the simulator where they were asked to determine fetal and placental position, and to take the 3 biometrical standardized measurements. Group B had the same training session but with a real ultrasound machine and a pregnant volunteer. The 2 groups were then asked to perform an US session on real patients (22 weeks) during which they had to do the same US study. The time needed to complete the whole scan was analyzed. The quality of the measurements was compared based on the previously published Objective Quality Criteria scoring. The mean total score was significantly (P=0.001) better for group A (14.3±1.4) compared to group B 10.3 (±2.75) for group A and B respectively. The time needed to accomplish the whole exam tended to be longer for group A (569±174s) compared to group A (479±104s) (P=0.18). The simulator might be a useful initiation tool to obstetric ultrasound for those who never practiced. It might prove a time sparing procedure in the training process and allow trainees to reach a basic practice level before performing examinations on actual patients. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  3. Effect of peripheral vision training on the attack of beginner indoor soccer players: a study during competition

    Directory of Open Access Journals (Sweden)

    Nelson Kautzner Marques Junior

    2009-01-01

    Full Text Available http://dx.doi.org/10.5007/1980-0037.2009v11n1p119   In the area of Biophysical Dimension and following the research line of the Study of Learning Mechanisms and Processes and of Motor Conduct within the epistemological construct of phenomenological explanation. The objective of this study was to investigate peripheral vision training (PVT and its effect on attack runs during indoor soccer, taking into account dominant laterality (brain hemisphere function in both learning speed and offensive skills. Ten beginner indoor soccer players aged 10.4 ± 2.31 years, from Lar da Criança Padre Franz Neumair, Ititioca, Niterói, Rio de Janeiro, Brazil, participated in the study. The boys were divided into an experimental group (EG, n = 5 and a control group (CG, n = 5 with similar dominant laterality (brain hemisphere function (H (EG: 80% left H and 20% right H, CG: 60% left H and 40% right H. The players underwent nine training sessions, followed by a championship, and then six additional sessions, followed by a second championship. Each championship was filmed for scout video analysis. Two-way ANOVA revealed a significant difference in peripheral vision during offensive runs between CG and EG, with marked acquisition of peripheral vision in EG. The quality of the attack runs was significant (two-way ANOVA. EG was the better team at the beginning of the attack runs and during attack development, whereas CG was better at attack finalization during the first championship. EG showed more competence in attack run finalization during the second championship. No significant difference in the number of goals scored was observed between the two groups (two-way ANOVA, p>0.05. The frequency of participation in the training sessions was significant (t-test for independent samples, p≤0.05, with EG attending more sessions. In conclusion, EG acquired peripheral vision, a finding suggesting that PVT improves the attack capacity of indoor soccer players.

  4. EIR, KfK joint heat transfer experiment on a single rod, roughened with trapezoidal rounded ribs and cooled by various gases

    International Nuclear Information System (INIS)

    Hudina, M.; Huggenberger, M.; Dalle Donne, M.; Meyer, L.; Rehme, K.

    1978-10-01

    Heat transfer and pressure drop experiments with an identical fuel rod simulator have been performed at the two Research Establishments in Wuerenlingen and in Karlsruhe. The rod was artificially roughened with 'two-dimensional' ribs of trapezoidal shape and with rounded edges. The experiments at EIR were performed with CO 2 and the rough rod was contained in a smooth tube and centered by special spacers. The experiments at KfK were performed using helium and nitrogen in the same test section (rod and outer smooth tube with spacers) and air with the rod mounted in another outer smooth tube and with spacers located farther away from the measuring positions. The global measured friction factors and Stanton numbers for different gases agree reasonably well. The differences between the roughness parameters R and G are larger. The possible reasons for the uncertainties in the reduction of these parameters are discussed. It is recommended to perform further experiments with helium in a test section with spacers far apart, to investigate the effect of the temperature ratio on heat transfer and to check if the unfavourable data obtained by the experiment with air are too pessimistic for GCFR application. (orig.) [de

  5. Effect of aluminium and copper on biofilm development of Pseudomonas pseudoalcaligenes KF707 and P. fluorescens as a function of different media compositions.

    Science.gov (United States)

    Booth, Sean C; George, Iain F S; Zannoni, Davide; Cappelletti, Martina; Duggan, Gavin E; Ceri, Howard; Turner, Raymond J

    2013-06-01

    Bioremediation efforts worldwide are faced with the problem of metals interfering with the degradation of organic pollutants. There has been little systematic investigation into how the important environmental factors of media composition, buffering agent, and carbon source affect the exertion of metal toxicity on bacteria. This study aimed to systematically separate and investigate the influence of these factors by examining planktonic and biofilm establishment and growth. Two Pseudomonads were chosen, the PCB degrader P. pseudoalcaligenes KF707 and P. fluorescens. The two strains were grown in the presence of Al(3+) and Cu(2+) under different media conditions of carbon source (Lysogeny broth, biphenyl, succinate, aspartic acid, butyric acid, oxaloacetic acid, putrescine and benzoic acid) and under different buffering conditions (high and low phosphate or MOPS). These experiments allowed for the elucidation of an effect of different metabolic conditions and metal speciation on planktonic bacteria growth and biofilm establishment and development under metal stress. Here we show that the nature of bacterial growth (planktonic and biofilm development) is dramatically affected by the interplay between toxic metals, carbon source and media composition. The capacity of a media to bind toxic metals as well as quality of carbon source greatly influences the amount of metal that bacteria can tolerate, depending on both the bacterium and metal. Future studies evaluating metal ion toxicity should consider these effects, as well as their interactions with specific environments into account in order to improve clean-up success.

  6. Improving streamflow predictions at ungauged locations with real-time updating: application of an EnKF-based state-parameter estimation strategy

    Science.gov (United States)

    Xie, X.; Meng, S.; Liang, S.; Yao, Y.

    2014-10-01

    The challenge of streamflow predictions at ungauged locations is primarily attributed to various uncertainties in hydrological modelling. Many studies have been devoted to addressing this issue. The similarity regionalization approach, a commonly used strategy, is usually limited by subjective selection of similarity measures. This paper presents an application of a partitioned update scheme based on the ensemble Kalman filter (EnKF) to reduce the prediction uncertainties. This scheme performs real-time updating for states and parameters of a distributed hydrological model by assimilating gauged streamflow. The streamflow predictions are constrained by the physical rainfall-runoff processes defined in the distributed hydrological model and by the correlation information transferred from gauged to ungauged basins. This scheme is successfully demonstrated in a nested basin with real-world hydrological data where the subbasins have immediate upstream and downstream neighbours. The results suggest that the assimilated observed data from downstream neighbours have more important roles in reducing the streamflow prediction errors at ungauged locations. The real-time updated model parameters remain stable with reasonable spreads after short-period assimilation, while their estimation trajectories have slow variations, which may be attributable to climate and land surface changes. Although this real-time updating scheme is intended for streamflow predictions in nested basins, it can be a valuable tool in separate basins to improve hydrological predictions by assimilating multi-source data sets, including ground-based and remote-sensing observations.

  7. Quantum dynamics study of the K+HF(v=0-2,j=0)-->KF+H reaction and comparison with quasiclassical trajectory results.

    Science.gov (United States)

    Mayneris, Jordi; Martínez, Rodrigo; Hernando, Jordi; Gray, Stephen K; González, Miguel

    2008-04-14

    Extensive quantum real wave packet calculations within the helicity decoupling approximation are used to analyze the influence of the HF vibrational excitation on the K+HF(v=0-2,j=0)-->KF+H reaction. Quantum reaction probabilities P and reaction cross sections sigma are compared with corresponding quasiclassical trajectory (QCT) results. Disregarding threshold regions for v=0 and 1 (v=2 has no threshold), both approaches lead to remarkably similar results, particularly for sigma, validating the use of the QCT method for this system. When moving from v=0 to v=1 there is a large increase in P and sigma, as expected for a late barrier system. For v=2 the reaction becomes exoergic and P approximately 0.95 (with the exception of large total angular momenta where centrifugal barriers play a role). While substantial vibrational enhancement of the reactivity is thus seen, it is still quite less than that inferred from experimental data in the intermediate and high collision energy ranges. The origin of this discrepancy is unclear.

  8. Continuous ethanol fermentation from non-sulfuric acid-washed molasses using traditional stirred tank reactors and the flocculating yeast strain KF-7.

    Science.gov (United States)

    Tang, Yue-Qin; An, Ming-Zhe; Zhong, Ya-Ling; Shigeru, Morimura; Wu, Xiao-Lei; Kida, Kenji

    2010-01-01

    Waste molasses is one of the most important feedstock for ethanol production in Brazil as well as in many Southeast Asian countries, including China. Sulfuric acid pretreatment is employed in most ethanol distilleries in China to control bacterial contamination, which results in difficulties in the treatment of wastewater containing high levels of sulfate ions. In this study, a high efficiency, non-sterilized, continuous ethanol fermentation process without sulfuric acid pretreatment was developed using the flocculating yeast strain KF-7 and the widely utilized, traditional, stirred tank reactors. An alternative molasses medium feeding method, which differs from traditional methods, is proposed that effectively controls bacterial contamination. Separate feeding of 1.2-fold diluted molasses and tap water into the reactor proved to be effective against bacterial contamination during long-term continuous fermentation. By feeding yeast cells with high metabolic activity to the second reactor, a two-stage continuous fermentation process that yielded a high ethanol concentration of 80 g/l as well as high ethanol productivity of 6.6 g/l/h was successfully operated for more than one month. This fermentation process can be applied to ethanol distilleries in which traditional tank reactors are used. 2009 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  9. Purification of Biotransformation Products of Cis-Isoflavan-4-ol by Biphenyl Dioxygenase of Pseudomonas pseudoalcaligenes KF707 Strain Expressed in Escherichia coli

    Directory of Open Access Journals (Sweden)

    Tri Ratna Sulistiyani

    2013-04-01

    Full Text Available Isoflavone has multiple beneficial effects on human health, especially through its antioxidant and anticancer activities. The biotransformation of isoflavone using byphenyl dioxygenase could be performed to extend the diversity of flavonoids and to improve their biological and physiological properties. Biotransformation of two enantiomers (3R, 4R-cis-isoflavan-4-ol and (3S, 4S-cis-isoflavan-4-ol by E. coli JM109 (pJHF108 carrying a biphenyl dioxygenase gene from P. pseudoalcaligenesKF707 produced two products, designated as CM1 andCM2. The products had a retention time of 11.9 and 14.6 min, respectively, and the same absorption peaks at 204, 220, and 275 nm. CM1 and CM2 had [M-H2O+H]+ at m/z 225. Based on the molecular mass and hydrolysis products, we proposed that epoxidation occurred on cis-isoflavan-4-ol. Chloroform extraction instead of ethyl acetate extraction was performed to improve the stability of cismetabolites, CM1 and CM2.

  10. Formation of a K-In-Se Surface Species by NaF/KF Postdeposition Treatment of Cu(In,Ga)Se2Thin-Film Solar Cell Absorbers.

    Science.gov (United States)

    Handick, Evelyn; Reinhard, Patrick; Wilks, Regan G; Pianezzi, Fabian; Kunze, Thomas; Kreikemeyer-Lorenzo, Dagmar; Weinhardt, Lothar; Blum, Monika; Yang, Wanli; Gorgoi, Mihaela; Ikenaga, Eiji; Gerlach, Dominic; Ueda, Shigenori; Yamashita, Yoshiyuki; Chikyow, Toyohiro; Heske, Clemens; Buecheler, Stephan; Tiwari, Ayodhya N; Bär, Marcus

    2017-02-01

    A NaF/KF postdeposition treatment (PDT) has recently been employed to achieve new record efficiencies of Cu(In,Ga)Se 2 (CIGSe) thin film solar cells. We have used a combination of depth-dependent soft and hard X-ray photoelectron spectroscopy as well as soft X-ray absorption and emission spectroscopy to gain detailed insight into the chemical structure of the CIGSe surface and how it is changed by different PDTs. Alkali-free CIGSe, NaF-PDT CIGSe, and NaF/KF-PDT CIGSe absorbers grown by low-temperature coevaporation have been interrogated. We find that the alkali-free and NaF-PDT CIGSe surfaces both display the well-known Cu-poor CIGSe chemical surface structure. The NaF/KF-PDT, however, leads to the formation of bilayer structure in which a K-In-Se species covers the CIGSe compound that in composition is identical to the chalcopyrite structure of the alkali-free and NaF-PDT absorber.

  11. Status report. KfK contribution to the development of DEMO-relevant test blankets for NET/ITER. Pt. 2: BOT helium cooled solid breeder blanket. Vol. 2

    International Nuclear Information System (INIS)

    Dalle Donne, M.; Boccaccini, L.V.; Bojarsky, E.; Deckers, H.; Dienst, W.; Doerr, L.; Fischer, U.; Giese, H.; Guenther, E.; Haefner, H.E.; Hofmann, P.; Kappler, F.; Knitter, R.; Kuechle, M.; Moellendorf, U. von; Norajitra, P.; Penzhorn, R.D.; Reimann, G.; Reiser, H.; Schulz, B.; Schumacher, G.; Schwenk-Ferrero, A.; Sordon, G.; Tsukiyama, T.; Wedemeyer, H.; Weimar, P.; Werle, H.; Wiegner, E.; Zimmermann, H.

    1991-10-01

    The BOT (Breeder Outside Tube) Helium Cooled Solid Breeder Blanket for a fusion Demo reactor and the status of the R and D program is presented. This is the KfK contribution to the European Program for the Demo relevant test blankets to be irradiated in NET/ITER. Volume 1 (KfK 4928) contains the summary, volume 2 (KfK 4929) a more detailed version of the report. In both volumes are described the reasons for the selected design, the reference blanket design for the Demo reactor, the design of the test blanket including the ancillary systems together with the present status of the relative R and D program in the fields of neutronic and thermohydraulic calculations, of the electromagnetic forces caused by disruptions, of the development and irradiation of the ceramic breeder material, of the tritium release and recovery, and of the technological investigations. An outlook is given on the required R and D program for the BOT Helium Cooled Solid Breeder Blanket prior to tests in NET/ITER and the proposed test program in NET/ITER. (orig.) [de

  12. Apache Solr beginner's guide

    CERN Document Server

    Serafini, Alfredo

    2013-01-01

    Written in a friendly, example-driven format, the book includes plenty of step-by-step instructions and examples that are designed to help you get started with Apache Solr.This book is an entry level text into the wonderful world of Apache Solr. The book will center around a couple of simple projects such as setting up Solr and all the stuff that comes with customizing the Solr schema and configuration. This book is for developers looking to start using Apache Solr who are stuck or intimidated by the difficulty of setting it up and using it.For anyone wanting to embed a search engine in their

  13. C++ for beginners... masters

    CERN Document Server

    Asthana, Ankit

    2007-01-01

    About the Book: The purpose of this book is to provide an introductory text for understanding the C++ language and to empower the reader to write C++ programs. The book also introduces reader to the paradigm of object oriented programming. The main strength and USP of this book is that it is written by a student for students but will be equally useful for intermediate level programmers, and software development professionals. The author is in the best position to identify and address issues and areas where a student needs maximum help in understanding the C++ concepts and developing programmi

  14. Adult intubation for beginners.

    Science.gov (United States)

    Rooney, P

    1994-10-01

    The UKCC's 'Scope of Professional Practice' validly points out that, 'Practice takes place in a context of continuing change and development' partly 'as a result of new approaches to professional practice'. Consequently, demands are made on educational institutions to prepare professionals for new practice. One of the new skills, which is now being taught to nurses on the Anaesthetic Nursing Course at the Eastern Area College, is that of endotracheal intubation. Bearing in mind the all-important proviso that 'As a registered nurse, midwife or health visitor, you are personally accountable for your practice', it is essential that post registration education 'equips practitioners with additional and more specialist skills necessary to meet the special needs of patients and clients'. This article is therefore designed as an introduction to the basic rationale, anatomy and procedural skills necessary for safe intubation.

  15. Engaging Your Beginners

    Science.gov (United States)

    Hill, Jane

    2016-01-01

    Teachers love to see the spark of engagement when students eagerly engage in learning. But when teachers work with English language learners in the earliest stages of language acquisition, they're often unsure how to foster challenge and engagement with students who know such sparse English. Hill shares six key do's and don'ts for classroom…

  16. Am Beginn des Hausbaus

    DEFF Research Database (Denmark)

    Kinzel, Moritz

    Architectural developments during the Neolithic period show important innovations, e.g., the discovery and use of the right angle and the use of activity floors placed on top of each other. Although these developments influenced our building history and our understanding of architecture in genera...

  17. Kant for beginners

    CERN Document Server

    Want, Christopher; Appignanesi, Richard

    1996-01-01

    Immanuel Kant, philosopher of the Enlightenment, laid the foundations of modern Western thought. This work focuses on the three critiques of Pure Reason, Practical Reason and Judgement. It describes Kant's main formal concepts: the relation of mind to sensory experience, the question of freedom and the law and, above all, the revaluation of metaphysics. Kant emerges as a diehard rationalist yet also a Romantic, deeply committed to the power of the sublime to transform experience.

  18. Openlayers 3 beginner's guide

    CERN Document Server

    Gratier, Thomas; Hazzard, Erik

    2015-01-01

    Whether you are a hobbyist or a professional web developer, if you wish to use maps on your website, then this book is for you. A basic understanding of JavaScript will be helpful, but is not necessary. If you've never worked with maps before, this book will introduce you to some common mapping topics and will guide you through the OpenLayers library. Experienced developers can also use this book as a reference to OpenLayers 3 components and to further enhance their knowledge.

  19. TCSA for beginners

    CERN Multimedia

    CERN. Geneva

    2014-01-01

    the basics of the approach I also give a brief overview of the recently introduced renormalization methods to deal with cut-off dependence, which led to a major improvement in precision and also widened the potential scope of applications.

  20. Hamilton's principle for beginners

    International Nuclear Information System (INIS)

    Brun, J L

    2007-01-01

    I find that students have difficulty with Hamilton's principle, at least the first time they come into contact with it, and therefore it is worth designing some examples to help students grasp its complex meaning. This paper supplies the simplest example to consolidate the learning of the quoted principle: that of a free particle moving along a line. Next, students are challenged to add gravity to reinforce the argument and, finally, a two-dimensional motion in a vertical plane is considered. Furthermore these examples force us to be very clear about such an abstract principle

  1. Android NDK beginner's guide

    CERN Document Server

    Ratabouil, Sylvain

    2015-01-01

    Are you an Android Java programmer who needs more performance? Are you a C/C++ developer who doesn't want to bother with the complexity of Java and its out-of-control garbage collector? Do you want to create fast intensive multimedia applications or games? If you've answered yes to any of these questions then this book is for you. With some general knowledge of C/C++ development, you will be able to dive headfirst into native Android development.

  2. Jazz: A Beginner's Guide

    Science.gov (United States)

    Poliniak, Susan

    2011-01-01

    Introducing jazz music to elementary and middle school students can open a multitude of creative doors--provided that teachers know how and where to start. This article presents a sample of what Christine Nowmos teaches to her kindergarten-through-fourth-grade classrooms over the course of two months. During January and February each year, she has…

  3. NS simulator for beginners

    CERN Document Server

    Altman, Eitan

    2012-01-01

    NS-2 is an open-source discrete event network simulator which is widely used by both the research community as well as by the people involved in the standardization protocols of IETF. The goal of this book is twofold: on one hand to learn how to use the NS-2 simulator, and on the other hand, to become acquainted with and to understand the operation of some of the simulated objects using NS-2 simulations. The book is intended to help students, engineers or researchers who need not have much background in programming or who want to learn through simple examples how to analyse some simulated obje

  4. Einstein a beginner's guide

    CERN Document Server

    Breithaupt, Jim

    2000-01-01

    This guide contains the essential facts and concepts of the life and work of Albert Einstein. It examines his background and the scientific method of the day, and explains his theories in simple terms. Central themes are presented in jargon-free language and key terms are highlighted and explained.

  5. Hydrogen energy for beginners

    CERN Document Server

    2013-01-01

    This book highlights the outstanding role of hydrogen in energy processes, where it is the most functional element due to its unique peculiarities that are highlighted and emphasized in the book. The first half of the book covers the great natural hydrogen processes in biology, chemistry, and physics, showing that hydrogen is a trend that can unite all natural sciences. The second half of the book is devoted to the technological hydrogen processes that are under research and development with the aim to create the infrastructure for hydrogen energetics. The book describes the main features of hydrogen that make it inalienable player in processes such as fusion, photosynthesis, and metabolism. It also covers the methods of hydrogen production and storage, highlighting at the same time the exclusive importance of nanotechnologies in those processes.

  6. Quantum physics for beginners

    CERN Document Server

    Ficek, Zbigniew

    2016-01-01

    The textbook introduces students to the main ideas of quantum physics and the basic mathematical methods and techniques used in the fields of advanced quantum physics, atomic physics, laser physics, nanotechnology, quantum chemistry, and theoretical mathematics. The textbook explains how microscopic objects (particles) behave in unusual ways, giving rise to what's called quantum effects. It contains a wide range of tutorial problems from simple confidence-builders to fairly challenging exercises that provide adequate understanding of the basic concepts of quantum physics.

  7. Nuclear power for beginners

    International Nuclear Information System (INIS)

    Croall, S.; Sempler, K.

    1978-01-01

    A 'comic strip' account of nuclear power, covering weapons and weapons proliferation, reactor accidents involving human errors, radiation hazards, radioactive waste management and the fuel cycle, fast breeder reactors and plutonium, security, public relations and sociological aspects, energy consumption patterns, energy conservation and alternative energy sources, environmental aspects and anti-nuclear activities. (U.K.)

  8. Online Peer Feedback between Colombian and New Zealand FL Beginners: A Comparison and Lessons Learned (Retroalimentación virtual de pares entre aprendices principiantes de lengua de Colombia y Nueva Zelanda: una comparación y lecciones aprendidas)

    Science.gov (United States)

    Tolosa, Constanza; Ordóñez, Claudia Lucía; Alfonso, Tania

    2015-01-01

    We report on an exploratory study comparing the performance as online tutors of two groups of beginner eleven-year-old students of English in Colombia and Spanish in New Zealand. The native speaker students of the foreign language the others were learning corrected paragraphs written by their peers. The feedback provided by each group of tutors…

  9. New Raman method for aqueous solutions: xi-function dispersion evidence for strong F(-)-water H-bonds in aqueous CsF and KF solutions.

    Science.gov (United States)

    Walrafen, George E

    2005-08-15

    The Raman xi-function dispersion method recently elucidated for the strong H-bond breaker, ClO4-, in water [G. E. Walrafen, J. Chem. Phys. 122, 094510 (2005)] is extended to the strongly H-bond forming ion, F-. Measuring the xi function is analogous to measuring DeltaG from the thermodynamic activity of the water, aH2O, as the stoichiometric mol fraction of the water in the solution decreases due to addition of an electrolyte or nonelectrolyte. xi is the derivative of the OH-stretching part of the Gibbs free energy with respect to the water mol fraction; xiomega identical with-RT[ partial differential ln(Iomega/IREF) partial differentialX2](T,P). I is the Raman intensity at omega (omega=Raman shift in cm-1); IREF, that at an arbitrary reference omega; and, X2 is the water mol fraction (X1=CsF or KF mol fraction). ln(Iomega/IREF) was found to be linear in X2 for the complete range of OH-stretching omega's, with correlation coefficients as large as 0.999 96. Linearity of ln(Iomega/IREF) versus X2 is an experimental fact for all omega's throughout the spontaneous Raman OH-stretching contour; this fact cannot be negated by relative contributions of ultrafast/fast, homogeneous/inhomogeneous processes which may underlie this linearity. Linearity in ln(Iomega/IREF) versus 1T, or in ln(Iomega/IREF) versus P, was also observed for the Raman H-bond energy DeltaE and pair volume DeltaV dispersions, respectively. A low-frequency maximum (MAX) and a high-frequency minimum (MIN) were observed in the xi function dispersion curve. Deltaxi=xiMIN-xiMAX values of -7000+/-800-cal/mol H2O for CsF, and the experimentally equal Deltaxi=-6400+/-1000-cal/mol H2O for KF, were obtained. These Deltaxi's are opposite in sign but have nearly the same absolute magnitude as the Deltaxi value for NaClO4 in water; Deltaxi=+8050+/-100-cal/mol H2O. A positive Deltaxi corresponds to a water-water H-bond breaker; a negative Deltaxi to a H-bond former; specifically, a F--water H-bond former, in the

  10. NaF-KF-AlF3 System: Phase Transition in K2NaAl3F12 Ternary Fluoride.

    Science.gov (United States)

    Kirik, Sergei D; Zaitseva, Yulia N; Leshok, Darya Yu; Samoilo, Alexandr S; Dubinin, Petr S; Yakimov, Igor S; Simakov, Dmitry A; Gusev, Alexandr O

    2015-06-15

    Phase formation in the NaF-KF-AlF3 system, in the vicinity of the K2NaAl3F12 composition, has been studied. The samples have been prepared by melting the starting components at 650 °C. A new phase has been revealed, which appeared to be a low-temperature form of the well-known K2NaAl3F12 ternary fluoride obtained by the hydrothermal synthesis method. The high-temperature form melts at 598 °C and is stable in a narrow temperature region of about 15 deg below the melting point. Thermal analysis, high temperature X-ray diffraction, IR-spectroscopy, X-ray fluorescence, and X-ray powder diffraction crystal structure analysis have been applied to study the composition, crystal structure, and thermal properties of the low-temperature phase. The crystal structure consists of trigonal-hexagonal two-dimensional (2D) grids built from the [AlF6] octahedra connected via vertices. The 2D grids have a specific wave-like conformation with a wavelength of 11.88 Å and an amplitude of 0.46 Å. There is a shift of the adjacent grids relative to each other. Because of this shift, the space between the grids changes. The shift leads to the formation of pores adapted to potassium and sodium ions. The reasons for the wave-like structure of layers are discussed. It is shown that the two polymorphic forms differ in the order of cation occupations.

  11. Oracle Application Express 5 for beginners a practical guide to rapidly develop data-centric web applications accessible from desktop, laptops, tablets, and smartphones

    CERN Document Server

    2015-01-01

    Oracle Application Express has taken another big leap towards becoming a true next generation RAD tool. It has entered into its fifth version to build robust web applications. One of the most significant feature in this release is a new page designer that helps developers create and edit page elements within a single page design view, which enormously maximizes developer productivity. Without involving the audience too much into the boring bits, this full colored edition adopts an inspiring approach that helps beginners practically evaluate almost every feature of Oracle Application Express, including all features new to version 5. The most convincing way to explore a technology is to apply it to a real world problem. In this book, you’ll develop a sales application that demonstrates almost every feature to practically expose the anatomy of Oracle Application Express 5. The short list below presents some main topics of Oracle APEX covered in this book: Rapid web application development for desktops, la...

  12. Using a task-based approach to teaching and learning Chinese as a Foreign Language in a university beginner's level class

    DEFF Research Database (Denmark)

    Ruan, Youjin; Duan, Xiaoju; Wang, Li

    2015-01-01

    to learning Chinese as a foreign language. Chinese culture elements were also integrated into the tasks and the learning process. By analysing seven items of a post-course survey, this paper investigates the learners’ opinions toward the task-based language teaching and learning method, as well as the methods......The task-based method is regarded as an effective approach for promoting interaction and collaboration in language learning. In a beginner Chinese language course offered as an elective at Aalborg University, Denmark, a selection of tasks was designed and used to attract the students’ interests...... used in integrating culture with the language learning in this course. The results indicated that course participants were generally positive about their learning experiences and processes during the course. They appreciated not only the task-based method, but also the ways in which culture...

  13. The missing link in linear alkylbenzenesulfonate surfactant degradation: 4-sulfoacetophenone as a transient intermediate in the degradation of 3-(4-sulfophenyl)butyrate by Comamonas testosteroni KF-1.

    Science.gov (United States)

    Schleheck, David; von Netzer, Frederick; Fleischmann, Thomas; Rentsch, Daniel; Huhn, Thomas; Cook, Alasdair M; Kohler, Hans-Peter E

    2010-01-01

    Biodegradation of the laundry surfactant linear alkylbenzenesulfonate (LAS) involves complex bacterial communities. The known heterotrophic community has two tiers. First, all LAS congeners are oxygenated and oxidized to about 50 sulfophenylcarboxylates (SPC). Second, the SPCs are mineralized. Comamonas testosteroni KF-1 mineralizes 3-(4-sulfophenyl)butyrate (3-C4-SPC). During growth of strain KF-1 with 3-C4-SPC, two transient intermediates were detected in the culture medium. One intermediate was identified as 4-sulfoacetophenone (SAP) (4-acetylbenzenesulfonate) by nuclear magnetic resonance (NMR). The other was 4-sulfophenol (SP). This information allowed us to postulate a degradation pathway that comprises the removal of an acetyl moiety from (derivatized) 3-C4-SPC, followed by a Baeyer-Villiger monooxygenation of SAP and subsequent ester cleavage to yield SP. Inducible NADPH-dependent SAP-oxygenase was detected in crude extracts of strain KF-1. The enzyme reaction involved transient formation of 4-sulfophenol acetate (SPAc), which was completely hydrolyzed to SP and acetate. SP was subject to NADH-dependent oxygenation in crude extract, and 4-sulfocatechol (SC) was subject to oxygenolytic ring cleavage. The first complete degradative pathway for an SPC can now be depicted with 3-C4-SPC: transport, ligation to a coenzyme A (CoA) ester, and manipulation to allow abstraction of acetyl-CoA to yield SAP, Baeyer-Villiger monooxygenation to SPAc, hydrolysis of the ester to acetate and SP, monooxygenation of SP to SC, the ortho ring-cleavage pathway with desulfonation, and sulfite oxidation.

  14. A facile and efficient synthesis of diaryl amines or ethers under microwave irradiation at presence of KF/Al2O3 without solvent and their anti-fungal biological activities against six phytopathogens.

    Science.gov (United States)

    Huang, Liang-Zhu; Han, Pan; Li, You-Qiang; Xu, Ying-Meng; Zhang, Tao; Du, Zhen-Ting

    2013-09-12

    A series of diaryl amines, ethers and thioethers were synthesized under microwave irradiation efficiently at presence of KF/Al2O3 in 83%-96% yields without any solvent. The salient characters of this method lie in short reaction time, high yields, general applicability to substrates and simple workup procedure. At the same time, their antifungal biological activities against six phytopathogen were evaluated. Most of the compounds (3b, 3c, 3g-o) are more potent than thiophannate-methyl against to Magnaporthe oryzae. This implies that diaryl amine or ether moiety may be helpful in finding a fungicide against Magnaporthe oryzae.

  15. A Facile and Efficient Synthesis of Diaryl Amines or Ethers under Microwave Irradiation at Presence of KF/Al2O3 without Solvent and Their Anti-Fungal Biological Activities against Six Phytopathogens

    Directory of Open Access Journals (Sweden)

    Tao Zhang

    2013-09-01

    Full Text Available A series of diaryl amines, ethers and thioethers were synthesized under microwave irradiation efficiently at presence of KF/Al2O3 in 83%–96% yields without any solvent. The salient characters of this method lie in short reaction time, high yields, general applicability to substrates and simple workup procedure. At the same time, their antifungal biological activities against six phytopathogen were evaluated. Most of the compounds (3b, 3c, 3g–o are more potent than thiophannate-methyl against to Magnaporthe oryzae. This implies that diaryl amine or ether moiety may be helpful in finding a fungicide against Magnaporthe oryzae.

  16. A Web-Based, Social Networking Beginners' Running Intervention for Adults Aged 18 to 50 Years Delivered via a Facebook Group: Randomized Controlled Trial.

    Science.gov (United States)

    Looyestyn, Jemma; Kernot, Jocelyn; Boshoff, Kobie; Maher, Carol

    2018-02-26

    Online social networks continue to grow in popularity, with 1.7 billion users worldwide accessing Facebook each month. The use of social networking sites such as Facebook for the delivery of health behavior programs is relatively new. The primary aim of this study was to determine the effectiveness of a Web-based beginners' running program for adults aged 18 to 50 years, delivered via a Facebook group, in increasing physical activity (PA) and cardiorespiratory fitness. A total of 89 adults with a mean age of 35.2 years (SD 10.9) were recruited online and via print media. Participants were randomly allocated to receive the UniSA Run Free program, an 8-week Web-based beginners' running intervention, delivered via a closed Facebook group (n=41) that included daily interactive posts (information with links, motivational quotes, opinion polls, or questions) and details of the running sessions; or to the control group who received a hard copy of the running program (n=48). Assessments were completed online at baseline, 2 months, and 5 months. The primary outcome measures were self-reported weekly moderate to vigorous physical activity (MVPA) and objectively measured cardiorespiratory fitness. Secondary outcomes were social support, exercise attitudes, and self-efficacy. Analyses were undertaken using random effects mixed modeling. Compliance with the running program and engagement with the Facebook group were analyzed descriptively. Both groups significantly increased MVPA across the study period (P=.004); however, this was significantly higher in the Facebook group (P=.04). The Facebook group increased their MVPA from baseline by 140 min/week versus 91 min for the control at 2 months. MVPA remained elevated for the Facebook group (from baseline) by 129 min/week versus a 50 min/week decrease for the control at 5 months. Both groups had significant increases in social support scores at 2 months (P=.02); however, there were no group by time differences (P=.16). There were

  17. Status report. KfK contribution to the development of DEMO-relevant test blankets for NET/ITER. Pt. 1: Self-cooled liquid metal breeder blanket. Vol. 1

    International Nuclear Information System (INIS)

    Malang, S.; Reimann, J.; Sebening, H.; Barleon, L.; Bogusch, E.; Bojarsky, E.; Borgstedt, H.U.; Buehler, L.; Casal, V.; Deckers, H.; Feuerstein, H.; Fischer, U.; Frees, G.; Graebner, H.; John, H.; Jordan, T.; Kramer, W.; Krieg, R.; Lenhart, L.; Malang, S.; Meyder, R.; Norajitra, P.; Reimann, J.; Schwenk-Ferrero, A.; Schnauder, H.; Stieglitz, R.; Oschinski, J.; Wiegner, E.

    1991-12-01

    A self-cooled liquid metal breeder blanket for a fusion DEMO-reactor and the status of the development programme is described as a part of the European development programme of DEMO relevant test blankets for NET/ITER. Volume 1 (KfK 4907) contains a summary, Volume 2 (KfK 4908) a more detailed version of the report. Both volumes contain sections on previous studies on self-cooled liquid metal breeder blankets, the reference blanket design for a DEMO-reactor, a typical test blanket design including the ancillary loop system and the building requirements for NET/ITER together with the present status of the associated R and D-programme in the fields of neutronics, magnetohydrodynamics, tritium removal and recovery, liquid metal compatibility and purification, ancillary loop system, safety and reliability. An outlook is given regarding the required R and D-programme for the self-cooled liquid metal breeder blanket prior to tests in NET/ITER and the relevant test programme to be performed in NET/ITER. (orig.) [de

  18. EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA); Scientific Opinion on the substantiation of a health claim related to KF2BL20 and maintenance of normal hair pursuant to Article 13(5) of Regulation (EC) No 1924/2006

    DEFF Research Database (Denmark)

    Tetens, Inge

    and contributes to reduce hair loss”. The target population proposed by the applicant is healthy adults in the general population. The Panel considers that maintenance of normal hair is a beneficial physiological effect. The applicant identified one single arm study as being pertinent to the health claim...... related to KF2BL20, which is a combination of keratin, copper, zinc, niacin, pantothenic acid, pyridoxine and D-biotin, and maintenance of normal hair. The Panel considers that KF2BL20 is sufficiently characterised. The claimed effect is “helps to reinforce hair strength and normal hair function....... The Panel notes that this study was uncontrolled and considers that no conclusions can be drawn from this study for the scientific substantiation of the claim. The Panel concludes that a cause and effect relationship has not been established between the consumption of KF2BL20 and maintenance of normal hair....

  19. The integration of Mathematics, Science and Technology in early childhood education and the foundation phase: The role of the formation of the professional identities of beginner teachers

    Directory of Open Access Journals (Sweden)

    Marie Botha

    2015-02-01

    Full Text Available This article focuses on the professional identity formation of six beginner teachers (three in early childhood education and three in the foundation phase, involved in the teaching of Mathematics, Science and Technology (MST. Attention is in particular being paid to the role of professional identity in how they applied innovative teaching methods such as enquiry-based teaching. The study is based on the personal narratives of the six teachers, regarding their own learning experiences in MST, the impact of their professional training at an institution of higher education, as well as their first experiences as MST teachers in the workplace. A qualitative research design was applied and data was obtained through visual (photo collages and written stories, observation and interviews. Whilst all the teachers held negative attitudes towards Mathematics, this situation was turned around during their university training. The three teachers in early childhood education experienced their entrance to the profession as positive, due mainly to the support of colleagues in their application of innovative teaching methods. Two teachers in the foundation phase, however, experienced the opposite. The findings emphasise the complex processes in the moulding of a professional teacher identity and how teaching practices are influenced by these processes.

  20. Application of beta-(2-chloroaroyl)thioacetanilide in synthesis(III): an efficient three-component synthesis of thiochromeno[2,3-b]pyridines catalyzed by KF/neutral Al2O3 co-operated with PEG 6000 under microwave irradiation.

    Science.gov (United States)

    Wen, Lirong; Ji, Chen; Li, Yafeng; Li, Ming

    2009-01-01

    A series of new functionalized thiochromeno[2,3-b]pyridine derivatives have been synthesized via a sequence of Knoevenagel condensation, Michael addition, cyclization, and intramolecular nucleophilic substitution, which is first catalyzed by KF/neutral Al(2)O(3) cooperated with PEG 6000 under microwave irradiation. Experimental results indicated that among the catalysts tested, KF/ neutral Al(2)O(3) with PEG 6000 exhibits the best catalytic activity, which leads to a substantial improvement in the overall yield and purity of the desired final products and significantly shorter reaction time.

  1. Ćwierćpetit. Einmaliger Leseblatt der Belegschaft der Graphischen Betriebe „Książka i Wiedza” in Thorn als Informationsquelle über das gesellschaftliche Leben zu Beginn der 50er Jahre des 20. Jahrhunderts

    Directory of Open Access Journals (Sweden)

    Wanda Ciszewska

    2011-12-01

    Full Text Available Der einmalige Leseblatt Ćwierćpetit stammt aus der Zeit der Eigentumsumgestaltung der Thorner Druckerei, die zu Beginn der 50er Jahre stattfanden. Die Höhe der Auflage innerhalb der Grenzen von 300 Exemplaren und das Fehlen eines aufgedruckten Preises zeugen davon, dass diese Veröffentlichung vermutlich ausschließlich unter der Belegschaft des Unternehmens verteilt wurde. Die Publikation erschien im Mai zu Ehren der Arbeiterwelt und hat erkennbar einen politischen Kontext, der heute ein Zeugnis des Bierut-Kultes und der sozialistischen Propaganda aus den ersten Jahren der Volksrepublik Polen ist.

  2. Quantum physics a beginner's guide

    CERN Document Server

    Rae, Alastair I M

    2005-01-01

    As Alastair Rae points out in his introduction, ""quantum physics is not rocket science"". It may have gained a reputation as the theory that no one really understands, but its practical applications are all around us in everyday life. If it were not for quantum physics, computers would not function, metals would not conduct electricity, and the power stations that heat our homes would not produce energy. Assuming no prior scientific or mathematical knowledge, this clear and concise introduction provides a step-by-step guide to quantum theory, right from the very basic principles to the most c

  3. Artificial intelligence a beginner's guide

    CERN Document Server

    Whitby, Blay

    2012-01-01

    Tomorrow begins right here as we embark on an enthralling and jargon-free journey into the world of computers and the inner recesses of the human mind. Readers encounter everything from the nanotechnology used to make insect-like robots, to computers that perform surgery, in addition to discovering the biggest controversies to dog the field of AI. Blay Whitby is a Lecturer on Cognitive Science and Artificial Intelligence at the University of Sussex UK. He is the author of two books and numerous papers.

  4. Livecode mobile development beginner's guide

    CERN Document Server

    Holgate, Colin

    2015-01-01

    The ideal reader for this book would be someone who already knows LiveCode, is interested in creating mobile apps, and wants to save the many hours it took for me to track down all of the information on how to get started! Chapter 1, LiveCode Fundamentals, will help those of you who know programming but are not familiar with LiveCode. The knowledge you've acquired should be enough for you to benefit from the remainder of the book.

  5. Pentaho data integration beginner's guide

    CERN Document Server

    Roldán, María Carina

    2013-01-01

    This book focuses on teaching you by example. The book walks you through every aspect of Pentaho Data Integration, giving systematic instructions in a friendly style, allowing you to learn in front of your computer, playing with the tool. The extensive use of drawings and screenshots make the process of learning Pentaho Data Integration easy. Throughout the book, numerous tips and helpful hints are provided that you will not find anywhere else.This book is a must-have for software developers, database administrators, IT students, and everyone involved or interested in developing ETL solutions,

  6. Planet earth a beginner's guide

    CERN Document Server

    Gribbin, John

    2012-01-01

    In this incredible expedition into the origins, workings, and evolution of our home planet, John Gribbin, bestselling author of In Search of Schrödinger's Cat, The Scientists, and In Search of the Multiverse, does what he does best: taking four and a half billion years of mind-boggling science and digging out the best bits. From the physics of Newton and the geology of Wegener, to the environmentalism of Lovelock, this is a must read for Earth's scientists and residents alike. Trained as an astrophysicist at Cambridge University, John Gribbin is currently Visiting Fellow in Astronomy at the University of Sussex, England.

  7. Kayh am Beginn der Neuzeit

    OpenAIRE

    Trugenberger, Volker

    1990-01-01

    Die Kayher Gegend barg in ihrem Boden einen besonderen Schatz: Alabaster. Herzog Ludwig von Württemberg kaufte eigens zwischen 1581 und 1586 von den Kayher Bürgern Urban Binder, Jakob Schwarz und Martin Noppel deren auf Altinger Markung uffm kreidengraben gelegene Äcker mit alapasterstein, insgesamt 2 Morgen. Der darauf gebrochene Alabaster wurde für Kunstwerke verwandt, die im Auftrag des Herzogs angefertigt wurden; er wurde nicht abgebaut, um ihn anderweitig zu verkaufen und damit Gewinne z...

  8. Python 3 for Absolute Beginners

    CERN Document Server

    Hall, Tim

    2009-01-01

    There are many more people who want to study programming other than aspiring computer scientists with a passing grade in advanced calculus. This guide appeals to your intelligence and ability to solve practical problems, while gently teaching the most recent revision of the programming language Python. You can learn solid software design skills and accomplish practical programming tasks, like extending applications and automating everyday processes, even if you have no programming experience at all. Authors Tim Hall and J-P Stacey use everyday language to decode programming jargon and teach Py

  9. Java 7 A Beginner's Tutorial

    CERN Document Server

    Kurniawan, Budi

    2011-01-01

    A Books24x7's TOP 10 title for 4 consecutive years! Java is an easy language to learn. However, you need to master more than the language syntax to be a professional Java programmer. For one, object-oriented programming (OOP) skill is key to developing robust and effective Java applications. In addition, knowing how to use the vast collection of libraries makes development more rapid. This book introduces you to important programming concepts and teaches how to use the Java core libraries. It is a guide to building real-world applications, both desktop and Web-based. The coverage is the

  10. Quantum error correction for beginners

    International Nuclear Information System (INIS)

    Devitt, Simon J; Nemoto, Kae; Munro, William J

    2013-01-01

    Quantum error correction (QEC) and fault-tolerant quantum computation represent one of the most vital theoretical aspects of quantum information processing. It was well known from the early developments of this exciting field that the fragility of coherent quantum systems would be a catastrophic obstacle to the development of large-scale quantum computers. The introduction of quantum error correction in 1995 showed that active techniques could be employed to mitigate this fatal problem. However, quantum error correction and fault-tolerant computation is now a much larger field and many new codes, techniques, and methodologies have been developed to implement error correction for large-scale quantum algorithms. In response, we have attempted to summarize the basic aspects of quantum error correction and fault-tolerance, not as a detailed guide, but rather as a basic introduction. The development in this area has been so pronounced that many in the field of quantum information, specifically researchers who are new to quantum information or people focused on the many other important issues in quantum computation, have found it difficult to keep up with the general formalisms and methodologies employed in this area. Rather than introducing these concepts from a rigorous mathematical and computer science framework, we instead examine error correction and fault-tolerance largely through detailed examples, which are more relevant to experimentalists today and in the near future. (review article)

  11. Minimal Materials for ESL Beginners

    Directory of Open Access Journals (Sweden)

    N. S. Prabhu

    2010-01-01

    Full Text Available In November 2006, the government of the state of Karnataka in India announced its decision to start teaching English as a school subject from class 1 onwards in all primary schools in the state, instead of from class 5 as hitherto.

  12. Mac Programming for Absolute Beginners

    CERN Document Server

    Wang, Wallace

    2011-01-01

    Want to learn how to program on your Mac? Not sure where to begin? Best-selling author Wallace Wang will explain how to get started with Cocoa, Objective-C, and Xcode. Whether you are an experienced Windows coder moving to the Mac, or you are completely new to programming, you'll see how the basic design of a Mac OS X program works, how Objective-C differs from other languages you may have used, and how to use the Xcode development environment. Most importantly, you'll learn how to use elements of the Cocoa framework to create windows, store data, and respond to users in your own Mac programs.

  13. Seven Myths about Beginners' Language

    DEFF Research Database (Denmark)

    Lund, Karen; Kirkebæk, Mads Jakob

    2015-01-01

    ) the myth about ‘the only thing’ (the method), (4) the myth about “we tried that before”, (5) the myth about “one people and one teaching method, (6) the myth about easy and difficult languages, and (7) the myth about students with no competences and a worthless past. The article suggests language teachers...... to use a ‘myth-detector’ to detect, reflect on and possibly reject myths they may meet in their profession. The ‘myth-detector’ consists of four simple questions, namely (1) Where do we know it from? (2) What is it built on? (3) What views on learning, language and culture lie behind? and (4) Who (gets......In the article the authors have selected seven myths about beginners’ language for discussion, reflection and possible rejection. These are (1) the myth about the necessity of mastering the system before being able to speak the language, (2) the myth about limited capacity on the ‘hard disc’, (3...

  14. Artificial Neural Networks for Beginners

    OpenAIRE

    Gershenson, Carlos

    2003-01-01

    The scope of this teaching package is to make a brief induction to Artificial Neural Networks (ANNs) for people who have no previous knowledge of them. We first make a brief introduction to models of networks, for then describing in general terms ANNs. As an application, we explain the backpropagation algorithm, since it is widely used and many other algorithms are derived from it. The user should know algebra and the handling of functions and vectors. Differential calculus is recommendable, ...

  15. Seven Myths about Beginners' Language

    DEFF Research Database (Denmark)

    Lund, Karen; Kirkebæk, Mads Jakob

    2015-01-01

    ) the myth about ‘the only thing’ (the method), (4) the myth about “we tried that before”, (5) the myth about “one people and one teaching method, (6) the myth about easy and difficult languages, and (7) the myth about students with no competences and a worthless past. The article suggests language teachers......In the article the authors have selected seven myths about beginners’ language for discussion, reflection and possible rejection. These are (1) the myth about the necessity of mastering the system before being able to speak the language, (2) the myth about limited capacity on the ‘hard disc’, (3...... to use a ‘myth-detector’ to detect, reflect on and possibly reject myths they may meet in their profession. The ‘myth-detector’ consists of four simple questions, namely (1) Where do we know it from? (2) What is it built on? (3) What views on learning, language and culture lie behind? and (4) Who (gets...

  16. Using a Blog to Guide Beginner Students to Use Adjectives Appropriately When Writing Descriptions in English (El uso de una bitácora o "blog" para guiar a estudiantes principiantes en el uso apropiado de los adjetivos cuando escriben descripciones en inglés)

    Science.gov (United States)

    Lizarazo Jara, Omar Yesid

    2012-01-01

    Beginner students often have difficulties using adjectives when they write descriptions in English. This article focuses on the procedures used to help my sixth grade students understand and use adjectives in the correct order by using a blog. To achieve the objective of the project I decided to implement an innovation in and out of class…

  17. Programa de mentoria online: espaço para o desenvolvimento profissional de professoras iniciantes e experientes Online mentorship program: a space for the professional development of beginner and experienced teachers

    Directory of Open Access Journals (Sweden)

    Aline Maria de Medeiros Rodrigues Reali

    2008-04-01

    -research about the formative processes of beginner teachers and their mentors. The initial formation of teachers by their mentors takes place under the Mentorship Program of the UFSCar Teachers' Portal (www.portaldosprofessores.ufscar.br, and the formation of mentors (experienced teachers happens in presence meetings with the authors of this work. Research and intervention are based on a constructive-collaborative methodology, and the main tools of data-gathering are the narratives - both written and spoken - and interactive conversations. The theoretical framework assumes that: the learning of teaching is a continuous process influenced by beliefs and conceptions, and by knowledges of different natures; the initiation to teaching is a conflicting, but rich, period of intensive learning, during which the beginner teacher effectively becomes a teacher; teacher educators - just as teachers in general - need support for their professional development; continued education must be school-centered, even when virtually, and focus on responding to teachers' demands considering the context of the action; online education via the Internet is an important possibility for teacher education. Among the results, we mention the construction of new professional knowledges by the beginner teachers, mentors, and researchers; the experience by the mentors - seasoned and successful teachers - of initiation processes similar to those undergone by the beginner teachers they supervise; the potentials of learning communities and of narratives for the promotion of the professional development of teaching.

  18. Disease specific stress of tumor patients at the beginning of radiotherapy. Effect on psychosocial support requirement; Krankheitsspezifische Belastungen von Tumorpatienten zu Beginn einer Strahlentherapie. Auswirkungen auf den psychosozialen Betreuungsbedarf

    Energy Technology Data Exchange (ETDEWEB)

    Sehlen, S.; Hollenhorst, H.; Schymura, B.; Firsching, M.; Duehmke, E. [Ludwig-Maximilians-Univ., Muenchen (Germany). Klinik und Poliklinik fuer Strahlentherapie und Radioonkologie; Aydemir, U. [Inst. fuer Biometrie und Epidemiologie, Klinikum Grosshadern, Ludwig-Maximilians-Univ., Muenchen (Germany); Herschbach, P. [Technische Univ. Muenchen (Germany). Inst. und Poliklinik fuer Psychosomatische Medizin, Psychotherapie und medizinische Psychologie

    2001-10-01

    requirement. (orig.) [German] Hintergrund: Die Radiotherapie bringt Tumorpatienten in eine besondere Lebenssituation, in der sie eine Reihe von unterschiedlichen Faktoren ausgesetzt werden, deren Auspraegung weitgehend unbekannt ist. Intention dieser Querschnittsstudie war es, erstmals systematisch die spezifischen Belastungen von Tumorpatienten zu Beginn einer Strahlentherapie aufzuzeigen und einen belastungsabhaengigen Betreuungswunsch zu erheben mit dem Ziel einer Belastungsreduktion und Verbesserung von Lebensqualitaet und Compliance waehrend einer radioonkologischen Behandlung. Patienten und Methoden: 732 Patienten wurden zunaechst in die Studie aufgenommen, von denen 446 (60,9%) die Einschlusskriterien erfuellten (Ablehnung 21,0%, Karnofsky-Index 6,6%, organisatorische Probleme 3,4%, Sprachbarrieren 3,0%, kognitive Einschraenkung 2,6%, Tod 2,5%). Folgende Erhebungsinstrumente gingen in die Auswertung zu Beginn der Strahlentherapie ein: medizinische und soziodemographische Daten, Lebenssituation (LS), Fragebogen zur Belastung von Krebspatienten (FBK), selbst definierter Betreuungswunsch (BB). 262 Maenner und 184 Frauen (medianes Alter 60,0 Jahre) mit unterschiedlichen Diagnosen wurden untersucht. Ergebnisse: Auf Skalenebene des Fragebogens zur Belastung von Krebspatienten zeigte sich vor allem eine Belastung durch Einschraenkung der Leistungsfaehigkeit, Angst und Schmerz. Frauen hatten signifikant hoehere Belastungswerte in den Bereichen Schmerz (p=0,016) und Angst (p=0,009), Patienten unter 45 Jahren im Bereich Information (p=0,002) und Patienten zwischen 45 und 60 Jahren in den Bereichen Angst (p=0,002) und Gesamtbelastung (p=0,003). Patientinnen mit einem Mammakarzinom waren am staerksten belastet. Der Anteil von stark belasteten Patienten war in den Skalen Leistungsfaehigkeit (43%) und Angst (40%) am hoechsten. Es bestand ein signifikanter Zusammenhang zwischen hoher Belastung und hohem Betreuungswunsch (insbesondere nach Arzt-/Psychologengespraechen und Information

  19. Treino musical e capacidade da memória operacional em crianças iniciantes, veteranas e sem conhecimentos musicais Musical training and working memory span in beginners, veterans and with no musical knowledge children

    Directory of Open Access Journals (Sweden)

    Fabiana Silva Ribeiro

    2012-01-01

    Full Text Available A memória operacional e a atividade musical ativam áreas encefálicas recíprocas e homólogas, contudo não há evidências se o treino musical pode ampliar a capacidade da memória operacional. Objetivo: Avaliar o desempenho do treino musical sob a memória operacional em crianças de 9 e 10 anos de idade, praticantes de treino musical e sem experiência musical. PARTICIPANTES: Crianças Iniciantes (n=20, Veteranas (n=20 e Grupo Controle (n=20. MATERIAIS: Instrumentos computadorizados para avaliação da memória operacional. RESULTADOS: Crianças veteranas apresentaram melhores pontuações no BCPR (Teste de Repetição de Pseudopalavras para crianças brasileiras e em subtestes da AWMA (Avaliação Automatizada da Memória Operacional. CONCLUSÃO: O treino musical parece ter contribuído para o desenvolvimento da memória operacional em crianças veteranas no programa de treino musical.Working memory and musical activity activate reciprocal and homologues brain areas. However, there is a lack of evidence if musical training can amplify the working memory span. Objective: To assess the performance of musical training on working memory in children aged 9 and 10 years old who regularly have musical training or with no musical training at all. PARTICIPANTS: Beginners (n=20, Veterans (n=20 and a Control Group (n=20. MATERIALS: Computerized instruments to assess working memory. RESULTS: Veteran children presented higher scores in BCPR (Brazilian Children's Test of Pseudoword Repetition and in specific tasks of AWMA (Automated Working Memory Assessment. CONCLUSION: Musical training seems to have contributed for working memory development in veteran children under musical training programs.

  20. Web application security: a beginner's guide

    National Research Council Canada - National Science Library

    Sullivan, Bryan; Liu, Vincent

    2012-01-01

    .... Sullivan and Liu have created a savvy, essentials-based approach to web app security packed with immediately applicable tools for any information security practitioner sharpening his or her tools or just starting...

  1. Basic dermoscopy of melanocytic lesions for beginners

    Directory of Open Access Journals (Sweden)

    Grażyna Kamińska-Winciorek

    2011-08-01

    Full Text Available Background. Dermoscopy is a safe, easy-to-repeat diagnostic method used especially in the diagnosis of melanocytic lesions and others. Performing dermoscopy for skin lesions on the whole body takes only one minute more than standard clinical examination. Therefore the knowledge of basic dermoscopy among multi-specialization doctors – from general practitioners, surgeons, oncologists to dermatologists – increases the possibility of detection of potential melanoma.Aim. To describe the basic aspects of dermoscopy of melanocytic lesions.Methods. Review of medical databases PubMed and Medline from the last 8 years and a retrospective analysis of own experience.Results. We report the fundamental principles of performing dermoscopy, basic dermoscopic features and diagnostic algorithms of selected melanocytic lesions. Conclusions. The knowledge base of dermoscopy is very important among doctors of many specializations. It increases melanoma detection in very early stages.

  2. Engineering haptic devices a beginner's guide

    CERN Document Server

    Hatzfeld, Christian

    2014-01-01

    In this greatly reworked second edition of Engineering Haptic Devices the psychophysic content has been thoroughly revised and updated. Chapters on haptic interaction, system structures and design methodology were rewritten from scratch to include further basic principles and recent findings. New chapters on the evaluation of haptic systems and the design of three exemplary haptic systems from science and industry have been added. This book was written for students and engineers that are faced with the development of a task-specific haptic system. It is a reference book for the basics of hap

  3. Renormalization Methods - A Guide For Beginners

    International Nuclear Information System (INIS)

    Cardy, J

    2004-01-01

    The stated goal of this book is to fill a perceived gap between undergraduate texts on critical phenomena and advanced texts on quantum field theory, in the general area of renormalization methods. It is debatable whether this gap really exists nowadays, as a number of books have appeared in which it is made clear that field-theoretic renormalization group methods are not the preserve of particle theory, and indeed are far more easily appreciated in the contexts of statistical and condensed matter physics. Nevertheless, this volume does have a fresh aspect to it, perhaps because of the author's background in fluid dynamics and turbulence theory, rather than through the more traditional migration from particle physics. The book begins at a very elementary level, in an effort to motivate the use of renormalization methods. This is a worthy effort, but it is likely that most of this section will be thought too elementary by readers wanting to get their teeth into the subject, while those for whom this section is apparently written are likely to find the later chapters rather challenging. The author's particular approach then leads him to emphasise the role of renormalized perturbation theory (rather than the renormalization group) in a number of problems, including non-linear systems and turbulence. Some of these ideas will be novel and perhaps even surprising to traditionally trained field theorists. Most of the rest of the book is on far more familiar territory: the momentum-space renormalization group, epsilon-expansion, and so on. This is standard stuff, and, like many other textbooks, it takes a considerable chunk of the book to explain all the formalism. As a result, there is only space to discuss the standard φ 4 field theory as applied to the Ising model (even the N-vector model is not covered) so that no impression is conveyed of the power and extent of all the applications and generalizations of the techniques. It is regrettable that so much space is spent on rather oversimplified and unrelated models in the first part of the book that, in the end, the reader is left breathless on the threshold of the really interesting material. Despite the earlier emphasis on the application of renormalization ideas in dynamics, in the end the full power of the field-theoretical approach is not applied to the obvious arena of dynamic critical phenomena (where there certainly is currently a gap in the literature) but to the Navier--Stokes equations. The development of the book is somewhat illogical in places. Mean field theory interrupts discussion of block spin methods and scaling arguments---the two are distinct approaches. The Callan--Symanzik equation is introduced before Feynman diagrams are explained, so that there is a hiatus before the actual results for the critical exponents can be found. I think this book is too broad in some respects, and too limited in others, to be a really useful textbook for a course on renormalization methods. Those who have learned these ideas either from field theory, or from nonlinear systems, will find it more rewarding for the sections covering the topics with which they are less familiar. For this reason alone, the book should at least find a place on most library reference shelves. (book review)

  4. 4-H Textile Science Beginner Projects.

    Science.gov (United States)

    Scholl, Jan

    This packet contains three 4-H projects for students beginning the sewing sequence of the textile sciences area. The projects cover basics of sewing using sewing machines, more difficult sewing machine techniques, and hand sewing. Each project provides an overview of what the student will learn, what materials are needed, and suggested projects…

  5. A Beginner's Course in Tunisian Arabic.

    Science.gov (United States)

    Amor, Taoufik Ben

    This guide is designed for the Arabic language training of Peace Corps volunteers serving in Tunisia and focuses on daily communication skills needed in that context. It contains 15 lessons, each made up of: a teacher's guide sheet, which outlines specific objectives, contents, and materials needed; a dialogue introducing the lesson's theme; a…

  6. Colloquial English the complete course for beginners

    CERN Document Server

    King, Gareth

    2015-01-01

    Colloquial English provides a step-by-step course in English as it is written and spoken today. Combining a user-friendly approach with a thorough treatment of the language, it equips learners with the essential skills needed to communicate confidently and effectively in English in a broad range of situations. Key features include:progressive coverage of speaking, listening, reading and writing skillsstructured, jargon-free explanations of grammaran extensive range of focused and stimulating exercisesrealistic and entertaining dialogues covering a broad variety of scenariosuseful explanations

  7. A beginners guide to the SVXII

    International Nuclear Information System (INIS)

    Yarema, R.; Kipnis, I.; Kleinfelder, S.; Luo, L.; Milgrome, O.; Sarraj, M.; Yarema, R.; Zimmerman, T.

    1994-06-01

    In the late 1980's, several versions of a full custom chip called the SVX were built and tested. The chip was designed to be a second generation silicon strip readout chip incorporating new features such as data sparsification for silicon strip detectors. The SVX designed by Stuart Kleinfelder and others at LBL contained 128 channels of electronics and proved to be very popular. Initially the chip was fabricated in 3.0 micron process and later transferred to a 1.2 micron radiation hard process. Based on the success of the first SVX (referred herein as SVXI), a need arose for a third generation device. This new 128 channel device called the SVXII was developed by a collaboration of engineers at Fermilab and Lawrence Berkeley Laboratory. The SVXII, designed in a 1.2 micron process, contains many new features including analog storage and digitization of the analog information. In addition to the new features, the SXVII is intended to operate with interaction times approximately 25 times faster than the original SVX, have the same or better noise characteristics, and have a minimal increase in power. The SVXII is an engineering challenge. This report is a first detailed attempt to introduce the SVXIII to the user. Knowledge of the original SVX and its operation would be helpful and can be obtained from references 1--3

  8. Tagalog for Beginners. PALI Language Texts: Philippines.

    Science.gov (United States)

    Ramos, Teresita V.; de Guzman, Videa

    This language textbook is designed for beginning students of Tagalog, the principal language spoken on the island of Luzon in the Philippines. The introduction discusses the history of Tagalog and certain features of the language. An explanation of the text is given, along with notes for the teacher. The text itself is divided into nine sections:…

  9. JavaScript for Absolute Beginners

    CERN Document Server

    McNavage, T

    2010-01-01

    If you are new to both JavaScript and programming, this hands-on book is for you. Rather than staring blankly at gobbledygook, you'll explore JavaScript by entering and running hundreds of code samples in Firebug, a free JavaScript debugger. Then in the last two chapters, you'll leave the safety of Firebug and hand-code an uber cool JavaScript application in your preferred text editor. Written in a friendly, engaging narrative style, this innovative JavaScript tutorial covers the following essentials: * Core JavaScript syntax, such as value types, operators, expressions, and statements provide

  10. Renormalization methods: a guide for beginners

    National Research Council Canada - National Science Library

    McComb, W. D

    2004-01-01

    ... approach based on quasi-particles 1.2.7 Control parameters: how to weaken the coupling 1.2.8 Perturbation theory 1.3 Solving the relevant differential equations by perturbation theory 1.3.1 Solution in series 1.3.2 Green's functions 1.3.3 Example: Green's function in electrostatics 1.3.4 Example: Green's function for the diffusion equat...

  11. GNOME 3 application development beginner's guide

    CERN Document Server

    Anwari, Mohammad

    2013-01-01

    This book is a step-by-step guide with ready-to-run codes to guide you in developing applications with GNOME. If you have programming skill either in Linux or other operating systems and want to have GNOME 3 as one of your deployment targets, then this book is for you. This book is also for commercial software developers or an open source software hacker. The reader needs to be familiar with Vala and JavaScript before starting to develop Gtk+ and Clutter applications.

  12. Kali Linux wireless penetration testing beginner's guide

    CERN Document Server

    Ramachandran, Vivek

    2015-01-01

    If you are a security professional, pentester, or anyone interested in getting to grips with wireless penetration testing, this is the book for you. Some familiarity with Kali Linux and wireless concepts is beneficial.

  13. Drupal 7 Mobile Web Development Beginner's Guide

    CERN Document Server

    StovallTom

    2012-01-01

    Follow the fun example of a family pizza restaurant to help you adapt your own website to one that is fullyfunctional in a mobile environment. Each chapter covers a different aspect of mobile web development with plenty of step-by-step instructions and screenshots to make things clearer. This book is for independent developers who may or may not have had experience with Drupal websites. We take some "deep dives" into customized functionality that will take your Drupal development and your development workflow to the next level.

  14. Colloquial French the complete course for beginners

    CERN Document Server

    Demouy, Valérie

    2014-01-01

     COLLOQUIAL FRENCH is easy to use and completely up to date!Specially written by experienced teachers for self-study or class use, the course offers a step-by-step approach to written and spoken French. No prior knowledge of the language is required.What makes COLLOQUIAL FRENCH your best choice in personal language learning?Interactive - lots of exercises for regular practiceClear - concise grammar notesPractical - useful vocabulary and pronunciation guideComplete - including answer key and reference sectionWhether you''re a business traveller, or about to take up a daring challenge in adventu

  15. Geometric measure theory a beginner's guide

    CERN Document Server

    Morgan, Frank

    1995-01-01

    Geometric measure theory is the mathematical framework for the study of crystal growth, clusters of soap bubbles, and similar structures involving minimization of energy. Morgan emphasizes geometry over proofs and technicalities, and includes a bibliography and abundant illustrations and examples. This Second Edition features a new chapter on soap bubbles as well as updated sections addressing volume constraints, surfaces in manifolds, free boundaries, and Besicovitch constant results. The text will introduce newcomers to the field and appeal to mathematicians working in the field.

  16. KfK KARLSRUHE/RUTHERFORD APPLETON: New neutrino physics

    International Nuclear Information System (INIS)

    Anon.

    1993-01-01

    Full text: The Karlsruhe-Rutherford Medium Energy Neutrino Experiment (KARMEN) at the UK Rutherford Appleton Laboratory's ISIS spallation neutron facility studies the interactions of neutrinos with nuclei in an energy range of particular importance for neutrino astrophysics. After its first three years of datataking the German/British experiment has analysed more than 1000 neutrino- nucleus interactions. The spectroscopic quality of neutrino data complemented by an extremely low background allows reliable cross section measurements down to 10 -42 cm 2 as well as precision tests of the standard model. Having reached its design value of 200 microamps average proton beam current at 800 MeV, ISIS is the world's most powerful pulsed medium energy neutrino source. The proton beam stop delivers extremely short but intense bursts of neutrinos. A prompt burst of 30 MeV muon neutrinos from pion decay at rest is followed by a pulse of electron and muon antineutrinos from muon decay at rest with energies up to 53 MeV. This allows separation of different neutrino 'flavours' by time measurement. In addition, cosmic ray background is highly suppressed. Neutrinos are detected by a 60 ton high resolution liquid scintillation calorimeter 17.5 m from the beam stop and housed in a massive 6000 ton iron blockhouse. Consisting entirely of hydrocarbons, the calorim eter is an all active target of carbon- 12 and hydrogen nuclei. Nuclear excitations by neutrino interactions with carbon-12 nuclei through weak charged or neutral currents can be identified by the subsequent deexcitation processes. At beam stop energies nuclear charged current reactions can only be induced by electron neutrinos. A prototype example is the charged current transition from carbon-12 to the ground state of nitrogen-12. The delayed coincidence of this reaction allows clear identification of electron neutrinos. The flux-averaged as well as the energy dependence of the absorption cross-section both agree with calculations using standard model neutrino-nucleus couplings. In addition, the reaction kinematics can be used to measure the energies of electron neutrinos. Thus the first spectrum of electron neutrinos from muon decay could be derived from 240 neutrino charged current events. Analysis of the spectral shape of electron neutrinos near the kinematic endpoint shows no significant deviation from the standard (V-A) helicity structure of charged currents, thereby putting stringent upper limits on non-standard effects in muon decay. One of KARMEN's major achievements has been the first observation of a neutral current excitation of a nucleus. Within the first year of datataking the experiment could clearly identify neutral current excitations of carbon-12 (to the isovector T=1 level at 15.1 MeV above ground state), the signature being the 15.1 MeV gamma quanta from the decay of the excited carbon-12 level. Focusing on the muon decay time window, the experiment has measured the sum of neutral current excitations induced by electron neutrinos and muon antineutrinos. The flux-averaged cross-section for the sum of both neutrino species is in excellent agreement with recent calculations. A thorough test of flavour universality of the neutrino neutral current coupling comes from comparing neutral and charged current channels. The experimental ratio clearly indicates that both neutrino flavours participate with equal strength in the neutral current channel. As neutrinos from muon decay are the closest terrestrial analogue of supernova neutrinos, these results are also of great relevance to neutrino astrophysics. The second major KARMEN activity is a high sensitivity search for oscillations between muon- and electron type neutrinos and antineutrinos. Oscillation of muon- into electron type neutrinos would be signalled by monoenergetic electron neutrinos in the prompt time window of pion decay using the charged current reaction on carbon-12. Oscillations of muon into electron type antineutrinos would be identified by the inverse beta-decay reaction on the free protons of the scintillator. In both reaction channels no positive evidence for neutrino oscillations has so far been detected. Taking full advantage of the unique time structure of ISIS the experiment will, after three more years of data taking, provide good limits for mixing of electron and muon neutrinos. The future programme will also cover new fields, including measurements of muon-neutrino-induced neutral current excitations of carbon- 12 and of electron-neutrino-induced charged current reactions to excited levels of nitrogen-12, testing the significance of neutrino-induced nucleosynthesis in core collapse supernovae. The KARMEN collaboration includes groups from the Kernforschungszentrum and University of Karlsruhe, Erlangen, the Rutherford-Appleton Laboratory, Queen Mary and Westfield College London, and Oxford

  17. TELLUS_ECCO_OBP_KF080:1

    Data.gov (United States)

    National Aeronautics and Space Administration — The Tellus ECCO Ocean Bottom Pressure (OBP) data contain monthly averaged OBP generated from the ECCO model (http://www.ecco-group.org), where OBP is defined as the...

  18. KfA Institute of Nuclear Physics. Annual report 1987

    International Nuclear Information System (INIS)

    Gruemmer, F.; Kilian, K.; Schult, O.; Seyfarth, H.; Speth, J.; Turek, P.

    1988-04-01

    This annual report contains extended abstracts about the work performed at the named institute together with a list of publications and speeches. The work concerns nuclear reactions, nuclear spectroscopy, intermediate-energy physics, nuclear structure, developments of the isochronous cyclotron and the ISIS ion source, construction of spectrometers, detectors, and targets, computer development, counting electronics, and radiation protection. (HSI)

  19. 1948-IJBCS-Article-Akinwunmi K.F

    African Journals Online (AJOL)

    hp

    Oyedapo OO, Akinpelu BA, Orefuwa SO. 2004. Antiinflammatory effects of. Theobroma cacao, L. root extract. J. Trop. Med. Plants (Malaysia), 5(2): 161-. 166. Oyedapo OO. 1996. Studies on the biological activities of Plumbago zeylanica. Inter. J. Pharmacognosy, 34(5): 365-369. Oyedemi SO, Yakubu MT, Afolayan AJ. 2010.

  20. A derékfájás

    DEFF Research Database (Denmark)

    Tamás, Illés S.

    2015-01-01

    The low back pain has become one of the greatest public health problems worldwide. The author based on the current international standards summarizes the knowledge necessary for every day treatment of low back pain. In acute low back pain the author underlines the necessity of the rapid, accurate...

  1. KfW Water Symposium 2009 : Financing Sanitation

    OpenAIRE

    KfW Development Bank

    2010-01-01

    "The central objective of the International Year of Sanitation was to put the global community on track to achieve the Millennium Development Goals MDG sanitation target. However, one year later, it is still difficult to keep sanitation high on the agenda, while practical action is required to encourage demand driven and sustainable solutions. With the support of the German Ministry for Development and Cooperation and together with the European Investment Bank EIB and the French Developm...

  2. Effect of a mentoring through reflection program on the verbal behavior of beginner volleyball coaches: a case study. Efecto de un programa de supervisión reflexiva sobre la conducta verbal de entrenadores principiantes de voleibol: un estudio de casos.

    Directory of Open Access Journals (Sweden)

    Moreno Domínguez, Alberto

    2007-07-01

    Full Text Available AbstractThe purpose of this study was to modify the verbal behavior of volleyball coaches during competition. Three beginner volleyball coaches were included in a formative program that included supervisory feedback plus systematic analysis of the coaches´ verbal feedback, as well as the coaches´ own observations and self-corrections of their behavior during the competitive season. The outcome variable of interest was the verbal behavior of the coach during timeouts during games, with consideration given for two specific dimensions of behavior: the type of information provided to the team and the team to which the coach made reference. The results revealed a change in the verbal behavior of the coaches, which was principally demonstrated in an increase in amount of tactical information and information provided about the opponent.ResumenEl propósito de este estudio fue modificar la conducta verbal del entrenador de voleibol durante la competición. Tres entrenadores de voleibol fueron sometidos a un programa formativo (feedback de supervisión con análisis sistemático de la conducta verbal del entrenador, y visionado de la actuación durante una temporada de competición. La variable dependiente de la investigación fue la conducta verbal del entrenador durante los tiempos muertos, considerándose dos dimensiones en la misma: tipo de información, equipo al que hace referencia la información. Los resultados obtenidos muestran una modificación en la conducta verbal de los entrenadores, manifestada fundamentalmente en el incremento de información táctica y sobre el equipo contrario.

  3. iPhone Location Aware Apps by Example - Beginners Guide

    CERN Document Server

    Chawdhary, Zeeshan

    2012-01-01

    Using a By example approach you will master the essentials of location awareness and augmented reality by building five complete apps using easy to follow step by step instructions geared towards newcomers. Novice to professional level iOS programmers who want to master location awareness and augmented reality. Build five practical location-based iOS Apps from scratch, a first for any book, converting learning into actual implementation.

  4. Pentaho 5.0 reporting by example beginner's guide

    CERN Document Server

    Mattío, Mariano García

    2013-01-01

    This is a Cookbook with easy-to-follow recipes, containing practical and detailed examples which are all fully backed up with code, illustrations, and tips to dig deep into Backbone.js.This book is great for JavaScript developers who want to learn how to build advanced frontend applications with the Backbone.js framework. This book can be used in educational institutions to teach students how to build frontend applications in an MVC manner.It's assumed that you have some experience in jQuery, and are familiar with HTML.

  5. Aeronautics Study Takes Off! Glider Design for Beginners

    Science.gov (United States)

    Lazaros, Edward J.; Carlson, Katie

    2008-01-01

    Study of aeronautics is an interesting and motivating subject for students and educators alike. The activity described in this article--appropriate for upper elementary or middle school students--provides an excellent introduction to airplane design and the science of aerodynamics. It also gives students good experience applying knowledge from a…

  6. Artificial Intelligence Information Sources for the Beginner and Expert

    Science.gov (United States)

    1991-05-01

    Electronics Engineers) sponsors a number of artificial intelli- gence conferences, including the Conference on Artificial Intelligence Applications and the...Artificial Intelligence and Legal Reasoning Intelligent Tutoring Systems Artificial Intelligence Applications for Nil- Technologies itary Logistics

  7. Learning About The Internet Bibliography And Beginner’s Guide

    Science.gov (United States)

    1994-01-01

    the library / electronic books Americans With Disabilities Act Documents: Collection of documents about the ADA, including the Department of...gopher wiretap.spies.com / electronic books / cia world factbook World Health Organization: Provides access to world health statistics, WHO press

  8. Early numeracy performance of South African school beginners

    Directory of Open Access Journals (Sweden)

    Pirjo Aunio

    2016-12-01

    Full Text Available Early numeracy skills are highly relevant for children’s mathematics learning at school, especially in the initial years when much mathematics learning relies on early numeracy competence. The aim of this study was to investigate the level of early numeracy skills in a sample of South African children in the first months of formal schooling. In this cross- sectional study, there were 443 first graders (206 girls and 237 boys from Gauteng Province schools. The mean age of the children was 81.61 months (6 years 10 months (SD 5.40 months. Their early numeracy skills were measured with the ThinkMath Scale. The main finding of this study was that there were statistically significant differences in early numeracy skills between the children when they started first grade. The differences were related to the home language of the first graders in the English medium schools, as well as the type of school (public vs. private. This article concludes that the numeracy competence of the children from the sample was notably varied in the beginning of their formal schooling, which has implications for teaching in the vastly different classroom populations that are all served by one national curriculum.

  9. A finite element primer for beginners the basics

    CERN Document Server

    Zohdi, Tarek I

    2014-01-01

    The purpose of this primer is to provide the basics of the Finite Element Method, primarily illustrated through a classical model problem, linearized elasticity. The topics covered are:(1) Weighted residual methods and Galerkin approximations,(2) A model problem for one-dimensional?linear elastostatics,(3) Weak formulations in one dimension,(4) Minimum principles in one dimension,(5) Error estimation in one dimension,(5) Construction of Finite Element basis functions in one dimension,(6) Gaussian Quadrature,(7) Iterative solvers and element by element data structures,(8) A model problem for th

  10. Modern cryptography and elliptic curves a beginner's guide

    CERN Document Server

    Shemanske, Thomas R

    2017-01-01

    This book offers the beginning undergraduate student some of the vista of modern mathematics by developing and presenting the tools needed to gain an understanding of the arithmetic of elliptic curves over finite fields and their applications to modern cryptography. This gradual introduction also makes a significant effort to teach students how to produce or discover a proof by presenting mathematics as an exploration, and at the same time, it provides the necessary mathematical underpinnings to investigate the practical and implementation side of elliptic curve cryptography (ECC). Elements of abstract algebra, number theory, and affine and projective geometry are introduced and developed, and their interplay is exploited. Algebra and geometry combine to characterize congruent numbers via rational points on the unit circle, and group law for the set of points on an elliptic curve arises from geometric intuition provided by Bézout's theorem as well as the construction of projective space. The structure of the...

  11. Learning Basic English in Overcrowded Classes for True Beginners

    Science.gov (United States)

    Santana, Isaias

    2016-01-01

    The higher educational institution where this study took place is located in the Dominican Republic. The purpose of this study was to provide insights to the effectiveness and impact of the instructional process applied in a Basic English class under overcrowding conditions, implementing an in depth interview to the faculty members and an…

  12. Introduction to nanoparticles, nanocomposites, nanomaterials an introduction for beginners

    CERN Document Server

    Vollath, Dieter

    2013-01-01

    Meeting the demand for a readily understandable introduction to nanomaterials and nanotechnology, this textbook specifically addresses the needs of students - and engineers - who need to get the gist of nanoscale phenomena in materials without having to delve too deeply into the physical and chemical details. The book begins with an overview of the consequences of small particle size, such as the growing importance of surface effects, and covers successful, field-tested synthesis techniques of nanomaterials. The largest part of the book is devoted to the particular magnetic, optical, electrical and mechanical properties of materials at the nanoscale, leading on to emerging and already commercialized applications, such as nanofluids in magnetic resonance imaging, high-performance nanocomposites and carbon nanotube-based electronics. Based on the author's experience in teaching nanomaterials courses and adapted, in style and level, for students with only limited background knowledge, the textbook includes fur...

  13. Audio engineering 101 a beginner's guide to music production

    CERN Document Server

    Dittmar, Tim

    2013-01-01

    Audio Engineering 101 is a real world guide for starting out in the recording industry. If you have the dream, the ideas, the music and the creativity but don't know where to start, then this book is for you!Filled with practical advice on how to navigate the recording world, from an author with first-hand, real-life experience, Audio Engineering 101 will help you succeed in the exciting, but tough and confusing, music industry. Covering all you need to know about the recording process, from the characteristics of sound to a guide to microphones to analog versus digital

  14. Some Applications of Fourier's Great Discovery for Beginners

    Science.gov (United States)

    Kraftmakher, Yaakov

    2012-01-01

    Nearly two centuries ago, Fourier discovered that any periodic function of period T can be presented as a sum of sine waveforms of frequencies equal to an integer times the fundamental frequency [omega] = 2[pi]/T (Fourier's series). It is impossible to overestimate the importance of Fourier's discovery, and all physics or engineering students…

  15. Some applications of Fourier's great discovery for beginners

    International Nuclear Information System (INIS)

    Kraftmakher, Yaakov

    2012-01-01

    Nearly two centuries ago, Fourier discovered that any periodic function of period T can be presented as a sum of sine waveforms of frequencies equal to an integer times the fundamental frequency ω = 2π/T (Fourier's series). It is impossible to overestimate the importance of Fourier's discovery, and all physics or engineering students should be familiar with this subject. A suitable device for demonstrating spectra of electrical signals is a digital storage oscilloscope. Spectra of various waveforms and of AM and FM signals are demonstrated, as well as AM signals from a broadcasting station. Changes in the signals filtered by frequency-selective circuits are seen by comparing the spectra of the input and output voltages. All the experiments are suitable for undergraduate laboratories and usable as classroom demonstrations. (paper)

  16. What Should We Teach Beginners about Solubility and Solubility Products?

    Science.gov (United States)

    Hawkes, Stephen J.

    1998-01-01

    Argues that consideration should be given to whether teaching solubility product calculations is at all useful. Claims that experienced teachers seriously misunderstand and misuse solubility product calculations. (DDR)

  17. Beginn und Dosisanpassung einer intensivierten konventionellen Insulintherapie (ICT beim Erwachsenen

    Directory of Open Access Journals (Sweden)

    Lohr R

    2012-01-01

    Full Text Available Eine intensivierte Insulintherapie (ICT ist die Behandlung der Wahl bei Diabetes mellitus Typ 1 und auch bei vielen Menschen mit insulinpflichtigem Typ-2-Diabetes. Bei Therapiebeginn müssen individuell Insuline ausgewählt und die richtige Dosierung festgelegt werden. Im weiteren Verlauf ist dann die Anpassung der Insulintherapie an besondere Alltagssituationen wie Sport oder akute Erkrankungen vorrangig. Eine gute Patientenschulung und eine gute Zusammenarbeit zwischen Betroffenem und Behandlerteam sind entscheidend, um diese komplizierte Therapie erfolgreich umzusetzen.

  18. Imaging for primary hyperparathyroidism -- what beginners should know

    Energy Technology Data Exchange (ETDEWEB)

    Ahuja, A.T. E-mail: aniltahuja@cuhk.edu.hk; Wong, K.T.; Ching, A.S.C.; Fung, M.K.; Lau, J.Y.W.; Yuen, E.H.Y.; King, A.D

    2004-11-01

    For patients with primary hyperparathyroidism surgical removal of the hyperfunctioning parathyroid gland is curative. With advances in minimally invasive surgery, accurate pre-operative localization of the hyperfunctioning parathyroid tissue is essential to aid successful surgical treatment. The onus of identifying this hyperfunctioning parathyroid tissue therefore falls on imaging techniques such as high-resolution ultrasound, radionuclide imaging, computed tomography and magnetic resonance imaging. This article is not an exhaustive review, and its main aim is to familiarize the general radiologist, trainee radiologists and clinicians with the basics of various imaging techniques and their roles in practical management of patients with primary hyperparathyroidism.

  19. Flight Physics for Beginners: Simple Examples of Applying Newton's Laws

    Science.gov (United States)

    Spathopoulos, Vassilis

    2011-01-01

    Educators are constantly trying to find new ways of motivating their students. In subjects such as mechanics with a strong mathematical component, it is particularly important to devise real-life examples that can increase interest and student excitement. Aircraft flight is a topic that most young people find exciting. It therefore would seem…

  20. Smart Cards 101: Everything a Beginner Needs To Get Started.

    Science.gov (United States)

    Wiens, Janet

    2001-01-01

    Discusses how to implement a smart card system at a college or university, and explains what smart cards are, their potential applications, benefits, and costs. Provides a resource for obtaining additional information about smart cards. (GR)

  1. jQuery 2.0 animation techniques beginner's guide

    CERN Document Server

    Culpepper, Adam

    2013-01-01

    This book is a guide to help you create attractive web page animations using jQuery. Written in a friendly and engaging approach this book is designed to be placed alongside your computer as a mentor.If you are a web designer or a frontend developer or if you want to learn how to animate the user interface of your web applications with jQuery, this book is for you. Experience with jQuery or Javascript would be helpful but solid knowledge base of HTML and CSS is assumed.

  2. Teaching ESL Beginners Metacognitive Writing Strategies through Multimedia Software

    Science.gov (United States)

    Wei, Jing; Chen, Julian Chengchiang; Adawu, Anthony

    2014-01-01

    This case study explores how strategy-based instruction (SBI), assisted by multimedia software, can be incorporated to teach beginning-level ESL learners metacognitive writing strategies. Two beginning-level adult learners participated in a 10-session SBI on planning and organizing strategies. The Cognitive Academic Language Learning Approach…

  3. Microsoft SQL Server 2014 Business Intelligence development beginner's guide

    CERN Document Server

    Rad, Reza

    2014-01-01

    Written in an easy-to-follow, example-driven format, there are plenty of step-by-step instructions to help get you started! The book has a friendly approach, with the opportunity to learn by experimenting.If you are a BI and Data Warehouse developer new to Microsoft Business Intelligence, and looking to get a good understanding of the different components of Microsoft SQL Server for Business Intelligence, this book is for you.It's assumed that you will have some experience in databases systems and T-SQL. This book is will give you a good upshot view of each component and scenarios featuring th

  4. Review: Ways of teaching struggling reading students, and beginners

    African Journals Online (AJOL)

    International Journal of Pedagogy, Policy and ICT in Education. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 2, No 1 (2012) >. Log in or Register to get access to full text downloads.

  5. First French reader a beginner's dual-language book

    CERN Document Server

    Appelbaum, Stanley

    2008-01-01

    This excellent anthology offers the beginning French-language student a first taste of some of the world's most significant prose. Chosen for both their eloquence and ease of reading, excerpts from such masterpieces as Les Misérables, The Red and the Black, Madame Bovary, Carmen, and The Three Musketeers will open new worlds for linguists. Readers will savor the words of fifty great writers of multiple genres from the seventeenth through twentieth centuries, including Voltaire, Rousseau, Balzac, Baudelaire, Dumas, Proust, and other literary virtuosos.Lucid and accessible, the unabridged Englis

  6. Blend for visual studio 2012 by example beginner's guide

    CERN Document Server

    Shukla, Abhishek

    2015-01-01

    This book is aimed at developers and designers who are new to Blend and looking to learn Blend, not just practically, but also conceptually. This book does not assume any knowledge about Blend on the part of developers; however, some experience in design or development might be useful in understanding the concepts faster, but this book explains everything very simply so that you are able to understand everything with little or no effort.

  7. A beginner's guide to nutritional profiling in physiology and ecology.

    Science.gov (United States)

    Frost, Paul C; Song, Keunyea; Wagner, Nicole D

    2014-11-01

    The nutritional history of an organism is often difficult to ascertain. Nonetheless, this information on past diet can be particularly important when explaining the role of nutrition in physiological responses and ecological dynamics. One approach to infer the past dietary history of an individual is through characterization of its nutritional phenotype, an interrelated set of molecular and physiological properties that are sensitive to dietary stress. Comparisons of nutritional phenotypes between a study organism and reference phenotypes have the potential to provide insight into the type and intensity of past dietary constraints. Here, we describe this process of nutritional profiling for ecophysiological research in which a suite of molecular and physiological responses are cataloged for animals experiencing known types and intensities of dietary stress and are quantitatively compared with those of unknown individuals. We supplement this delineation of the process of nutritional profiling with a first-order analysis of its sensitivity to the number of response variables in the reference database, their responsiveness to diet, and the size of reference populations. In doing so, we demonstrate the considerable promise this approach has to transform future studies of nutrition by its ability to provide more and better information on responses to dietary stress in animals and their populations. © The Author 2014. Published by Oxford University Press on behalf of the Society for Integrative and Comparative Biology. All rights reserved. For permissions please email: journals.permissions@oup.com.

  8. PrestaShop 1.5 beginner's guide

    CERN Document Server

    Caro, Jose Antonio Tizon

    2013-01-01

    This book is written in a friendly voice with lots of tips, tricks, and screenshots to help you set up, extend, and personalize your own online shop. If you want to start your own e-commerce business, then this book will help you do that.This book is for people who are interested in creating an online shop. Basic HTML and CSS skills would be beneficial but are not required as we will provide you with all the code and know-how you need.

  9. PHP and MongoDB Web Development Beginner's Guide

    CERN Document Server

    Islam, Rubayeet

    2011-01-01

    The book follows a "Code first, explain later" approach, using practical examples in PHP to demonstrate unique features of MongoDB. This book is packed with step-by-step instructions and practical examples, along with challenges to test and improve your knowledge. This book assumes that you are experienced in web application development using PHP, HTML, and CSS. Having working knowledge of using a relational database system such as MySQL will help you grasp some of the concepts quicker, but it is not strictly mandatory. No prior knowledge of MongoDB is required.

  10. Albert Einstein for beginners. 12. enl. and rev. ed.

    International Nuclear Information System (INIS)

    Karamanolis, Stratis

    2008-01-01

    He was called the most important jew since the birth of Christus. Others however believed however he has came like no other nearer to the gods. Thought is Albrt Einstein, the scientific work of him and especially his relativity theory has the world changed radically both in scientific and in political regard. The present 12th extended and strongly revised edition of the book, which came out firstly above 20 years ago and until today thousands of readers - young and old - has always enthused, describes not only the relativity theory but also the role, which Einstein played in the development of the first atomic bomb. A short biographical part mediates to the reader also something about the man Einstein

  11. Repeating Input-Based Tasks with Young Beginner Learners

    Science.gov (United States)

    Shintani, Natsuko

    2012-01-01

    The study reported in this article investigated task-repetition with young Japanese children. Fifteen children with no prior knowledge of English completed a communicative listening task that was designed to introduce new vocabulary. The same task was repeated nine times over five weeks. In line with Allwright's (1984) claim that "interaction…

  12. The Use of Communication Strategies in the Beginner EFL Classroom

    Science.gov (United States)

    Rodríguez Cervantes, Carmen A.; Roux Rodriguez, Ruth

    2012-01-01

    When language learners do not know how to say a word in English, they can communicate effectively by using their hands, imitating sounds, inventing new words, or describing what they mean. These ways of communicating are communication strategies (CSs). EFL teachers are not always aware of the importance of teaching communication strategies to…

  13. Practical guide to ICP-MS: a tutorial for beginners

    National Research Council Canada - National Science Library

    Thomas, Robert

    2013-01-01

    ... for those with limited knowledge of the technique. Written by an insider with more than 20 years experience in product development, customer support, and technical marketing for an ICP-MS instrument vendor, the book highlights this powerful ultra...

  14. WS-BPEL 2.0 beginner's guide

    CERN Document Server

    Juric, Matjaz B

    2014-01-01

    If you are a software architect, a designer, a software developer, an SOA and BPM architect, a project manager, or a business process analyst who is responsible for the design and development of business processes, composite applications, and BPM/SOA solutions, then this book is for you. You should have a clear grasp of general SOA concepts including business processes and web services, but no prior knowledge of the BPEL language is required.

  15. Google SketchUp for Game Design Beginner's Guide

    CERN Document Server

    de Jongh, Robin

    2011-01-01

    The book takes a clear, step-by-step approach to building a complete game level using SketchUp with many props and textures. This book is designed for anyone who wants to create entire 3D worlds in freely available game engines such as Unity 3D, CryEngine, Ogre, Panda3D, Unreal Engine, and Blender Game Engine. It also targets all those who wish to create new levels and assets to sell in game asset stores or use in visualization or animation.

  16. Formative value of descriptive grades in mathematics instruction for beginners

    Directory of Open Access Journals (Sweden)

    Đelić Jasmina

    2016-01-01

    Full Text Available Descriptive grading has been implemented in the first grade of primary school in the Republic of Serbia from 2003. The monitoring of this system novelty has been absent since research community most often dealt with teachers’ attitudes and their self-evaluation of the competences for descriptive grading. This form of grading, which stems from the social constructivist paradigm, is observed as the trigger of development of the formative approach in assessment, which has been in the focus of theoreticians and practitioners in the past thirty years, especially in the United States of America and Great Britain. The method of content analysis was applied to 316 descriptive grades in mathematics given to first grade primary students. The quality of three key elements was assessed: the description of academic achievement, the description of students’ engagement and the recommendations to achieve further progress, as well as the balance of quality between the elements of the same descriptive grade. Research results have shown that descriptive grades mostly lack the necessary formative capacity. This means that the majority of students this sample of grades was prepared for did not receive quality and comprehensive feedback, which would be conducive for their further education. Formative assessment, as one of the implications of the constructivist theoretical grounding, demands a high level of development of teacher competences for monitoring the progress and assessing the students, which has not been confirmed in the present research.

  17. Normalizing Social Networking in a Beginners' Japanese Course

    Science.gov (United States)

    Morofushi, Mari; Pasfield-Neofitou, Sarah Ellen

    2014-01-01

    With the spread of the Internet, students now have greater opportunities to use Japanese outside of the classroom. For example, they can interact with other Japanese speakers through instant messaging or social networking, or utilize online dictionaries and translation tools to decipher websites in ways that would be impossible with traditional…

  18. ESL for Hotel/Hospitality Industry. Level: Beginner.

    Science.gov (United States)

    Western Suffolk County Board of Cooperative Educational Services, Northport, NY.

    This document contains eight lesson plans for a beginning course in work-related English for non-English or limited-English speaking entry-level employees in the hotel and hospitality industry. Course objectives include the following: helping participants understand and use job-specific vocabulary; receive and understand job-related instructions;…

  19. Getting started in radio astronomy beginner projects for the amateur

    CERN Document Server

    Arnold, Steven

    2013-01-01

    Radio astronomy is a mystery to the majority of amateur astronomers, yet it is the best subject to turn to when desirous of an expanded knowledge of the sky. This guide intends to instruct complete newcomers to radio astronomy, and provides help for the first steps on the road towards the study of this fascinating subject. In addition to a history of the science behind the pursuit, directions are included for four easy-to-build projects, based around long-term NASA and Stanford Solar Center projects. The first three projects constitute self-contained units available as kits, so there is no nee

  20. The Beginner’s Guide to Nation-Building

    Science.gov (United States)

    2007-01-01

    Front in El Salvador, the Resistencia Nacional Moçambicana in Mozambique, and the Khmer Rouge in Cambodia. These programs have met with mixed success...Remedial educational programs, 147 Remote sensing systems, 32 Representative institutions, structuring, 190–191, 195–198 Resistance, 15 Resistencia

  1. Nuclear Fusion Project. Annual report of the Association KfK/EURATOM

    International Nuclear Information System (INIS)

    Kast, G.

    1991-10-01

    Report on the technology program for NET: Plasma facing components magnets, tritium fuel cycle, basic blanket, remote handling and maintenance, safety and environment, solid breeder and liquid metal test blankets, mechanical properties of pre- and post-irradiation of 1.4914 steel (MANET). ECRH power sources, NET study contracts. (orig.)

  2. KfK Laboratory for Isotope Technology. Progress report on research and development activities in 1990

    International Nuclear Information System (INIS)

    1991-03-01

    The R and D work done by the laboratory for isotope technology (LIT) in 1990 under the project of pollutant control in the environment, concentrated on thermal waste treatment processes, above all on the classical refuse incineration, for which closed-circuit pollutant balances were established, and process engineering studies were made aimed at reducing pollutants in waste gas. The central research facility of the LIT is the semi-technical pilot plant TAMARA (test plant for refuse incineration, waste gas purification, residue recycling, waste water treatment) with a throughput of 200 kg/hour of refuse. It was put into operation in 1986. The annex lists the publications by the LIT staff. (BBR) [de

  3. Nuclear Fusion Project. Semi-annual report of the Association KfK/EURATOM

    International Nuclear Information System (INIS)

    Kast, G.

    1988-10-01

    Report on technology tasks: Blanket designs studies; Computational tools for neutronics; Corrosion and fatigue of structural materials in Pb-17Li; Tritium extraction from liquid Pb-17Li by the use of solid getters; Development of ceramic breeder materials; The large coil task; Development of high field composite conductors; Superconducting poloidal field coil development; Poloidal field coil for TORE SUPRA as NET-Prototype Coil; Structural materials Fatigue characterization at 4 K; Low electrical conductivity structures development; MANET 1; Pre- and post-irradiation fatigue properties and fracture toughness of 1.4914 martensitic steel; In-pile creep-fatigue testing of type 316 and 1.4914 steels; Ceramics for first-wall protection and for RF windows; Development of low activation ferritic-martensitic steels; Design study of plasma facing components and shield; Procedures and tools for structural design evaluation; Theory and tools for evaluation of magnetic field effects on liquid-metal breeder blankets; Studies of pebble beds of ceramic compounds; Background studies on remote maintenance; Handling equipment for in-vessel components; Safety aspects of the cryosystem and superconducting magnets; Overall plant accident scenarios and safety guidelines for NET; Generic environmental impact assessment for a fusion facility; Industrial development of large components for plasma exhaust pumping; Optimization of cryogenic vacuum pumping of helium; Plasma exhaust purification by means of cryosorption on molecular-sieves or alternative absorbents and use of hot-metal getters; Adsorption of DT on heated metal beds other than uranium; Catalyst development for the exhaust purification process; Development of ECRH power sources. NET study contracts: Availability of the LCT plant; Investigation of the vacuum and exhaust performation of NET; Study about the NET TF pancake test; Evaluation of crack growth delay in multilayer sheets. (orig./AH)

  4. KfK, Institute for Reactor Components. Results of research and development activities in 1989

    International Nuclear Information System (INIS)

    1990-03-01

    R and D activities at IRB (Institut fuer Reaktorbauelemente - Institute for Reactor Components) are dedicated to thermodynamics and fluid dynamics. Emphasis is on the design of nuclear reactor and fusion reactor components. Environmental engineering was added recently. Most activities are applications-oriented. Fundamental investigations focus on energy research and energy technology. The activities are carried out in the framework of different projects (PKF/nuclear fusion, PSF/nuclear safety, PSU/pollution control). Points of main effort are the development of basic liquid-metal-cooled blanket solutions, investigations on natural convection in reactor tanks, and the cooling properties of future containments for pressurized water reactors in the case of nuclear fusion accidents. (orig./GL) [de

  5. Nuclear fusion project. Annual report of the Association KfK/EURATOM. October 1992 - September 1993

    International Nuclear Information System (INIS)

    Kast, G.

    1993-12-01

    The central areas of work are: 1) Structural materials, plasma forming components, plasma engineering; 2) superconducting magnets; 3) vacuum systems; 4) basic blanket; 5) remote handling and maintenance; 6) safety and environment; 7) material development, mechanical properties of pre- and post-irradiation of MANET (steel 1.4914); 8) solid breeder and liquid metal test blankets; 9) ECRH power sources; 10) TRT-1=tritium supply and management; 11) study contracts for ITER/NET. (HP)

  6. Production of ethanol from kitchen waste by using flocculating Saccharomyces cerevisiae KF-7.

    Science.gov (United States)

    Wang, Yan-Fang; Tan, Li; Wang, Ting; Sun, Zhao-Yong; Tang, Yue-Qin; Kida, Kenji

    2017-02-01

    Kitchen waste is rich in carbohydrates and can potentially serve as feedstock for ethanol production. Starch was the primary carbohydrate in kitchen waste obtained from the canteen in the Sichuan University, which was used to evaluate long-term ethanol fermentation performance in this study. The optimal conditions for liquefaction and saccharification of the kitchen waste were as follows: adding α-amylase at 0.3 μL/g glucan for liquefaction at 90°C for 30 min, and adding glucoamylase at 4 μL/g glucan for saccharification at 50°C. Glucose yield obtained under the optimal conditions was over 80%. Addition of cellulase did not enhance glucose yield, but decreased the viscosity of the saccharified slurry. Repeated-batch presaccharification followed by simultaneous saccharification and fermentation of 20 batches was successfully carried out at an aeration of 0.1 vvm. Ethanol concentration of 43.9-45.0 g/L was achieved, corresponding to ethanol yield and productivity of 88.9-91.2% and 3.3-3.5 g/L/h, respectively, and the CO 2 /ethanol molar ratio was approximately 1. Continuous PSSF was stably carried out at a dilution rate of ≤0.3 h -1 . Productivity was 11.5 g/L/h at a dilution rate of 0.3 h -1 . Ethanol concentration and yield were 42.0 g/L and 82.8% at a dilution rate of 0.2 h -1 , respectively.

  7. Synthesis of polyhedral phenylsilsesquioxanes with KF as the source of the fluoride ion.

    Science.gov (United States)

    Kozelj, Matjaz; Orel, Boris

    2008-10-07

    An alternative method for the preparation of polyhedral phenylsilsesquioxanes is reported. Phenylsilsesquioxane resin and freshly hydrolysed phenyltrimethoxysilane was refluxed with various phase-transfer catalysts and potassium fluoride in toluene yielding octaphenylsilsesquioxane, or in a mixture of THF and ethanol yielding dodecaphenylsilsesquioxane.

  8. Hypercapnic acidosis attenuates pressure-dependent increase in whole-lung filtration coefficient (Kf).

    Science.gov (United States)

    Bommakanti, Nikhil; Isbatan, Ayman; Bavishi, Avni; Dharmavaram, Gourisree; Chignalia, Andreia Z; Dull, Randal O

    2017-01-01

    Hypercapnic acidosis (HCA) has beneficial effects in experimental models of lung injury by attenuating inflammation and decreasing pulmonary edema. However, HCA increases pulmonary vascular pressure that will increase fluid filtration and worsen edema development. To reconcile these disparate effects, we tested the hypothesis that HCA inhibits endothelial mechanotransduction and protects against pressure-dependent increases in the whole lung filtration coefficient (K f ). Isolated perfused rat lung preparation was used to measure whole lung filtration coefficient (K f ) at two levels of left atrial pressure (P LA  = 7.5 versus 15 cm H 2 O) and at low tidal volume (LV t ) versus standard tidal volume (STV t ) ventilation. The ratio of K f2 /K f1 was used as the index of whole lung permeability. Double occlusion pressure, pulmonary artery pressure, pulmonary capillary pressures, and zonal characteristics (ZC) were measured to assess effects of HCA on hemodynamics and their relationship to K f2 /K f1 . An increase in P LA2 from 7.5 to 15 cm H 2 O resulted in a 4.9-fold increase in K f2 /K f1 during LV t and a 4.8-fold increase during STV t . During LV t , HCA reduced K f2 /K f1 by 2.7-fold and reduced STV t K f2 /K f1 by 5.2-fold. Analysis of pulmonary hemodynamics revealed no significant differences in filtration forces in response to HCA. HCA interferes with lung vascular mechanotransduction and prevents pressure-dependent increases in whole lung filtration coefficient. These results contribute to a further understanding of the lung protective effects of HCA.

  9. KF/Clinoptilolite: an efficient promoter for the synthesis of thioethers.

    Science.gov (United States)

    Salmanpour, Sadegh; Khalilzadeh, Mohammad A; Hosseini, Abolfazl

    2013-06-01

    Potassium fluoride impregnated on natural zeolite as a new solid base system effectively catalyzes the coupling of thiophenols with electron-deficient fluoro-, chloro- and bromo-arenes in DMSO. This versatile and efficient solid base has been demonstrated to afford the corresponding desired products in good to excellent yields. This procedure provides a convenient, efficient and practical method for the preparation of diaryl thioethers.

  10. Antimicrobial activities of the Streptomyces ceolicolor strain AOB KF977550 isolated from a tropical estuary

    Directory of Open Access Journals (Sweden)

    Bamidele T. Odumosu

    2017-11-01

    Full Text Available The aim of this study was to screen for important antibiotic producing species of the genus Streptomyces from a tropical estuary. Five bacterial strains were isolated from the Lagos lagoon and identified by 16S rDNA gene sequencing as Streptomyces albogriseolus, S. aureus, S. coelicolor, S. albus, and S. pseudogriseolus. Ethyl acetate extracts of Streptomyces spp. fermented broths were evaluated against laboratory strains of MRSA Methicillin-resistant Staphyloccus aureus (MRSA 144 m, Bacillus coagulans UL001, and Escherichia coli as well as the standard strains Klebsiella pneumonia ATCC 8308, Gardnerella vaginalis ATCC 27853 and Salmonella typhi ATCC 13311 using the well diffusion method. The presence of secondary metabolites was determined and analysed using gas chromatography-mass spectrometry (GC-MS. A broad spectrum of activity was only observed for S. coelicolor on all of the tested bacteria except S. typhi, ant GC-MS analysis revealed the presence of 16 secondary metabolites with relevant antibiotic properties. The result of this study suggest that Lagos Lagoon is a potential source and reservoir of novel antibiotics. Keywords: Streptomyces, Antibiotics, Resistance, Secondary Metabolites

  11. Progress report on research and development in 1991, Institute of Nuclear Physics, KfK

    International Nuclear Information System (INIS)

    1992-03-01

    Progress report on research and development in 1991 Institute of Nuclear Physics. Within the framework of the KASCADE project to study air showers of cosmic radiation, a comprehensive detector field (array) and the central calorimeter have been developed and built. One of the working groups deals with neutrino physics at the spallation neutron source ISIS of the Rutherford Appleton Laboratory in England. By means of the detector system KARMEN I, measurements are made in relation with neutrino oscillation, neutrino-core scattering, and neutrino-electron scattering. Nuclear physics activities mainly deal with experiments on nuclear astrophysics. To that effect, cross sections of neutron capture processes are measured in order to clarify the process of element transformation in stars. Other experiments use laser-spectroscopic methods to determine nuclear radii and moments of short-lived radioactive atoms. For the project 'Reprocessing and Waste Treatment' measuring instruments have been developed by which the isotopic composition and concentration of fissionable materials can be determined very precisely and quickly. (orig./DG) [de

  12. Progress report on research and development in 1993, Institute of Nuclear Physics, KfK

    International Nuclear Information System (INIS)

    1994-03-01

    Within the framework of the KASCADE project to study air showers of cosmic radiation, a comprehensive detector field (array) and the central calorimeter have been developed and built. One of the working groups deals with neutrino physics at the spallation neutronsource ISIS of the Rutherford Appleton Laboratory in England. By means of the detector system KARMEN I, measurements are made in relation with neutrino oscillation, neutrino-core scattering and neutrino-electron scattering. Nuclear physics activities mainly deal with experiments on nuclear astrophysics. To that effect cross sections of neutron capture processes are measured in order to clarify the process of element transformation in stars. (orig.) [de

  13. KfK, Institute for Radiochemistry. Report on the results of research and development performances 1989

    International Nuclear Information System (INIS)

    1990-03-01

    In 1989 the Institute for Radiochemistry became involved with research and development tasks in the context of the following projects: 'Reprocessing and Waste Treatment' (PWA), 'Fast Breeder' (PSB), 'Nuclear Fusion' (PKF) and 'Terminal Storage' (ELA). Environmental analysis and water technology within the Institute were amongst the programmes collected together in the project 'Environment and Safety'. Problems to do with surface chemistry and analysis were dealt with under 'Microtechnology'. Within the 'Reprocessing and Waste Treatment Project', the studies carried out in the Institute concentrated chiefly on investigating ways of simplifying the reprocessing process, especially in the reprocessing of fast-breeder fuels and waste reduction and treatment. In the 'Fast Breeder' project, further investigations were carried out on oxide fuel rods. In the 'Nuclear Fusion' project, the subject of investigation was chemical problems in the field of tritium technology as they arise during the recovery of tritium from tritium compounds in the internal or external fuel cycle of a fusion reactor. To this end, studies were carried out on the physical-chemical analysis of ceramic breeder materials. Research were carried out on the analysis and description of surfaces and on the reactions occurring on these surfaces and on the reactions occurring on these surfaces with regard to the application of knowledge gained from this programme to problems within environmental research, nuclear technology and microtechnology. The Water Chemistry Department working mainly on 'Environment and Safety' carried out chemical research and method development in the following subject areas: New technologies for the removal of problem constituents from water, the production of useable water and sewage recycling and the analysis and description of water pollutants. (orig./HK) [de

  14. Nuclear fusion project. Annual report of the Association KfK/EURATOM

    International Nuclear Information System (INIS)

    Kast, G.

    1990-09-01

    Report on the technology program for NET: Plasma facing components, magnets, tritium fuel cycle, basic blanket, remote handling and maintenance, safety and environment, solid breeder and liquid metal test blankets, mechanical properties of pre- and post-irradiation of 1.4914 steel (MANET). ECRH power sources, NET study contracts. (HP)

  15. Nuclear fusion project. Semi-annual report of the Association KfK/Euratom

    International Nuclear Information System (INIS)

    Kast, G.

    1989-11-01

    Report on the technology program for NET: Plasma facing components, magnets, tritium fuel cycle, basic blanket, remote handling and maintenance, safety and environment, solid breeder and liquid metal test blankets, mechanical properties of pre- and post-irradiation of 1.4914 steel (MANET), ECRH power sources, NET study contracts. (HP)

  16. TERSE-KF: Event-Trigger Diffusion Kalman Filter with Application to Localization and Time Synchronization

    OpenAIRE

    Alanwar, Amr; Chang, Tsang-Kai; Srivastava, Mani; Mehta, Ankur

    2017-01-01

    The performance of a distributed network state estimation problem depends strongly on collaborative signal processing, which often involves excessive communication and computation overheads on a resource-constrained sensor node. In this work, we approach the distributed estimation problem from the viewpoint of sensor networks to design a more efficient algorithm with reduced overheads, while still achieving the required performance bounds on the results. We propose an event-trigger diffusion ...

  17. A probabilistic parametrization for geological uncertainty estimation using the ensemble Kalman filter (EnKF)

    NARCIS (Netherlands)

    Sebacher, B.; Hanea, R.G.; Heemink, A.

    2013-01-01

    In the past years, many applications of historymatching methods in general and ensemble Kalman filter in particular have been proposed, especially in order to estimate fields that provide uncertainty in the stochastic process defined by the dynamical system of hydrocarbon recovery. Such fields can

  18. User and reference manual for the KfK code INS

    International Nuclear Information System (INIS)

    Daum, E.

    1993-09-01

    The INS code (Intense Neutron Source) serves to calculate uncollided neutron flux contours, neutron flux volumes and spatial-dependent neutron flux spectra in the test cell of an intense neutron source, of the t-H 2 O or d-Li concept. With the information of the neutron flux spectra the neutron irradiation damage like displacements per atom (DPA), H- and He-production rates and the generation of foreign elements by transmutations can be calculated for any element at any position in the test cell. This manual gives an introduction into the theory of neutron flux calculation of thick targets and neutron irradiation damage calculations. It is explained how the code is working and the handling of the input and output parameters. For each application of the several code modules an example is given. The results like contours, spectra, flux volumes and damage rates are summarized in tabular form and graphically. Damage and element transmutation data have been calculated for 23 isotopes and compared with the DEMO 1st wall values. (orig./HP) [de

  19. KfK, Institute of Hot Chemistry. Progress report on research and development activities in 1990

    International Nuclear Information System (INIS)

    1991-03-01

    The activities undertaken by the hot chemistry laboratory (IHCH) in 1990 under the following projects are presented: (1) Radioactive waste management (basic work on reprocessing technologies); (2) pollutant control in the environment (communal waste management, water and soil, system analysis and environmental analytics, emission-reducing processes); (3) solid-state and materials testing (chemistry of materials research); (4) nuclear and particle physics (neutrino and particle physics); (5) other research projects (institute-related non-sponsored research). In the annex the publications by the IHCH staff are listed. (BBR) [de

  20. A Carrier Estimation Method Based on MLE and KF for Weak GNSS Signals.

    Science.gov (United States)

    Zhang, Hongyang; Xu, Luping; Yan, Bo; Zhang, Hua; Luo, Liyan

    2017-06-22

    Maximum likelihood estimation (MLE) has been researched for some acquisition and tracking applications of global navigation satellite system (GNSS) receivers and shows high performance. However, all current methods are derived and operated based on the sampling data, which results in a large computation burden. This paper proposes a low-complexity MLE carrier tracking loop for weak GNSS signals which processes the coherent integration results instead of the sampling data. First, the cost function of the MLE of signal parameters such as signal amplitude, carrier phase, and Doppler frequency are used to derive a MLE discriminator function. The optimal value of the cost function is searched by an efficient Levenberg-Marquardt (LM) method iteratively. Its performance including Cramér-Rao bound (CRB), dynamic characteristics and computation burden are analyzed by numerical techniques. Second, an adaptive Kalman filter is designed for the MLE discriminator to obtain smooth estimates of carrier phase and frequency. The performance of the proposed loop, in terms of sensitivity, accuracy and bit error rate, is compared with conventional methods by Monte Carlo (MC) simulations both in pedestrian-level and vehicle-level dynamic circumstances. Finally, an optimal loop which combines the proposed method and conventional method is designed to achieve the optimal performance both in weak and strong signal circumstances.

  1. Progress report on research and development in 1991, Institute of Reactor Development, KfK

    International Nuclear Information System (INIS)

    1992-03-01

    Progress report on research and development in 1991 Institute of Reactor Development. The papers on nuclear fusion concentrate on the design and material selection for highly stressed components as well as on safety matters. Experiments with the thermomechanical behaviour of different material samples continued, with selected materials being put to a load of up to 10 000 cycles. Carbon fiber reinforced composite materials proved to be very stable as regards their form, and unproblematic from a thermomechanical viewpoint, even at high cycle numbers. The papers on handling techniques refer to specific requirements of nuclear fusion with applications at JET and NET, to the development of system solutions to be used in the classical industrial area, and to standardization accompanying the developments. The system for physical simulation of working scenes was refined and extended by models for the prototype of a testing device to be handled in the torus of a fusion machine. Control of the articulated boom has been further improved. Under the nuclear safety research project, studies have been made of the dynamic behaviour of fast reactors under incident conditions, of the possible propagation of local cooling incidents in the reactor core as well as of core monitoring. The further development of physical models and computer programs on the dynamic behaviour of fast sodium-cooled reactors has been supported by experimental results. (orig./DG) [de

  2. KfK, Institute for Reactor Development. Results of research and development activities in 1990

    International Nuclear Information System (INIS)

    1991-03-01

    R and D activities at IRE (Institut fuer Reaktorentwicklung-Institute for Reactor Development) are dedicated to power engineering and handling processes in the framework of the point-of-main-effort projects 'nuclear fusion', 'solid-state and materials research', 'handling', 'nuclear safety' and 'miscellaneous research'. Nuclear fusion contributions deal with special vacuum system design problems, heavy-duty design and materials selection and safety aspects. Specimens from 30 different carbon-based materials were subjected to comparative tests in a plasma spraying plant. In the framework of solid-state and materials research activities a viscoplastic model for mechanical component analysis was investigated for its compatibility with elementary physical laws under complex loads. The handling project was dedicated to the specific requirements of nuclear fusion with regard to JET and NET uses, the development of system solutions for flexible industrial techniques, and to standardization. A study on the control system of a work station for NET remote handling tasks was completed. In the framework of the nuclear safety project one currently investigates the dynamics of fast reactors under failure conditions, the possible propagation of local cooling failures in the reactor core, and core monitoring problems. (orig./GL) [de

  3. Using SPSS syntax: a beginner's guide Jacqueline Collier Using SPSS syntax: a beginner's guide Sage Pages: 216 £24.99 9781412922180 1412922186 [Formula: see text].

    Science.gov (United States)

    2011-01-21

    As someone who is comfortable with analysing data in SAS using coding language, it is perplexing that I run from the use of syntax in SPSS. But, my apprehension has subsided with the Collier's guide. Syntax command can automate processes, increase reproducibility and give the user broader access to features otherwise unavailable in SPSS.

  4. Big Ears. A beginners introduction to GRACES. An elementary approach to running the system. Version 1

    International Nuclear Information System (INIS)

    Haskell, P.

    1978-10-01

    An introduction to GRACES (GEC/Rutherford Accelerator Control Executive System), which is a system for controlling the SNS accelerator, is presented. The word GRACES includes both the program running in the computer and the GRACES language used to communicate with the program. (U.K.)

  5. Employment and First Year Experience of Beginner Primary School Teachers at Private Educational Institutions

    Directory of Open Access Journals (Sweden)

    Turgay ÖNTAŞ

    2016-10-01

    Full Text Available In this study to demonstrate primary school teachers' employment process and their first year teaching in private educational organizations is aimed. The major employer of primary school teachers is public schools that are funded by state. There will be a gap between grade inflation and employment rate when all of the teacher candidates claim to be appointed to public schools. Hence private educational organizations provide alternative career opportunities for teacher candidates. Qualitative methods will be used in this study to display real evidence from the eyes of teachers and also principals. The data have been obtained through documents and interview techniques. After the data have been collected, descriptive analysis has been used. The findings of the study were given within the frame of themes and codes which were determined based on the problem statement. The first theme, career was presented in the context of choosing sector, recruitment and selecting process, professional development, leave the profession. The second theme, factors affecting first years' success was explained in the context of teaching factors, consistency and skills focus. The third theme was presented in a category of pressure, workload, complaining psychological and physical exhaustion, flexible working conditions.

  6. Beginners on Stage: Arendt, Natality and the Appearance of Children in Contemporary Performance

    OpenAIRE

    Senior, A

    2016-01-01

    This paper examines the complex questions that arise around the appearance of children in contemporary performance. Drawing on performances by Nottingham-based theatre company Zoo Indigo and Tim Etchells and the Flemish theatre company Victoria, I consider the extent to which Hannah Arendt’s theorisation of natality as ‘the new beginning inherent in birth’ that gives rise to the political potential to ‘begin something anew’ can help us to understand the ethico-political dimensions of children...

  7. Making Sense of Online Learning: A Guide for Beginners and the Truly Skeptical

    Directory of Open Access Journals (Sweden)

    Ugur DEMIRAY

    2004-10-01

    Full Text Available TABLE OF CONTENTS Author Information List of Tables and Figures INTRODUCTION: GETTING THE MOST FROM THIS RESOURCE Who Should Read This Book? Who Should Not Read This Book? Who Are the Authors? How Is This Book Organized? Frequently Asked Questions (FAQ 1. TAKING THE LEAP What Is Online Learning? Where Has Online Learning Come from and Where Is It Going? When Does Using Technology for Learning Make Sense? How Can I Tell Whether My Organization Is Ready? What Is Good Online Learning? What Skills Do I Need? How Do I Stay Sane? Resources. 2. WHAT ABOUT LEARNING? What Is Learning? What Is Instruction? What Activities Should Be Included in Instruction? How Do I Select Interactions and Activities? Conclusion. 3. THE LANGUAGE OF ONLINE LEARNING: HOW TO SPELL HTML How to Speak the Right Language. What Are the Most Common Terms That Are Misunderstood by Folks New to This Field, and What Do They Mean? New Terms and Technologies. Conclusion. 4. DESIGNING FOR THE WEB Does Traditional Instructional Design Work for Online Learning? How Do I Design with the User in Mind? How Do I Make Things Easy to Find on My Site? How Do I Make Sure the Site Is Easy to Navigate? Conclusion. 5. TOOLS AND TECHNOLOGIES FOR ONLINE LEARNING PART 1: DEVELOPMENT How Do I Build Online Learning? What Are the Most Common Tools Used for Building Online Instructional Materials? What Do I Need to Know to Get Started? What Are Some Technologies I Need to Know About? Conclusion. 6. TOOLS AND TECHNOLOGIES FOR ONLINE LEARNING PART 2: INFRASTRUCTURE What Is Learning Infrastructure? What Tools Can I Use to Track Learners and Courses? What Tools Can I Use to Keep Track of Online Content? What Are Learning Objects, and How Do They Relate to Tracking and Managing Online Content? What Are Learning Standards? Conclusion. 7. EVALUATING ONLINE LEARNING What Is Evaluation? What Aspects of Online Instruction Should I Evaluate? What’s the Difference Between Assessment and Evaluation? How Do You Evaluate a Course or Program? How Can You Evaluate Online Learning? Conclusion. CONCLUSION REFERENCES INDEX ABOUT THE AUTHORS

  8. Neural Networks for Beginners. A fast implementation in Matlab, Torch, TensorFlow

    OpenAIRE

    Giannini, Francesco; Laveglia, Vincenzo; Rossi, Alessandro; Zanca, Dario; Zugarini, Andrea

    2017-01-01

    This report provides an introduction to some Machine Learning tools within the most common development environments. It mainly focuses on practical problems, skipping any theoretical introduction. It is oriented to both students trying to approach Machine Learning and experts looking for new frameworks.

  9. Clean Up Your Image: A Beginner's Guide to Scanning and Photoshop

    Science.gov (United States)

    Stitzer, Michael S.

    2005-01-01

    In this article, the author addresses the key steps of scanning and illustrates the process with screen shots taken from a Macintosh G4 Powerbook computer running OSX and Adobe Photoshop 7.0. After reviewing scanning procedures, the author describes how to use Photoshop 7.0 to manipulate a scanned image. This activity gives students a good general…

  10. Cacti beginner's guide leverage Cacti to design a robust network operations center

    CERN Document Server

    Urban, Thomas

    2017-01-01

    The book is designed in such a way that you can explore it chapter-by-chapter or skip any chapter without missing a beat. If you are a network operator and want to use Cacti for implementing performance measurement for trending, troubleshooting, and reporting purposes, then this book is for you. You only need to know the basics of network ...

  11. "We Are All Beginners": Amazigh in Language Policy and Educational Practice in Morocco

    Science.gov (United States)

    El Aissati, Abderrahman; Karsmakers, Suzanne; Kurvers, Jeanne

    2011-01-01

    In 2003, the Amazigh (Berber) language and the Tifinagh script were, for the first time in history, introduced as a subject for all students in public primary schools in Morocco. This study first investigates the language planning policy behind the introduction of the new Amazigh curriculum: selection, codification, standardization, curriculum…

  12. Constructing a "Fast Protocol" for Middle School Beginner Violin Classes in Japan

    Science.gov (United States)

    Akutsu, Taichi

    2018-01-01

    This study aimed to investigate the process of constructing a "fast-protocol" for violin instruction. Since learning string instruments has not been common, and because there are limited hours for music in Japanese schools, the author, a violinist, collaborated with the general music teacher at a middle school in the Tokyo metropolitan…

  13. Four Points Beginner Risk Managers Should Learn from Jeff Holman's Mistakes in the Discussion of Antifragile

    OpenAIRE

    Nassim Nicholas Taleb

    2014-01-01

    Using Jeff Holman's comments in Quantitative Finance to illustrate 4 critical errors students should learn to avoid: 1) Mistaking tails (4th moment) for volatility (2nd moment), 2) Missing Jensen's Inequality, 3) Analyzing the hedging wihout the underlying, 4) The necessity of a numeraire in finance.

  14. Beginners Remember Orthography when They Learn to Read Words: The Case of Doubled Letters

    Science.gov (United States)

    Wright, Donna-Marie; Ehri, Linnea C.

    2007-01-01

    Sight word learning and memory were studied to clarify how early during development readers process visual letter patterns that are not dictated by phonology, and whether their word learning is influenced by the legality of letter patterns. Forty kindergartners and first graders were taught to read 12 words containing either single consonants…

  15. Observational Learning: Tell Beginners What They Are about to Watch and They Will Learn Better.

    Science.gov (United States)

    Andrieux, Mathieu; Proteau, Luc

    2016-01-01

    Observation aids motor skill learning. When multiple models or different levels of performance are observed, does learning improve when the observer is informed of the performance quality prior to each observation trial or after each trial? We used a knock-down barrier task and asked participants to learn a new relative timing pattern that differed from that naturally emerging from the task constraints (Blandin et al., 1999). Following a physical execution pre-test, the participants observed two models demonstrating different levels of performance and were either informed of this performance prior to or after each observation trial. The results of the physical execution retention tests of the two experiments reported in the present study indicated that informing the observers of the demonstration quality they were about to see aided learning more than when this information was provided after each observation trial. Our results suggest that providing advanced information concerning the quality of the observation may help participants detect errors in the model's performance, which is something that novice participants have difficulty doing, and then learn from these observations.

  16. Introduction to Differential Calculus Systematic Studies with Engineering Applications for Beginners

    CERN Document Server

    Rohde, Ulrich L; Poddar, Ajay K; Ghosh, A K

    2011-01-01

    Enables readers to apply the fundamentals of differential calculus to solve real-life problems in engineering and the physical sciences Introduction to Differential Calculus fully engages readers by presenting the fundamental theories and methods of differential calculus and then showcasing how the discussed concepts can be applied to real-world problems in engineering and the physical sciences. With its easy-to-follow style and accessible explanations, the book sets a solid foundation before advancing to specific calculus methods, demonstrating the connections between differential calculus

  17. A Beginner’s Guide to METAPOST for Creating High-quality Graphics

    Science.gov (United States)

    2016-03-31

    structures and flow control, and compilation of the METAPOST source code yields EPS graphics. These features provide an elegant method for generating...part. METAPOST uses the standard syntax for defining points in the plane, e.g., (x,y) where both x and y are numeric data typed variables. In order to... defined using the color data type. Colors in METAPOST are simply ordered triplets of the form (r,g,b) where r, g, and b are numerics between 0 and 1. These

  18. A kinematic and metabolic analysis of the first Lu of Tai Chi in experts and beginners.

    Science.gov (United States)

    Zorzi, Elena; Nardello, Francesca; Fracasso, Enrico; Franchi, Sara; Clauti, Anna; Cesari, Paola; Zamparo, Paola

    2015-10-01

    The aim of this study was to compare movement kinematics, cocontraction times, and metabolic data in expert and nonexpert Tai Chi practitioners. Significant differences were observed for all kinematic parameters: experts moved smoothly (lower jerk) and with a lower frequency. No differences in metabolic and electromyography data were observed but for the breathing pattern (experts breathed slowly and deeply). Movement frequency and breathing pattern are thus the main features that distinguish expert and nonexpert practitioners.

  19. Early 3 Rs: How To Lead Beginners into Reading, Writing, and Arithme-TALK.

    Science.gov (United States)

    Mountain, Lee

    Directed to teachers, paraprofessionals, parents, and others interested in giving a young child an early start on the 3 Rs, this book provides easy-to-follow instructions for promoting emergent literacy and for teaching reading, writing, and arithmetic from preschool into the primary grades. The progression of content extends from early…

  20. What Do Beginner Biology Teacher Candidates Know of Genetics and Genes?

    Science.gov (United States)

    Oztas, Fulya; Oztas, Haydar

    2016-01-01

    Misconceptions are a barrier to understanding biology hence, to promote meaningful learning, it is necessary to overcome these difficulties with the help of different instructional methods rather than traditional instructional methods. Therefore it could be very interesting to find out "how students' prior knowledge of genetics affects…

  1. Striking the Right Balance: Issues of Transition for the Beginner Secondary Music Teacher

    Science.gov (United States)

    Cyster, Drew

    2012-01-01

    Transition from primary to secondary school in the UK has received considerable attention in educational research over the last few decades, although specific focus on transition in music has only been relatively recently addressed. Research by Mills (1996) and Marshall and Hargreaves (2007, 2008) draws upon both general and music-specific studies…

  2. Reflecting on the Japan-Chile Task-Based Telecollaboration Project for Beginner-Level Learners

    Science.gov (United States)

    Dunne, B. Greg

    2014-01-01

    Using O'Dowd and Ritter's (2006) Inventory of Reasons for Failed Communication in Telecollaborative Projects as a barometer, this article details the considerations and procedures followed in a task-based, asynchronous email telecollaboration project between EFL (English as a Foreign Language) learners in Japan and Chile. In a climate where…

  3. Programming Basics for Beginners. Experience of the Institute of Informatics at Tallinn University of Technology

    Directory of Open Access Journals (Sweden)

    Olga Mironova

    2017-11-01

    Full Text Available The present paper demonstrates the teaching approach in programming basics course for novices: schoolchildren of different ages and schoolteachers. This programming course was developed at the Institute of Informatics at Tallinn University of Technology in Tallinn, Estonia and it based on many years experience in teaching programming for non-IT first year students. The main aim of the chosen teaching approach in the course is to raise the motivation and keep the learners’ interest in programming field on the high level. The idea of developed teaching technique is the implementation of the visual programming before a serious textual coding. Furthermore, authors suggest readers some ways and methods to overcome learners’ difficulties in the first stage in a textual coding.

  4. Introduction to Integral Calculus Systematic Studies with Engineering Applications for Beginners

    CERN Document Server

    Rohde, Ulrich L; Poddar, Ajay K; Ghosh, A K

    2011-01-01

    An accessible introduction to the fundamentals of calculus needed to solve current problems in engineering and the physical sciences I ntegration is an important function of calculus, and Introduction to Integral Calculus combines fundamental concepts with scientific problems to develop intuition and skills for solving mathematical problems related to engineering and the physical sciences. The authors provide a solid introduction to integral calculus and feature applications of integration, solutions of differential equations, and evaluation methods. With logical organization coupled with cle

  5. Die Energiebranche am Beginn der digitalen Transformation: aus Versorgern werden Utilities 4.0

    Science.gov (United States)

    Doleski, Oliver D.

    Die traditionelle Energieversorgung befindet sich in einer Zäsur. Das seit Jahrzehnten bewährte und stabile Geschäftsmodell einer zuverlässig planbaren, zentralen Energieerzeugung mit anschließender unidirektionaler Verteilung geriet spätestens seit der Energiewende des Jahres 2011 immer mehr unter Druck. Angesichts fortschreitender Digitalisierung und Dezentralisierung einerseits und gestiegener Erwartungshaltung der Kunden gegenüber "ihrem" Versorger andererseits sieht sich die Energiebranche heute einem epochalen Transformationsprozess gegenübergestellt. Bei diesem entwickeln sich aus den monopolistischen Versorgern des 19. und 20. Jahrhunderts (Utility 1.0), über die liberalisierten Energieversorgungsunternehmen (Utility 2.0) und Energiedienstleistungsunternehmen (Utility 3.0) heutiger Prägung, die digitalen Energiedienstleistungsunternehmen (Utility 4.0) von morgen. Oliver D. Doleski beschränkt sich in seinem Beitrag nicht auf die reine Beschreibung dieses Veränderungsprozesses an sich. Vielmehr werden darüber hinaus sowohl die mit dieser Entwicklung verbundenen übergeordneten Ziele als auch die wesentlichen Anforderungen an erfolgreiche Utilities 4.0 skizziert. Das Kapitel endet mit einem prägnanten Überblick profitabler Betätigungsfelder, die zur Sicherung der ökonomischen Zukunft von Energiekonzernen, Regionalversorgern und Stadtwerken beitragen können.

  6. Easy robot programming for beginners and kids using augmented reality environments

    Science.gov (United States)

    Sakamoto, Kunio; Nishiguchi, Masahiro

    2010-11-01

    The authors have developed the mobile robot which can be programmed by command and instruction cards. All you have to do is to arrange cards on a table and to shot the programming stage by a camera. Our card programming system recognizes instruction cards and translates icon commands into the motor driver program. This card programming environment also provides low-level structure programming.

  7. Working in the Reggio Way: A Beginner's Guide for American Teachers

    Science.gov (United States)

    Wurm, Julianne P.

    2005-01-01

    Are you curious about the Reggio Emilia approach but not quite sure where to begin? "Working in the Reggio Way" helps early childhood teachers bring the reflective, high-quality practices of Reggio Emilia to American programs. Based on an American teacher's experience observing and working in the schools of Reggio Emilia, Italy, this…

  8. Character Learning Strategies Among Danish and Swedish Beginners of Chinese as a Foreign Language (CFL)

    DEFF Research Database (Denmark)

    Zhang, Chun; Chen, Yi-ting

    Inventory for Language Learning (SILL) by Oxford (1990), we adapted Shen’ (2005) questionnaire into two online surveys. The first survey was done in February 2016 aiming to discover some Chinese character learning strategies employed by Danish and Swedish learners. Based on the 1st survey, the second survey...

  9. The NKS-NORCMAS guide to beginners in IP-MS

    International Nuclear Information System (INIS)

    Ross, P.; Appelblad, P.; Skipperud, L.; Sjoegren, A.

    2006-04-01

    This text is meant as a guide for those who wishes to approach the field of ICP mass spectrometry for one purpose or another. In principle any mass spectrometer consists of three parts: An ion source, a mass analyser and a detector. These three parts will be treated separately in the text before focusing on the specific issues concerning ultra trace measurements and isotope ratios of radioisotopes. The text includes some general considerations with practical tips which are useful to the novel user when doing sample analysis with ICP-MS. It also includes a short training course consisting of five exercises. (au)

  10. Epistemology for Beginners: Two- to Five-Year-Old Children's Representation of Falsity.

    Science.gov (United States)

    Mascaro, Olivier; Morin, Olivier

    2015-01-01

    This paper investigates the ontogeny of human's naive concept of truth. Surprisingly, children find it hard to treat assertions as false before their fifth birthday. Yet, we show in six studies (N = 140) that human's concept of falsity develops early. Two-year-olds use truth-functional negation to exclude one term in an alternative (Study 1). Three-year-olds can evaluate discrepancies between the content of a representation and what it aims at representing (Study 2). They use this knowledge to treat beliefs and assertions as false (Study 3). Four-year-olds recognise the involutive nature of falsity ascriptions: they properly infer 'p' from 'It is not true that "It is not true that "p"' (Study 4), an inference that rests on second-order representations of representations. Controls confirm that children do not merely equate being mistaken with failing to achieve one's goal (Studies 5 and 6). These results demonstrate remarkable capacities to evaluate representations, and indicate that in the absence of formal training, young children develop the building blocks of a theory of truth and falsity-a naive epistemology. We suggest that children's difficulties in discarding false assertions need not reflect any conceptual lacuna, and may originate from their being trustful.

  11. Neutrons for biologists: a beginner's guide, or why you should consider using neutrons

    Science.gov (United States)

    Lakey, Jeremy H.

    2009-01-01

    From the structures of isolated protein complexes to the molecular dynamics of whole cells, neutron methods can achieve a resolution in complex systems that is inaccessible to other techniques. Biology is fortunate in that it is rich in water and hydrogen, and this allows us to exploit the differential sensitivity of neutrons to this element and its major isotope, deuterium. Furthermore, neutrons exhibit wave properties that allow us to use them in similar ways to light, X-rays and electrons. This review aims to explain the basics of biological neutron science to encourage its greater use in solving difficult problems in the life sciences. PMID:19656821

  12. iPhone and iPad apps for absolute beginners

    CERN Document Server

    Lewis, Rory

    2013-01-01

    So how do you build an application for the iPhone and iPad? Don't you need to spend years learning complicated programming languages? What about Objective-C and Cocoa touch? The answer is that you don't need to know any of those things! Anybody can start building simple apps for the iPhone and iPad, and this book will show you how. This update of an Apress bestseller walks you through creating your first app, using plain English and practical examples using the iOS 6 software development platform and more. It cuts through the fog of jargon and misinformation that surrounds iPhone and iPad app

  13. Graphics and Animation on iOS A Beginner's Guide to Core Graphics and Core Animation

    CERN Document Server

    Nahavandipoor, Vandad

    2011-01-01

    Jazz up your iPhone and iPad apps with some slick graphics and animation-and keep users from looking elsewhere. This short and concise book shows developers with even little Cocoa programming experience how to create impressive graphics and animation effects with relatively easy coding. Learn how to incorporate smooth animations and draw images in your apps to achieve the classy look you want. The recipes in this book include step-by-step instructions and simple code solutions that you can put to work right away. Learn basic concepts for adapting to different screen sizesConstruct, set, and

  14. [Arduous working conditions for beginners: when workplace prevention becomes an economic risk].

    Science.gov (United States)

    Latil, François

    2015-01-01

    The French law of 20.01.2014 recently instituted an arduous working conditions allowance. This innovated legislation is designed to improve the status of workers subject to arduous working conditions either by allowing lighter work schedules or job reclassification or early retirement. The impact of arduous working conditions on health has been clearly established, but no consensual solution has yet been proposed. Life expectancy without disability can differ by as much as 9 years between higher executives and manual workers, but the proposed solutions comprise a multitude of perverse effects. Workers may benefit from maintaining their arduous working conditions in order to preserve their right to early retirement. Companies do not necessarily have the desire or the resources to invest in prevention, which is the only consensually accepted effective measure, if they are also required to finance both training and retirement. In particular, management of the arduous working conditions allowance is very complex and entirely financed by companies. Consequently, company productivity can be impacted, leading to transfers of company headquarters, outsourcing to interim workers, replacement of jobs by automation. Unemployment could be the big winner of this conflict. Politically, arduous working conditions allowance appears to be very difficult to put into practice and can be considered to be more a promise by the government to the left and to the trade unions.

  15. The Campcraft Book: A Beginner's Guide to Outdoor Living Skills. Revised Edition.

    Science.gov (United States)

    Hammett, Catherine T.

    This handbook contains information designed to help develop campcraft skills. This basic guide to outdoor living contains the following chapters: (1) Come On Out; (2) On the Trail; (3) Your Own Outdoor Equipment; (4) Campcraft Skills; (5) Fire Building and Fireplaces; (6) Outdoor Food; (7) Knotcraft; (8) Lashing; (9) Toolcraft; (10) Finding Your…

  16. SNS for Learners at Beginner Level: An Alternative Use of FB

    Science.gov (United States)

    Carpi, Tiziana

    2014-01-01

    Despite that previous studies have shown that the implementation of Social Network Sites (SNSs) into the classroom may bring several learning benefits, the focus has been mainly restricted to learners at intermediate language level with a focus on use of SNSs for fostering communicative competence or as class management. This project, implemented…

  17. Language and Culture Pedagogy for Motivating Chinese Learning Beginners in the Danish context

    DEFF Research Database (Denmark)

    Du, Xiangyun; Bao, Rui; Egekvist, Ulla Egidiussen

    Paper presented at International conference: From the specific patterns of Chinese language to its teaching, 12-13 January 2012......Paper presented at International conference: From the specific patterns of Chinese language to its teaching, 12-13 January 2012...

  18. Teaching Non-Beginner Programmers with App Inventor: Survey Results and Implications

    Science.gov (United States)

    Soares, Andrey; Martin, Nancy L.

    2015-01-01

    This paper reports the results of a survey with 40 students enrolled in an Android Application Development course offered during the spring semester of 2013 and 2014. The course used App Inventor to build the apps and required students to have an introduction to programming course as a prerequisite. The survey asked for demographic information and…

  19. Regularity of minimal and almost minimal sets and cones : J. Taylor's theorem for beginners

    OpenAIRE

    David, Guy

    2012-01-01

    Notes for lectures that were given in the Séminaire de Mathématiques Supérieures (on metric spaces and transport) , Montréal, 2011; We discuss various settings for the Plateau problem, a proof of J. Taylor's regularity theorem for $2$-dimensional almost minimal sets, some applications, and potential extensions of regularity results to the boundary.

  20. Cartan for beginners differential geometry via moving frames and exterior differential systems

    CERN Document Server

    Ivey, Thomas A

    2016-01-01

    Two central aspects of Cartan's approach to differential geometry are the theory of exterior differential systems (EDS) and the method of moving frames. This book presents thorough and modern treatments of both subjects, including their applications to both classic and contemporary problems in geometry. It begins with the classical differential geometry of surfaces and basic Riemannian geometry in the language of moving frames, along with an elementary introduction to exterior differential systems. Key concepts are developed incrementally, with motivating examples leading to definitions, theorems, and proofs. Once the basics of the methods are established, the authors develop applications and advanced topics. One notable application is to complex algebraic geometry, where they expand and update important results from projective differential geometry. As well, the book features an introduction to G-structures and a treatment of the theory of connections. The techniques of EDS are also applied to obtain explici...

  1. Supporting Beginner Teacher Identity Development: External Mentors and the Third Space

    Science.gov (United States)

    McIntyre, Joanna; Hobson, Andrew J.

    2016-01-01

    This paper reports findings from a study of support provided by non-school-based mentors of secondary science teachers in England. It focuses on the identity development of beginning teachers of physics, some of the recipients of the mentoring. Drawing on the analysis of interview and case study data, and utilising third space theory, the authors…

  2. Radiation protection and environmental radioactivity. A voyage to the World Wide Web for beginners

    International Nuclear Information System (INIS)

    Weimer, S.

    1998-01-01

    According to the enormous growth of the Internet service 'World Wide Web' there is also a big growth in the number of web sites in connection with radiation protection. An introduction is given of some practical basis of the WWW. The structure of WWW addresses and navigating through the web with hyperlinks is explained. Further some search engines are presented. The paper lists a number of WWW addresses of interesting sites with radiological protection informations. (orig.) [de

  3. Simply rails 2 the ultimate beginner's guide to Ruby on rails

    CERN Document Server

    Lenz, Patrick

    2008-01-01

    Want to learn all about Ruby on Rails 2.0, the web application framework that is inspiring developers around the world? The second edition of this practical, hands on book will: show you how to install Ruby on Rails on Windows, Mac, or Linux walk you, step by step, through the development of a Web 2.0 social news application, just like digg.com show you how to test, debug, benchmark, and deploy your Rails application Unlike other Rails books, this book doesn't assume that you are an experienced web developer, or that you've used Ruby before. An entire chapter is devoted to learning Ruby in a fun way, using the interactive Ruby console, so you can follow along at home. You'll be an accomplished Ruby programmer in no time! The example application that the book builds - a user-generated news web site - is built upon with each following chapter, and concepts such as sessions, cookies and basic AJAX usage are gradually introduced. Different aspects of Rails, such as user authentication, session cookies, and automa...

  4. Adult Beginner Instrumentalists' Practice, Self-Regulation, and Self-Efficacy: A Pilot Study

    Science.gov (United States)

    Ritchie, Laura; Kearney, Phil

    2018-01-01

    The self-regulation of practice behaviour has repeatedly been shown to distinguish between novice and expert performers, however interventions designed to encourage self-regulation by novice musicians have shown limited effectiveness. Guided by successful research in sporting contexts, the present study investigated the behaviours of beginner…

  5. PAVING THE WAY: CONDITIONS OF INCLUSION OF THE EDUCATORS BEGINNERS IN NORTHERN MEXICO

    Directory of Open Access Journals (Sweden)

    Evangelina Cervantes H

    2013-09-01

    Full Text Available In the present paper the authors analyzes the knowledge process and labor conditions in the teaching work of the graduates students of the Bachelor of education offered by the Universidad Autónoma de Ciudad Juárez. Through the qualitative method the authors provide testimonies of the novels teachers in theirs first work. The search offer a perspective of the trajectories of this teachers in the basic educational system in Juarez city, Chih., observed laboral precarious conditions of teachers careers in university preparation, in effect, exist incidence the discords elements in their certification, qualification and development in relation with the graduates students of Escuelas Normales.

  6. Can Tasks Be Used to Teach Chinese Culture at the Beginner Level?

    DEFF Research Database (Denmark)

    Ruan, Youjin

    2012-01-01

    In the autumn term of 2011, the Confucius Institute for Learning and Innovation (CI) at Aalborg University (AAU) offered a Chinese course as part of an international program at Gug School. The course introduced Chinese culture and information about modern China as well as limited Chinese language....... In this course, the teacher tried to combine the culture with the language by using tasks, games and lectures. As more and more tasks were introduced in culture and language teaching, the students’ motivation improved and they became more active and involved in the classroom. This chapter describes...... the background, content and methods of the teaching in detail, and also discusses the exploration and application of using tasks as a method in this course....

  7. ESL for Hotel/Hospitality Industry. Level: Advanced Beginner/Intermediate.

    Science.gov (United States)

    Western Suffolk County Board of Cooperative Educational Services, Northport, NY.

    This document contains 16 lesson plans for an advanced beginning and intermediate course in work-related English for non-English- or limited-English-speaking entry-level employees in the hotel and hospitality industry. Course objectives are as follows: helping participants understand and use job-specific vocabulary; receive and understand…

  8. Transforaminal Percutaneous Endoscopic Discectomy using Transforaminal Endoscopic Spine System technique: Pitfalls that a beginner should avoid.

    Science.gov (United States)

    Kapetanakis, Stylianos; Gkasdaris, Grigorios; Angoules, Antonios G; Givissis, Panagiotis

    2017-12-18

    Transforaminal Percutaneous Endoscopic Discectomy (TPED) is a minimally invasive technique mainly used for the treatment of lumbar disc herniation from a lateral approach. Performed under local anesthesia, TPED has been proven to be a safe and effective technique which has been also associated with shorter rehabilitation period, reduced blood loss, trauma, and scar tissue compared to conventional procedures. However, the procedure should be performed by a spine surgeon experienced in the specific technique and capable of recognizing or avoiding various challenging conditions. In this review, pitfalls that a novice surgeon has to be mindful of, are reported and analyzed.

  9. Beginners' Progress in Decoding L2 French: Some Longitudinal Evidence from English Modern Foreign Languages Classrooms

    Science.gov (United States)

    Woore, Robert

    2009-01-01

    "Decoding"--converting the written symbols (or graphemes) of an alphabetical writing system into the sounds (or phonemes) they represent, using knowledge of the language's symbol/sound correspondences--has been argued to be an important but neglected skill in the teaching of second language (L2) French in English secondary schools.…

  10. Learning through teaching: exploring what conservatoire students learn from teaching beginner older adults

    OpenAIRE

    Perkins, R.; Aufegger, L.; Williamon, A.

    2014-01-01

    Building on burgeoning research in the field of arts and health, this article explores the role that learning music plays in enhancing wellbeing in older adulthood. Despite an increasing focus on the role of learning in supporting mental wellbeing, there is strikingly little research that examines this in relation to music, or that explores wellbeing as a subjective phenomenon captured through mixed-methods enquiry. This research addresses this gap through two inter-related studies. Study 1 a...

  11. Beginners’ Tutorial for JHU UNIX at BRL (Ballistic Research Laboratory).

    Science.gov (United States)

    1983-12-01

    separate file for each chapter, called chapi chap2 etc... Or, if each chapter were broken Into several files, you might have 17 ohapl.1 chapi .2 chapl...you can see how to list the names of files of the book $ 1 chap* produces chapl.1 chapl.2 chapi .3 The 10 is not limited to last position in a

  12. The P.O.E.Ms of Educational Research: A Beginners' Concise Guide

    Science.gov (United States)

    Mustafa, Rami F.

    2011-01-01

    Embarking in an educational research paper is one of the daunting processes any scholar can go through. And the process is even harder for novice education students who wander through the plethora of terminology, styles and paradigms trying to figure out their way in that jungle called educational research. The following of the review presents the…

  13. A Beginner’s Guide to Factor Analysis: Focusing on Exploratory Factor Analysis

    Directory of Open Access Journals (Sweden)

    An Gie Yong

    2013-10-01

    Full Text Available The following paper discusses exploratory factor analysis and gives an overview of the statistical technique and how it is used in various research designs and applications. A basic outline of how the technique works and its criteria, including its main assumptions are discussed as well as when it should be used. Mathematical theories are explored to enlighten students on how exploratory factor analysis works, an example of how to run an exploratory factor analysis on SPSS is given, and finally a section on how to write up the results is provided. This will allow readers to develop a better understanding of when to employ factor analysis and how to interpret the tables and graphs in the output.

  14. Cacti beginner's guide leverage cacti to design a robust network operations center

    CERN Document Server

    Urban, Thomas

    2017-01-01

    The book is designed in such a way that you can explore it chapter-by-chapter or skip any chapter without missing a beat. If you are a network operator and want to use Cacti for implementing performance measurement for trending, troubleshooting, and reporting purposes, then this book is for you. You only need to know the basics of network ...

  15. Spectacular energy technology: Panorama-Sauna Holzweiler. KfW funds indoor swimming pools as 'process heat'; Energetisch spektakulaer: Panorama-Sauna Holzweiler. KfW foerdert Schwimmbaeder als 'Prozesswaerme'

    Energy Technology Data Exchange (ETDEWEB)

    Meissner, Rolf

    2008-11-15

    The ''Panorama-Sauna'' at Grafschaft is a big indoor swimming pool and Sauna centre in a rural region not far from Cologne and Koblenz. The charm of this spectacular solar project is in its minimalism. Conventional solar thermal power systems, in contrast, tend to be complex and prone to failure. (orig.)

  16. Metabolic characterization and transformation of the non-dairy Lactococcus lactis strain KF147, for production of ethanol from xylose

    DEFF Research Database (Denmark)

    Petersen, Kia Vest; Liu, Jianming; Chen, Jun

    2017-01-01

    the arcA gene encoding the arginine deiminase. The fermentation product profile suggested two routes for xylose degradation, the phosphoketolase pathway and the pentose phosphate pathway. Inactivation of the phosphoketolase pathway redirected the entire flux through the pentose phosphate pathway whereas...... xylose into useful chemicals we chose to redirect metabolism towards ethanol production. A synthetic promoter library was used to drive the expression of codon-optimized versions of the Zymomonas mobilis genes encoding pyruvate decarboxylase and alcohol dehydrogenase, and the outcome was a strain...... producing ethanol as the sole fermentation product with a high yield corresponding to 83% of the theoretical maximum. The results clearly indicate the great potential of using the more metabolically diverse non-dairy L. lactis strains for bio-production based on xylose containing feedstocks....

  17. Gas Chromatography - Mass Spectrometry Analysis and Antibacterial Activity of Bluish-Green Pigment from Pseudomonas sp. JJTBVK (KF836502

    Directory of Open Access Journals (Sweden)

    Bala Verma

    2015-08-01

    Full Text Available The present study was conducted for the isolation of potential bacteria from the desert soil, their molecular identification and prediction of restriction sites of the potential isolate using the bioinformatics tools. Production of the metabolites was done by inoculating in nutrient broth of pH 8.6. Metabolite was bluish-green in color; it was extracted and dried by using methanol and used for partial characterization by using GC-MS spectroscopy. Antibacterial activity was performed with the clinical human pathogenic isolates. The bacterium was identified as Pseudomonas sp.JJTBVK on the basis of 16S rRNA sequencing. The sequence was analyzed for the restriction cleavage sites, which showed that the sequence had various restriction sites for different enzymes. Antibacterial activity (MIC of methanol extract of the bacterial culture broth showed antibacterial activity (MIC, which was 29, 30, 30 and 29 mm for Pseudomonas aeruginosa, Staphylococcus aureus, Bacillus subtilis and Salmonella typhi, respectively. GC-MS analysis of the methanol extract showed the presence of naphth [2,3-B] azet-2 (1H -one, 1-phenyl-, which was the characteristic compound showing the antibacterial activity.

  18. Summarizing annual report 1989, on R and D work performed by the KfK Institute for Microstructural Engineering, IMT

    International Nuclear Information System (INIS)

    1990-03-01

    The main activities of the institute in the year under review continued the work with the separation nozzle method for U-235 enrichment, the testing of separation nozzle elements and the related methods for UF 6 production, and the design and testing of components for separation systems. In another working area, activities centered on microstructural techniques, as e.g. the production of masking blanks or structural masks for the deep-etch synchrotron radiation lithography, on the development of synchrotron radiation sources, or the design of irradiation facilities or wet chemical processes for microstructural techniques. The latter include molding of metals or plastics, surface etching and thin-film deposition. Experiments were carried out for microstructural process development, and product control and analyses for the purpose of quality assurance of microstructures. (HK) [de

  19. Results of 1989/90 research and development activities at KfK Institute for Reactor Components

    International Nuclear Information System (INIS)

    1991-03-01

    R and D activities at IRB (Institut fuer Reaktorbauelemente - Institute for Reactor Components) are dedicated to thermodynamics and fluid dynamics. Emphasis is on the design of nuclear reactor and fusion reactor components. Environmental engineering was added recently. Most activities are applications-oriented. Fundamental investigations focus on energy research and energy technology. The activities are carried out in the framework of different projects (PKF/nuclear fusion, PSF/nuclear safety, PSU/pollution control). Points of main effort are the development of basic liquid-metal-cooled blanket solutions, investigations on natural convection in reactor ranks, and the cooling properties of future containments for pressurized water reactors in the case of nuclear fusion accidents. (orig./GL) [de

  20. KF-loaded mesoporous Mg-Fe bi-metal oxides: high performance transesterification catalysts for biodiesel production.

    Science.gov (United States)

    Tao, Guiju; Hua, Zile; Gao, Zhe; Zhu, Yan; Zhu, Yan; Chen, Yu; Shu, Zhu; Zhang, Lingxia; Shi, Jianlin

    2013-09-21

    Using newly developed mesoporous Mg-Fe bi-metal oxides as supports, a novel kind of high performance transesterification catalysts for biodiesel production has been synthesized. More importantly, the impregnation solvent was for the first time found to substantially affect the structures and catalytic performances of the resultant transesterification catalysts.

  1. Status report on the waste management cooperation programme jointly undertaken by KfK/INE-NUCLEBRAS/CDTN

    International Nuclear Information System (INIS)

    Teh Whei Miaw, S.; Krause, H.

    1988-04-01

    The prime objective of the first phase of the programme was to develop processes for the treatment of the wastes arising at CDTN and to qualify waste forms for final disposal. Chemical precipitation and evaporation have been selected as the main processes for the treatment of low-level liquid wastes. Operating conditions for flocculation have been specified in laboratory-scale experiments. The plant has already been operated successfully. The evaporator nears completion. Two pilot plants for cementation have been erected and investigated, one with an in-drum mixer, the other with an in-tank mixer. Laboratory experiments on cementation have provided the basis for solidification of first batches of waste concentrates. Laboratory experiments on bituminization have started recently. A small-scale bitumen extruder will be put into operation soon. There have also been activities on the development, improvement and test of drums, containers and shielding casks for radioactive wastes. (orig./HP) [de

  2. Progress report on research and development in 1991, Institute of Neutron Physics and Reactor Engineering, KfK

    International Nuclear Information System (INIS)

    1992-03-01

    Progress report on research and development in 1991 Institute of Neutron Physics and Reactor Engineering. The Institute of Neutron Physics and Reactor Engineering is concerned with research work in the field of nuclear engineering related to the safety of fast and thermal reactors as well as with specific problems of fusion reactor technology. Under the project of nuclear safety research, the Institute works on concepts designed to drastically improve reactor safety. Apart from that, methods to estimate and minimize the radiological consequences of reactor accidents are developed. Under the fusion technology project, the Institute deals with neutron physics and technological questions of the breeding blanket. Basic research covers technico-physical questions of the interaction between light ion radiation of a high energy density and matter. In addition and to a small extent, questions of employing hydrogen in the transport area are studied. For all these tasks it is indispensable to use up-to-date data processing methods and equipment, from the highest capacity computer to the integrated minicomputer system. (orig./DG) [de

  3. Improving the spin-up of regional EnKF for typhoon assimilation and forecasting with Typhoon Sinlaku (2008

    Directory of Open Access Journals (Sweden)

    Eugenia Kalnay

    2013-09-01

    Full Text Available The Running-In-Place (RIP method is implemented in the framework of the Local Ensemble Transform Kalman Filter (LETKF coupled with the Weather Research and Forecasting (WRF model. RIP aims at accelerating the spin-up of the regional LETKF system when the WRF ensemble is initialised from a global analysis, which is obtained at a coarser resolution and lacks features related to the underlying mesoscale evolution. The RIP method is further proposed as an outer-loop scheme to improve the nonlinear evolution of the ensemble when the characteristics of the error statistics change rapidly owing to strong nonlinear dynamics. The impact of using RIP as an outer-loop for the WRF-LETKF system is evaluated for typhoon assimilation and prediction with Typhoon Sinlaku (2008 as a case study. For forecasts beyond one day, the typhoon track prediction is significantly improved after RIP is applied, especially during the spin-up period of the LETKF assimilation when Sinlaku is developing rapidly from a severe tropical storm to a typhoon. The impact of the dropsondes is significantly increased by RIP at early assimilation cycles. Results suggest that these improvements are because of the positive impact on the environmental condition of the typhoon. Results also suggest that using the RIP scheme adaptively allows RIP to be used as an outer-loop for the WRF-LETKF with further improvements.

  4. Satellite lithium-ion battery remaining useful life estimation with an iterative updated RVM fused with the KF algorithm

    Directory of Open Access Journals (Sweden)

    Yuchen SONG

    2018-01-01

    Full Text Available Lithium-ion batteries have become the third-generation space batteries and are widely utilized in a series of spacecraft. Remaining Useful Life (RUL estimation is essential to a spacecraft as the battery is a critical part and determines the lifetime and reliability. The Relevance Vector Machine (RVM is a data-driven algorithm used to estimate a battery’s RUL due to its sparse feature and uncertainty management capability. Especially, some of the regressive cases indicate that the RVM can obtain a better short-term prediction performance rather than long-term prediction. As a nonlinear kernel learning algorithm, the coefficient matrix and relevance vectors are fixed once the RVM training is conducted. Moreover, the RVM can be simply influenced by the noise with the training data. Thus, this work proposes an iterative updated approach to improve the long-term prediction performance for a battery’s RUL prediction. Firstly, when a new estimator is output by the RVM, the Kalman filter is applied to optimize this estimator with a physical degradation model. Then, this optimized estimator is added into the training set as an on-line sample, the RVM model is re-trained, and the coefficient matrix and relevance vectors can be dynamically adjusted to make next iterative prediction. Experimental results with a commercial battery test data set and a satellite battery data set both indicate that the proposed method can achieve a better performance for RUL estimation.

  5. KfK Laboratory for Aerosol Physics and Filter Technology. Progress report and development activities in 1990

    International Nuclear Information System (INIS)

    1991-03-01

    The activities undertaken by the laboratory for aerosol physics and filter technology (LAF) in 1990 under the following projects are described: (1) nuclear safety research (safety and material problems of fast breeders, IWR-oriented safety research); (2) pollutant control in the environment (communal waste management, emission-reducing processes, climate research - pollutants' behaviour in the atmosphere), and (3) radioactive waste management (basic work on reprocessing technologies). The annex lists the publications by the LAF staff. (BBR) [de

  6. Trunk Muscle EMG During Intermediate Pilates Mat Exercises in Beginner Healthy and Chronic Low Back Pain Individuals.

    Science.gov (United States)

    Pereira, Ivye L R; Queiroz, Bergson; Loss, Jefferson; Amorim, César; Sacco, Isabel C N

    2017-06-01

    The purpose of this study was to compare the electromyographic pattern of core muscles during intermediate Pilates mat exercises between healthy people and those with low back pain. We evaluated healthy participants (n = 19; mean ± standard deviation [SD]: age 28 ± 8 years, body mass 65 ± 10 kg, height 160.0 ± 9.1 cm) and a low back pain group (n = 13; mean ± SD: age 30 ± 9 years, body mass 67 ± 12 kg, height 170.0 ± 6.6 cm). Electromyographic analysis assessed the multifidus, external oblique, internal oblique, and rectus abdominis muscles during classical Pilates exercises (single leg stretch, criss-cross, and dead bug). We calculated the root mean square normalized by maximum voluntary contraction, and the time of peak activation was provided by a linear envelope and normalized by the total movement cycle. The criss-cross exercise presented the highest values of root mean square for trunk flexors (rectus abdominis and oblique) compared with the other exercises, followed by the single leg stretch and the dead bug, which had similar muscle activation. The single leg stretch presented more activation of the rectus abdominis and oblique, whereas the criss-cross and dead bug created more activation of the oblique compared with the multifidus and rectus. The Pilates exercises presented different muscle recruitment patterns, and allowed the activation of the lumbopelvic stabilizing muscles even in the first session for healthy individuals and those with chronic low back pain. Copyright © 2017. Published by Elsevier Inc.

  7. Understanding the Role of Teaching Materials in a Beginners' Level English as a Foreign Language Course: A Case Study

    Science.gov (United States)

    Cruz Rondón, Elio Jesús; Velasco Vera, Leidy Fernanda

    2016-01-01

    Learning a foreign language may be a challenge for most people due to differences in the form and structure between one's mother tongue and a new one. However, there are some tools that facilitate the teaching and learning of a foreign language, for instance, new applications for digital devices, video blogs, educational platforms, and teaching…

  8. Die russische baltische Historiographie in der zweiten Hälfte des 19. und zu Beginn des 20. Jahrhunderts / Tiit Rosenberg

    Index Scriptorium Estoniae

    Rosenberg, Tiit, 1946-

    2005-01-01

    Vene balti historiograafiast 19. sajandi teisel poolel ja 20. saj. algul. Evgraf Tsheshihhin, Joann Jürgens, Georgi Forsten, Vassili Blagoveshtshenski, Stepan Sivitski, Vassili Ivanov, Aleksandr Nevzorov, Aleksandr Brückner, Anton Budilovitsh, Aleksandr Tshumikov, Ivan Lutshitski, Konstantin Vojenski jt.

  9. MOOCs for Language Learning-Opportunities and Challenges: The Case of the Open University Italian Beginners' MOOCs

    Science.gov (United States)

    Motzo, Anna; Proudfoot, Anna

    2017-01-01

    Massive Open Online Courses (MOOCs) are a fairly recent development in online education. Language MOOCs (LMOOCs) have recently been added to the ever-growing list of open courses offered by various providers, including FutureLearn. For learners, MOOCs offer an innovative and inexpensive alternative to formal and traditional learning. For course…

  10. A Constructivist Approach to Game-Based Language Learning: Student Perceptions in a Beginner-Level EFL Context

    Science.gov (United States)

    York, James; deHaan, Jonathan William

    2018-01-01

    This article provides information on an action research project in a low-level EFL setting in Japan. The project aims were to (1) foster spoken communication skills and (2) help students engage with their own learning. The project investigated the applicability of board games as a mediating tool for authentic communication as part of a wider TBLT…

  11. PHYSICS EDUCATION AND THE INTERNET: A beginner's guide to a physicist starting out on an Internet journey

    Science.gov (United States)

    Burton, Paul

    1998-05-01

    Thirty useful physics-related sites are listed to help get you started. I hope you will find some of the following sites of use in your teaching or good for pointing your pupils in the right direction when doing research. I have not attempted to rank or sort them in any order. However, by the time you read this issue of Physics Education some of the sites may not be available; this is the nature of the net. Those not wishing to retype each address can access them from my school's physics page (http://www.bootham.demon.co.uk/physics/links.html) or e-mail me at pkb@bootham.demon.co.uk and I can send you a document with the hypertext live links in. The new IOP sponsored 16-19 Physics project is promising great things with its own Internet site. You will be able to download information, updates, worksheets etc. Any queries about the development of this project at present can be sent to Evelyn van Dyk at: 16-19project@iop.org Engineering and Physical Sciences Research Councilhttp://www.epsrc.ac.uk Particle Physics and Astronomy Research Councilhttp://www.pparc.ac.uk American Institute of Physicshttp://www.aip.org Usenet Physics FAQ (frequently asked questions)http://www.weburbia.demon.co.uk/physics/faq.html CERNhttp://www.cern.ch/ BBC Educationhttp://www.bbc.co.uk/education/ Useful data on the Periodic Tablehttp://www.shef.ac.uk/chemistry/web-elements/ JET WWW index page:http://www.jet.uk NERC satellite station, Dundee Universityhttp://www.sat.dundee.ac.uk/ The Meteorological Officehttp://www.meto.govt.uk/ The Smithsonian Institute, Washington, DChttp://www.si.edu/newstart.htm Frequently asked questions on time and frequencyhttp://www.boulder.nist.gov/timefreq/faq/faq.htm Physics newshttp://www.het.brown.edu/news/index.html TIPTOP: The Internet Pilot to Physicshttp://www.tp.umu.se/TIPTOP/ A Dictionary of Scientific Quotationshttp://naturalscience.com/dsqhome.html ScI-Journal: an on-line publication for science studentshttp://www.soton.ac.uk/~plf/ScI-Journal/ Science On-linehttp://www.shu.ac.uk/schools/sci/sol/contents.htm Physics humourhttp://quark.physics.uwo.ca/~harwood/humor12.htm Searching for someone's e-mail address?http://www.four11.com SKY publicationshttp://www.skypub.com Planet Sciencehttp://www.keysites.com New Scientisthttp://www.newscientist.com NASA links to the American space programhttp://www.nasa.gov NASA Jet Propulsion Laboratoryhttp://www.jpl.nasa.gov Hewlett-Packardhttp://www.hp.com The Bradford Schools Telescope Projecthttp://www.telescope.org/rti/nuffield/ To contact a professional societyhttp://www.lib.uwaterloo.ca/society/overview.html The Schools' Physics Group: post-16 issueshttp://diana.ecs.soton.ac.uk/~pm/Physics/post16.html Sleuth search for physics and chemistryhttp://www.isleuth.com/index.shtml The Particle Adventurehttp://pdg.lbl.gov/cpep/adventure_home.html Acknowledgments I thank colleagues David Robinson and Robin Peach for their help in selecting and validating these sites and William Try, pupil at Bootham School, for preparing and maintaining the department's homepage with hypertext links. Received 21 January 1998

  12. Practical guidelines for ultrasound-guided core needle biopsy of soft-tissue lesions: Transformation from beginner to specialist

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Sang Yoon; Chung, Hye Won; Oh, Tack Sun; Lee, Jong Seok [University of Ulsan College of Medicine, Asan Medical Center, Seoul (Korea, Republic of)

    2017-04-15

    Ultrasound-guided core needle biopsy (US-CNB) is an important step in the diagnosis of musculoskeletal soft-tissue lesions. To maximize efficacy and minimize the complications of US-CNB, it is critical to collaborate with a multidisciplinary team and to understand the particular considerations of US-CNB for these lesions. The purpose of this article is to provide a systematic review and step-by-step tips for using US-CNB to diagnose musculoskeletal soft-tissue lesions.

  13. Effect of peripheral vision training on the attack of beginner indoor soccer players: a study during competition

    OpenAIRE

    Nelson Kautzner Marques Junior

    2009-01-01

    http://dx.doi.org/10.5007/1980-0037.2009v11n1p119   In the area of Biophysical Dimension and following the research line of the Study of Learning Mechanisms and Processes and of Motor Conduct within the epistemological construct of phenomenological explanation. The objective of this study was to investigate peripheral vision training (PVT) and its effect on attack runs during indoor soccer, taking into account dominant laterality (brain hemisphere function) in both learning speed and ...

  14. Effect of peripheral vision training on the attack of beginner indoor soccer players: a study during competition

    OpenAIRE

    Nelson Kautzner Marques Junior

    2009-01-01

    This study was conducted within the context of Human Motor Skill Science, in the area of Biophysical Dimension and following the research line of the Study of Learning Mechanisms and Processes and of Motor Conduct within the epistemological construct of phenomenological explanation. The objective of this study was to investigate peripheral vision training (PVT) and its effect on attack runs during indoor soccer, taking into account dominant laterality (brain hemisphere function) in both learn...

  15. Hegemony for Beginners: Egyptian Activity in the Southern Levant during the Second Half of the Fourth Millennium B.C

    Directory of Open Access Journals (Sweden)

    Branislav Anđelković

    2016-03-01

    Full Text Available After a modest start in the mid-20th century, thousands of Protodynastic Egyptian objects have been unearthed and identified as such in the Southern Levant, including serekh-signs of several Dynasty 0 (Narmer, "Double Falcon", Ny-Hor, IryHor, Ka, and 1st Dynasty (Hor Aha pharaohs. The explanatory models presented so far fail to integrate the totality of the archaeologically manifested parameters, especially considering the impact of the last fifteen years of finds and their contextual and other analysis, into the proper semiotic matrix. The conundrum of Egyptian activity in the Southern Levant displays, at the same time, features of a small-scale trading partner, a colonizer, and a suzerain. Egyptian pottery of local origin provides an indication of a south-north flow of the Egyptian daily-life repertoire of pottery types, or rather their contents, between the Egyptian-related sites, that clearly demonstrates an Egyptian distribution system operating on an intra-regional level in the Early Bronze IB Southern Levant. The ‘Egyptian phenomenon’ is far from being unique since reestablishment of a similar geopolitical pattern, only on a considerably greater scale, can be recognized during the New Kingdom – the Egyptian province in Asia.

  16. Thinking Aloud about L2 Decoding: An Exploration of the Strategies Used by Beginner Learners when Pronouncing Unfamiliar French Words

    Science.gov (United States)

    Woore, Robert

    2010-01-01

    "Decoding"--converting the written symbols (or graphemes) of an alphabetical writing system into the sounds (or phonemes) they represent, using knowledge of the language's symbol/sound correspondences--has been argued to be an important but neglected skill in the teaching of second language (L2) French in English secondary schools.…

  17. Electrochemical studies of the molten system K2NbF7-Na2O-Nb-(LiF-NaF-KF)(eut) at 700 degrees C

    DEFF Research Database (Denmark)

    Rosenkilde, C.; Vik, A.; Østvold, T.

    2000-01-01

    . A slow, spontaneous reduction of Nb(V)-fluoru complexes to Nb(IV)-fluoro, complexes was observed in the absence of Nb metal. With a stoichiometric amount of Nb metal, Nb(V) is reduced rapidly to Nb(IV) according to the reaction 4NbF(7)(2-) + Nb reversible arrow 5NbF(x)((x-4)-). The solubilities of Nb2O5...

  18. A. Kim, k.f. Anderson, j. Berliner, j. Hassan, j. Jensen, h.j. Mertz, h. Pietsch, a. Rao, R. Scherer, and a. Sutterfield.

    Science.gov (United States)

    Kim, A; Anderson, K F; Berliner, J; Hassan, J; Jensen, J; Mertz, H J; Pietsch, H; Rao, A; Scherer, R; Sutterfield, A

    2003-10-01

    In this study, three dummies were evaluated on the component level and as a whole. Their responses were compared with available volunteer and embalmed Post Mortem Human Subject (PMHS) data obtained under similar test conditions to evaluate their biofidelity. The volunteer and PMHS data, used as comparators in this study, were used previously to establish some of the biofidelity requirements of the Hybrid III. The BioRID II, the Hybrid III, and the RID2 were all subjected to rear impact HYGE sled tests with deltaVs of 17 and 28 km/hr to determine their biofidelity in these conditions. A static pull test, where a load was manually applied to the head of each dummy, was used to evaluate the static strength of their necks in flexion and extension. Finally, pendulum tests were conducted with the Hybrid III and RID2 to evaluate the dynamic characteristics of their necks in flexion and extension. The sled test results indicate that out of the three dummies, the overall flexibility of the Hybrid III is comparable to that of the volunteer anticipating the impact. The overall flexibilities of the BioRID II and the RID2 are greater than those of all the comparators used in this study (the tensed volunteer and the two embalmed PMHSs). The responses of the Hybrid III are closer to those of the tensed volunteer than those of the PMHSs. The responses of the BioRID II and the RID2 are closer to those of the PMHSs than to the tensed volunteer.

  19. Synthesis of Dihydrophenanthridines and Oxoimidazolidines from Anilines and Ethylglyoxylate via Aza Diels-Alder Reaction of Arynes and KF-Induced Annulation.

    Science.gov (United States)

    Reddy, R Santhosh; Lagishetti, Chandraiah; Chen, Shuo; Kiran, I N Chaithanya; He, Yun

    2016-09-16

    The transition-metal-free multicomponent coupling of arynes, anilines, and ethylglyoxylate, proceeding via an inverse electron-demand aza Diels-Alder cycloaddition and N-arylation, has been demonstrated. This protocol allows rapid access to N-aryl dihydrophenanthridine derivatives in moderate to high yields at room temperature from readily available starting materials. In addition, an unprecedented fluoride induced annulation of ethyl(arylimino)acetates led to the formation of highly functionalized oxoimidazolidine derivatives in good yields under mild conditions.

  20. A Study of Coupling Parameter Estimation Implemented by 4D-Var and EnKF with a Simple Coupled System

    Directory of Open Access Journals (Sweden)

    Guijun Han

    2015-01-01

    Full Text Available Coupling parameter estimation (CPE that uses observations to estimate the parameters in a coupled model through error covariance between variables residing in different media may increase the consistency of estimated parameters in an air-sea coupled system. However, it is very challenging to accurately evaluate the error covariance between such variables due to the different characteristic time scales at which flows vary in different media. With a simple Lorenz-atmosphere and slab ocean coupled system that characterizes the interaction of two-timescale media in a coupled “climate” system, this study explores feasibility of the CPE with four-dimensional variational analysis and ensemble Kalman filter within a perfect observing system simulation experiment framework. It is found that both algorithms can improve the representation of air-sea coupling processes through CPE compared to state estimation only. These simple model studies provide some insights when parameter estimation is implemented with a coupled general circulation model for improving climate estimation and prediction initialization.

  1. Electrodeposition of uranium metal by reduction of uranium oxides in molten Lif-KF=NaF-CaF 2-UF4

    International Nuclear Information System (INIS)

    Pao, D.S.; Burris, L.; Steunenberg, R.K.; Tomczuk, Z.

    1990-01-01

    Although electrolytic reduction of uranium oxides was shown to be feasible in the early 1960's it is recognized that considerable improvement in the electrolytic reduction technology must be achieved for practical applications. This exploratory work on electrolytic reduction of uranium oxide was undertaken to investigate potential improvements in the technology. The approach taken was to deposit solid uranium metal directly on a solid cathode at temperatures below the melting point of uranium (1132 degrees C). The lower temperature electrolytic reduction process has several advantages over the existing chemical reduction processes. It lessens materials problems and special heating and insulating requirements associated with high-temperature operations. It removes most impurities. It does not produce the large quantities of byproduct oxides wastes typical of chemical reduction processes

  2. 40 CFR Table 27 to Subpart G of... - Summary of Internal Floating Deck Fitting Loss Factors (KF) and Typical Number of Fittings (NF)

    Science.gov (United States)

    2010-07-01

    ... EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS FOR SOURCE CATEGORIES National Emission Standards for Organic Hazardous Air Pollutants From the Synthetic Organic Chemical Manufacturing Industry for Process Vents, Storage Vessels, Transfer Operations, and Wastewater Pt. 63, Subpt. G, Table 27 Table 27 to...

  3. Exploration and validation of alternate sensing methods for wearable continuous pulse transit time measurement using optical and bioimpedance modalities.

    Science.gov (United States)

    Ibrahim, Bassem; Nathan, Viswam; Jafari, Roozbeh

    2017-07-01

    In this work we explore the viability of a multimodal sensing device that can be integrated in a wearable form factor for daily, non-invasive ambulatory blood pressure (BP) monitoring. A common approach in previous research has been to rely on measuring the pulse transit time (PTT), which has been shown to be correlated with the BP. In this work, we look into the feasibility of measuring PTT using sensors separated by a small distance on one arm so that any eventual realization of the system is convenient to wear and use over long periods of time. Moreover, we investigate the combined use of two different modalities for cardiovascular measurement: the optical photoplethysmogram (PPG) as well as the bio-potential based impedance (Bio-Z) measurement. These two modalities have been previously only studied on their own or in conjunction with the electrocardiogram (ECG) for the purpose of estimating PTT. We measure the PTT from the wrist to the finger using Bio-Z and PPG sensors, and compare it to the conventional PTT measured from the ECG to PPG at the finger, in order to prove that it can be an effective replacement for existing PTT measurement strategies. Moreover, successful measurement of PTT with two different modalities of sensors at close proximity will allow designs with multiple heterogeneous sensors on a more versatile wearable sensing platform that is optimized for power and is more robust to environmental or skin contact changes. This will enable the next generation of smart watches that capture PTT and BP. Experiments were conducted in vivo with simultaneous ECG, Bio-Z and PPG sensors, and results indicate that the PTT calculated from the Bio-Z and PPG sensors placed at a close distance correlates well with the more established PTT measurement using the ECG in conjunction with PPG, with correlation coefficient as high as 0.92.

  4. Educational Success Prediction Instrument 2nd Version: A Foreign Language Perspective on Readiness to Take a Beginner High School Foreign Language Online Course

    Science.gov (United States)

    Sparks, Lynne Marie

    2017-01-01

    Online foreign language course offerings have grown exponentially in secondary and post-secondary schools during the last two decades. Although numerous instruments and surveys exist to assess readiness for a student to take online courses, insufficient research has dealt with the particularities of learning a foreign language online. This study…

  5. EFL SPEAKING AND INDIVIDUAL DIFFERENCES IN WORKING MEMORY CAPACITY: GRAMMATICAL COMPLEXITY AND WEIGHTED LEXICAL DENSITY IN THE ORAL PRODUCTION OF BEGINNERS

    Directory of Open Access Journals (Sweden)

    GICELE VERGINE e RAQUEL D’ELY

    2008-04-01

    Full Text Available O presente estudo expande a investigação de Fontanini, Weissheimer, Bergsleithner, Perucci and D’Ely (2005 utilizando parte dos dados dessa pesquisa para examinar a relação entre capacidade de memória de trabalho, medida pelo teste de amplitude oral e pelo teste de amplitude geral, e o uso de fala gramaticalmente complexa e lexicalmente densa de doze alunos iniciantes ao elaborarem uma descrição de gravura em Inglês como L2. Adicionando aos resultados obtidos por Fontanini et al (2005, não houve correlação estatisticamente significativa entres as medidas de memória de trabalho e a fala complexa e lexicalmente densa dos aprendizes. Portanto, os resultados corroboram a existência de efeito de troca de recursos atencionais (trade-off effects entre variáveis da produção oral como uma função de diferenças individuais na capacidade de memória de trabalho.PALAVRAS-CHAVE: produção oral, complexidade, densidade lexical, capacidade de memória de trabalho, efeito de troca de recursos atencionais.

  6. Regulation of distribution grid prices at the beginning of market liberalisation - Experience in Norway and Sweden; Regulierung der Verteilnetzpreise zu Beginn der Marktoeffnung. Erfahrung in Norwegen und Schweden

    Energy Technology Data Exchange (ETDEWEB)

    Filippini, M.; Wind, J.; Luchsinger, C.

    2001-07-01

    This report for the Swiss Federal Office of Energy (SFOE) reviews the experience gained in the deregulation of electricity distribution grids in Norway and Sweden and compares it with the possible options for Switzerland. The report looks at the requirements placed on the future Swiss regulation of electricity distribution grids and the various regulation models such as Rate-of-Return, Price-Cap, Revenue-Cap and Benchmarking that could be used in the short and long term. The choice of Sweden and Norway from the list of countries with liberalised electricity markets is discussed. The results of the study of the two countries are discussed individually, including the structure of the sector, the various stages of deregulation, the main characteristics encountered at the start of deregulation, regulation of grid prices at the beginning of liberalisation and experience gained in each case. The report is supplemented by a comprehensive list of the sources used.

  7. Bryophytes for Beginners: The Usability of a Printed Dichotomous Key versus a Multi-Access Computer-Based Key for Bryophyte Identification

    Science.gov (United States)

    Stagg, Bethan C.; Donkin, Maria E.; Smith, Alison M.

    2015-01-01

    Bryophytes are a rewarding study group in field biology and the UK bryophyte flora has international importance to biodiversity conservation. We designed an identification key to common woodland moss species and compared the usability of two formats, web-based multi-access and printed dichotomous key, with undergraduate students. The rate of…

  8. Word-reading and word-spelling styles of french beginners : Do all children learn to read and to spell in the same way?

    OpenAIRE

    Eme, Elsa; Golder, Caroline

    2005-01-01

    This article explores the styles of word reading and word spelling used by beginning readers in the French language. The aim of the study was to find out whether “sub-lexical” and “lexical” styles of reliance, which has been observed in children learning to read and spell in English, exists in French, a language with a more transparent orthography. A sample of 159 subjects were assessed on their reading and spelling of regular words, irregular words and nonwords. Cluster analyses on reading/s...

  9. Ni, Co, and Mo-metal-catalyzed alkynes hydrostannations using Bu(3)SnCl/PMHS/KF/18-crown-6 as an in situ Bu(3)SnH source.

    Science.gov (United States)

    Ghosh, Banibrata; Maleczka, Robert E

    2011-10-12

    A number of terminal alkynes were subjected to nickel, cobalt, and molybdenum catalyzed hydrostannations in presence of tributyltin chloride, polymethylhydrosiloxane, potassium fluoride and 18-crown-6 as an situ organotin hydride source to produce vinylstannanes.

  10. Früher Beginn: Aggression bei jugendlichen Paaren und ihr Bezug zu Partnerschaftsqualität und Bewältigung von Konflikten [Early start: Aggression in adolescent couples and its link to relationship quality and coping with conflicts

    NARCIS (Netherlands)

    Seiffge-Krenke, I.; Burk, W.J.

    2016-01-01

    Aggressive behavior in adult couples is a problem which must be taken seriously and is a frequent reason for psychotherapy and counseling. Less is known about an early start of aggression, e.g. in adolescent romantic relationships. In a sample of 194 romantic partner dyads (age 16-18 years)

  11. Ensino de PLA para falantes de espanhol: uma proposta de sequência didática para alunos iniciantes = PLA teaching for Hispanic speakers: a proposal of didactic sequence for beginners

    Directory of Open Access Journals (Sweden)

    Santos, Leticia Grubert dos

    2016-01-01

    Full Text Available Este trabalho tem por objetivo apresentar uma sequência didática de Português como língua adicional para alunos falantes de espanhol em nível iniciante. Uma vez que as duas línguas apresentam semelhanças, esses alunos têm características e necessidades que devem ser levadas em conta no planejamento da aula. Baseado na perspectiva de gêneros do discurso Bakhtiniana, e considerando o construto de proficiência do Exame Celpe-Bras, uma sequência foi desenvolvida para promover a prática de gêneros orais. Uma análise detalhada da sequência didática acerca do tema “Trabalho voluntário” é apresentada. O estudo traz importantes contribuições a fim de promover reflexões para os professores de português como língua adicional, sobretudo em relação ao desenvolvimento de tarefas para alunos de línguas próximas

  12. Atomic physics for cave-men and other beginners. The universe from within. Molecules, atoms, and elementary particles; Atomphysik fuer Hoehlenmenschen und andere Anfaenger. Das Universum von innen. Molekuele, Atome und Elementarteilchen

    Energy Technology Data Exchange (ETDEWEB)

    Beetz, Juergen

    2016-07-01

    In this essential can be found the structure and the general properties of atoms, the precise interior of atoms and the special behaviour resulting from it, and the mysterious world of ''quanta'' and their behaviour.

  13. Zur Frage der Nutzung der Höhenlagen im südlichen Beriech der Przeworsk-Kultur am Beginn der Völkerwanderungszeit, in Bezug auf die Siedlungen im Jeseníky-Vorgebirge

    Czech Academy of Sciences Publication Activity Database

    Loskotová, Zuzana

    2011-01-01

    Roč. 52, č. 2 (2011), s. 1211-7250 ISSN 1211-7250 Institutional research plan: CEZ:AV0Z80010507 Keywords : upper silesia * migration period * hilltop settlements Subject RIV: AC - Archeology, Anthropology, Ethnology

  14. Data driven computing by the morphing fast Fourier transform ensemble Kalman filter in epidemic spread simulations

    Science.gov (United States)

    Mandel, Jan; Beezley, Jonathan D.; Cobb, Loren; Krishnamurthy, Ashok

    2010-01-01

    The FFT EnKF data assimilation method is proposed and applied to a stochastic cell simulation of an epidemic, based on the S-I-R spread model. The FFT EnKF combines spatial statistics and ensemble filtering methodologies into a localized and computationally inexpensive version of EnKF with a very small ensemble, and it is further combined with the morphing EnKF to assimilate changes in the position of the epidemic. PMID:21031155

  15. Multilevel ensemble Kalman filter

    KAUST Repository

    Chernov, Alexey

    2016-01-06

    This work embeds a multilevel Monte Carlo (MLMC) sampling strategy into the Monte Carlo step of the ensemble Kalman filter (EnKF). In terms of computational cost vs. approximation error the asymptotic performance of the multilevel ensemble Kalman filter (MLEnKF) is superior to the EnKF s.

  16. Flexural properties untreated and treated kenaf fiber reinforced polypropylene composites

    Science.gov (United States)

    Husin, Muhammad Muslimin; Mustapa, Mohammad Sukri; Wahab, Md Saidin; Arifin, Ahmad Mubarak Tajul; Masirin, Mohd Idrus Mohd; Jais, Farhana Hazwanee

    2017-05-01

    Today natural fiber polymer composites are being extensively used as alternatives in producing furniture to fulfill society demand instead of saving cost and environmentally friendly. The objective of this search is to investigate the untreated fine and rough kenaf fiber (KF) as well as treated KF reinforced with polypropylene (PP) on the flexural strength. Flexural strengths of pure PP, 10%, and 20% of untreated fine and rough KF by weight to PP have been recorded. In addition, flexural strengths of treated KF soaked with 5% and 10% of Sodium Hydroxide (NaOH) have also been recorded. KF reinforced PP (PP/KF) untreated and treated composites were melt blended and then injection molded to observe their flexural strengths by measuring their threshold. Three point bending test was apply to determine the flexural stress of the composites. The result show treated fine KF produce better flexural performance at 20% PP/KF. Scanning Electron Microscopy (SEM) is used to observe the morphological surface PP/KF. Overall 5% NaOH with 20% PP/KF (Fine KF) show good interfacial bonding PP/KF and best result with flexural stress value 30.25MPa.

  17. Kiwifruit Non-Sugar Components Reduce Glycaemic Response to Co-Ingested Cereal in Humans.

    Science.gov (United States)

    Mishra, Suman; Edwards, Haley; Hedderley, Duncan; Podd, John; Monro, John

    2017-10-30

    Kiwifruit (KF) effects on the human glycaemic response to co-ingested wheat cereal were determined. Participants (n = 20) consumed four meals in random order, all being made to 40 g of the same available carbohydrate, by adding kiwifruit sugars (KF sug; glucose, fructose, sucrose 2:2:1) to meals not containing KF. The meals were flaked wheat biscuit (WB)+KFsug, WB+KF, WB+guar gum+KFsug, WB+guar gum+KF, that was ingested after fasting overnight. Blood glucose was monitored 3 h and hunger measured at 180 min post-meal using a visual analogue scale. KF and guar reduced postprandial blood glucose response amplitude, and prevented subsequent hypoglycaemia that occurred with WB+KFsug. The area between the blood glucose response curve and baseline from 0 to 180 min was not significantly different between meals, 0-120 min areas were significantly reduced by KF and/or guar. Area from 120 to 180 min was positive for KF, guar, and KF+guar, while the area for the WB meal was negative. Hunger at 180 min was significantly reduced by KF and/or guar when compared with WB. We conclude that KF components other than available carbohydrate may improve the glycaemic response profile to co-ingested cereal food.

  18. A Ketogenic Formula Prevents Tumor Progression and Cancer Cachexia by Attenuating Systemic Inflammation in Colon 26 Tumor-Bearing Mice.

    Science.gov (United States)

    Nakamura, Kentaro; Tonouchi, Hidekazu; Sasayama, Akina; Ashida, Kinya

    2018-02-14

    Low-carbohydrate, high-fat diets (ketogenic diets) might prevent tumor progression and could be used as supportive therapy; however, few studies have addressed the effect of such diets on colorectal cancer. An infant formula with a ketogenic composition (ketogenic formula; KF) is used to treat patients with refractory epilepsy. We investigated the effect of KF on cancer and cancer cachexia in colon tumor-bearing mice. Mice were randomized into normal (NR), tumor-bearing (TB), and ketogenic formula (KF) groups. Colon 26 cells were inoculated subcutaneously into TB and KF mice. The NR and TB groups received a standard diet, and the KF mice received KF ad libitum . KF mice preserved their body, muscle, and carcass weights. Tumor weight and plasma IL-6 levels were significantly lower in KF mice than in TB mice. In the KF group, energy intake was significantly higher than that in the other two groups. Blood ketone body concentrations in KF mice were significantly elevated, and there was a significant negative correlation between blood ketone body concentration and tumor weight. Therefore, KF may suppress the progression of cancer and the accompanying systemic inflammation without adverse effects on weight gain, or muscle mass, which might help to prevent cancer cachexia.

  19. Kiwifruit Non-Sugar Components Reduce Glycaemic Response to Co-Ingested Cereal in Humans

    Directory of Open Access Journals (Sweden)

    Suman Mishra

    2017-10-01

    Full Text Available Kiwifruit (KF effects on the human glycaemic response to co-ingested wheat cereal were determined. Participants (n = 20 consumed four meals in random order, all being made to 40 g of the same available carbohydrate, by adding kiwifruit sugars (KF sug; glucose, fructose, sucrose 2:2:1 to meals not containing KF. The meals were flaked wheat biscuit (WB+KFsug, WB+KF, WB+guar gum+KFsug, WB+guar gum+KF, that was ingested after fasting overnight. Blood glucose was monitored 3 h and hunger measured at 180 min post-meal using a visual analogue scale. KF and guar reduced postprandial blood glucose response amplitude, and prevented subsequent hypoglycaemia that occurred with WB+KFsug. The area between the blood glucose response curve and baseline from 0 to 180 min was not significantly different between meals, 0–120 min areas were significantly reduced by KF and/or guar. Area from 120 to 180 min was positive for KF, guar, and KF+guar, while the area for the WB meal was negative. Hunger at 180 min was significantly reduced by KF and/or guar when compared with WB. We conclude that KF components other than available carbohydrate may improve the glycaemic response profile to co-ingested cereal food.

  20. A Ketogenic Formula Prevents Tumor Progression and Cancer Cachexia by Attenuating Systemic Inflammation in Colon 26 Tumor-Bearing Mice

    Directory of Open Access Journals (Sweden)

    Kentaro Nakamura

    2018-02-01

    Full Text Available Low-carbohydrate, high-fat diets (ketogenic diets might prevent tumor progression and could be used as supportive therapy; however, few studies have addressed the effect of such diets on colorectal cancer. An infant formula with a ketogenic composition (ketogenic formula; KF is used to treat patients with refractory epilepsy. We investigated the effect of KF on cancer and cancer cachexia in colon tumor-bearing mice. Mice were randomized into normal (NR, tumor-bearing (TB, and ketogenic formula (KF groups. Colon 26 cells were inoculated subcutaneously into TB and KF mice. The NR and TB groups received a standard diet, and the KF mice received KF ad libitum. KF mice preserved their body, muscle, and carcass weights. Tumor weight and plasma IL-6 levels were significantly lower in KF mice than in TB mice. In the KF group, energy intake was significantly higher than that in the other two groups. Blood ketone body concentrations in KF mice were significantly elevated, and there was a significant negative correlation between blood ketone body concentration and tumor weight. Therefore, KF may suppress the progression of cancer and the accompanying systemic inflammation without adverse effects on weight gain, or muscle mass, which might help to prevent cancer cachexia.

  1. Pradinukų savęs vertinimas ir pasitikėjimas savimi per kūno kultūros pamokas

    OpenAIRE

    Labunskytė, Irma

    2005-01-01

    The subject of master‘s work – “Self – esteem and self – confidence of the beginners during the lessons of physical education”. The aim of the work – to define self – esteem and self – confidence of the beginners during the lessons of physical education. The following tasks were raised in the work: 1. to determine theoretical presumptions of the beginners self – esteem and self – confidence during the lessons of physical education; 2. to disclose the beginners (boys and girls)...

  2. Dissolved inorganic carbon, total alkalinity, pH, and other variables collected from surface discrete observations using flow through pump and other instruments from Explorer of the Seas (ID: 33KF) in the Caribbean Sea and North Atlantic ocean during the Ocean Acidification Cruise EX1507 from 2015-02-14 to 2015-02-15 (NCEI Accession 0154385)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This archival package contains surface discrete measurements of dissolved inorganic carbon, total alkalinity, pH in the Caribbean Sea. Increasing amounts of...

  3. Chemometrics-assisted spectrophotometric method for simultaneous determination of Pb2+ and Cu2+ ions in different foodstuffs, soil and water samples using 2-benzylspiro [isoindoline-1,5‧-oxazolidine]-2‧,3,4‧-trione using continuous wavelet transformation and partial least squares - Calculation of pKf of complexes with rank annihilation factor analysis

    Science.gov (United States)

    Abbasi Tarighat, Maryam; Nabavi, Masoume; Mohammadizadeh, Mohammad Reza

    2015-06-01

    A new multi-component analysis method based on zero-crossing point-continuous wavelet transformation (CWT) was developed for simultaneous spectrophotometric determination of Cu2+ and Pb2+ ions based on the complex formation with 2-benzyl espiro[isoindoline-1,5oxasolidine]-2,3,4 trione (BSIIOT). The absorption spectra were evaluated with respect to synthetic ligand concentration, time of complexation and pH. Therefore according the absorbance values, 0.015 mmol L-1 BSIIOT, 10 min after mixing and pH 8.0 were used as optimum values. The complex formation between BSIIOT ligand and the cations Cu2+ and Pb2+ by application of rank annihilation factor analysis (RAFA) were investigated. Daubechies-4 (db4), discrete Meyer (dmey), Morlet (morl) and Symlet-8 (sym8) continuous wavelet transforms for signal treatments were found to be suitable among the wavelet families. The applicability of new synthetic ligand and selected mother wavelets were used for the simultaneous determination of strongly overlapped spectra of species without using any pre-chemical treatment. Therefore, CWT signals together with zero crossing technique were directly applied to the overlapping absorption spectra of Cu2+ and Pb2+. The calibration graphs for estimation of Pb2+ and Cu 2+were obtained by measuring the CWT amplitudes at zero crossing points for Cu2+ and Pb2+ at the wavelet domain, respectively. The proposed method was validated by simultaneous determination of Cu2+ and Pb2+ ions in red beans, walnut, rice, tea and soil samples. The obtained results of samples with proposed method have been compared with those predicted by partial least squares (PLS) and flame atomic absorption spectrophotometry (FAAS).

  4. An Efficient State–Parameter Filtering Scheme Combining Ensemble Kalman and Particle Filters

    KAUST Repository

    Ait-El-Fquih, Boujemaa

    2017-12-11

    This work addresses the state-parameter filtering problem for dynamical systems with relatively large-dimensional state and low-dimensional parameters\\' vector. A Bayesian filtering algorithm combining the strengths of the particle filter (PF) and the ensemble Kalman filter (EnKF) is proposed. At each assimilation cycle of the proposed EnKF-PF, the PF is first used to sample the parameters\\' ensemble followed by the EnKF to compute the state ensemble conditional on the resulting parameters\\' ensemble. The proposed scheme is expected to be more efficient than the traditional state augmentation techniques, which suffer from the curse of dimensionality and inconsistency that is particularly pronounced when the state is a strongly nonlinear function of the parameters. In the new scheme, the EnKF and PF interact via their ensembles\\' members, in contrast with the recently introduced two-stage EnKF-PF (TS-EnKF-PF), which exchanges point estimates between EnKF and PF while requiring almost double the computational load. Numerical experiments are conducted with the Lorenz-96 model to assess the behavior of the proposed filter and to evaluate its performances against the joint PF, joint EnKF, and TS-EnKF-PF. Numerical results suggest that the EnKF-PF performs best in all tested scenarios. It was further found to be more robust, successfully estimating both state and parameters in different sensitivity experiments.

  5. The Ensemble Kalman filter: a signal processing perspective

    Science.gov (United States)

    Roth, Michael; Hendeby, Gustaf; Fritsche, Carsten; Gustafsson, Fredrik

    2017-12-01

    The ensemble Kalman filter (EnKF) is a Monte Carlo-based implementation of the Kalman filter (KF) for extremely high-dimensional, possibly nonlinear, and non-Gaussian state estimation problems. Its ability to handle state dimensions in the order of millions has made the EnKF a popular algorithm in different geoscientific disciplines. Despite a similarly vital need for scalable algorithms in signal processing, e.g., to make sense of the ever increasing amount of sensor data, the EnKF is hardly discussed in our field. This self-contained review is aimed at signal processing researchers and provides all the knowledge to get started with the EnKF. The algorithm is derived in a KF framework, without the often encountered geoscientific terminology. Algorithmic challenges and required extensions of the EnKF are provided, as well as relations to sigma point KF and particle filters. The relevant EnKF literature is summarized in an extensive survey and unique simulation examples, including popular benchmark problems, complement the theory with practical insights. The signal processing perspective highlights new directions of research and facilitates the exchange of potentially beneficial ideas, both for the EnKF and high-dimensional nonlinear and non-Gaussian filtering in general.

  6. Camelid Single-Domain Antibodies (VHHs against Crotoxin: A Basis for Developing Modular Building Blocks for the Enhancement of Treatment or Diagnosis of Crotalic Envenoming

    Directory of Open Access Journals (Sweden)

    Marcos B. Luiz

    2018-03-01

    Full Text Available Toxic effects triggered by crotalic envenoming are mainly related to crotoxin (CTX, composed of a phospholipase A2 (CB and a subunit with no toxic activity (CA. Camelids produce immunoglobulins G devoid of light chains, in which the antigen recognition domain is called VHH. Given their unique characteristics, VHHs were selected using Phage Display against CTX from Crotalus durissus terrificus. After three rounds of biopanning, four sequence profiles for CB (KF498602, KF498603, KF498604, and KF498605 and one for CA (KF498606 were revealed. All clones presented the VHH hallmark in FR2 and a long CDR3, with the exception of KF498606. After expressing pET22b-VHHs in E. coli, approximately 2 to 6 mg of protein per liter of culture were obtained. When tested for cross-reactivity, VHHs presented specificity for the Crotalus genus and were capable of recognizing CB through Western blot. KF498602 and KF498604 showed thermostability, and displayed affinity constants for CTX in the micro or nanomolar range. They inhibited in vitro CTX PLA2 activity, and CB cytotoxicity. Furthermore, KF498604 inhibited the CTX-induced myotoxicity in mice by 78.8%. Molecular docking revealed that KF498604 interacts with the CA–CB interface of CTX, seeming to block substrate access. Selected VHHs may be alternatives for the crotalic envenoming treatment.

  7. Laboratory evaluation of four commercial repellents against larval Leptotrombidium deliense (Acari: Trombiculidae).

    Science.gov (United States)

    Hanifah, Azima Laili; Ismail, Siti Hazar Awang; Ming, Ho Tze

    2010-09-01

    Four commercial repellents were evaluated in the laboratory against Leptotrombidium deliense chiggers. Both in vitro and in vivo methods were used to determine repellency of the compounds. The repellents were Kellis (containing citronella oil, jojoba oil and tea tree oil), Kaps (containing citronella oil), BioZ (containing citronella oil, geranium oil and lemon grass oil) and Off (containing DEET). The combination of three active ingredients: citronella oil, geranium oil, lemon grass oil gave the highest repellency (87%) followed by DEET (84%). In vitro repellencies ranged from 73% to 87%. There was no significant difference between the four products. All the repellents had 100% in vivo repellency compared to 41-57% for the controls.

  8. GenBank blastn search result: AK242726 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242726 J090045P18 AB079602.1 AB079602 Escherichia coli kpsS, kfoG, kfoF, kfoE, kfoD, kfoIS, kfoC, kf...oB, kfoA, kpsT genes for KpsS hypothetical protein, predicted glycosyltransferase, UDP-glucose dehydrogenase, Kf...oE hypothetical protein, KfoD hypothetical protein, IS hypothetical protein, chondroitin polymerase, Kf

  9. Jenkins essentials

    CERN Document Server

    Soni, Mitesh

    2015-01-01

    If you are a Jenkins novice or beginner with a basic understanding of continuous integration, then this is the book for you. Beginners in Jenkins will get quick hands-on experience and gain the confidence to go ahead and explore the use of Jenkins further.

  10. Teaching Front Handsprings from a Developmental Approach

    Science.gov (United States)

    Stork, Steve

    2006-01-01

    The front handspring is an important gymnastics skill that serves as a transition from beginner-level rolling and static balances to more advanced tumbling. It is, therefore, a skill highly desired by beginners. Early learning requires a great deal of effort during which students experience many failed attempts. Unless they are highly motivated,…

  11. Young Learners and Lexical Awareness: Children's Engagement with Wordlists and Concordances

    Science.gov (United States)

    MacGregor, Alex

    2014-01-01

    Sinclair (1991) found that lexical analysis can be overcomplicated, yet Johns (1994) called for investigation into whether corpus analysis can motivate beginners and near-beginners. The findings of this research suggest that young EFL learners can enjoy using corpus analysis tools (wordlists and concordances) to identify, classify, and generalize…

  12. Learners' Starting Age of Learning EFL and Use of Language Learning Strategies

    Science.gov (United States)

    Sadeghi, Karim; Khonbi, Zainab Abolfazli

    2013-01-01

    This study investigated the use of language learning strategies (LLS) and reasons for learning English among Iranian EFL students who began learning English at different ages. The participants (N = 33, both male and female) were divided into two groups of younger beginners (who began learning English before age 9; N = 16) and older beginners (who…

  13. Mobile-Based Chatting for Meaning Negotiation in Foreign Language Learning

    Science.gov (United States)

    Castrillo, María Dolores; Martín-Monje, Elena; Bárcena, Elena

    2014-01-01

    This paper analyzes the adequacy of mobile chatting via Whatsapp for the enhancement of a type of spontaneous and colloquial written interaction which has a strong connection with oral discourse. This is part of a research project undertaken with Spanish students of German as a foreign language with a beginner's or quasi-beginner's level. The…

  14. Evaluating the Learning Process of Mechanical CAD Students

    Science.gov (United States)

    Hamade, R. F.; Artail, H. A.; Jaber, M. Y.

    2007-01-01

    There is little theoretical or experimental research on how beginner-level trainees learn CAD skills in formal training sessions. This work presents findings on how trainees develop their skills in utilizing a solid mechanical CAD tool (Pro/Engineer version 2000i[squared] and later version Wildfire). Exercises at the beginner and intermediate…

  15. The CAMILLE Project: Espana Interactiva (The CAMILLE Project: Interactive Spanish).

    Science.gov (United States)

    Gimeno, Ana; Ingraham, Bruce

    CAMILLE's primary objective is to exploit recent developments in multimedia computing to create a flexible, student-centered, electronic language learning environment to support the acquisition of a second language. The consortium's first target was to produce a learning resource for beginners of Spanish and another for beginners of Dutch, as well…

  16. Dicty_cDB: VFO569 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available smnyqlvvlkvllxf*vlmxqh*ilhlilqhhmxkihnllx kf*hmviihhq*pi*evxliqpm*RQQDVQVEHHVQXILVIFKQMVVMFEAQTISLN--- ---NF...llikvivmlvvlvvvkvsll*fkmxttv*ifqwigngmsfvq Frame C: f*fqlfplqkpixnmlfvnsmnyqlvvlkvllxf*vlmxqh*ilhlilqhhmx

  17. A One-Step-Ahead Smoothing-Based Joint Ensemble Kalman Filter for State-Parameter Estimation of Hydrological Models

    KAUST Repository

    El Gharamti, Mohamad

    2015-11-26

    The ensemble Kalman filter (EnKF) recursively integrates field data into simulation models to obtain a better characterization of the model’s state and parameters. These are generally estimated following a state-parameters joint augmentation strategy. In this study, we introduce a new smoothing-based joint EnKF scheme, in which we introduce a one-step-ahead smoothing of the state before updating the parameters. Numerical experiments are performed with a two-dimensional synthetic subsurface contaminant transport model. The improved performance of the proposed joint EnKF scheme compared to the standard joint EnKF compensates for the modest increase in the computational cost.

  18. Export financing of nuclear power plants - banks experience

    International Nuclear Information System (INIS)

    Loeber

    1976-01-01

    Export financing of a nuclear power plant to be exported from Germany, is, in principle, provided by German commercial banks and KfW (Kreditanstalt fuer Wiederaufbau). As a rule, 50 per cent of the financing of maturities falling due under the export portion of the loan will be taken over by a banking syndicate of approximately 25 member banks, and the remaining 50 per cent would be provided by KfW. KfW and the commercial banks must grant their loans at the respective money market conditions. The banks' and KfW's loans will normally be disbursed pro rata delivery. (HP) [de

  19. A hybrid nudging-ensemble Kalman filter approach to data assimilation. Part I: application in the Lorenz system

    Directory of Open Access Journals (Sweden)

    Lili Lei

    2012-05-01

    Full Text Available A hybrid data assimilation approach combining nudging and the ensemble Kalman filter (EnKF for dynamic analysis and numerical weather prediction is explored here using the non-linear Lorenz three-variable model system with the goal of a smooth, continuous and accurate data assimilation. The hybrid nudging-EnKF (HNEnKF computes the hybrid nudging coefficients from the flow-dependent, time-varying error covariance matrix from the EnKF's ensemble forecasts. It extends the standard diagonal nudging terms to additional off-diagonal statistical correlation terms for greater inter-variable influence of the innovations in the model's predictive equations to assist in the data assimilation process. The HNEnKF promotes a better fit of an analysis to data compared to that achieved by either nudging or incremental analysis update (IAU. When model error is introduced, it produces similar or better root mean square errors compared to the EnKF while minimising the error spikes/discontinuities created by the intermittent EnKF. It provides a continuous data assimilation with better inter-variable consistency and improved temporal smoothness than that of the EnKF. Data assimilation experiments are also compared to the ensemble Kalman smoother (EnKS. The HNEnKF has similar or better temporal smoothness than that of the EnKS, and with much smaller central processing unit (CPU time and data storage requirements.

  20. Dicty_cDB: CHE515 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hvpkkxv*lilqsilmitmhvplipvhhqlvfptlqltvmi vnpctidscnnstglxxhsnqw****slvp*ih--- --...FGLXGGFXGGGTXGKXDCXTCKN*xtxfi*lxfkk ixkkfxkkfxkkkklfvflsniynf*k*kf Frame C: nkctvdscsnstgcvntpincddsnpctvdscnns

  1. Global Kalman filter approaches to estimate absolute angles of lower limb segments.

    Science.gov (United States)

    Nogueira, Samuel L; Lambrecht, Stefan; Inoue, Roberto S; Bortole, Magdo; Montagnoli, Arlindo N; Moreno, Juan C; Rocon, Eduardo; Terra, Marco H; Siqueira, Adriano A G; Pons, Jose L

    2017-05-16

    In this paper we propose the use of global Kalman filters (KFs) to estimate absolute angles of lower limb segments. Standard approaches adopt KFs to improve the performance of inertial sensors based on individual link configurations. In consequence, for a multi-body system like a lower limb exoskeleton, the inertial measurements of one link (e.g., the shank) are not taken into account in other link angle estimations (e.g., foot). Global KF approaches, on the other hand, correlate the collective contribution of all signals from lower limb segments observed in the state-space model through the filtering process. We present a novel global KF (matricial global KF) relying only on inertial sensor data, and validate both this KF and a previously presented global KF (Markov Jump Linear Systems, MJLS-based KF), which fuses data from inertial sensors and encoders from an exoskeleton. We furthermore compare both methods to the commonly used local KF. The results indicate that the global KFs performed significantly better than the local KF, with an average root mean square error (RMSE) of respectively 0.942° for the MJLS-based KF, 1.167° for the matrical global KF, and 1.202° for the local KFs. Including the data from the exoskeleton encoders also resulted in a significant increase in performance. The results indicate that the current practice of using KFs based on local models is suboptimal. Both the presented KF based on inertial sensor data, as well our previously presented global approach fusing inertial sensor data with data from exoskeleton encoders, were superior to local KFs. We therefore recommend to use global KFs for gait analysis and exoskeleton control.

  2. Assessing performance of Bayesian state-space models fit to Argos satellite telemetry locations processed with Kalman filtering.

    Science.gov (United States)

    Silva, Mónica A; Jonsen, Ian; Russell, Deborah J F; Prieto, Rui; Thompson, Dave; Baumgartner, Mark F

    2014-01-01

    Argos recently implemented a new algorithm to calculate locations of satellite-tracked animals that uses a Kalman filter (KF). The KF algorithm is reported to increase the number and accuracy of estimated positions over the traditional Least Squares (LS) algorithm, with potential advantages to the application of state-space methods to model animal movement data. We tested the performance of two Bayesian state-space models (SSMs) fitted to satellite tracking data processed with KF algorithm. Tracks from 7 harbour seals (Phoca vitulina) tagged with ARGOS satellite transmitters equipped with Fastloc GPS loggers were used to calculate the error of locations estimated from SSMs fitted to KF and LS data, by comparing those to "true" GPS locations. Data on 6 fin whales (Balaenoptera physalus) were used to investigate consistency in movement parameters, location and behavioural states estimated by switching state-space models (SSSM) fitted to data derived from KF and LS methods. The model fit to KF locations improved the accuracy of seal trips by 27% over the LS model. 82% of locations predicted from the KF model and 73% of locations from the LS model were Argos data. On average, 88% of whale locations estimated by KF models fell within the 95% probability ellipse of paired locations from LS models. Precision of KF locations for whales was generally higher. Whales' behavioural mode inferred by KF models matched the classification from LS models in 94% of the cases. State-space models fit to KF data can improve spatial accuracy of location estimates over LS models and produce equally reliable behavioural estimates.

  3. Real-time muscle state estimation from EMG signals during isometric contractions using Kalman filters.

    Science.gov (United States)

    Menegaldo, Luciano L

    2017-12-01

    State-space control of myoelectric devices and real-time visualization of muscle forces in virtual rehabilitation require measuring or estimating muscle dynamic states: neuromuscular activation, tendon force and muscle length. This paper investigates whether regular (KF) and extended Kalman filters (eKF), derived directly from Hill-type muscle mechanics equations, can be used as real-time muscle state estimators for isometric contractions using raw electromyography signals (EMG) as the only available measurement. The estimators' amplitude error, computational cost, filtering lags and smoothness are compared with usual EMG-driven analysis, performed offline, by integrating the nonlinear Hill-type muscle model differential equations (offline simulations-OS). EMG activity of the three triceps surae components (soleus, gastrocnemius medialis and gastrocnemius lateralis), in three torque levels, was collected for ten subjects. The actualization interval (AI) between two updates of the KF and eKF was also varied. The results show that computational costs are significantly reduced (70x for KF and 17[Formula: see text] for eKF). The filtering lags presented sharp linear relationships with the AI (0-300 ms), depending on the state and activation level. Under maximum excitation, amplitude errors varied in the range 10-24% for activation, 5-8% for tendon force and 1.4-1.8% for muscle length, reducing linearly with the excitation level. Smoothness, measured by the ratio between the average standard variations of KF/eKF and OS estimations, was greatly reduced for activation but converged exponentially to 1 for the other states by increasing AI. Compared to regular KF, extended KF does not seem to improve estimation accuracy significantly. Depending on the particular application requirements, the most appropriate KF actualization interval can be selected.

  4. An Adjoint-Based Adaptive Ensemble Kalman Filter

    KAUST Repository

    Song, Hajoon

    2013-10-01

    A new hybrid ensemble Kalman filter/four-dimensional variational data assimilation (EnKF/4D-VAR) approach is introduced to mitigate background covariance limitations in the EnKF. The work is based on the adaptive EnKF (AEnKF) method, which bears a strong resemblance to the hybrid EnKF/three-dimensional variational data assimilation (3D-VAR) method. In the AEnKF, the representativeness of the EnKF ensemble is regularly enhanced with new members generated after back projection of the EnKF analysis residuals to state space using a 3D-VAR [or optimal interpolation (OI)] scheme with a preselected background covariance matrix. The idea here is to reformulate the transformation of the residuals as a 4D-VAR problem, constraining the new member with model dynamics and the previous observations. This should provide more information for the estimation of the new member and reduce dependence of the AEnKF on the assumed stationary background covariance matrix. This is done by integrating the analysis residuals backward in time with the adjoint model. Numerical experiments are performed with the Lorenz-96 model under different scenarios to test the new approach and to evaluate its performance with respect to the EnKF and the hybrid EnKF/3D-VAR. The new method leads to the least root-mean-square estimation errors as long as the linear assumption guaranteeing the stability of the adjoint model holds. It is also found to be less sensitive to choices of the assimilation system inputs and parameters.

  5. Molecular Characterization of Yeast Strains Isolated from Different Sources by Restriction Fragment Length Polymorphism

    International Nuclear Information System (INIS)

    Ali, M. S.; Latif, Z.

    2016-01-01

    Various molecular techniques like analysis of the amplified rDNA internal transcribed spacers (ITS), intragenic spacers and total ITS region analysis by restriction fragment length polymorphism (RFLP) has been introduced for yeast identification but there are limited databases to identify yeast species on the basis of 5.8S rDNA. In this study, twenty nine yeast strains from various sources including spoiled fruits, vegetables, foodstuffs, and concentrated juices were characterized by PCR-RFLP. PCR-RFLP has been used to characterize yeasts present in different spoiled food samples after isolation of the yeasts. By using this technique, the isolated yeast strains were characterized by direct 5.8S-ITS rDNA region amplification. RFLP analysis was applied to each of the amplification products (varied from 400bp to 800bp) detected, and the corresponding yeast identifications were made according to each specific restriction patterns obtained after treatment with two endonucleases TaqI and HaeIII which yielded a specific banding pattern for each species. For further confirmation amplified products of eleven selected isolates were sequenced and blast on NCBI. Both RFLP and sequence analyses of the strains with accession nos. KF472163, KF472164, KF472165, KF472166, KF472167, KF472168, KF472169, KF472170, KF472171, KF472172, KF472173 gave significantly similar results. The isolates were found to belong five different yeast species including; Candida spp., Pichia spp., Kluyveromyces spp., Clavispora spp. and Hanseniaspora spp. This method provides a fast, easy, reliable and authentic way for determining yeast population present in different type of samples, as compared to traditional characterization technique. (author)

  6. Pour une nouvelle approche de l'hispanité grâce aux TICE - La formation d'enseignants d'espagnol langue étrangère Towards a new approach of Hispanic culture thanks to ICT - Beginners training for Spanish language teachers

    Directory of Open Access Journals (Sweden)

    Veronique Pugibet

    2006-04-01

    Full Text Available Si désormais les divers pays et cultures du monde hispanique figurent dans les programmes officiels de l'apprentissage de l'espagnol langue étrangère en France, l'approche qui en est proposée demeure encore souvent traditionnelle, une certaine vision de l'histoire et les "beaux" textes dominant largement. Comment amener les jeunes enseignants en formation initiale à porter un regard différent sur l'autre, à atteindre une véritable compétence culturelle dépassant la culture académique ? Nous rendrons compte dans notre étude de la spécificité de la formation initiale des professeurs d'espagnol qui, dorénavant, sont de plus en plus nombreux à être d'origine hispanophone. Nous exposerons leur parcours de formation sur et grâce aux TICE afin de dépasser les clichés réducteurs initiaux comme en témoignent leur approche première sur Internet, et en vue d'atteindre un regard plus ouvert sur l'hispanité et des pratiques pédagogiques différentes.Despite the ongoing presence of several Hispanic countries and cultures in state programs concerning Spanish as a foreign language in French education, the suggested methodology remains very often traditional with a predominantly biased vision of history as well as texts that are considered "beautiful". How can we help young teachers in their initial training to have a different perception of the other, to reach a true cultural competence that surpasses academic culture? We will show in our study the details involved in a Spanish teacher's initial training since, as it appears, they tend to be more and more of Hispanic origin. We will describe their training history through and thanks to the TICE in order to overcome the reductive and stereotyping clichés as they move initially towards the use of Internet, and in order to reach out for a more open perception of the Hispanic World and of different pedagogical practices.

  7. Fiche pratique: Elaborer un texte ecrit avec des debutants; Frequence FDM: Les journees du patrimoine; "Bonne annee"...en kit; Cles pour une expo... (Practical Ideas: Elaborating on a Written Text with Beginners; Frequency FDM: Heritage Days; "Happy New Year"...In a Kit; Keys to an Exhibition).

    Science.gov (United States)

    Royer, Corinne; And Others

    1996-01-01

    Four French classroom activities are described, including an introductory exercise in French for special purposes (business administration), a cultural exploration activity using a commercial audiotape, holiday card-writing, and an exercise in interpreting an art or other exhibition. (MSE)

  8. Genetics Home Reference: Williams syndrome

    Science.gov (United States)

    ... CA, Berman KF. Neural correlates of genetically abnormal social cognition in Williams syndrome. Nat Neurosci. 2005 Aug;8(8):991-3. Epub 2005 Jul 10. Citation on PubMed Meyer-Lindenberg A, Mervis CB, Berman KF. Neural mechanisms in Williams syndrome: a unique window to genetic ...

  9. Identification of a premature termination of DNA polymerization in ...

    Indian Academy of Sciences (India)

    It was also identified that deletions of more than four residues of KF thumb subdomain could induce PmTP, and two-residue deletion of KF thumb subdomain only ... Key Laboratory of Medical Cell Biology of Ministry of Education, China Medical University, Shenyang, China; Animal Science and Veterinary Medicine College, ...

  10. Fast Kalman-like filtering for large-dimensional linear and Gaussian state-space models

    KAUST Repository

    Ait-El-Fquih, Boujemaa

    2015-08-13

    This paper considers the filtering problem for linear and Gaussian state-space models with large dimensions, a setup in which the optimal Kalman Filter (KF) might not be applicable owing to the excessive cost of manipulating huge covariance matrices. Among the most popular alternatives that enable cheaper and reasonable computation is the Ensemble KF (EnKF), a Monte Carlo-based approximation. In this paper, we consider a class of a posteriori distributions with diagonal covariance matrices and propose fast approximate deterministic-based algorithms based on the Variational Bayesian (VB) approach. More specifically, we derive two iterative KF-like algorithms that differ in the way they operate between two successive filtering estimates; one involves a smoothing estimate and the other involves a prediction estimate. Despite its iterative nature, the prediction-based algorithm provides a computational cost that is, on the one hand, independent of the number of iterations in the limit of very large state dimensions, and on the other hand, always much smaller than the cost of the EnKF. The cost of the smoothing-based algorithm depends on the number of iterations that may, in some situations, make this algorithm slower than the EnKF. The performances of the proposed filters are studied and compared to those of the KF and EnKF through a numerical example.

  11. An iterative ensemble Kalman filter for reservoir engineering applications

    NARCIS (Netherlands)

    Krymskaya, M.V.; Hanea, R.G.; Verlaan, M.

    2009-01-01

    The study has been focused on examining the usage and the applicability of ensemble Kalman filtering techniques to the history matching procedures. The ensemble Kalman filter (EnKF) is often applied nowadays to solving such a problem. Meanwhile, traditional EnKF requires assumption of the

  12. Novel Kalman filter algorithm for statistical monitoring of extensive landscapes with synoptic sensor data

    Science.gov (United States)

    Raymond L. Czaplewski

    2015-01-01

    Wall-to-wall remotely sensed data are increasingly available to monitor landscape dynamics over large geographic areas. However, statistical monitoring programs that use post-stratification cannot fully utilize those sensor data. The Kalman filter (KF) is an alternative statistical estimator. I develop a new KF algorithm that is numerically robust with large numbers of...

  13. Application of an Ensemble Kalman filter to a 1-D coupled hydrodynamic-ecosystem model of the Ligurian Sea

    NARCIS (Netherlands)

    Lenartz, F.; Raick, C.; Soetaert, K.E.R.; Grégoire, M.

    2007-01-01

    The Ensemble Kalman filter (EnKF) has been applied to a 1-D complex ecosystem model coupled with a hydrodynamic model of the Ligurian Sea. In order to improve the performance of the EnKF, an ensemble subsampling strategy has been used to better represent the covariance matrices and a pre-analysis

  14. 'Knocking-fingers' chest compression technique in infant cardiac arrest: single-rescuer manikin study.

    Science.gov (United States)

    Jung, Woo Jin; Hwang, Sung Oh; Kim, Hyung Il; Cha, Yong Sung; Kim, Oh Hyun; Kim, Hyun; Lee, Kang Hyun; Cha, Kyoung-Chul

    2018-01-30

    We designed a new chest compression technique, the 'knocking-fingers' chest compression (KF) technique, for a single rescuer in infant cardiac arrest. We compared the effectiveness and feasibility between the KF technique and the two-finger (TF) and two-thumb encircling hands (TT) techniques. A prospective, randomized, crossover study was carried out to compare the quality of chest compression and ventilation between the KF, TF, and TT techniques using a 30 : 2 compression-to-ventilation ratio and mouth-to-mouth ventilation. The area of chest compression, finger(s) pain, and fatigability were measured to compare safety and feasibility. The total frequency of chest compression for 5 min was the highest with the KF technique, followed by the TF and TT techniques. The total frequency of ventilation for 5 min was higher with the KF and TF techniques compared with the TT technique. The total hands-off time was the shortest with the KF technique, followed by the TF and TT techniques. The area of chest compression was the smallest in KF technique. Participants complained of severe finger pain and high fatigability in TF technique. The single-rescuer KF chest compression technique is an effective alternative to the TF or TT techniques for infant cardiac arrest.

  15. Kölliker-Fuse GABAergic and glutamatergic neurons project to distinct targets.

    Science.gov (United States)

    Geerling, Joel C; Yokota, Shigefumi; Rukhadze, Irma; Roe, Dan; Chamberlin, Nancy L

    2017-06-01

    The Kölliker-Fuse nucleus (KF) is known primarily for its respiratory function as the "pneumotaxic center" or "pontine respiratory group." Considered part of the parabrachial (PB) complex, KF contains glutamatergic neurons that project to respiratory-related targets in the medulla and spinal cord (Yokota, Oka, Tsumori, Nakamura, & Yasui, 2007). Here we describe an unexpected population of neurons in the caudal KF and adjacent lateral crescent subnucleus (PBlc), which are γ-aminobutyric acid (GABA)ergic and have an entirely different pattern of projections than glutamatergic KF neurons. First, immunofluorescence, in situ hybridization, and Cre-reporter labeling revealed that many of these GABAergic neurons express FoxP2 in both rats and mice. Next, using Cre-dependent axonal tracing in Vgat-IRES-Cre and Vglut2-IRES-Cre mice, we identified different projection patterns from GABAergic and glutamatergic neurons in this region. GABAergic neurons in KF and PBlc project heavily and almost exclusively to trigeminal sensory nuclei, with minimal projections to cardiorespiratory nuclei in the brainstem, and none to the spinal cord. In contrast, glutamatergic KF neurons project heavily to the autonomic, respiratory, and motor regions of the medulla and spinal cord previously identified as efferent targets mediating KF cardiorespiratory effects. These findings identify a novel, GABAergic subpopulation of KF/PB neurons with a distinct efferent projection pattern targeting the brainstem trigeminal sensory system. Rather than regulating breathing, we propose that these neurons influence vibrissal sensorimotor function. © 2017 Wiley Periodicals, Inc.

  16. Pressure-induced structural transition of nonionic micelles

    Indian Academy of Sciences (India)

    increased. On addition of KF, rod-like micelles exist at ambient pressure, which results in rod-like to lamellar structural transition at a much lower pressure in the presence of KF. Micellar structural transitions have been observed to be reversible. Keywords. Micelles; dynamic light scattering, small angle neutron scattering.

  17. Kaempferide Prevents Titanium Particle Induced Osteolysis by Suppressing JNK Activation during Osteoclast Formation.

    Science.gov (United States)

    Jiao, Zixian; Xu, Weifeng; Zheng, Jisi; Shen, Pei; Qin, An; Zhang, Shanyong; Yang, Chi

    2017-11-30

    Kaempferide (KF) is an O-methylated flavonol, a natural plant extract, which is often found in Kaempferia galanga. It has a variety of effects including anti-carcinogenic, anti-inflammatory, anti-oxidant, anti-bacterial and anti-viral properties. In this study, we aimed to investigate whether KF effectively inhibits titanium particle induced calvarial bone loss via down regulation of the JNK signaling pathway. In the mice with titanium particle induced calvarial osteolysis, the Low dose of KF mildly reduced the resorption pits while in the high dose group, fewer scattered pits were observed on the surface of calvarium. Histological examination showed fewer osteoclasts formation in the KF group. In mouse bone marrow macrophages (BMMs) and RAW264.7 cells, KF significantly inhibited the osteoclast formation and bone resorption at 12.5 μM. However, KF does not affect the mature osteoclast F-actin ring formation. But when being co-treated with KF and anisomycin, BMMs differentiated into mature osteoclasts. At the molecular levels, the JNK phosphorylation was inhibited and the osteoclastogenesis-related specific gene expression including V-ATPase d2, TRAP, calcitonin receptor (CTR), c-Fos and NFATc1 was markedly suppressed. In conclusion, these results indicated that KF is a promising agent in the treatment of osteoclast-related diseases.

  18. Joint history matching of well data and surface subsidence observations using the Ensemble Kalman Filter: A field study

    NARCIS (Netherlands)

    Wilschut, F.; Peters, E.; Visser, K.; Fokker, P.A.; Hooff, P.M.E. van

    2011-01-01

    The number of reported applications of the Ensemble Kalman Filter (EnKF) for history matching reservoir models is increasing steadily for various reasons. Here, we report on exploiting the capability of EnKF to handle observations from different sources simultaneously. While traditionally only well

  19. Investigation of Adaptive Robust Kalman Filtering Algorithms for GPS/DR Navigation System Filters

    Science.gov (United States)

    Elzoghby, MOSTAFA; Arif, USMAN; Li, FU; Zhi Yu, XI

    2017-03-01

    The conventional Kalman filter (KF) algorithm is suitable if the characteristic noise covariance for states as well as measurements is readily known but in most cases these are unknown. Similarly robustness is required instead of smoothing if states are changing abruptly. Such an adaptive as well as robust Kalman filter is vital for many real time applications, like target tracking and navigating aerial vehicles. A number of adaptive as well as robust Kalman filtering methods are available in the literature. In order to investigate the performance of some of these methods, we have selected three different Kalman filters, namely Sage Husa KF, Modified Adaptive Robust KF and Adaptively Robust KF, which are easily simulate able as well as implementable for real time applications. These methods are simulated for land based vehicle and the results are compared with conventional Kalman filter. Results show that the Modified Adaptive Robust KF is best amongst the selected methods and can be used for Navigation applications.

  20. Mean-field Ensemble Kalman Filter

    KAUST Repository

    Law, Kody

    2015-01-07

    A proof of convergence of the standard EnKF generalized to non-Gaussian state space models is provided. A density-based deterministic approximation of the mean-field limiting EnKF (MFEnKF) is proposed, consisting of a PDE solver and a quadrature rule. Given a certain minimal order of convergence between the two, this extends to the deterministic filter approximation, which is therefore asymptotically superior to standard EnKF for d < 2 . The fidelity of approximation of the true distribution is also established using an extension of total variation metric to random measures. This is limited by a Gaussian bias term arising from non-linearity/non-Gaussianity of the model, which arises in both deterministic and standard EnKF. Numerical results support and extend the theory.