WorldWideScience

Sample records for bioz kf beginn

  1. Quantum Physics for Beginners.

    Science.gov (United States)

    Strand, J.

    1981-01-01

    Suggests a new approach for teaching secondary school quantum physics. Reviews traditional approaches and presents some characteristics of the three-part "Quantum Physics for Beginners" project, including: quantum physics, quantum mechanics, and a short historical survey. (SK)

  2. Liferay Beginner's Guide

    CERN Document Server

    Chen, Robert; Bhatt, Samir

    2011-01-01

    Part of Packt's Beginner's Guide series, each chapter follows the creation of a fictional neighbourhood site to demonstrate an aspect of Liferay portal with practical examples, screenshots, and step-by-step instructions. All you need in order to benefit from the Liferay Beginner's Guide is programming experience. No prior knowledge of Liferay is required, although experienced Liferay portal programmers who need to get up to speed with its latest features will also find this book useful.

  3. Joomla! 25 Beginner's Guide

    CERN Document Server

    Tiggeler, Eric

    2012-01-01

    Written with a fast-paced but friendly and engaging approach, this Packt Beginner's guide is designed to be placed alongside the computer as your guide and mentor. Step-by-step tutorials are bolstered by explanations of the reasoning behind what you are doing. You will quickly pick up the necessary skills, tips, and tricks for building a successful Joomla! website. This book is written for beginners to website design. By the end of the book you will have built a complete custom content managed website, and be ready to build any kind of website.

  4. PrimeFaces beginner's guide

    CERN Document Server

    Reddy, K Siva Prasad

    2013-01-01

    A guide for beginner's with step-by-step instructions and an easy-to-follow approach.PrimeFaces Beginners Guide is a simple and effective guide for beginners, wanting to learn and implement PrimeFaces in their JSF-based applications. Some basic JSF and jQuery skills are required before you start working through the book.

  5. JBoss ESB Beginner's Guide

    CERN Document Server

    DiMaggio, Len; Magesh, Kumar

    2012-01-01

    Part of Packt's Beginner's Guide series, each chapter contains practical examples with step-by-step instructions and plenty of screenshots to guide you through the implementation of JBoss ESB. This book is intended for Java programmers although you don't need previous experience with middleware such as application servers or ESBs.

  6. concrete5 Beginner's Guide

    CERN Document Server

    Laubacher, Remo

    2011-01-01

    This book is part of Packt's Beginner's Guide series. You will be guided through the set up of a Concrete5 site with step-by-step practical examples. This book is ideal for developers who would like to build their first site with Concrete5. Some k

  7. Nuclear power for beginners

    International Nuclear Information System (INIS)

    Croall, S.; Sempler, K.

    1979-01-01

    Witty, critically, and with expert knowledge, 'Atomic power for beginners' describes the development of nuclear power for military purposes and its 'peaceful uses' against the will of the population. Atomic power, the civil baby of the bomb is not only a danger to our lives - it is enemy to all life as all hard technologies are on which economic systems preoccupied with growth put their hopes. Therefore, 'Atomic power for beginners' does not stop at nuclear engineering but proceeds to investigate its consequences, nationally and with a view to the Third World. And since the consequences are so fatal and it is not enough to say no to nuclear power, it gives some thoughts to a better future - with soft technology and alternative production. (orig.) 891 HP/orig. 892 MKO [de

  8. French courses for Beginners

    CERN Multimedia

    HR Department

    2009-01-01

    French courses for beginners (level 0) will take place from 13 July to 27 August 2009. •\tTimetable: Mondays, Tuesdays, Wednesdays, Thursdays (11:00 to 13:00 or 13:30 to 15:30) •\tDuration: 56 hours (8 hours a week) •\tPrice: 728 CHF For registration and further information on the courses, please consult our Web pages: http://cern.ch/Training or contact Mrs. Dumeaux, tel. 78144.

  9. French courses for Beginners

    CERN Multimedia

    HR Department

    2009-01-01

    French courses for beginners (level 0) will take place from 13 July to 27 August 2009. •\tTimetable: Mondays, Tuesdays, Wednesdays, Thursdays (11:00 to 13:00 or 13:30 to 15:30) •\tDuration: 56 hours (8 hours a week) •\tPrice: 728 CHF For registration and further information on the courses, please consult our Web pages: http://cern.ch/Training or contact Mrs. Dumeaux: Tel. 78144.

  10. French courses for Beginners

    CERN Multimedia

    HR Department

    2009-01-01

    French courses for beginners (level 0) will take place from 13 July to 27 August 2009. •\tTimetable: Mondays, Tuesdays, Wednesdays, Thursdays (11.00 to 13.00 or 13.30 to 15.30) •\tDuration: 56 hours (8 hours a week) •\tPrice: 728 CHF For registration and further information on the courses, please consult our Web pages: http://cern.ch/Training or contact Mrs. Dumeaux : Tel. 78144.

  11. Joomla! 3 beginner's guide

    CERN Document Server

    Tiggeler, Eric

    2014-01-01

    An easy to use, step-by-step guide to creating professional, mobile-friendly websites with the free Joomla CMS. The Joomla! 3 Beginner's Guide Second Edition is the ultimate guide for web developers who wish to build upon their skills and knowledge on creating websites. Even if you're new to this subject, you won't have any difficulty understanding the clear and friendly instructions and explanations. No prior knowledge of HTML and CSS is required.

  12. Android NDK Beginner's Guide

    CERN Document Server

    Ratabouil, Sylvain

    2012-01-01

    This beginner's guide focuses on getting you through all the major learning points in a smooth, logical order. You'll also see how to avoid some common pitfalls. Are you an Android Java programmer who needs more performance? Are you a C/C++ developer who doesn't want to bother with Java stuff and its out-of-control garbage collector? Do you want to create fast intensive multimedia applications or games? Answer yes to any of the above and this book is for you. With some general knowledge of C/C++ development, you will be able to dive head first into native Android development.

  13. qooxdoo Beginner's Guide

    CERN Document Server

    Raffi, Mohamed

    2011-01-01

    This is a Packt beginner's guide. The unique style of the book is to set the requirements for an application, Team Twitter, in the first chapter and apply the concepts in the application as you learn in the following chapters. When you complete this book, you would have developed a complete application. Although the scope of this book is only on the Qooxdoo framework, which is a client side framework, we have explained how to set up one of the RPC servers and demonstrated the end to end application in the Team Twitter. This book is intended for the client side developers who design and develop

  14. Stochastic cooling for beginners

    International Nuclear Information System (INIS)

    Moehl, D.

    1984-01-01

    These two lectures have been prepared to give a simple introduction to the principles. In Part I we try to explain stochastic cooling using the time-domain picture which starts from the pulse response of the system. In Part II the discussion is repeated, looking more closely at the frequency-domain response. An attempt is made to familiarize the beginners with some of the elementary cooling equations, from the 'single particle case' up to equations which describe the evolution of the particle distribution. (orig.)

  15. CFEngine 3 Beginner's Guide

    CERN Document Server

    Rajneesh

    2011-01-01

    Part of Packt's Beginner's Guide series, this book guides you through setting up Cfengine to maximizing its potential. This book focuses on getting you through all the major learning points in a smooth, logical order. You'll also learn how to avoid some common pitfalls. If you are a System Administrator or Configuration manager with a growing infrastructure and if you are looking for a dependable tool to manage your infrastructure, then this book is for you. If your infrastructure is already big with hundreds and thousands of nodes and you are looking for a secure, versatile and stable configu

  16. Astronomy for beginners

    CERN Document Server

    Becan, Jeff

    2008-01-01

    Astronomy For Beginners is a friendly and accessible guide to our universe, our galaxy, our solar system and the planet we call home. Each year as we cruise through space on this tiny blue-green wonder, a number of amazing and remarkable events occur. For example, like clockwork, we'll run head-on into asteroid and cometary debris that spreads shooting stars across our skies. On occasion, we'll get to watch the disk of the Moon passing the Sun, casting its shadow on the face of the Earth, and sometimes we'll get to watch our own shadow as it glides across the face of the Moon. The Sun's path w

  17. French courses for beginners

    CERN Multimedia

    Françoise Benz

    2006-01-01

    If you wish to participate in one of the following courses, please tell to your supervisor and apply electronically from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an 'application for training'form available from your Departmental Secretariat or from your DTO (Departmental Training Officer). Applications will be accepted in the order in which they are received. French courses for beginners (level 0) From 17 July to 31 August 2006. Mondays, Tuesdays, Wednesdays and Thursdays(8 hours a week / between 11.00 and 15.30) Duration: 56 hours Price: 728 CHF For registration and further information on the courses, please consult our Web pages: http://cern.ch/Training or contact Mrs. Benz: Tel. 73127.

  18. KF-1 ubiquitin ligase: an anxiety suppressor

    Directory of Open Access Journals (Sweden)

    Tamotsu Hashimoto-Gotoh

    2009-05-01

    Full Text Available Anxiety is an instinct that may have developed to promote adaptive survival by evading unnecessary danger. However, excessive anxiety is disruptive and can be a basic disorder of other psychiatric diseases such as depression. The KF-1, a ubiquitin ligase located to the endoplasmic reticulum (ER, may prevent excessive anxiety; kf-1−/− mice exhibit selectively elevated anxiety-like behavior against light or heights. Thus, KF-1 may degrade some target proteins, responsible for promoting anxiety, through the ER-associated degradation pathway, similar to Parkin in Parkinson's disease (PD. Parkin, another ER-ubiquitin ligase, prevents the degeneration of dopaminergic neurons by degrading the target proteins responsible for PD. Molecular phylogenetic studies have revealed that the prototype of kf-1 appeared in the very early phase of animal evolution but was lost, unlike parkin, in the lineage leading up to Drosophila. Therefore, kf-1−/− mice, be a powerful tool for elucidating the molecular mechanisms involved in emotional regulation, and for screening novel anxiolytic/antidepressant compounds.

  19. Manga studio 5 beginner's guide

    CERN Document Server

    Rhodes, Richard

    2014-01-01

    Using a step-by-step approach, this book will lead you through the process of building up complex, multi-page comic/Manga art, along with industry insights along the way. ""Manga Studio Beginner's Guide"" is for beginners in comic creation. The more you know about how comics are made, the better you will be, but it's not essential to get the most out of this book. Even if you're a professional comic artist, this book will get you up to speed on using Manga Studio 5.

  20. Interesting Instruction of Programming for Beginners

    OpenAIRE

    横井, 仁史; Hitoshi, YOKOI; 聖徳学園女子短期大学; Shotoku Gakuen Women's Junior Collge

    1994-01-01

    Programming needs logoical thinking as mathematics. But I have an experience that I insturucted Programming for beginners as mathematics, then most of students did not like Prgramming. Interesting Insturuction for example to make pictures and games in computer fits for beginners. So I show Interesting Insturuction of programming for beginners in SHOTOKU Juior College.

  1. TestNG beginner's guide

    CERN Document Server

    Menon, Varun

    2013-01-01

    This book is written in a friendly, beginner's guide style with plenty of step-by-step instructions with appropriate examples.This book is great for developers and testers who are new to TestNg and want to learn how to use TestNG for writing their application as well as functional tests. This book assumes that you have experience in Java and OOPs concepts and have worked with certain IDE.

  2. GeoServer beginner's guide

    CERN Document Server

    Youngblood, Brian

    2013-01-01

    Step-by-step instructions are included and the needs of a beginner are totally satisfied by the book. The book consists of plenty of examples with accompanying screenshots and code for an easy learning curve. You are a web developer with knowledge of server side scripting, and have experience with installing applications on the server. You have a desire to want more than Google maps, by offering dynamically built maps on your site with your latest geospatial data stored in MySQL, PostGIS, MsSQL or Oracle. If this is the case, this book is meant for you.

  3. Android Apps for Absolute Beginners

    CERN Document Server

    Jackson, Wallace

    2011-01-01

    Anybody can start building simple apps for the Android platform, and this book will show you how! Android Apps for Absolute Beginners takes you through the process of getting your first Android applications up and running using plain English and practical examples. It cuts through the fog of jargon and mystery that surrounds Android application development, and gives you simple, step-by-step instructions to get you started.* Teaches Android application development in language anyone can understand, giving you the best possible start in Android development * Provides simple, step-by-step exampl

  4. Android 30 Animations Beginner's Guide

    CERN Document Server

    Shaw, Alex

    2011-01-01

    Written in Packt's Beginner's Guide series, this book takes a step-by-step approach with each chapter made up of three to five tutorials that introduce and explain different animation concepts. All concepts are explained with real-world examples that are fun to read and work with. If you are familiar with developing Android applications and want to bring your apps to life by adding smashing animations, then this book is for you. The book assumes that you are comfortable with Java development and have familiarity with creating Android Views in XML and Java. The tutorials assume that you will wa

  5. NET 40 Generics Beginner's Guide

    CERN Document Server

    Mukherjee, Sudipta

    2012-01-01

    This is a concise, practical guide that will help you learn Generics in .NET, with lots of real world and fun-to-build examples and clear explanations. It is packed with screenshots to aid your understanding of the process. This book is aimed at beginners in Generics. It assumes some working knowledge of C# , but it isn't mandatory. The following would get the most use out of the book: Newbie C# developers struggling with Generics. Experienced C++ and Java Programmers who are migrating to C# and looking for an alternative to other generic frameworks like STL and JCF would find this book handy.

  6. Transforming beginner teacher mentoring interventions for social ...

    African Journals Online (AJOL)

    Transforming beginner teacher mentoring interventions for social reform. ... for developing scholarship of teaching, as it is aligned with the role of scholar and ... Keywords: Action research; learning styles; mentoring practice; professional ...

  7. KfK Nuclear Safety Project. First semiannual report 1985

    International Nuclear Information System (INIS)

    1985-11-01

    The semiannual progress report 1985/1 is a description of work within the Nuclear Safety Project performed in the first six month of 1985 in the nuclear safety field by KfK institutes and departements and by external institutions on behalf of KfK. The chosen kind of this report is that of short summaries, containing the topics: work performed, results obtained and plans for future work. (orig./HP) [de

  8. PhoneGap 3 beginner's guide

    CERN Document Server

    Natili, Giorgio

    2013-01-01

    Written in a friendly, example-driven Beginner's Guide format, there are plenty of step-by-step instructions to help you get started with PhoneGap.If you are a web developer or mobile application developer interested in an examples-based approach to learning mobile application development basics with PhoneGap, then this book is for you.

  9. PILOT: A Programming Language for Beginners.

    Science.gov (United States)

    Schnorr, Janice M.

    The presentation describes PILOT (Programmed Inquiry, Learning or Teaching), a special programing language easy for beginners to learn and available for several brands of microcomputers. PILOT is explained to contain substantially fewer commands than most other languages and to be written in an easy to understand manner. Edit commands and their…

  10. Python 3 Web Development Beginner's Guide

    CERN Document Server

    Anders, Michel

    2011-01-01

    Part of Packt's Beginner's Guide Series, this book follows a sample application, with lots of screenshots, to help you get to grips with the techniques as quickly as possible. Moderately experienced Python programmers who want to learn how to create fairly complex, database-driven, cross browser compatible web apps that are maintainable and look good will find this book of most use. All key technologies except for Python 3 are explained in detail.

  11. RavenDB 2.x beginner's guide

    CERN Document Server

    Tannir, Khaled

    2013-01-01

    Written in a friendly, example-driven Beginner's Guide format, there are plenty of step-by-step instructions and examples that are designed to help you get started with RavenDB. If you are a .NET developer, new to document-oriented databases, and you wish to learn how to build applications using NoSQL databases, then this book is for you. Experience with relational database systems will be helpful, but not necessary.

  12. Visual media processing using Matlab beginner's guide

    CERN Document Server

    Siogkas, George

    2013-01-01

    Written in a friendly, Beginner's Guide format, showing the user how to use the digital media aspects of Matlab (image, video, sound) in a practical, tutorial-based style.This is great for novice programmers in any language who would like to use Matlab as a tool for their image and video processing needs, and also comes in handy for photographers or video editors with even less programming experience wanting to find an all-in-one tool for their tasks.

  13. Colloquial French the complete course for beginners

    CERN Document Server

    Demouy, Valérie

    2015-01-01

    Colloquial French: The Complete Course for Beginners has been carefully developed by an experienced teacher to provide a step-by-step course to French as it is written and spoken today. Combining a clear, practical and accessible style with a methodical and thorough treatment of the language, it equips learners with the essential skills needed to communicate confidently and effectively in French in a broad range of situations. No prior knowledge of the language is required. Colloquial French is exceptional; each unit presents a wealth of grammatical points that are reinforced with a wide range

  14. iAd Production Beginner's Guide

    CERN Document Server

    Collier, Ben

    2012-01-01

    This beginner's guide focuses on getting you through all the major learning points in a smooth, logical order. You'll also see how to avoid some common pitfalls. This book is for brands, advertisers and developers who want to create compelling, emotive, iAd advertisements that generate revenue and increase brand awareness. You don't need previous experience of creating adverts or apps for iPhone and iPad, as you'll be taken through the entire process to make motion-rich, beautiful ads.

  15. Eclipse plugin development by example beginner's guide

    CERN Document Server

    Blewitt, Alex

    2013-01-01

    A Beginner's Guide following the ""by Example"" approach. There will be 5-8 major examples that will be used in the book to develop advanced plugins with the Eclipse IDE.This book is for Java developers who are familiar with Eclipse as a Java IDE and are interested in learning how to develop plug-ins for Eclipse. No prior knowledge of Eclipse plug-in development or OSGi is necessary, although you are expected to know how to create, run, and debug Java programs in Eclipse.

  16. Language Training: French course for beginners

    CERN Multimedia

    Françoise Benz

    2004-01-01

    If you wish to participate in one of the following courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. A French course for beginners (level 0) will take place from 12 July to 27 August. Timetable: not yet fixed Duration: 54 hours / 2 hours a day Price: CHF 702 Please enrol as soon as possible through the Web: http://cern.ch/Training FORMATION EN LANGUES LANGUAGE TRAINING Françoise Benz 73127 language.training@cern.ch

  17. Language Training: French course for beginners

    CERN Multimedia

    Françoise Benz

    2004-01-01

    If you wish to participate in one of the following courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. A French course for beginners (level 0) will take place from 12 July to 27 August. Timetable: not yet fixed Duration: 54 hours / 2 hours a day Price: 702 SF Please enrol as soon as possible through the Web: http://cern.ch/Training FORMATION EN LANGUES LANGUAGE TRAINING Françoise Benz 73127 language.training@cern.ch

  18. jQuery for designers beginner's guide

    CERN Document Server

    MacLees, Natalie

    2014-01-01

    A step-by-step guide that spices up your web pages and designs them in the way you want using the most widely used JavaScript library, jQuery. The beginner-friendly and easy-to-understand approach of the book will help get to grips with jQuery in no time. If you know the fundamentals of HTML and CSS, and want to extend your knowledge by learning to use JavaScript, then this is just the book for you. jQuery makes JavaScript straightforward and approachable - you'll be surprised at how easy it can be to add animations and special effects to your beautifully designed pages.

  19. Relativity and quantum physics for beginners

    CERN Document Server

    Manly, Steven L

    2009-01-01

    As we humans have expanded our horizons to see things vastly smaller, faster, larger, and farther than ever before, we have been forced to confront preconceptions born of the human experience and create wholly new ways of looking at the world around us. The theories of relativity and quantum physics were developed out of this need and have provided us with phenomenal, mind-twisting insights into the strange and exciting reality show of our universe.Relativity and Quantum Physics For Beginners is an entertaining and accessible introduction to the bizarre concepts that fueled the scientific revolution of the 20th century and led to amazing advances in our understanding of the universe.

  20. User manual for the KfK code PCROSS

    International Nuclear Information System (INIS)

    Ravndal, S.; Oblozinsky, P.; Kelzenberg, S.; Cierjacks, S.

    1991-08-01

    The PCROSS code calculates the so-called 'pseudo' cross sections for sequential (x,n) reactions and merges them together with 'collapsed' cross sections for neutron induced reactions into one file of cross sections. The file is tailored to provide an input for the FISPACT inventory code that calculates the activation and related radiological quantities of material irradiated in a neutron flux. The present report describes the structure of the KfK code PCROSS, outlines the role of subroutines, and provides necessary information for a practical user of the code. (orig.) [de

  1. Review: Ways of teaching struggling reading students, and beginners

    African Journals Online (AJOL)

    Review: Ways of teaching struggling reading students, and beginners. ... International Journal of Pedagogy, Policy and ICT in Education. Journal Home · ABOUT THIS JOURNAL ... AJOL African Journals Online. HOW TO USE AJOL.

  2. Beginner teacher professional development: An action research and ...

    African Journals Online (AJOL)

    Tanya

    beginner teacher taking part in an 'education sink or swim gala' be empowered to help transform society? Society in the .... greatest challenges that were perceived then and are still present ..... mentees 1, 4 and 5 have a triple dominant profile,.

  3. Irrlicht 17 Realtime 3D Engine Beginner's Guide

    CERN Document Server

    Stein, Johannes

    2011-01-01

    A beginner's guide with plenty of screenshots and explained code. If you have C++ skills and are interested in learning Irrlicht, this book is for you. Absolutely no knowledge of Irrlicht is necessary for you to follow this book!

  4. Mice lacking the kf-1 gene exhibit increased anxiety- but not despair-like behavior

    Directory of Open Access Journals (Sweden)

    Atsushi Tsujimura

    2008-09-01

    Full Text Available KF-1 was originally identified as a protein encoded by human gene with increased expression in the cerebral cortex of a patient with Alzheimer’s disease. In mouse brain, kf-1 mRNA is detected predominantly in the hippocampus and cerebellum, and kf-1 gene expression is elevated also in the frontal cortex of rats after chronic antidepressant treatments. KF-1 mediates E2-dependent ubiquitination and may modulate cellular protein levels as an E3 ubiquitin ligase, though its target proteins are not yet identified. To elucidate the role of kf-1 in the central nervous system, we generated kf-1 knockout mice by gene targeting, using Cre-lox recombination. The resulting kf-1−/− mice were normal and healthy in appearance. Behavioral analyses revealed that kf-1−/− mice showed significantly increased anxiety-like behavior compared with kf-1+/+ littermates in the light/dark transition and elevated plus maze tests; however, no significant differences were observed in exploratory locomotion using the open field test or in behavioral despair using the forced swim and tail suspension tests. These observations suggest that KF-1 suppresses selectively anxiety under physiological conditions probably through modulating protein levels of its unknown target(s. Interestingly, kf-1−/− mice exhibited significantly increased prepulse inhibition, which is usually reduced in human schizophrenic patients. Thus, the kf-1−/− mice provide a novel animal model for elucidating molecular mechanisms of psychiatric diseases such as anxiety/depression, and may be useful for screening novel anxiolytic/antidepressant compounds.

  5. Mitigating Observation Perturbation Sampling Errors in the Stochastic EnKF

    KAUST Repository

    Hoteit, Ibrahim

    2015-03-17

    The stochastic ensemble Kalman filter (EnKF) updates its ensemble members with observations perturbed with noise sampled from the distribution of the observational errors. This was shown to introduce noise into the system and may become pronounced when the ensemble size is smaller than the rank of the observational error covariance, which is often the case in real oceanic and atmospheric data assimilation applications. This work introduces an efficient serial scheme to mitigate the impact of observations’ perturbations sampling in the analysis step of the EnKF, which should provide more accurate ensemble estimates of the analysis error covariance matrices. The new scheme is simple to implement within the serial EnKF algorithm, requiring only the approximation of the EnKF sample forecast error covariance matrix by a matrix with one rank less. The new EnKF scheme is implemented and tested with the Lorenz-96 model. Results from numerical experiments are conducted to compare its performance with the EnKF and two standard deterministic EnKFs. This study shows that the new scheme enhances the behavior of the EnKF and may lead to better performance than the deterministic EnKFs even when implemented with relatively small ensembles.

  6. Mitigating Observation Perturbation Sampling Errors in the Stochastic EnKF

    KAUST Repository

    Hoteit, Ibrahim; Pham, D.-T.; El Gharamti, Mohamad; Luo, X.

    2015-01-01

    The stochastic ensemble Kalman filter (EnKF) updates its ensemble members with observations perturbed with noise sampled from the distribution of the observational errors. This was shown to introduce noise into the system and may become pronounced when the ensemble size is smaller than the rank of the observational error covariance, which is often the case in real oceanic and atmospheric data assimilation applications. This work introduces an efficient serial scheme to mitigate the impact of observations’ perturbations sampling in the analysis step of the EnKF, which should provide more accurate ensemble estimates of the analysis error covariance matrices. The new scheme is simple to implement within the serial EnKF algorithm, requiring only the approximation of the EnKF sample forecast error covariance matrix by a matrix with one rank less. The new EnKF scheme is implemented and tested with the Lorenz-96 model. Results from numerical experiments are conducted to compare its performance with the EnKF and two standard deterministic EnKFs. This study shows that the new scheme enhances the behavior of the EnKF and may lead to better performance than the deterministic EnKFs even when implemented with relatively small ensembles.

  7. R statistical application development by example : beginner's guide

    CERN Document Server

    Tattar, Narayanachart Prabhanjan

    2013-01-01

    Full of screenshots and examples, this Beginner's Guide by Example will teach you practically everything you need to know about R statistical application development from scratch. You will begin learning the first concepts of statistics in R which is vital in this fast paced era and it is also a bargain as you do not need to do a preliminary course on the subject.

  8. Selecting literature for beginner readers in South Africa

    Directory of Open Access Journals (Sweden)

    Hibbert, Liesel

    2011-12-01

    Full Text Available This article explores complexities of choosing appropriate reading material which may provide maximum engagement for beginner readers in Southern Africa, with the aim of instilling a lifelong love of reading. The article presents a case in favour of literary criteria as base line for choices of reading material for beginner readers. Furthermore, the article outlines general characteristics of reading material for beginner readers, as well as specific criteria to be considered in the Southern African context, taking into account the linguistic diversity which exists in formal education and the vast literacy backlog in the region. Furthermore, it is argued that translated children’s stories should ideally be adapted rather than literally translated, in order to meet the requirements of what is universally regarded as good children’s literature for beginner readers. A culture of reading can only be instilled by adhering to the following criteria, i.e. ensuring affective engagement, maximum meaning-making potential, delight, the engagement of the imagination for the purposes of developing the creative mind, and strong identification with the material for the purposes of developing a sense of agency.

  9. NumPy 1.5 Beginner's Guide

    CERN Document Server

    Idris, Ivan

    2011-01-01

    The book is written in beginner's guide style with each aspect of NumPy demonstrated by real world examples. There is appropriate explained code with the required screenshots thrown in for the novice. This book is for the programmer, scientist or engineer, who has basic Python knowledge and would like to be able to do numerical computations with Python.

  10. A beginner's guide to the literature search in medical education.

    Science.gov (United States)

    Martin, S; Hussain, Z; Boyle, J G

    2017-05-01

    Conducting a literature search can be a daunting prospect if you have not done it before. This article aims to provide a beginner's guide to searching the medical education literature, by describing how to construct an effective search strategy, the resources that are available and the basics of how searching works.

  11. New KF-PP-SVM classification method for EEG in brain-computer interfaces.

    Science.gov (United States)

    Yang, Banghua; Han, Zhijun; Zan, Peng; Wang, Qian

    2014-01-01

    Classification methods are a crucial direction in the current study of brain-computer interfaces (BCIs). To improve the classification accuracy for electroencephalogram (EEG) signals, a novel KF-PP-SVM (kernel fisher, posterior probability, and support vector machine) classification method is developed. Its detailed process entails the use of common spatial patterns to obtain features, based on which the within-class scatter is calculated. Then the scatter is added into the kernel function of a radial basis function to construct a new kernel function. This new kernel is integrated into the SVM to obtain a new classification model. Finally, the output of SVM is calculated based on posterior probability and the final recognition result is obtained. To evaluate the effectiveness of the proposed KF-PP-SVM method, EEG data collected from laboratory are processed with four different classification schemes (KF-PP-SVM, KF-SVM, PP-SVM, and SVM). The results showed that the overall average improvements arising from the use of the KF-PP-SVM scheme as opposed to KF-SVM, PP-SVM and SVM schemes are 2.49%, 5.83 % and 6.49 % respectively.

  12. Nuclear fusion project. Semi-annual report of the Association KfK/EURATOM

    International Nuclear Information System (INIS)

    1986-11-01

    Nuclear fusion is one of the main activities of the Karlsruhe Nuclear Research Center (KfK). It is organized as a project under the Directorate of Reactor Development and Safety. The work of KfK concentrates on technology aspects of nuclear fusion with magnetic confinement. It is part of the European Fusion Programme where KfK participates as an association to EURATOM. Close links have been established to the Max Planck Institute for Plasma Physics (IPP). In the Entwicklungsgemeinschaft Kernfusion KfK and IPP cooperate for the development of future fusion experiments joining the experience gained in plasma physics (IPP) and materials, safety, and nuclear technology (KfK), respectively. As in the present strategy of the European Fusion Programme the Next European Tokamak (NET) is foreseen as the major next step, most of the activities of KfK address this subject. In addition to the contributions to NET, studies are carried out to innovate INTOR, the worldwide cooperation for an experimental reactor under the auspices of IAEA. Furthermore, the Entwicklungsgemeinschaft Kernfusion has evaluated the feasibility of a fusion reactor with a stellarator confinement. (orig./GG)

  13. Zend framework 2.0 by example beginner's guide

    CERN Document Server

    Shasankar, Krishna

    2013-01-01

    Zend Framework 2.0 by Example: Beginner's Guide is a step-by-step guide that aims to empower you to build web applications packed with some really exciting features using Zend Framework 2.0.If you are a PHP Developer who is new to Zend Framework, but you want to get hands-on with the product quickly, this book is for you. Basic knowledge of object oriented programming with PHP is expected.

  14. Utilization of balance equipment in windsurf beginners off water training.

    OpenAIRE

    Frič, Čestmír

    2013-01-01

    Work name: Utilization of balance equipment in windsurf beginners off water training. Aim of work: To determin and evaluate significance of balance equipment in off water training. Method: The method of comparative experiment have been used in this thesis. Than the obtained data were evaluated. It was nessesary to create and compare two groups of people, compound of young healthy individuals in the age 20 - 30 both male and female. The only condition for the research was their zero experience...

  15. CS Circles: An In-Browser Python Course for Beginners

    OpenAIRE

    Pritchard, David; Vasiga, Troy

    2012-01-01

    Computer Science Circles is a free programming website for beginners that is designed to be fun, easy to use, and accessible to the broadest possible audience. We teach Python since it is simple yet powerful, and the course content is well-structured but written in plain language. The website has over one hundred exercises in thirty lesson pages, plus special features to help teachers support their students. It is available in both English and French. We discuss the philosophy behind the cour...

  16. Influence of KF substitution on the ferroelectric phase transition of lead titanate single crystals studied by Brillouin light scattering

    Directory of Open Access Journals (Sweden)

    Seonhyeop Shin

    2015-06-01

    Full Text Available The elastic properties of KF-substituted perovskite lead titanate (PbTiO3 were investigated by dielectric measurements and Brillouin light scattering. The ferroelectric phase transition occurred at substantially lower temperature due to KF substitution, which was attributed to the modification of the covalency in Pb–O and Ti–O bonds. The longitudinal acoustic (LA mode of KF-substituted PbTiO3 showed a frequency softening in the paraelectric phase, which was accompanied by increasing acoustic damping. This indicated that polarization fluctuations responsible for the acoustic anomalies were enhanced by KF substitution.

  17. iClone 431 3D Animation Beginner's Guide

    CERN Document Server

    McCallum, MD

    2011-01-01

    This book is a part of the Beginner's guide series, wherein you will quickly start doing tasks with precise instructions. Then the tasks will be followed by explanation and then a challenging task or a multiple choice question about the topic just covered. Do you have a story to tell or an idea to illustrate? This book is aimed at film makers, video producers/compositors, vxf artists or 3D artists/designers like you who have no previous experience with iClone. If you have that drive inside you to entertain people via the internet on sites like YouTube or Vimeo, create a superb presentation vid

  18. Vaadin 7 UI design by example beginner's guide

    CERN Document Server

    Duarte, Alejandro

    2013-01-01

    This book is a hands-on Beginner's Guide for developers who are new to Vaadin and/or Vaadin UI components. The book will teach readers through examples to use each of the exciting components to build and add various aspects of the user interface to their web apps.If you have experience with the Java language and want to create web applications that look good without having to deal with HTML, XML, and JavaScript, this book is for you. Basic Java programming skills are required, but no web development knowledge is needed at all.

  19. Discovering SQL A Hands-On Guide for Beginners

    CERN Document Server

    Kriegel, Alex

    2011-01-01

    Teaching the SQL skills that businesses demand when hiring programmers If you're a SQL beginner, you don't just want to learn SQL basics, you also want to get some practical SQL skills you can use in the job market. This book gives you both. Covering the basics through intermediate topics with clear explanations, hands-on exercises, and helpful solutions, this book is the perfect introduction to SQL. Topics include both the current SQL:2008 standards, the upcoming SQL:2011 standards, and also how to use SQL against current releases of the most popular commercial SQL databases, such as Oracle,

  20. KfK-seminar series on supercomputing und visualization from May till September 1992

    International Nuclear Information System (INIS)

    Hohenhinnebusch, W.

    1993-05-01

    During the period of may 1992 to september 1992 a series of seminars was held at KfK on several topics of supercomputing in different fields of application. The aim was to demonstrate the importance of supercomputing and visualization in numerical simulations of complex physical and technical phenomena. This report contains the collection of all submitted seminar papers. (orig./HP) [de

  1. Electric conductivity of salt melts containing KCL, KF and K2TaF7

    International Nuclear Information System (INIS)

    Agulyanskij, A.I.; Stangrit, P.T.; Konstantinov, V.I.

    1978-01-01

    Given are electric conductivity measurement results depending on the temperature and composition of the molten KF-K 2 TaF 7 , KCl-K 2 TaF 7 systems and also melts close in their composition to industrial electrolytes, KCl-KF (in mass ratio of 2:1) with addition of K 2 TaF 7 up to 25 mass%. Presented are electric conductivity molecular isotherms of the KF-K 2 TaF 7 , KCl-K 2 TaF 7 systems at 800 deg C and specific electric conductivity dependence of KCl-KF-K 2 TaF 7 melts on K 2 TaF 7 composition at 800 deg C and 900 deg C. Proceeding from the shape of molecular and specific electric conductivity isotherms a conclusion is made about existence of the following tantalum-containing ions: TaF 7 2- , TaF 6 - and TaF 6 Cl 2- in the investigated melts

  2. Nuclear fusion project. Semi-annual report of the Association KfK/EURATOM

    International Nuclear Information System (INIS)

    Kast, G.

    1988-07-01

    Short communications give a survey of 38 technology tasks, the development of ECRH power sources at 150 GHz, and 9 NET study are listed in the appendices I and II, respectively, while the KfK departments contributing to the Fusion Project and the Fusion Project Management Staff are listed in appendices III and IV, respectively. (GG)

  3. OXIDATION OF POLYCHLORINATED BIPHENYLS BY PSEUDOMONAS SP. STRAIN LB400 AND PSEUDOMONAS PSEUDOALCALIGENES KF707

    Science.gov (United States)

    Biphenyl-grown cells and cell extracts prepared from biphenyl-grown cells of Pseudomonas sp. strain LB400 oxidize a much wider range of chlorinated biphenyls than do analogous preparations from Pseudomonas pseudoalcaligenes KF707. These results are attributed to differences in th...

  4. Electrochemical behavior of boron in LiF-NaF-KF- melts

    DEFF Research Database (Denmark)

    Polyakova, L.P.; Bukatova, G.A.; Polyakova, E.G.

    1996-01-01

    The electrochemical reduction of B(III) to B(0) in KBF4-LiF-NaF-KF melts has been studied by voltammetric and chronopotentiometric methods, Glassy carbon, Pt, and Ag were used as working electrode materials. Only in the case of Ag was the reduction not complicated by interaction between boron...

  5. Joint Parametric Fault Diagnosis and State Estimation Using KF-ML Method

    DEFF Research Database (Denmark)

    Sun, Zhen; Yang, Zhenyu

    2014-01-01

    The paper proposes a new method for a kind of parametric fault online diagnosis with state estimation jointly. The considered fault affects not only the deterministic part of the system but also the random circumstance. The proposed method first applies Kalman Filter (KF) and Maximum Likelihood (...

  6. Draft Genome Sequence of Cupriavidus pauculus Strain KF709, a Biphenyl-Utilizing Bacterium Isolated from Biphenyl-Contaminated Soil.

    Science.gov (United States)

    Watanabe, Takahito; Yamazoe, Atsushi; Hosoyama, Akira; Fujihara, Hidehiko; Suenaga, Hikaru; Hirose, Jun; Futagami, Taiki; Goto, Masatoshi; Kimura, Nobutada; Furukawa, Kensuke

    2015-03-26

    We report the draft genome sequence of Cupriavidus pauculus strain KF709, which comprises 6,826,799 bp with 6,272 coding sequences. The strain KF709 utilizes biphenyl and degrades low-chlorinated biphenyls; however, it possesses fewer coding sequences involved in the degradation of aromatic compounds than other strains belonging to the Betaproteobacteria. Copyright © 2015 Watanabe et al.

  7. Draft Genome Sequence of Cupriavidus pauculus Strain KF709, a Biphenyl-Utilizing Bacterium Isolated from Biphenyl-Contaminated Soil

    OpenAIRE

    Watanabe, Takahito; Yamazoe, Atsushi; Hosoyama, Akira; Fujihara, Hidehiko; Suenaga, Hikaru; Hirose, Jun; Futagami, Taiki; Goto, Masatoshi; Kimura, Nobutada; Furukawa, Kensuke

    2015-01-01

    We report the draft genome sequence of Cupriavidus pauculus strain KF709, which comprises 6,826,799 bp with 6,272 coding sequences. The strain KF709 utilizes biphenyl and degrades low-chlorinated biphenyls; however, it possesses fewer coding sequences involved in the degradation of aromatic compounds than other strains belonging to the Betaproteobacteria.

  8. A Proposal of a Color Music Notation System on a Single Melody for Music Beginners

    Science.gov (United States)

    Kuo, Yi-Ting; Chuang, Ming-Chuen

    2013-01-01

    Music teachers often encounter obstructions in teaching beginners in music reading. Conventional notational symbols require beginners to spend significant amount of time in memorizing, which discourages learning at early stage. This article proposes a newly-developed color music notation system that may improve the recognition of the staff and the…

  9. Velocity of sound in, and adiabatic compressibility of, Molten LiF-NaF, LiF-KF, NaF-KF mixtures

    International Nuclear Information System (INIS)

    Minchenko, V.I.; Konovalov, Y.V.; Smirnov, M.V.

    1986-01-01

    The authors measured the velocity of sound as a function of temperature at 1.5 zHM frequency in LiF-NaF, NaF-KF, LiF-KF melts over the entire range of their compositions. The measurements were made by comparison of the phases of a reference pulse signal and a signal reflected from the bottom of the crucible. The specified temperatures were maintained constant within plus or minus 1 degree. The sound conductor consisted of a cylindrical rod of sintered beryllium oxide, which does not interact with test melts. The study shows that the velocity of sound decreases linearly with increase of the temperature. The values of the constants of the empirical equations are presented in a table, with indication of the temperature range. The dependence of the velocity of sound on composition of the melts is shown, where isotherms for 1250 K are given as an example. Variation of the composition by 1-2 mole % leads to increase or decrease of the velocity of sound by 5-10 m

  10. Electric conductivity of molten mixtures of ternary mutual KF-KCl-ZrF4 system

    International Nuclear Information System (INIS)

    Darienko, S.E.; Raspopin, S.P.; Chervinskij, Yu.F.

    1988-01-01

    Using the relative capillary method at the frequency of 50 kHz the specific electric conductivity of molten mixtures of the KF-KCl-ZnF 4 system is measured. All the measurements were made in the atmosphere of purified argon. Temperature dependence of electric conductivity of the mixtures studied (800-1260 K) is described by the equations of exponential type with sufficient accuracy. Curves of identical specific electric conductivity of the three-component system are presented. With an increase in zirconium tetrachloride concentration in the mixtures electric conductivity of the melts decreases. On the basis of the measurement results of KF-ZrF 4 and KCl-ZrF 4 molten mixture specific electric conductivity and data on the melt density the values of molar electric conductivity at 1200 K are calculated

  11. Facile preparation of highly pure KF-ZrF4 molten salt

    Science.gov (United States)

    Zong, Guoqiang; Cui, Zhen-Hua; Zhang, Zhi-Bing; Zhang, Long; Xiao, Ji-Chang

    2018-03-01

    The preparation of highly pure KF-ZrF4 (FKZr) molten salt, a potential secondary coolant in molten salt reactors, was realized simply by heating a mixture of (NH4)2ZrF6 and KF. X-ray diffraction analysis indicated that the FKZr molten salt was mainly composed of KZrF5 and K2ZrF6. The melting point of the prepared FKZr molten salt was 420-422 °C under these conditions. The contents of all metal impurities were lower than 20 ppm, and the content of oxygen was lower than 400 ppm. This one-step protocol avoids the need for a tedious procedure to prepare ZrF4 and for an additional purification process to remove oxide impurities, and is therefore a convenient, efficient and economic preparation method for high-purity FKZr molten salt.

  12. Ensemble singular vectors and their use as additive inflation in EnKF

    Directory of Open Access Journals (Sweden)

    Shu-Chih Yang

    2015-07-01

    Full Text Available Given an ensemble of forecasts, it is possible to determine the leading ensemble singular vector (ESV, that is, the linear combination of the forecasts that, given the choice of the perturbation norm and forecast interval, will maximise the growth of the perturbations. Because the ESV indicates the directions of the fastest growing forecast errors, we explore the potential of applying the leading ESVs in ensemble Kalman filter (EnKF for correcting fast-growing errors. The ESVs are derived based on a quasi-geostrophic multi-level channel model, and data assimilation experiments are carried out under framework of the local ensemble transform Kalman filter. We confirm that even during the early spin-up starting with random initial conditions, the final ESVs of the first analysis with a 12-h window are strongly related to the background errors. Since initial ensemble singular vectors (IESVs grow much faster than Lyapunov Vectors (LVs, and the final ensemble singular vectors (FESVs are close to convergence to leading LVs, perturbations based on leading IESVs grow faster than those based on FESVs, and are therefore preferable as additive inflation. The IESVs are applied in the EnKF framework for constructing flow-dependent additive perturbations to inflate the analysis ensemble. Compared with using random perturbations as additive inflation, a positive impact from using ESVs is found especially in areas with large growing errors. When an EnKF is ‘cold-started’ from random perturbations and poor initial condition, results indicate that using the ESVs as additive inflation has the advantage of correcting large errors so that the spin-up of the EnKF can be accelerated.

  13. Nuclear Fusion Project. Semi-annual report of the Association KfK/EURATOM

    International Nuclear Information System (INIS)

    Kast, G.

    1987-12-01

    Short communications give a survey of 38 technology tasks, the development of ECRH power sources at 150 GHz, and 8 NET study contracts. The fusion technology contracts and the NET contracts are listed in the appendices I and II, respectively, while the KfK departments contributing to the Fusion Project and the Fusion Project Management Staff are listed in appendices III and IV, respectively. (GG)

  14. Nuclear fusion project. Semi-annual report of the Association KfK/EURATOM

    International Nuclear Information System (INIS)

    Kast, G.

    1987-05-01

    This semi-annual report gives 36 short descriptions of the work done in the framework of the Nuclear Fusion Project and outlines studies for NET/INTOR and for ECRH power sources at 150 GHz. Tables of fusion technology contracts, of NET contracts, of KfK departments contributing to the Fusion Project, and of the Fusion Project management staff complete this report. (GG)

  15. A guide to MATLAB for beginners and experienced users

    CERN Document Server

    Hunt, Brian R; Rosenberg, Jonathan M

    2014-01-01

    Now in its third edition, this outstanding textbook explains everything you need to get started using MATLAB®. It contains concise explanations of essential MATLAB commands, as well as easily understood instructions for using MATLAB's programming features, graphical capabilities, simulation models, and rich desktop interface. MATLAB 8 and its new user interface is treated extensively in the book. New features in this edition include: a complete treatment of MATLAB's publish feature; new material on MATLAB graphics, enabling the user to master quickly the various symbolic and numerical plotting routines; and a robust presentation of MuPAD® and how to use it as a stand-alone platform. The authors have also updated the text throughout, reworking examples and exploring new applications. The book is essential reading for beginners, occasional users and experienced users wishing to brush up their skills. Further resources are available from the authors' website at www-math.umd.edu/schol/a-guide-to-matlab.html.

  16. Density of salt melts containing KF, KCl, K2TaF7 and Ta2O5

    International Nuclear Information System (INIS)

    Agulyanskij, A.I.; Stangrit, P.T.; Konstantinov, V.I.

    1978-01-01

    The results of density measurements by hydrostatic weighing are given for molten K 2 TaF 7 - KF, K 2 TaF 7 -KCL, K 2 TaF 7 - KF - KCl and K 2 TaF 7 - KF - KCl - Ta 2 O 5 mixtures depending on their temperature and composition. The density of the last two systems was measured at compositions close to those of commercial electrolytes. The obtained specific volume - composition dependencies show that no interaction is taking place in the mixtures studied. It is, therefore, believed that, in the K 2 TaF 7 - KF melt, tantalum is mainly present as a complex TaF 7 2- ion, and, in the K 2 TaF 7 - KCl mlt, a certain amount of TaF 6 - ions may be formed along with TaF 7 2-

  17. Semiokapitalismus und imperiale Kontrollgesellschaft Zur Digitalisierung der Produktion am Beginn des 21. Jahrhunderts

    Directory of Open Access Journals (Sweden)

    Wolfgang Neurath

    2014-12-01

    Full Text Available Wolfgang Neurath analysiert angesichts des kybernetischen Semiokapitalismus und des durch ihn entstandenen "Kognitariats" in welcher Art und Weise digitale Produktions- und Wertschöpfungsprozesse am Beginn des 21. Jahrhunderts zur Kontrolle eingesetzt werden ...

  18. Specific problems of beginners at study of programming and possibilities of their solution

    OpenAIRE

    Procházková, Petra

    2017-01-01

    This thesis deals with the problems of beginners in the study of programming at University of Economics in Prague, Faculty of Informatics and Statistics. This applies particularly to students who are studying the subject Programming in Java.

  19. What are the important manoeuvres for beginners to minimize surgical time in primary total knee arthroplasty?

    Science.gov (United States)

    Harato, Kengo; Maeno, Shinichi; Tanikawa, Hidenori; Kaneda, Kazuya; Morishige, Yutaro; Nomoto, So; Niki, Yasuo

    2016-08-01

    It was hypothesized that surgical time of beginners would be much longer than that of experts. Our purpose was to investigate and clarify the important manoeuvres for beginners to minimize surgical time in primary total knee arthroplasty (TKA) as a multicentre study. A total of 300 knees in 248 patients (averaged 74.6 years) were enrolled. All TKAs were done using the same instruments and the same measured resection technique at 14 facilities by 25 orthopaedic surgeons. Surgeons were divided into three surgeon groups (four experts, nine medium-volume surgeons and 12 beginners). The surgical technique was divided into five phases. Detailed surgical time and ratio of the time in each phase to overall surgical time were recorded and compared among the groups in each phase. A total of 62, 119, and 119 TKAs were done by beginners, medium-volume surgeons, and experts, respectively. Significant differences in surgical time among the groups were seen in each phase. Concerning the ratio of the time, experts and medium-volume surgeons seemed cautious in fixation of the permanent component compared to other phases. Interestingly, even in ratio, beginners and medium-volume surgeons took more time in exposure of soft tissue compared to experts. (0.14 in beginners, 0.13 in medium-volume surgeons, 0.11 in experts, P time in exposure and closure of soft tissue compared to experts. Improvement in basic technique is essential to minimize surgical time among beginners. First of all, surgical instructors should teach basic techniques in primary TKA for beginners. Therapeutic studies, Level IV.

  20. Plutonium isotopic assay of reprocessing product solutions in the KfK K-edge densitometer

    International Nuclear Information System (INIS)

    Eberle, H.; Ottmar, H.; Matussek, P.

    1985-04-01

    The KfK K-edge densiometer, designed for accurate element concentration measurements using the technique of X-ray absorptiometry at the K absorption edge, provides as an additional option the possibility to determine the isotopic composition of freshly separated plutonium from an gamma-spectrometric analysis of its self-radiation. This report describes the underlying methodology and experimental procedures for the isotopic analysis in the K-edge densitometer. The paper also presents and discusses the experimental results so far obtained from routine measurements on reprocessing product solutions. (orig.)

  1. A stargazing program for beginners a pocket field guide

    CERN Document Server

    Carter, Jamie

    2015-01-01

     By investing just an hour a week and $50 in binoculars, it’s possible to learn a few simple techniques and quickly gain a real insight into the night sky's ever-changing patterns – and what they tell us about Earth, the seasons and ourselves. Searching more for a learned appreciation of nature and our exact place within the cosmos than academic scientific knowledge, science and travel writer Jamie Carter takes the reader on a 12 month tour of the night sky's incredible annual rhythms that say so much about Earth. During the journey he learns about the celestial mechanics at work in the skies above that are – to the beginner – almost beyond belief. As well as the vital constellations and clusters, and the weird and wonderful nebulas, he searches out “dark sky destinations” across the globe that help increase knowledge and give a new perspective on familiar night sky sights. On the journey he witnesses a solar eclipse and grapples with star-charts, binoculars, smartphone apps, telescopes, spots sa...

  2. Moving forward: Revisiting the Spanish for High Beginners course

    Directory of Open Access Journals (Sweden)

    Flavia Belpoliti

    2015-08-01

    Full Text Available This paper presents a case study on the redesign of a Spanish for High Beginners (SHB course at a large metropolitan university in Texas, USA. The first section presents a discussion on the diverse nature of students who can benefit from an intensive first-year Spanish course and the challenges that these learners’ mixed abilities pose for instruction. The second section describes the redesign process of the SHB course, including placement procedures, the Spanish Language Program sequence, and changes in the syllabus to integrate communicative and transcultural competences by implementing a combination of focused instruction, collaborative learning and task-based approaches. The last section introduces a short presentation of four activities implemented in the redesigned course, which provide paths for future development of advanced beginners’ integrative tasks. The final section focuses on the results of an exit survey measuring students’ perceptions of the course. The successful implementation of changes and its outcomes demonstrate that this course could be a relevant solution for Spanish programs at tertiary institutions with diverse populations, helping to solve challenges of placement, articulation, and time-to-graduation effectiveness.

  3. TOPICAL CASUAL TALKS AS RESPONSIVE LISTENING AND SPEAKING PERFORMANCES OF BEGINNERS

    Directory of Open Access Journals (Sweden)

    Taranindya Zulhi Amalia

    2017-04-01

    Full Text Available Global communication concern brings human to be familiar with English as early as possible. Nowadays beginner students started English orally in elementary school even kindergarten. At this moment, they dealth with listening and speaking skills and put them into practice. When they came down to English, some beginners feel uncomfortable in their learning because of facing formal situation. The beginners who were typically keen on playing and having fun comfortably could not be treated in teaching-learning that was usually presented to intermediate level or adult. Teachers had to create informal situation so that they were more relaxed and got chemistry one another. Dealing with comfortable zone put into informal situation in listening and speaking practices for the beginners, this study focused on topical casual talks. It set up a relaxed spot in order to explore effective communication related to their subject matters. The teachers/tutors could apply one of classroom listening and speaking performance types, responsive. This study used qualitative approach. While it refered to library research. The primary source was Elementary School Silabus. Whereas the secondary data sources were English teaching-learning books. This issue discussed about listening and speaking skills for beginners. The beginners classified into age 6-8. In listening section, the students processed teacher talk instantly. Afterwards in speaking, suitable direct short response answered the teacher talk. This action could be assessed by subjective test in the form of wh-questions and short answers test. Ultimately, the next comparable studies may converse different competences and performances for beginners or any levels.

  4. KfK analysis of the SUPER-PHENIX-1 control rod experiments. Pt. 1

    International Nuclear Information System (INIS)

    Giese, H.

    1991-03-01

    As proposed by the SPX-1 analysis task force, MSM (modified source multiplication) correction factors have been produced for a series of control rod configurations established in the first critical core C1D with minimum fissile loading and in the fully loaded core CMP. The report gives a complete description of the method used at KfK to produce these correction factors and summarises the evaluated experimental results obtained. The KfK method is characterized by a 'two-step-adjustment': A basic reactivity scale adjustment and a subsequent rod worth adjustment. The first adjustment was achieved by 'tuning' either the axialbuckling in the leakage term D B 2 or the average number of neutrons per fission in the production term so that the excess reactivity of the so-called 'Follower-core' with all control rods fully raised was properly reproduced. As this excess reactivity could not be directly determined by an experiment, it had to be assessed from the shut-down worth of the main control system in combination with measured fractions of the S-curve of this system. In the second adjustment, the absorber cross sections were tuned to reproduce experimental rod worths. While for the analysis of the C1D experiments, MSM correction factor calculations were performed in 2D centre-plane geometry only, the analysis of the CMP measurements employed both 2D and 3D calculations. (orig./HP)

  5. The Solubility of Aluminum in Cryolite-Based Electrolyte-Containing KF

    Science.gov (United States)

    Zhang, Yu; Yu, Jiangyu; Gao, Bingliang; Liu, Yibai; Hu, Xianwei; Shi, Zhongning; Wang, Zhaowen

    2016-04-01

    The solubility of aluminum in NaF-AlF3-CaF2-KF-A12O3 electrolyte system at 1253 K (980 °C) has been measured by the analysis of quenched samples saturated with aluminum. The content of the dissolved metal in the quenched melt was determined by collecting the volume of hydrogen gas when a finely crushed sample is treated with HCl. Addition of 0 to 5 pct KF has no obvious effect on the solubility of aluminum in cryolite-based melts with molar ratio of NaF/AlF3 (cryolite ratio) ranging from 2.2 to 3.0. The solubility of aluminum increases from 0.015 to 0.026 wt pct with cryolite ratio increases from 2.2 to 4.0 in the NaF-AlF3-5 wt pct CaF2-3 wt pct A12O3 electrolyte at 1253 K (980 °C). Aluminum solubility was affected by both chemical replacement reaction of Al + 3NaF = AlF3 + 3Na and physical dissolution.

  6. Three stitch hernioplasty: A novel technique for beginners

    Science.gov (United States)

    Patchayappan, Manikandan; Narayanasamy, Sangara Narayanan; Duraisamy, Nagarajan

    2015-01-01

    Objective: To analyze mesh fixation with minimum sutures and postoperative complications. Study Design: Prospective study. Place and Duration of Study: Department of General Surgery, Thanjavur Medical College and Hospital, Tamil Nadu, from July 2010 to June 2012. Materials and Methods: All inguinal hernia patients, who fulfilled the sample selection criteria, were admitted and planned for surgery. The prolene mesh is fashioned as in Lichtenstein's repair, placed and fixed only by three prolene stitches. The first stitch is made in the periosteum of pubic tubercle. The second stitch is taken in the inguinal ligament (1.5 cm lateral to the pubic tubercle) and the third stitch is from the medial most part of the conjoint tendon, that is, the mesh is fixed in the medial aspect alone. Results: Majority of the patients fall between the age group of 40 and 60 (72%) years and all are male patients. Of the total cases, 50% were right sided, 25% were left sided, and 25% were bilateral. Of the postoperative complications, 12% had seroma, 4% had hematoma, 2% developed surgical site infection, 2% developed chronic groin pain, 1% presented with recurrence, and none developed foreign body sinus. Conclusion: The incidence of long-term complications of three stitch hernioplasty are comparable to that of the other standard, tension-free open hernia repair as well as other laparoscopic procedures. Moreover, the three stitch hernioplasty method is a simple method, easy for the beginners to adopt, has less foreign body reaction, less time consuming, causes less tissue trauma, and lesser chance for vascular injury. PMID:26629464

  7. Reduction of Used Memory Ensemble Kalman Filtering (RumEnKF): A data assimilation scheme for memory intensive, high performance computing

    Science.gov (United States)

    Hut, Rolf; Amisigo, Barnabas A.; Steele-Dunne, Susan; van de Giesen, Nick

    2015-12-01

    Reduction of Used Memory Ensemble Kalman Filtering (RumEnKF) is introduced as a variant on the Ensemble Kalman Filter (EnKF). RumEnKF differs from EnKF in that it does not store the entire ensemble, but rather only saves the first two moments of the ensemble distribution. In this way, the number of ensemble members that can be calculated is less dependent on available memory, and mainly on available computing power (CPU). RumEnKF is developed to make optimal use of current generation super computer architecture, where the number of available floating point operations (flops) increases more rapidly than the available memory and where inter-node communication can quickly become a bottleneck. RumEnKF reduces the used memory compared to the EnKF when the number of ensemble members is greater than half the number of state variables. In this paper, three simple models are used (auto-regressive, low dimensional Lorenz and high dimensional Lorenz) to show that RumEnKF performs similarly to the EnKF. Furthermore, it is also shown that increasing the ensemble size has a similar impact on the estimation error from the three algorithms.

  8. Metabolic characterization and transformation of the non-dairy Lactococcus lactis strain KF147, for production of ethanol from xylose

    DEFF Research Database (Denmark)

    Petersen, Kia Vest; Liu, Jianming; Chen, Jun

    2017-01-01

    producing ethanol as the sole fermentation product with a high yield corresponding to 83% of the theoretical maximum. The results clearly indicate the great potential of using the more metabolically diverse non-dairy L. lactis strains for bio-production based on xylose containing feedstocks.......The non-dairy lactic acid bacterium Lactococcus lactis KF147 can utilize xylose as the sole energy source. To assess whether KF147 could serve as a platform organism for converting second generation sugars into useful chemicals, we characterized growth and product formation for KF147 when grown...... the arcA gene encoding the arginine deiminase. The fermentation product profile suggested two routes for xylose degradation, the phosphoketolase pathway and the pentose phosphate pathway. Inactivation of the phosphoketolase pathway redirected the entire flux through the pentose phosphate pathway whereas...

  9. Efficient KF loaded on MgCaAl hydrotalcite-like compounds in the transesterification of Jatropha curcas oil

    International Nuclear Information System (INIS)

    Guzmán-Vargas, Ariel; Santos-Gutiérrez, Teresa; Lima, Enrique; Flores-Moreno, Jorge L.; Oliver-Tolentino, Miguel A.; Martínez-Ortiz, María de J.

    2015-01-01

    Highlights: • MgCaAl hydrotalcite-like compounds were synthetized. • After KF impregnation and calcination fluorinated species were detected. • Fluorinated species were stables and actives. • LDH composition and KF load effect were evaluated in biodiesel production. - Abstract: In this work a series of MgCaAl hydrotalcite-like compounds were synthetized by coprecipitation method at constant pH. In order to obtain the catalysts, the samples were modified with KF by incipient wetness impregnation at different wt%, after that, they were dried and calcined to obtain the mixed oxides. The effect of divalent cations ratio and KF load were studied in the transesterification reaction of Jatropha curcas oil to obtain biodiesel employing an inedible oil. XRD analysis showed typical diffraction patterns of LDH, by nitrogen physisorption the LDH mesoporous structure was also confirmed, 27 Al NMR spectra showed bands at 10 and 88 ppm attributed to the Al coordination before and after thermal treatment. While for the impregnated samples after calcination the profiles exhibited the mixed oxide formation, in addition, another peaks appeared associated to the formation of various fluorinated species as shown by XRD, additionally, 19 F NMR showed a main signal at −180 ppm indicating the presence of active tetrahedral aluminum fluoride species. The reaction evolution was monitoring calculating the oil conversion to biodiesel by integration of the signal spectra using 1 H NMR spectroscopy. The results of catalytic tests in transesterification reaction showed a direct correlation between Mg/Ca ratio and KF content in the oil conversion to biodiesel, the higher conversion was achieved (90%) when Mg/Ca = 1 and KF load was 30 wt%

  10. Efficient KF loaded on MgCaAl hydrotalcite-like compounds in the transesterification of Jatropha curcas oil

    Energy Technology Data Exchange (ETDEWEB)

    Guzmán-Vargas, Ariel, E-mail: aguzmanv@ipn.mx [ESIQIE-IPN, Departamento de Ingeniería Química, Laboratorio de Investigación en Materiales Porosos, Catálisis Ambiental y Química Fina, UPALM Edif.7 P.B. Zacatenco, México D.F. 07738 (Mexico); Santos-Gutiérrez, Teresa [ESIQIE-IPN, Departamento de Ingeniería Química, Laboratorio de Investigación en Materiales Porosos, Catálisis Ambiental y Química Fina, UPALM Edif.7 P.B. Zacatenco, México D.F. 07738 (Mexico); Lima, Enrique [IIM-Universidad Nacional Autónoma de México, Circuito exterior s/n, Cd. Universitaria, 04510 México DF (Mexico); Flores-Moreno, Jorge L. [UAM-Azcapotzalco, Área de Química de Materiales, Av. San Pablo 180, Col. Reynosa Tamaulipas, 02200 México DF (Mexico); Oliver-Tolentino, Miguel A.; Martínez-Ortiz, María de J. [ESIQIE-IPN, Departamento de Ingeniería Química, Laboratorio de Investigación en Materiales Porosos, Catálisis Ambiental y Química Fina, UPALM Edif.7 P.B. Zacatenco, México D.F. 07738 (Mexico)

    2015-09-15

    Highlights: • MgCaAl hydrotalcite-like compounds were synthetized. • After KF impregnation and calcination fluorinated species were detected. • Fluorinated species were stables and actives. • LDH composition and KF load effect were evaluated in biodiesel production. - Abstract: In this work a series of MgCaAl hydrotalcite-like compounds were synthetized by coprecipitation method at constant pH. In order to obtain the catalysts, the samples were modified with KF by incipient wetness impregnation at different wt%, after that, they were dried and calcined to obtain the mixed oxides. The effect of divalent cations ratio and KF load were studied in the transesterification reaction of Jatropha curcas oil to obtain biodiesel employing an inedible oil. XRD analysis showed typical diffraction patterns of LDH, by nitrogen physisorption the LDH mesoporous structure was also confirmed, {sup 27}Al NMR spectra showed bands at 10 and 88 ppm attributed to the Al coordination before and after thermal treatment. While for the impregnated samples after calcination the profiles exhibited the mixed oxide formation, in addition, another peaks appeared associated to the formation of various fluorinated species as shown by XRD, additionally, {sup 19}F NMR showed a main signal at −180 ppm indicating the presence of active tetrahedral aluminum fluoride species. The reaction evolution was monitoring calculating the oil conversion to biodiesel by integration of the signal spectra using {sup 1}H NMR spectroscopy. The results of catalytic tests in transesterification reaction showed a direct correlation between Mg/Ca ratio and KF content in the oil conversion to biodiesel, the higher conversion was achieved (90%) when Mg/Ca = 1 and KF load was 30 wt%.

  11. Multiscale KF Algorithm for Strong Fractional Noise Interference Suppression in Discrete-Time UWB Systems

    Directory of Open Access Journals (Sweden)

    Liyun Su

    2011-01-01

    Full Text Available In order to suppress the interference of the strong fractional noise signal in discrete-time ultrawideband (UWB systems, this paper presents a new UWB multi-scale Kalman filter (KF algorithm for the interference suppression. This approach solves the problem of the narrowband interference (NBI as nonstationary fractional signal in UWB communication, which does not need to estimate any channel parameter. In this paper, the received sampled signal is transformed through multiscale wavelet to obtain a state transition equation and an observation equation based on the stationarity theory of wavelet coefficients in time domain. Then through the Kalman filter method, fractional signal of arbitrary scale is easily figured out. Finally, fractional noise interference is subtracted from the received signal. Performance analysis and computer simulations reveal that this algorithm is effective to reduce the strong fractional noise when the sampling rate is low.

  12. Extended software for the KfK K-edge densitometer

    International Nuclear Information System (INIS)

    Eberle, H.

    1985-04-01

    In order to further exploit the possibilities of the KfK K-edge densitometer, and to enlarge the range of its application, we have extended and modified the instrument's software. With the new software packages the instrument can now be used for analysis of the actinide elemments Th, U, Np, Pu and Am in single element solutions, and for the simultaneous assay of U and Pu in mixed U/Pu solutions. Provisions have been made for later extensions, allowing the analysis of additional elements combinations, if necessary. The report gives a short description of the new programs, and of the modifications to the previous programs. The listings and the corresponding programs are given in the Appendix. (orig./HP)

  13. Grundwassermodellbildung – Hydrostratigraphische Bewertungen mittels GCI-PetroKf, Datenbank- und Geoinformationssystemen

    DEFF Research Database (Denmark)

    Koch, Alexander; Fuchs, Sven; Göbel, Patricia

    reimportiert und für die Verwendung in Geoinformationssystemen (i.e. ArcGIS) weiter aufbereitet. Über Interpolationsverfahren konnte innerhalb des Programmes ArcGIS ein lateraler Bezug zwischen den verschiedenen Mächtigkeiten hergestellt werden, um so auf weitere Inhomogenitäten im Aufbau des Grundwasserleiter......-Systems schließen zu können. Anschließend wurden mittels ArcGIS die Quartärbasis des Modellraums konstruiert, sowie Grundwasserisolinien- und Grundwasserdifferenzenkarten berechnet. Die Grundwasserdifferenzenkarten reproduzieren gut die Grundwasserabsenkungen im Bereich von lokalen Tagebauen. Insgesamt zeigen sich...... gute Übereinstimmungen mit früheren hydrogeologischen Untersuchungen im Projektgebiet. Die Kombination des PetroKf-Algorithmus mit der Aufbereitung in einer Datenbank, sowie der Weiterverarbeitung in ArcGIS, zeigt einen praktikablen Weg zur Entwicklung und Parametrisierung eines hydrogeologischen...

  14. Oracle Data Guard 11gR2 administration beginner's guide

    CERN Document Server

    Baransel, Emre

    2013-01-01

    Using real-world examples and hands-on tasks, Oracle Data Guard 11gR2 Administration Beginner's Guide will give you a solid foundation in Oracle Data Guard. It has been designed to teach you everything you need to know to successfully create and operate Data Guard environments with maximum flexibility, compatibility, and effectiveness.If you are an Oracle database administrator who wants to configure and administer Data Guard configurations, then ""Oracle Data Guard 11gR2 Administration Beginner's Guide"" is for you. With a basic understanding of Oracle database administration, you'll be able

  15. A beginner's guide to 3D printing 14 simple toy designs to get you started

    CERN Document Server

    Rigsby, Mike

    2014-01-01

    A Beginner''s Guide to 3D Printing is the perfect resource for those who would like to experiment with 3D design and manufacturing, but have little or no technical experience with the standard software. Author Mike Rigsby leads readers step-by-step through 15 simple toy projects, each illustrated with screen caps of Autodesk 123D Design, the most common free 3D software available. The projects are later described using Sketchup, another free popular software package. Beginning with basics projects that will take longer to print than design, readers are then given instruction on more advanced t

  16. Teaching Norwegian to Beginners: Six Principles to Guide Lesson Planning

    Directory of Open Access Journals (Sweden)

    Anna Krulatz

    2014-01-01

    Full Text Available Teaching a foreign language is no simple task. There are several factors to consider, from curriculum design, to material selection and lesson implementation, to assessment. The challenge, however, is even greater, if you are teaching a less commonly taught language such as Norwegian – a language spoken by fewer than six million native speakers, used almost exclusively in one country, and with a limited number of available pedagogical materials. Under such circumstances, the task of preparing high quality communicative lessons is immense, even for an experienced language instructor. The goal of this article is to present how a successful language lesson can be developed even if one is using a textbook that does not foster communicative competence. As an example, I am using a unit from a Norwegian textbook for beginners: På vei, often used in Norwegian as a second language course for adults in Norway. The lesson focuses on routines and times of the day, and it concludes with the students comparing and contrasting their daily routines with a partner. Prior to this lesson, students have learned to provide basic information about themselves (where they come from, what languages they speak, what they do for work, expressions for greetings and goodbyes, basic verbs relating to daily activities such as ‘snakker’ (to speak, ‘kjører’ (to drive, ‘kjøpper’ (to buy, ‘jobber’ (to work, ‘leser’ (to read, ‘scriver’ (to write, ordinal numerals, meals, some food items, some basic prepositions and locations, words for family members, and subject and object pronouns for all persons. If you were to closely follow the textbook in teaching this unit, you would begin by teaching the students how to tell time, then briefly go over some verbs to express daily routines, listen to and read a text titled ‘Jeg står opp klokka seks,’ a narrative about Monica’s day (Monica is one of the characters in the book, and finally ask the students

  17. Biphenyl Modulates the Expression and Function of Respiratory Oxidases in the Polychlorinated-Biphenyls Degrader Pseudomonas pseudoalcaligenes KF707

    Directory of Open Access Journals (Sweden)

    Federica Sandri

    2017-06-01

    Full Text Available Pseudomonas pseudoalcaligenes KF707 is a soil bacterium which is known for its capacity to aerobically degrade harmful organic compounds such as polychlorinated biphenyls (PCBs using biphenyl as co-metabolite. Here we provide the first genetic and functional analysis of the KF707 respiratory terminal oxidases in cells grown with two different carbon sources: glucose and biphenyl. We identified five terminal oxidases in KF707: two c(caa3 type oxidases (Caa3 and Ccaa3, two cbb3 type oxidases (Cbb31 and Cbb32, and one bd type cyanide-insensitive quinol oxidase (CIO. While the activity and expression of both Cbb31 and Cbb32 oxidases was prevalent in glucose grown cells as compared to the other oxidases, the activity and expression of the Caa3 oxidase increased considerably only when biphenyl was used as carbon source in contrast to the Cbb32 oxidase which was repressed. Further, the respiratory activity and expression of CIO was up-regulated in a Cbb31 deletion strain as compared to W.T. whereas the CIO up-regulation was not present in Cbb32 and C(caa3 deletion mutants. These results, together, reveal that both function and expression of cbb3 and caa3 type oxidases in KF707 are modulated by biphenyl which is the co-metabolite needed for the activation of the PCBs-degradation pathway.

  18. Synthesis of biodiesel using potassium fluoride (KF) supported by hydrotalcite and process optimization by Box-Behnken design

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Bhaskar; Sharma, Yogesh C. [Banaras Hindu University, Department of Applied Chemistry, Institute of Technology, Varanasi (India); Birla, Ashish; Upadhyay, S.N. [Banaras Hindu University, Department of Chemical Engineering and Technology, Institute of Technology, Varanasi (India); Yaakob, Zahira [Universiti Kebangsaan Malaysia, Department of Chemical and Process Engineering, Selangor (Malaysia)

    2012-12-15

    Biodiesel has been developed using a heterogeneous catalyst potassium fluoride (KF) supported on hydrotalcite (HT) and waste frying oil (WFO) as feedstock. Hydrotalcite was synthesized by co-precipitation method using mixture of Mg(NO{sub 3}){sub 2}.6H{sub 2}O and Al(NO{sub 3}){sub 2}.9H{sub 2}O slowly added to a solution containing NaOH and Na{sub 2}CO{sub 3} and calcined at 500 C. KF was impregnated on hydrotalcite at KF/HT load ratio of 80:100 by addition of a small amount of water. Biodiesel was developed using KF/HT as heterogeneous catalyst by transesterification. Box-Behnken Design using Minitab 15.1 Statistical Software and Design-Expert (Demo version 8.0.6.1) software were used as statistical tool for design of experiments and optimization of fatty acid methyl ester yield. A high yield and conversion of biodiesel was obtained by optimization of variables affecting the reaction. The variables affected the reaction in the priority order of: catalyst amount >> molar ratio (methanol to oil) > reaction time. A 12:1 methanol to WFO molar ratio, 2.5 wt.% of catalyst at 60 C in 1 h reaction time gave a high fatty acid methyl ester yield of >98 %. The quantitative analysis of the product (i.e., biodiesel) was done on a Fourier-transform-nuclear magnetic resonance spectrometer. (orig.)

  19. An adaptive hybrid EnKF-OI scheme for efficient state-parameter estimation of reactive contaminant transport models

    KAUST Repository

    El Gharamti, Mohamad; Valstar, Johan R.; Hoteit, Ibrahim

    2014-01-01

    Reactive contaminant transport models are used by hydrologists to simulate and study the migration and fate of industrial waste in subsurface aquifers. Accurate transport modeling of such waste requires clear understanding of the system's parameters, such as sorption and biodegradation. In this study, we present an efficient sequential data assimilation scheme that computes accurate estimates of aquifer contamination and spatially variable sorption coefficients. This assimilation scheme is based on a hybrid formulation of the ensemble Kalman filter (EnKF) and optimal interpolation (OI) in which solute concentration measurements are assimilated via a recursive dual estimation of sorption coefficients and contaminant state variables. This hybrid EnKF-OI scheme is used to mitigate background covariance limitations due to ensemble under-sampling and neglected model errors. Numerical experiments are conducted with a two-dimensional synthetic aquifer in which cobalt-60, a radioactive contaminant, is leached in a saturated heterogeneous clayey sandstone zone. Assimilation experiments are investigated under different settings and sources of model and observational errors. Simulation results demonstrate that the proposed hybrid EnKF-OI scheme successfully recovers both the contaminant and the sorption rate and reduces their uncertainties. Sensitivity analyses also suggest that the adaptive hybrid scheme remains effective with small ensembles, allowing to reduce the ensemble size by up to 80% with respect to the standard EnKF scheme. © 2014 Elsevier Ltd.

  20. Production of a Biofuel that Keeps the Glycerol as a Monoglyceride by Using Supported KF as Heterogeneous Catalyst

    Directory of Open Access Journals (Sweden)

    Juan Calero

    2014-06-01

    Full Text Available This study describes the results obtained in the synthesis of a biofuel that avoids the production of glycerol by applying supported KF as alkaline heterogeneous catalyst, to generate two moles of fatty acid methyl esters and one mole of monoglyceride from one mol of triglyceride. In this respect, the selective transesterification process of sunflower oil with methanol was carried out with KF (10 wt% supported on three different solids, Al2O3, ZnO and MgO. The standard experimental conditions employed in the heterogeneous selective methanolysis reaction were: 12 mL of sunflower oil, 2.7 mL of methanol, 0.8 g of catalyst, at 65 °C temperature and one hour of reaction time. In all cases 100% conversion was obtained, with high selectivity values, greater than 90%, and quite suitable viscosity values, 4.5–8.5 cSt. In this way, the best catalytic behavior in the first use was obtained by using Al2O3 as support. However, although in the five consecutive reuses all catalysts exhibited a continuous decrease in their catalytic activities; the lower one was for KF catalyst using MgO as support. In summary, these three KF supported catalysts are very suitable to obtain a new biofuel, similar to conventional biodiesel, applicable to diesel engines.

  1. An adaptive hybrid EnKF-OI scheme for efficient state-parameter estimation of reactive contaminant transport models

    KAUST Repository

    El Gharamti, Mohamad

    2014-09-01

    Reactive contaminant transport models are used by hydrologists to simulate and study the migration and fate of industrial waste in subsurface aquifers. Accurate transport modeling of such waste requires clear understanding of the system\\'s parameters, such as sorption and biodegradation. In this study, we present an efficient sequential data assimilation scheme that computes accurate estimates of aquifer contamination and spatially variable sorption coefficients. This assimilation scheme is based on a hybrid formulation of the ensemble Kalman filter (EnKF) and optimal interpolation (OI) in which solute concentration measurements are assimilated via a recursive dual estimation of sorption coefficients and contaminant state variables. This hybrid EnKF-OI scheme is used to mitigate background covariance limitations due to ensemble under-sampling and neglected model errors. Numerical experiments are conducted with a two-dimensional synthetic aquifer in which cobalt-60, a radioactive contaminant, is leached in a saturated heterogeneous clayey sandstone zone. Assimilation experiments are investigated under different settings and sources of model and observational errors. Simulation results demonstrate that the proposed hybrid EnKF-OI scheme successfully recovers both the contaminant and the sorption rate and reduces their uncertainties. Sensitivity analyses also suggest that the adaptive hybrid scheme remains effective with small ensembles, allowing to reduce the ensemble size by up to 80% with respect to the standard EnKF scheme. © 2014 Elsevier Ltd.

  2. Electric conductivity of low-temperature molten electrolyte KF-AlF3 with additions of LiF and Al2O3

    International Nuclear Information System (INIS)

    Apisarov, A.P.; Kryukovskij, V.A.; Zajkov, Yu.P.; Red'kin, A.A.; Tkacheva, O.Yu.; Khokhlov, V.A.

    2007-01-01

    Electric conductivity of LiF, Al 2 O 3 doped KF-AlF 3 (Cryolite Ratio CR=1.3) molten electrolytes was estimated on the basis of empiric equations. Specific electric conductivity of KF-AlF 3 , KF-AIF 3 -AI 2 O 3 , KF-AlF 3 -LiF, KF-AlF 3 -LiF-Al 2 0 3 molten mixtures was measured in the range 687-797 Deg C. Cells with the pyrolytic boron nitride capillary and parallel molybdena electrodes were applied for the determination of electric conductivity. Comparison of calculated and experimental data of the specific electric conductivity of cryolite-alumina melts confirms that the offered model of the calculation adequate represents temperature and concentration dependencies, and it permits forecasting its change under the introduction of different additives in electrolyte [ru

  3. Language Learning Shifts and Attitudes towards Language Learning in an Online Tandem Program for Beginner Writers

    Science.gov (United States)

    Tolosa, Constanza; Ordóñez, Claudia Lucía; Guevara, Diana Carolina

    2017-01-01

    We present findings of a project that investigated the potential of an online tandem program to enhance the foreign language learning of two groups of school-aged beginner learners, one learning English in Colombia and the other learning Spanish in New Zealand. We assessed the impact of the project on students' learning with a free writing…

  4. English Idioms and Iranian Beginner Learners: A Focus on Short Stories and Pictures

    Science.gov (United States)

    Mehrpour, Saeed; Mansourzadeh, Nurullah

    2017-01-01

    Idiomatic expressions are among the most difficult and challenging aspects in the realm of lexicon. The focus of the present study was on investigating the effect of short stories and pictures on learning idiomatic expressions by beginner EFL learners. For this aim, 52 Iranian EFL learners were chosen and assigned to three groups randomly: two…

  5. Shifting ontologies of a serious game and its relationships with English education for beginners

    DEFF Research Database (Denmark)

    Hansbøl, Mikala; Meyer, Bente

    2011-01-01

      This paper takes its point of departure in a language project, which is a subproject under the larger ongoing (2007-2011) research project Serious Games on a Global Market Place. The language project follows how the virtual universe known as Mingoville ( http://www.mingoville.com/ ) becomes an ...... and learning situations of English for beginners. Keywords: Entanglement approach, relational ontology, serious games, teaching and learning English for beginners, educational technology research...... an actor in English education for beginners. The virtual universe provides an online environment for students beginning to learn English in schools and at home. This paper will focus on the shifting ontologies of Mingoville and teaching and learning situations in beginners' English. This paper takes its......  This paper takes its point of departure in a language project, which is a subproject under the larger ongoing (2007-2011) research project Serious Games on a Global Market Place. The language project follows how the virtual universe known as Mingoville ( http://www.mingoville.com/ ) becomes...

  6. A Case Study: Writing a Spanish Dictionary as a Collaborative Task among Beginner Students

    Science.gov (United States)

    Lopez, Nuria

    2016-01-01

    This article reports a small-scale study carried out in a beginners' Spanish class of second year undergraduate students. The purpose of the study was to investigate the effectiveness of a vocabulary task in terms of its impact on vocabulary acquisition, the learners' approach to vocabulary learning and their motivation and engagement. The task…

  7. Enhancing Beginners' Second Language Learning through an Informal Online Environment

    Science.gov (United States)

    Chakowa, Jessica

    2018-01-01

    Web 2.0 tools are used increasingly to support second language learning, but there have been limited studies involving beginner learners, multiple technologies, and informal settings. This current study addresses this gap and investigates the factors affecting students' interest in a nongraded online learning environment and what kinds of tools,…

  8. Collection Development for the School Library Media Program: A Beginner's Guide

    Science.gov (United States)

    Kerby, Mona

    2006-01-01

    A valuable resource for new or experienced school librarians, "Collection Development for the School Library Media Program: A Beginner's Guide" is an easy-to-use guide to collection development. It provides practical and relevant information about collection development issues such as: the school users, policies, selection criteria and sources,…

  9. Programming Languages or Generic Software Tools, for Beginners' Courses in Computer Literacy?

    Science.gov (United States)

    Neuwirth, Erich

    1987-01-01

    Discussion of methods that can be used to teach beginner courses in computer literacy focuses on students aged 10-12. The value of using a programing language versus using a generic software package is highlighted; Logo and Prolog are reviewed; and the use of databases is discussed. (LRW)

  10. Reasoning process characteristics in the diagnostic skills of beginner, competent, and expert dentists.

    Science.gov (United States)

    Crespo, Kathleen E; Torres, José E; Recio, María E

    2004-12-01

    The purpose of this study was to evaluate qualitative differences in the diagnostic reasoning process at different developmental stages of expertise. A qualitative design was used to study cognitive processes that characterize the diagnosis of oral disease at the stages of beginner (five junior students who had passed the NBDE I), competent (five GPR first-year residents), and expert dentists (five general dentists with ten or more years of experience). Individually, each participant was asked to determine the diagnosis of an oral condition based on a written clinical case, using the think aloud technique and retrospective reports. A subsequent interview was conducted to obtain the participants' diagnostic process model and pathophysiology of the case. The analysis of the verbal protocols indicated that experts referred to the patient's sociomedical context more frequently, demonstrated better organization of ideas, could determine key clinical findings, and had an ability to plan for the search of pertinent information. Fewer diagnostic hypotheses were formulated by participants who used forward reasoning, independent of the stage of development. Beginners requested additional diagnostic aids (radiographs, laboratory tests) more frequently than the competent/expert dentists. Experts recalled typical experiences with patients, while competent/beginner dentists recalled information from didactic courses. Experts evidenced cognitive diagnostic schemas that integrate pathophysiology of disease, while competent and beginner participants had not achieved this integration. We conclude that expert performance is a combination of a knowledge base, reasoning skills, and an accumulation of experiences with patients that is qualitatively different from that of competent and beginner dentists. It is important for dental education to emphasize the teaching of cognitive processes and to incorporate a wide variety of clinical experiences in addition to the teaching of

  11. Short-Range prediction of a Mediterranean Severe weather event using EnKF: Configuration tests

    Science.gov (United States)

    Carrio Carrio, Diego Saul; Homar Santaner, Víctor

    2014-05-01

    The afternoon of 4th October 2007, severe damaging winds and torrential rainfall affected the Island of Mallorca. This storm produced F2-F3 tornadoes in the vicinity of Palma, with one person killed and estimated damages to property exceeding 10 M€. Several studies have analysed the meteorological context in which this episode unfolded, describing the formation of a train of multiple thunderstorms along a warm front and the evolution of a squall line organized from convective activity initiated offshore Murcia during that morning. Couhet et al. (2011) attributed the correct simulation of the convective system and particularly its organization as a squall line to the correct representation of a convergence line at low-levels over the Alboran Sea during the first hours of the day. The numerical prediction of mesoscale phenomena which initiates, organizes and evolves over the sea is an extremely demanding challenge of great importance for coastal regions. In this study, we investigate the skill of a mesoscale ensemble data assimilation system to predict the severe phenomena occurred on 4th October 2007. We use an Ensemble Kalman Filter which assimilates conventional (surface, radiosonde and AMDAR) data using the DART implementation from (NCAR). On the one hand, we analyse the potential of the assimilation cycle to advect critical observational data towards decisive data-void areas over the sea. Furthermore, we assess the sensitivity of the ensemble products to the ensemble size, grid resolution, assimilation period and physics diversity in the mesoscale model. In particular, we focus on the effect of these numerical configurations on the representation of the convective activity and the precipitation field, as valuable predictands of high impact weather. Results show that the 6-h EnKF assimilation period produces initial fields that successfully represent the environment in which initiation occurred and thus the derived numerical predictions render improved

  12. Ethanol production from kitchen waste using the flocculating yeast Saccharomyces cerevisiae strain KF-7

    Energy Technology Data Exchange (ETDEWEB)

    Tang, Yue-Qin; Liu, Kai; An, Ming-Zhe; Morimura, Shigeru; Kida, Kenji [Graduate School of Science and Technology, Kumamoto University, 2-39-1 Kurokami, Kumamoto 860-8555 (Japan); Koike, Yoji [Tokyo Gas Co., Ltd., 1-7-7 Suehiro-cho, Tsurumi-ku, Yokohama City, Kanagawa 230-0045 (Japan); Wu, Xiao-Lei [Department of Energy and Resources Engineering, College of Engineering, Peking University, Beijing 100871 (China)

    2008-11-15

    A process for producing ethanol from kitchen waste was developed in this study. The process consists of freshness preservation of the waste, saccharification of the sugars in the waste, continuous ethanol fermentation of the saccharified liquid, and anaerobic treatment of the saccharification residue and the stillage. Spraying lactic acid bacteria (LCB) on the kitchen waste kept the waste fresh for over 1 week. High glucose recovery (85.5%) from LCB-sprayed waste was achieved after saccharification using Nagase N-40 glucoamylase. The resulting saccharified liquid was used directly for ethanol fermentation, without the addition of any nutrients. High ethanol productivity (24.0 g l{sup -1} h{sup -1}) was obtained when the flocculating yeast strain KF-7 was used in a continuous ethanol fermentation process at a dilution rate of 0.8 h{sup -1}. The saccharification residue was mixed with stillage and treated in a thermophilic anaerobic continuous stirred tank reactor (CSTR); a VTS loading rate of 6 g l{sup -1} d{sup -1} with 72% VTS digestion efficiency was achieved. Using this process, 30.9 g ethanol, and 65.2 l biogas with 50% methane, was produced from 1 kg of kitchen waste containing 118.0 g total sugar. Thus, energy in kitchen waste can be converted to ethanol and methane, which can then be used as fuels, while simultaneously treating kitchen waste. (author)

  13. KfK-analysis of the SUPER-PHENIX-1 control rod experiments. Pt. 2

    International Nuclear Information System (INIS)

    Giese, H.

    1992-10-01

    Using standard data and codes, this first analysis campaign led to results that drastically overestimated measured control rod worths with C/E ratios ranging from 1.17 to 1.28. These findings were in sharp contrast to the results of the majority of earlier control rod experiments in zero-power facilities, where C/E ratios were usually comprised between 1.0 and 1.1. Investigations were then launched to identify the origin of this discrepancy. By comparison with the calculation methods employed by the other working groups engaging in the analysis of the SPX-1 experiments it was found that the principal problem arose from the KfK/BN-procedure used for the homogenization of control rod absorber cross sections. The specific failure of this standard procedure in the case of the SPX-1 analysis is ascribed to the extremely heterogeneous structure of the SPX-1 control rods. In an attempt to improve on this point, a new method for the production of homogenized absorber cross sections was developed and applied to the SPX-1 analysis. The report concludes with a description of this method and a survey of the results obtained for SPX-1. It is found that this revised analysis leads to a significantly improved agreement of measured and calculated control rod worths and to a better consistency with the results of earlier control rod experiments in zero-power facilities. (orig.)

  14. Electrochemical separation of uranium in the molten system LiF-NaF-KF-UF4

    Science.gov (United States)

    Korenko, M.; Straka, M.; Szatmáry, L.; Ambrová, M.; Uhlíř, J.

    2013-09-01

    This article is focused on the electrochemical investigation (cyclic voltammetry and related studies) of possible reduction of U4+ ions to metal uranium in the molten system LiF-NaF-KF(eut.)-UF4 that can provide basis for the electrochemical extraction of uranium from molten salts. Two-step reduction mechanism for U4+ ions involving one electron exchange in soluble/soluble U4+/U3+ system and three electrons exchange in the second step were found on the nickel working electrode. Both steps were found to be reversible and diffusion controlled. Based on cyclic voltammetry, the diffusion coefficients of uranium ions at 530 °C were found to be D(U4+) = 1.64 × 10-5 cm2 s-1 and D(U3+) 1.76 × 10-5 cm2 s-1. Usage of the nickel spiral electrode for electrorefining of uranium showed fairly good feasibility of its extraction. However some oxidant present during the process of electrorefining caused that the solid deposits contained different uranium species such as UF3, UO2 and K3UO2F5.

  15. Rainfall Simulations of Typhoon Morakot with Controlled Translation Speed Based on EnKF Data Assimilation

    Directory of Open Access Journals (Sweden)

    Tzu-Hsiung Yen

    2011-01-01

    Full Text Available Typhoon Morakot produced record-breaking accumulated rainfall over southern Taiwan in August 2009. The combination of several factors resulted in this extreme weather event: the steep terrain in Taiwan, the prevailing south-westerly flow in the monsoon trough, Typhoon Goni over the northern South China Sea, and the slow translation speed of Morakot itself over Taiwan. In this study, the influence of the translation speed is particularly emphasized. Based on the EnKF data assimilation, an innovative method is applied to perform ensemble simulations with several designated translation speeds of Morakot using the WRF model. Thus the influence of the translation speed on the amount of accumulated rainfall over Taiwan can be quantitatively evaluated. In the control simulation with observed translation speed, the maximum amount and geographic pattern of accumulated rainfall during the landfall period of Morakot are generally consistent with the observations, though the detailed overall distributions of accumulated rainfall is mostly underestimated, resulting in the low bias of the frequency distribution of the accumulated rainfall. In a simulation with nearly-doubled translation speed of Morakot, the maximum accumulated rainfall is decreased by 33% than that in the control simulation, while the rainfall distribution over Taiwan remains similar. In addition, the 28 ensemble members can further provide additional information in terms of their spread and other statistics. The results from ensemble members reveal the usefulness of ensemble simulations for the quantitative precipitation forecast.

  16. Ethanol production from kitchen waste using the flocculating yeast Saccharomyces cerevisiae strain KF-7

    International Nuclear Information System (INIS)

    Tang, Y.-Q.; Koike, Yoji; Liu Kai; An, M.-Z.; Morimura, Shigeru; Wu Xiaolei; Kida, Kenji

    2008-01-01

    A process for producing ethanol from kitchen waste was developed in this study. The process consists of freshness preservation of the waste, saccharification of the sugars in the waste, continuous ethanol fermentation of the saccharified liquid, and anaerobic treatment of the saccharification residue and the stillage. Spraying lactic acid bacteria (LCB) on the kitchen waste kept the waste fresh for over 1 week. High glucose recovery (85.5%) from LCB-sprayed waste was achieved after saccharification using Nagase N-40 glucoamylase. The resulting saccharified liquid was used directly for ethanol fermentation, without the addition of any nutrients. High ethanol productivity (24.0 g l -1 h -1 ) was obtained when the flocculating yeast strain KF-7 was used in a continuous ethanol fermentation process at a dilution rate of 0.8 h -1 . The saccharification residue was mixed with stillage and treated in a thermophilic anaerobic continuous stirred tank reactor (CSTR); a VTS loading rate of 6 g l -1 d -1 with 72% VTS digestion efficiency was achieved. Using this process, 30.9 g ethanol, and 65.2 l biogas with 50% methane, was produced from 1 kg of kitchen waste containing 118.0 g total sugar. Thus, energy in kitchen waste can be converted to ethanol and methane, which can then be used as fuels, while simultaneously treating kitchen waste

  17. Separating DDTs in edible animal fats using matrix solid-phase dispersion extraction with activated carbon filter, Toyobo-KF.

    Science.gov (United States)

    Furusawa, Naoto

    2006-09-01

    A technique is presented for the economical, routine, and quantitative analysis of contamination by dichloro-diphenyl-trichloroethanes (DDTs) [pp'-DDT, pp'-dichlorodiphenyl dichloroethylene, and pp'-dichlorodiphenyl dichloreothane in beef tallow and chicken fat samples, based on their separation using matrix solid-phase dispersion (MSPD) extraction with Toyobo-KF, an activated carbon fiber. Toyobo-KF is a newly applied MSPD sorbent, and it is followed by reversed-phase high-performance liquid chromatography (HPLC) with a photodiode array detector. The resulting analytical performance parameters [recoveries of spiked DDTs (0.1, 0.2, and 0.4 microg/g) > or = 81%, with relative standard deviations of < or = 8% (n = 5), and quantitation limits < or = 0.03 microg/g], with minimal handling and cost-efficiency, indicate that the present MSPD-HPLC method may be a useful tool for routine monitoring of DDT contamination in meat.

  18. Electrochemical investigation on the redox chemistry of niobium in LiCl-KCl-KF-Na2O melts

    DEFF Research Database (Denmark)

    Gillesberg, Bo; Bjerrum, Niels; Barner, Jens H. Von

    1997-01-01

    The system LiCl-KCl-KF-1 mole percent K2NbF7 (molar ration F-/Nb = 8) has been investigated in-the temperature range 370 to 725 degrees C by cyclic and square wave voltammetry. In the temperature range from 370 to 520 degrees C Nb(V) was reduced to Nb(III) in two reversible steps: Nb(V) --> Nb(IV...

  19. Operating software for plutonium measurements in the KfK K-edge densitometer. A user's guide

    International Nuclear Information System (INIS)

    Eberle, H.

    1983-09-01

    A set of computer programs has been developed for the execution of plutonium concentration measurements in the KfK K-edge photon absorptiometer for performance evaluation. The programs are implemented on a ND-6620 data acquisition and processing system. A short description of the programs and commands for data accumulation and analysis is given. Nevertheless, the user should be familiar with the ND-6620 data acquisition and processing system, its system software, and with the FORTRAN programming language. (orig./HP)

  20. Nuclear Fusion Project. Semi-annual report of the Association KfK/EURATOM

    International Nuclear Information System (INIS)

    Kast, G.

    1989-04-01

    Report on technology tasks: Blanket design studies; development of computational tools for neutronics; corrosion and fatigue of structural materials in flowing Pb-17Li; tritium extraction from liquid Pb-17Li by the use of solid getters; ceramic breeder materials; high field composite conductors; superconducting poloidal field coil development; design and construction of a poloidal field coil for TORE SUPRA as NET-prototype coil; structural materials fatigue characterization at 4 K; low electrical conductivity structural development; MANET 1; pre- and post-irradiation fatigue properties of 1.4914 martensitic steel; in-pile creep-fatigue testing of type 316 and 1.4914 steel; ceramics for first-wall protection and for RF windows; fatigue under dual beam irradiation; low activation ferritic-martensitic steels; plasma facing components; procedures and tools for structural design evaluation; remote maintenance; mechanical component assembly; handling equipment for in-vessel components; safety aspects of the cryosystem and of superconducting magnets; safety guidelines for the design of NET; generic environmental impact assessment for a fusion facility; large components for plasma exhaust pumping; optimization of cryogenic vacuum pumping of He; solid particle separators for plasma exhaust; plasma exhaust purification; adsorption of DT on heated metal beds other than U; catalyst development for the exhaust purification process; ECRH power sources; vacuum and exhaust performance of NET; NET TF pancake tests; CAD DATA exchange between NET and KfK; catalytic plasma exhaust gas clean-up facility for NET; NET blanket handling device; electrical connectors for remote handling. (orig./HP)

  1. Teaching of reading to school beginners : a study of reading programmes in primary one in Uganda

    OpenAIRE

    Kemizano, Rosert

    2007-01-01

    Abstract The study examines reading programmes with the reference to the teaching/learning of reading to school beginners. The teaching of reading at the early stages is important because it is the quality of the experiences that children get that affect or lay the foundation for reading development (Chall, 1996).Therefore, the phenomenon, “teaching of reading to school beginners” studied is of great importance. The theoretical background used includes reading and its importance, Languag...

  2. Practice for beginners programming lesson using App Lab: Introduction of programming learning for undergraduate students

    OpenAIRE

    榊原, 直樹

    2017-01-01

    App Lab is an online programming education environment. It was designed classes of programming for beginners using the App Lab. Through 15 lessons of the class, it was to understand the basic structure of the programming of the sequential-repetition-branch. Students were allowed to complete the game as a final project. The effectiveness of App the Lab has been confirmed from these results.

  3. Consideration of a Learning Programming Process based on Software Design for Beginners

    OpenAIRE

    大村, 基将; 紅林, 秀治

    2016-01-01

    We considered a learning programming process based on software design for technology education. Lessons of computer program-aided measurement and control are for beginners to learn programming. These lessons are efficient to learn the step of programming, but the main of the lessons are works of typing the sample programming and debugging. Therefore, these lessons have a fundamental lack of the concept of design. Then we considered learning processes of programming and applied the process of ...

  4. [Beginners' operations and medical specialist standards : Avoidance of criminal liability and civil liability].

    Science.gov (United States)

    Schneider, H

    2018-05-16

    In all phases, patients are entitled to receive medical treatment according to medical specialist standards. This does not mean that patients necessarily have to be treated by a medical specialist. Operations performed by "beginners", e. g. assistant physicians, are permitted. However, there are increased liability risks, both for the specialist and the assistant physician. Furthermore, there are risks of criminal responsibility for causing bodily harm by negligence or negligent manslaughter. This article portrays the requirements of civil liability and criminal responsibility concerning beginners' operations on the basis of cases and judgments of the Federal Court and the Higher Regional Courts in Germany. Additionally, the reception of the jurisprudence by the relevant legal literature will be discussed. Jurisprudence and legal literature categorize breaches of duty of care. Assistant physicians can be subject to contributory negligence liabilities, while specialists can bear liabilities for negligent selection, organization or supervision. Responsible specialist and assistant physicians can protect themselves (and the patient) and avoid legal risks by only performing operations adequate to their educational level or by delegating operations to beginners and ensuring intervention by a specialist by supervision of the operation which is suitable to the assistant physician's level of education.

  5. Estimation of water level and steam temperature using ensemble Kalman filter square root (EnKF-SR)

    Science.gov (United States)

    Herlambang, T.; Mufarrikoh, Z.; Karya, D. F.; Rahmalia, D.

    2018-04-01

    The equipment unit which has the most vital role in the steam-powered electric power plant is boiler. Steam drum boiler is a tank functioning to separate fluida into has phase and liquid phase. The existence in boiler system has a vital role. The controlled variables in the steam drum boiler are water level and the steam temperature. If the water level is higher than the determined level, then the gas phase resulted will contain steam endangering the following process and making the resulted steam going to turbine get less, and the by causing damages to pipes in the boiler. On the contrary, if less than the height of determined water level, the resulted height will result in dry steam likely to endanger steam drum. Thus an error was observed between the determined. This paper studied the implementation of the Ensemble Kalman Filter Square Root (EnKF-SR) method in nonlinear model of the steam drum boiler equation. The computation to estimate the height of water level and the temperature of steam was by simulation using Matlab software. Thus an error was observed between the determined water level and the steam temperature, and that of estimated water level and steam temperature. The result of simulation by Ensemble Kalman Filter Square Root (EnKF-SR) on the nonlinear model of steam drum boiler showed that the error was less than 2%. The implementation of EnKF-SR on the steam drum boiler r model comprises of three simulations, each of which generates 200, 300 and 400 ensembles. The best simulation exhibited the error between the real condition and the estimated result, by generating 400 ensemble. The simulation in water level in order of 0.00002145 m, whereas in the steam temperature was some 0.00002121 kelvin.

  6. Language Learning Shifts and Attitudes Towards Language Learning in an Online Tandem Program for Beginner Writers

    Directory of Open Access Journals (Sweden)

    Constanza Tolosa

    2017-01-01

    Full Text Available We present findings of a project that investigated the potential of an online tandem program to enhance the foreign language learning of two groups of school-aged beginner learners, one learning English in Colombia and the other learning Spanish in New Zealand. We assessed the impact of the project on students’ learning with a free writing activity done as pretest and posttest and used a semi-structured interview to explore their attitudes towards language learning and their perceived development of their native language. Data analysis indicated statistically significant gains in foreign language writing and positive attitudinal changes toward foreign and native language learning.

  7. A beginner's guide to writing the nursing conceptual model-based theoretical rationale.

    Science.gov (United States)

    Gigliotti, Eileen; Manister, Nancy N

    2012-10-01

    Writing the theoretical rationale for a study can be a daunting prospect for novice researchers. Nursing's conceptual models provide excellent frameworks for placement of study variables, but moving from the very abstract concepts of the nursing model to the less abstract concepts of the study variables is difficult. Similar to the five-paragraph essay used by writing teachers to assist beginning writers to construct a logical thesis, the authors of this column present guidelines that beginners can follow to construct their theoretical rationale. This guide can be used with any nursing conceptual model but Neuman's model was chosen here as the exemplar.

  8. FusionCharts Beginner's Guide The Official Guide for FusionCharts Suite

    CERN Document Server

    Nadhani, Sanket; Bhattacharya, Shamasis

    2012-01-01

    The book is written as a practical, step-by-step guide to using FusionCharts Suite. The book not only teaches you the fundamentals and implementation of FusionCharts Suite, but also makes you the data visualization guru among your friends and colleagues by teaching how to select the right chart type and usability tips. Filled with examples, code samples and practical tips in a no-nonsense way, the book is a breeze to read.This book is both for beginners and advanced web developers who need to create interactive charts for their web applications. No previous knowledge of FusionCharts Suite is a

  9. Shifting ontologies of a serious game and its relationships with English education for beginners

    DEFF Research Database (Denmark)

    Hansbøl, Mikala; Meyer, Bente

    2011-01-01

      This paper takes its point of departure in a language project, which is a subproject under the larger ongoing (2007-2011) research project Serious Games on a Global Market Place. The language project follows how the virtual universe known as Mingoville ( http://www.mingoville.com/ ) becomes...... point of departure in neither Mingoville as part of the media ecologies of the classroom, nor in the epistemological ramifications of Mingoville. Instead, it suggests that opening up the shifting ontologies of Mingoville (i.e. what mediates Mingoville and its relationships with doing beginners English...

  10. A New Approach to Programming Language Education for Beginners with Top-Down Learning

    Directory of Open Access Journals (Sweden)

    Daisuke Saito

    2013-12-01

    Full Text Available There are two basic approaches in learning new programming language: a bottom-up approach and a top-down approach. It has been said that if a learner has already acquired one language, the top-down approach is more efficient to learn another while, for a person who has absolutely no knowledge of any programming languages; the bottom-up approach is preferable. The major problem of the bottom-up approach is that it requires longer period to acquire the language. For quicker learning, this paper applies a top-down approach for a beginners who has not yet acquired any programming languages.

  11. Adobe Flash 11 Stage3D (Molehill) Game Programming Beginner's Guide

    CERN Document Server

    Kaitila, Christer

    2011-01-01

    Written in an informal and friendly manner, the style and approach of this book will take you on an exciting adventure. Piece by piece, detailed examples help you along the way by providing real-world game code required to make a complete 3D video game. Each chapter builds upon the experience and achievements earned in the last, culminating in the ultimate prize - your game! If you ever wanted to make your own 3D game in Flash, then this book is for you. This book is a perfect introduction to 3D game programming in Adobe Molehill for complete beginners. You do not need to know anything about S

  12. Maxwell–Stefan diffusion and dynamical correlation in molten LiF-KF: A molecular dynamics study

    Energy Technology Data Exchange (ETDEWEB)

    Jain, Richa Naja, E-mail: ltprichanaja@gmail.com; Chakraborty, Brahmananda; Ramaniah, Lavanya M. [High Pressure & Synchrotron Radiation Physics Division, Bhabha Atomic Research Centre, Trombay, Mumbai-85 (India)

    2016-05-23

    In this work our main objective is to compute Dynamical correlations, Onsager coefficients and Maxwell-Stefan (MS) diffusivities for molten salt LiF-KF mixture at various thermodynamic states through Green–Kubo formalism for the first time. The equilibrium molecular dynamics (MD) simulations were performed using BHM potential for LiF–KF mixture. The velocity autocorrelations functions involving Li ions reflect the endurance of cage dynamics or backscattering with temperature. The magnitude of Onsager coefficients for all pairs increases with increase in temperature. Interestingly most of the Onsager coefficients has almost maximum magnitude at the eutectic composition indicating the most dynamic character of the eutectic mixture. MS diffusivity hence diffusion for all ion pairs increases in the system with increasing temperature. Smooth variation of the diffusivity values denies any network formation in the mixture. Also, the striking feature is the noticeable concentration dependence of MS diffusivity between cation-cation pair, Đ{sub Li-K} which remains negative for most of the concentration range but changes sign to become positive for higher LiF concentration. The negative MS diffusivity is acceptable as it satisfies the non-negative entropy constraint governed by 2{sup nd} law of thermodynamics. This high diffusivity also vouches the candidature of molten salt as a coolant.

  13. Development of a Portable Training Tool for Simulating Visceral Angiographic Procedures for Beginners

    International Nuclear Information System (INIS)

    Yamagami, Takuji; Osuga, Keigo; Yoshimatsu, Rika; Matsumoto, Tomohiro; Miura, Hiroshi; Terayama, Koshi; Anai, Hiroshi; Takahashi, Masahide; Hasebe, Terumitsu; Nishimura, Tsunehiko

    2009-01-01

    The purpose of this study was to evaluate the usefulness of a tool that we developed to simulate performance of visceral angiography to train beginners in the field of splanchnic angiography. Seven residents and two fellows who were rotating within the Division of Interventional Radiology at our institution between June and August 2008 participated in the evaluation of this tool. They had no experience in performing visceral angiography as an operator. Time for selection of arterial branches arising from the celiac axis on the model was measured before and after training. After such training, the participants performed actual visceral angiography as an operator with instructors beside them. Success of the trainees in selecting visceral arterial branches was evaluated in these real-life cases. In the first test using the model, seven of nine trainees (77.8%) succeeded in selecting all required arteries, while the remaining two failed to select all required arteries. After training using the model, all trainees succeeded in selecting all required arteries just before the actual angiographic study. In the actual angiography, the catheter was successfully inserted from the femoral artery and advanced to the superior mesenteric, celiac, splenic, common hepatic, gastroduodenal, and right and left hepatic arteries by all trainees with only two exceptions. In conclusion, this tool is helpful for training beginners in visceral angiographic procedures.

  14. Peculiarities of mathematics instruction for beginners for children with disabilities in regular primary schools

    Directory of Open Access Journals (Sweden)

    Jablan Branka

    2010-01-01

    Full Text Available The paper studies the issue of education of visually impaired children, hearing impaired children and children with intellectual disabilities in regular primary schools in the context of mathematics instruction for beginners. The authors state the basic characteristics of mathematics instruction for beginners with respect to the contents studied in the first four grades of primary school, as well as the key problems and educational needs of visually impaired children, hearing impaired children and children with intellectual disabilities. The basic characteristics of inclusive education and the key role of teacher in this process are pointed out. Starting from the developmental peculiarities of children with disabilities, the authors emphasize the importance of applying an individualized approach in teaching mathematics. Possible didactic and methodical solutions are discussed, as well as different approaches in teaching this subject that can facilitate learning of mathematical contents to visually impaired children, hearing impaired children and children with intellectual disabilities. Bearing in mind the peculiarities of inclusive education, i.e. the need for the children with disabilities to participate in common activities with the other children in the class, the authors emphasize the importance of encouraging interaction and communication among children in the process of learning mathematical contents.

  15. KF/Al2O3 as a Recyclable Basic Catalyst for 1,3-Dipolar Cycloaddition Reaction: Synthesis of Indolizine-1-Carbonitrile Derivatives

    Directory of Open Access Journals (Sweden)

    Abaszadeh Mehdi

    2017-07-01

    Full Text Available KF/Al2O3 as a green and efficient catalyst has been used for synthesis of indolizine-1-carbonitrile derivatives. It can be proceeded by using 1,3-dipolar cycloaddition reaction of 1-alkyl-2-chloropyridinium bromides, malononitrile and benzaldehyde in ethanol, at reflux. The great advantage of this catalyst is the ease of handling. KF/Al2O3 can be used and removed by filtration, avoiding cumbersome aqueous workups and decreasing solvent waste handling issues. High conversions, short reaction times and a cleaner reaction profiles are some of the outstanding advantages of this method.

  16. Electrochemical behaviours of lanthanide fluorides in the electrolysis system with LiF-NaF-Kf salt

    International Nuclear Information System (INIS)

    Joon-Bo, Shim; Sung-Chan, Hwang; Eung-Ho, Kim; Young-Ho, Kang; Byung-Jik, Lee; Jae-Hyung, Yoo

    2003-01-01

    As a part of partitioning studies, the experiments of cyclic voltammetry and electrolytic reduction with the liquid bismuth cathode were conducted to investigate electrochemical behaviours of lanthanide elements in the electrorefining system employing LiF-NaF-KF eutectic salt as the electrolyte. The cyclic voltammograms for NdF 3 and GdF 3 were obtained at various potential scan rates, respectively. The cathodic and anodic peak currents of the elements increased in proportion to the square root of the potential scan rate. According to changes of the potential difference between the coupled cathodic and anodic peaks, reversibilities of the reduction-oxidation reactions in this system were evaluated. In addition, further behaviours of electrochemical reaction of the elements were examined through electrolytic tests of the system using liquid bismuth as the cathode at fixed current densities. (author)

  17. Task-Based Language Teaching for Beginner-Level Learners of L2 French: An Exploratory Study

    Science.gov (United States)

    Erlam, Rosemary; Ellis, Rod

    2018-01-01

    This study investigated the effect of input-based tasks on the acquisition of vocabulary and grammar by beginner-level learners of L2 French and reported the introduction of task-based teaching as an innovation in a state secondary school. The experimental group (n = 19) completed a series of focused input-based language tasks, taught by their…

  18. Enhanced Recognition of Written Words and Enjoyment of Reading in Struggling Beginner Readers through Whole-Word Multimedia Software

    Science.gov (United States)

    Karemaker, Arjette; Pitchford, Nicola J.; O'Malley, Claire

    2010-01-01

    The effectiveness of a reading intervention using the whole-word multimedia software "Oxford Reading Tree (ORT) for Clicker" was compared to a reading intervention using traditional ORT Big Books. Developing literacy skills and attitudes towards learning to read were assessed in a group of 17 struggling beginner readers aged 5-6 years. Each child…

  19. Using Reciprocal Peer Teaching to Develop Learner Autonomy: An Action Research Project with a Beginners' Chinese Class

    Science.gov (United States)

    Liu, Weiming; Devitt, Ann

    2014-01-01

    Peer teaching has been used as a mechanism for promoting learner autonomy in a range of language learning contexts. This article explores how absolute beginners in a Chinese class can engage in reciprocal peer teaching (RPT) from the start of their language learning experience and how this contributes to the development of their autonomy as…

  20. Food Ration and Mental Training for the Improvement of the Free Throw Performance in Congolese Beginners Basketball Players

    Science.gov (United States)

    Bouhika, Eddie Janvier; Moussouami, Simplice Innocent; Tsiama Portejoie, Jean Aimé; Bazaba Kayilou, Jean Michel; Moyen, Rachel; Mizere Moungondo, Martin; Maouene, Michel; Mbemba, François

    2016-01-01

    Objective: Through an experimental study, the present work aims at testing the effectiveness of diet and mental imagery on the success of free throw in Congolese beginners Basketball Players. Method: 45 players participated in this experimental study in Brazzaville (Congo). These subjects were divided into 3 groups. Group I (n = 15), made up of…

  1. A Drawing and Multi-Representational Computer Environment for Beginners' Learning of Programming Using C: Design and Pilot Formative Evaluation

    Science.gov (United States)

    Kordaki, Maria

    2010-01-01

    This paper presents both the design and the pilot formative evaluation study of a computer-based problem-solving environment (named LECGO: Learning Environment for programming using C using Geometrical Objects) for the learning of computer programming using C by beginners. In its design, constructivist and social learning theories were taken into…

  2. Factors That Contribute to Transfer and Bachelor's Degree Attainment of Low-Income Community College Beginners

    Science.gov (United States)

    Felder, Andrea Darlene

    2016-01-01

    Transfer and bachelor's degree attainment rates of low-income community college beginners lag behind their middle- and high-income peers. As community college continues to be an affordable and accessible route to higher education, consideration should be given to how to close the gap in transfer and bachelor's degree attainment rates of low-income…

  3. From Theory to Practice: Beginner Teachers' Experiences of the Rigour of the Postgraduate Certificate in Education Programme

    Science.gov (United States)

    Nomlomo, Vuyokazi; Sosibo, Zilungile

    2016-01-01

    This article focuses on how recent graduates perceive the rigour of the Postgraduate Certificate in Education (PGCE) initial teacher education (ITE) programme. The article is based on qualitative data collected from a purposely selected sample of 19 beginner teachers who graduated from two higher education institutions that offer PGCE programmes…

  4. Quantitative Analysis of KF-LiF-ZrF4 Molten Salt by Probe Assisted in-situ LIBS Systems

    International Nuclear Information System (INIS)

    Kim, S.H.; Moon, J.H.; Kim, D.H.; Hwang, I.S.; Lee, J.H.

    2015-01-01

    Full text of publication follows: Pyro-processing draws attention as a recycling process of spent nuclear fuel for future nuclear reactor. In the aspect of process control and safeguards of the pyro-processing, it requires a technology to measure the concentration of molten salt in real-time. The existing technologies measure the concentration by chemical analysis of sampled molten salt in the hot cell but it is disadvantageous in the aspects of cost, safety and time. The LIBS (Laser-Induced Breakdown Spectroscopy) is a form of atomic emission spectroscopy in which a pulsed laser is used as the excitation source. LIBS technology is appropriate to measure sensitive nuclear materials in hot cell because it is capable of measuring specimen quantitatively and qualitatively by exited atom by laser. Spectrum obtained from plasma is largely influenced by laser operation conditions and physical properties of specimens. Also, plasma induction is limited on the surface of specimen, so analysis of composition inside of the molten salt is extremely difficult. Thus, several restrictions should be overcome in order to apply LIBS for the measurement of molten salt (KF-LiF-ZrF 4 ) composition in real-time. In this study probe assisted LIBS system will be introduced with KF-LiF-ZrF 4 to quantitatively measure molten salt composition. Echelle spectrometer was used and the measurable wavelength area was 250-400 nm, the range of UV ray. NIST atomic spectra database measured the wavelength for molten salt composition, and each element was selected high signal intensity and wavelength range that is not overlapped by other elements. (authors)

  5. Gaussian anamorphosis in the analysis step of the EnKF: a joint state-variable/observation approach

    Directory of Open Access Journals (Sweden)

    Javier Amezcua

    2014-09-01

    Full Text Available The analysis step of the (ensemble Kalman filter is optimal when (1 the distribution of the background is Gaussian, (2 state variables and observations are related via a linear operator, and (3 the observational error is of additive nature and has Gaussian distribution. When these conditions are largely violated, a pre-processing step known as Gaussian anamorphosis (GA can be applied. The objective of this procedure is to obtain state variables and observations that better fulfil the Gaussianity conditions in some sense. In this work we analyse GA from a joint perspective, paying attention to the effects of transformations in the joint state-variable/observation space. First, we study transformations for state variables and observations that are independent from each other. Then, we introduce a targeted joint transformation with the objective to obtain joint Gaussianity in the transformed space. We focus primarily in the univariate case, and briefly comment on the multivariate one. A key point of this paper is that, when (1–(3 are violated, using the analysis step of the EnKF will not recover the exact posterior density in spite of any transformations one may perform. These transformations, however, provide approximations of different quality to the Bayesian solution of the problem. Using an example in which the Bayesian posterior can be analytically computed, we assess the quality of the analysis distributions generated after applying the EnKF analysis step in conjunction with different GA options. The value of the targeted joint transformation is particularly clear for the case when the prior is Gaussian, the marginal density for the observations is close to Gaussian, and the likelihood is a Gaussian mixture.

  6. Report on research and development work 1985 on the nuclear fusion project. Annual report of the Association KfK-Euratom

    International Nuclear Information System (INIS)

    Finken, D.

    1986-05-01

    The Nuclear Research Centre Karlsruhe and the Max Planck Institute for Plasma Physics together form the Nuclear Fusion Development Association. The partners collaborate with the aim of creating the physical and technical preconditions for the use of the energy released by nuclear fusion and to plan and carry out future large-scale experiments. The work of the Nuclear Research Centre Karlsruhe on fusion with magnetic containment is included in the nuclear fusion project and is part of the European fusion technology programme. The work is supported by an association contract between KfK and Euratom by the European Commission. Connections are built up between areas of work and new projects are prepared by supplementary KfK contributions, mostly studies. This is done with regard to the expansion of the technology programme to be expected for future years and the planning activities for NET. The reports collected here are contributions of the KfK institutes in 1985. The appendix contains a list of the tasks which KfK has taken over from the fusion technology programme of the EEC. References to the institutes' contributions make the assignment of textual contributions easier. (orig.) [de

  7. 101 amazing sights of the night sky a guided tour for beginners

    CERN Document Server

    Moromisato, George

    2017-01-01

    Is there anything more wondrous and alluring than the night sky? You've seen the stars, and you know about the constellations--but there's so much more to discover! George Moromisato's magnificent full-color guide introduces you to 101 amazing sights, from Saturn's famous rings to the Andromeda Galaxy. Learn what to look for and when and where to find it! This astronomy book is perfect for beginners, so many objects can be seen with the unaided eye or binoculars, while others simply require a small telescope. Book Features: Guide to 101 phenomena and objects of the night sky, ranked by beauty, accessibility and historical importance Information about equipment needed, from binoculars to small telescopes Full-color photographs, including many from NASA Astrophotography tips on taking pictures of the night sky, such as snapping shots with a phone through a telescope Charts to know when to look for solar eclipses, meteor showers and other notable events.

  8. Objective-C for Absolute Beginners iPhone and Mac Programming Made Easy

    CERN Document Server

    Bennett, Gary; Fisher, Mitchell

    2010-01-01

    It seems as if everyone is writing applications for Apple's iPhone and iPad, but how do they all do it? It's best to learn Objective-C, the native language of both the iOS and Mac OS X, but where to begin? Right here, even if you've never programmed before! Objective-C for Absolute Beginners will teach you how to write software for your Mac, iPhone,or iPad using Objective-C, an elegant and powerful language with a rich set of developer tools. Using a hands-on approach, you'll learn to think in programming terms, how to use Objective-C to build program logic, and how to write your own applicati

  9. Review of The Atheist’s Primer and Atheism for Beginners

    Directory of Open Access Journals (Sweden)

    Andrew J Bissette

    2014-05-01

    Full Text Available The New Atheists are occasionally accused of lacking nuance and sophistication, or of existing in an intellectual vacuum. To some it may seem that Dawkins 'et al'. are naïve logical positivists; this perspective may be reinforced by recent authors’ explicit rejection of the value of philosophy and other non-scientific approaches to knowledge (cf. Lawrence Krauss, Stephen Hawking. Into the fray steps Michael Palmer, offering his attempt to popularise a version of atheism that is underpinned by a long tradition of philosophical inquiry. 'The Atheist’s Primer', a condensed version of Palmer’s previous work, is aptly named: it is a crash course on the history and major arguments of atheism from a firmly philosophical angle. Its companion text, 'Atheism For Beginners', is a coursebook aimed at tutors seeking to teach this material.

  10. Optical spectra of phthalocyanines and related compounds a guide for beginners

    CERN Document Server

    Isago, Hiroaki

    2015-01-01

    This book displays how optical (absorption, emission, and magnetic circular dichroism) spectra of phthalocyanines and related macrocyclic dyes can be varied from their prototypical ones depending on conditions. As these compounds can be involved in colorful chemistry (which might be driven by impurities in solvents), their spectra behave like the sea-god Proteus in their mutability. Therefore, those who have been engaged with phthalocyanines for the first time, including even educated professional researchers and engineers, may have been embarrassed by the deceptive behavior of their compounds and could have, in the worst cases, given up their projects. This book is aimed not merely at reviewing the optical spectra, but also at helping such people, particularly beginners, to figure them out by showing some examples of their prototypical spectra and their variations in several situations. For the purpose of better understanding, the book also provides an introduction to their theoretical backgrounds as graphic...

  11. Character Learning Strategies Among Danish and Swedish Beginners of Chinese as a Foreign Language (CFL)

    DEFF Research Database (Denmark)

    Zhang, Chun; Chen, Yi-ting

    Inventory for Language Learning (SILL) by Oxford (1990), we adapted Shen’ (2005) questionnaire into two online surveys. The first survey was done in February 2016 aiming to discover some Chinese character learning strategies employed by Danish and Swedish learners. Based on the 1st survey, the second survey......This study was conducted at three universities (i.e., Aarhus University, Copenhagen University, and Stockholm University) at two Nordic countries (i.e., Denmark and Sweden). 39 beginner Danish and Swedish of Chinese (L2) university students participated in the study. Drawing from the strategy...... was developed and thereafter conducted in March 2016. A preliminary analysis revealed that the students used primarily three types of strategies (1) compensation strategies (i.e., application-assisted tools), (2) cognitive strategies (i.e., orthographic knowledge) and (3) memory strategies (i.e., repeated...

  12. Data analysis using SPSS for Windows, versions 8 - 10 a beginner's guide

    CERN Document Server

    Foster, Jeremy J, Dr

    2001-01-01

    A new edition of this best-selling introductory book to cover the latest SPSS versions 8.0 - 10.0 This book is designed to teach beginners how to use SPSS for Windows, the most widely used computer package for analysing quantitative data. Written in a clear, readable and non-technical style the author explains the basics of SPSS including the input of data, data manipulation, descriptive analyses and inferential techniques, including; - creating using and merging data files - creating and printing graphs and charts - parametric tests including t-tests, ANOVA, GLM - correlation, regression and factor analysis - non parametric tests and chi square reliability - obtaining neat print outs and tables - includes a CD-Rom containing example data files, syntax files, output files and Excel spreadsheets.

  13. Advanced Beginner to Competent Practitioner: New Graduate Nurses' Perceptions of Strategies That Facilitate or Hinder Development.

    Science.gov (United States)

    St-Martin, Lyne; Harripaul, Anastasia; Antonacci, Rosetta; Laframboise, Devon; Purden, Margaret

    2015-09-01

    New graduate nurses (NGNs) are a precious resource, but their development from advanced beginners to competent nurses is challenging. This qualitative descriptive study explored NGNs' perceptions of strategies that influenced their development in the first 2 years of employment. Semistructured interviews were conducted with a sample of 13 nurses. The study revealed that NGNs learn to master aspects of the nursing role as they construct a professional identity. They identified organizational, educational, and personal strategies as being important to their development, including tailored orientation, opportunities for skill acquisition, and personal support. Few strategies supported the development of professional identity. Mastering the nursing role and constructing a professional identity is central to NGNs' development. Further attention from nursing leaders is needed to promote concurrent development in both dimensions. Nurses with a strong professional identity are more likely to remain in the profession. Copyright 2015, SLACK Incorporated.

  14. The Beginner's Guide to Wind Tunnels with TunnelSim and TunnelSys

    Science.gov (United States)

    Benson, Thomas J.; Galica, Carol A.; Vila, Anthony J.

    2010-01-01

    The Beginner's Guide to Wind Tunnels is a Web-based, on-line textbook that explains and demonstrates the history, physics, and mathematics involved with wind tunnels and wind tunnel testing. The Web site contains several interactive computer programs to demonstrate scientific principles. TunnelSim is an interactive, educational computer program that demonstrates basic wind tunnel design and operation. TunnelSim is a Java (Sun Microsystems Inc.) applet that solves the continuity and Bernoulli equations to determine the velocity and pressure throughout a tunnel design. TunnelSys is a group of Java applications that mimic wind tunnel testing techniques. Using TunnelSys, a team of students designs, tests, and post-processes the data for a virtual, low speed, and aircraft wing.

  15. Wheelchair propulsion kinematics in beginners and expert users: influence of wheelchair settings.

    Science.gov (United States)

    Gorce, P; Louis, N

    2012-01-01

    Biomechanical studies have linked the handrim wheelchair propulsion with a prevalence of upper limb musculoskeletal disorders. The purpose of this study was to examine the influence of the wheelchair settings on upper limb kinematics during wheelchair propulsion. Recordings were made under various wheelchair configuration conditions to understand the effect of wheelchair settings on kinematics parameters such shoulder, elbow and wrist angles. Ten experts and ten beginners' subjects propelled an experimental wheelchair on a roller ergometer system at a comfortable speed. Twelve wheelchair configurations were tested. Kinematics were recorded for each configuration. Based on the hand position relatively to the handrim, the main kinematic parameters of wheelchair propulsion were investigated on the whole propulsion cycle and a key event such as handrim contact and release. Compared to the beginner subjects, all the experts' subjects generally present higher joint amplitude and propulsion speeds. Seat height and antero-posterior axle position influence usage of the hand-rim, timing parameters and configurations of upper limb joints. Results seem to confirm that low and backward seat position allow a greater efficiency. Nevertheless, according that proximity of joint limit is a well known factor of musculoskeletal disorders, our results let us think that too low and backward seat position, increasing joints positions and amplitudes, could increase the risk of upper limb injuries in relation with manual wheelchair propulsion. Kinematic differences highlight that future studies on wheelchair propulsion should only be done with impaired experienced subjects. Furthermore, this study provides indications on how wheelchair settings can be used for upper limb injury prevention. Copyright © 2011 Elsevier Ltd. All rights reserved.

  16. Is Contrast Enhanced Ultrasonography a useful tool in a beginner's hand? How much can a Computer Assisted Diagnosis prototype help in characterizing the malignancy of focal liver lesions?

    Science.gov (United States)

    Moga, Tudor Voicu; Popescu, Alina; Sporea, Ioan; Danila, Mirela; David, Ciprian; Gui, Vasile; Iacob, Nicoleta; Miclaus, Gratian; Sirli, Roxana

    2017-08-23

    Contrast enhanced ultrasound (CEUS) improved the characterization of focal liver lesions (FLLs), but is an operatordependent method. The goal of this paper was to test a computer assisted diagnosis (CAD) prototype and to see its benefit in assisting a beginner in the evaluation of FLLs. Our cohort included 97 good quality CEUS videos[34% hepatocellular carcinomas (HCC), 12.3% hypervascular metastases (HiperM), 11.3% hypovascular metastases (HipoM), 24.7% hemangiomas (HMG), 17.5% focal nodular hyperplasia (FNH)] that were used to develop a CAD prototype based on an algorithm that tested a binary decision based classifier. Two young medical doctors (1 year CEUS experience), two experts and the CAD prototype, reevaluated 50 FLLs CEUS videos (diagnosis of benign vs. malignant) first blinded to clinical data, in order to evaluate the diagnostic gap beginner vs. expert. The CAD classifier managed a 75.2% overall (benign vs. malignant) correct classification rate. The overall classification rates for the evaluators, before and after clinical data were: first beginner-78%; 94%; second beginner-82%; 96%; first expert-94%; 100%; second expert-96%; 98%. For both beginners, the malignant vs. benign diagnosis significantly improved after knowing the clinical data (p=0.005; p=0,008). The expert was better than the beginner (p=0.04) and better than the CAD (p=0.001). CAD in addition to the beginner can reach the expert diagnosis. The most frequent lesions misdiagnosed at CEUS were FNH and HCC. The CAD prototype is a good comparing tool for a beginner operator that can be developed to assist the diagnosis. In order to increase the classification rate, the CAD system for FLL in CEUS must integrate the clinical data.

  17. Predictability over the North Atlantic ocean in hindcast ensembles of MPI-ESM initialized by EnKF and three nudging systems

    Science.gov (United States)

    Brune, Sebastian; Pohlmann, Holger; Düsterhus, Andre; Kröger, Jürgen; Müller, Wolfgang; Baehr, Johanna

    2016-04-01

    We investigate hindcast skill for surface air temperature and upper ocean heat content (0-700m) in the North Atlantic for yearly mean values from 1960 to 2014 in four prediction systems based on the global coupled Max Planck Institute for Meteorology Earth System Model (MPI-ESM). We find that in the North Atlantic and within the four prediction systems under consideration only the EnKF initialized hindcasts reproduce the variability of the reference data well both in terms of anomaly correlation and representation of the probability density function. The systems under consideration only differ in the method how they incorporate surface and sub-surface oceanic temperatures and salinities during assimilation: ensemble Kalman Filter (EnKF), anomaly nudging of ORA reanalysis (BS-1), full field nudging of ORA and GECCO reanalysis, respectively (PT-ORA, PT-GEC). We assess the hindcast skill of each prediction system with reference to HadCRUT4 near surface air temperature data (Morice et al. 2012) and NOAA OC5 upper ocean heat content data (Levitus et al. 2012) using anomaly correlation (ACC) and by analysing the interquartile range (IQR) of the probability density function (PDF). Firstly, we calculate hindcast skill in terms of ACC and IQR against reference data over the whole time period. Here, the hindcast skills of EnKF and BS-1 are better for both ACC and IQR in lead years 2 to 5 when compared to PT-ORA and PT-GEC, their hindcast skill drops off after lead year 1. Secondly, the PDF of the reference data is not uniformly distributed over time. We therefore calculate ACC and IQR for a 20 year moving window. We find hindcast skill in terms of ACC for EnKF and BS-1 in the 1960s and from the 1990s onwards, up to eight lead years in advance, with almost no skill for the time period inbetween. In contrast, there is no skill for PT-ORA and PT-GEC in any period after lead year one. The IQR of reference data is best captured by the EnKF, in the 1960s and 1990s up to lead year

  18. Characterization of the Second LysR-Type Regulator in the Biphenyl-Catabolic Gene Cluster of Pseudomonas pseudoalcaligenes KF707

    OpenAIRE

    Watanabe, Takahito; Fujihara, Hidehiko; Furukawa, Kensuke

    2003-01-01

    Pseudomonas pseudoalcaligenes KF707 possesses a biphenyl-catabolic (bph) gene cluster consisting of bphR1A1A2-(orf3)-bphA3A4BCX0X1X2X3D. The bphR1 (formerly orf0) gene product, which belongs to the GntR family, is a positive regulator for itself and bphX0X1X2X3D. Further analysis in this study revealed that a second regulator belonging to the LysR family (designated bphR2) is involved in the regulation of the bph genes in KF707. The bphR2 gene was not located near the bph gene cluster, and it...

  19. Deuteriation of an asymmetric short hydrogen bond. X-ray crystal structure of KF.(CH2CO2D)2

    International Nuclear Information System (INIS)

    Emsley, J.; Jones, D.J.; Kuroda, R.

    1981-01-01

    Deuteriation of the strong hydrogen bonds of KF.(CH 2 CO 2 H) 2 shows no isotope effect on the bond lengths. The only significant change is in the bond angle at the fluoride ion which widens to 128.5 from 116 0 . The i.r. spectrum shows very little change. Since the O-H ... F - hydrogen bonds are highly asymmetric, these observations challenge previous predictions about the effects of deuteriation on such bonds. (author)

  20. Thermodynamic Assessment of Hot Corrosion Mechanisms of Superalloys Hastelloy N and Haynes 242 in Eutectic Mixture of Molten Salts KF and ZrF4

    Energy Technology Data Exchange (ETDEWEB)

    Michael V. Glazoff

    2012-02-01

    The KF - ZrF4 system was considered for the application as a heat exchange agent in molten salt nuclear reactors (MSRs) beginning with the work carried out at ORNL in early fifties. Based on a combination of excellent properties such as thermal conductivity, viscosity in the molten state, and other thermo-physical and rheological properties, it was selected as one of possible candidates for the nuclear reactor secondary heat exchanger loop.

  1. A Prototype Regional GSI-based EnKF-Variational Hybrid Data Assimilation System for the Rapid Refresh Forecasting System: Dual-Resolution Implementation and Testing Results

    Science.gov (United States)

    Pan, Yujie; Xue, Ming; Zhu, Kefeng; Wang, Mingjun

    2018-05-01

    A dual-resolution (DR) version of a regional ensemble Kalman filter (EnKF)-3D ensemble variational (3DEnVar) coupled hybrid data assimilation system is implemented as a prototype for the operational Rapid Refresh forecasting system. The DR 3DEnVar system combines a high-resolution (HR) deterministic background forecast with lower-resolution (LR) EnKF ensemble perturbations used for flow-dependent background error covariance to produce a HR analysis. The computational cost is substantially reduced by running the ensemble forecasts and EnKF analyses at LR. The DR 3DEnVar system is tested with 3-h cycles over a 9-day period using a 40/˜13-km grid spacing combination. The HR forecasts from the DR hybrid analyses are compared with forecasts launched from HR Gridpoint Statistical Interpolation (GSI) 3D variational (3DVar) analyses, and single LR hybrid analyses interpolated to the HR grid. With the DR 3DEnVar system, a 90% weight for the ensemble covariance yields the lowest forecast errors and the DR hybrid system clearly outperforms the HR GSI 3DVar. Humidity and wind forecasts are also better than those launched from interpolated LR hybrid analyses, but the temperature forecasts are slightly worse. The humidity forecasts are improved most. For precipitation forecasts, the DR 3DEnVar always outperforms HR GSI 3DVar. It also outperforms the LR 3DEnVar, except for the initial forecast period and lower thresholds.

  2. USABILITY TESTING OF JAPANESE CAPTIONS SEGMENTATION SYSTEM TO SCAFFOLD BEGINNERS TO COMPREHEND JAPANESE VIDEOS

    Directory of Open Access Journals (Sweden)

    Ya-Fei Yang

    2013-06-01

    Full Text Available A major learning difficulty of Japanese foreign language (JFL learners is the complex composition of two syllabaries, hiragana and katakana, and kanji characters adopted from logographic Chinese ones. As the number of Japanese language learners increases, computer-assisted Japanese language education gradually gains more attention. This study aimed to adopt a Japanese word segmentation system to help JFL learners overcome literacy problems. This study adopted MeCab, a Japanese morphological analyzer and part-of-speech (POS tagger, to segment Japanese texts into separate morphemes by adding spaces and to attach POS tags to each morpheme for beginners. The participants were asked to participate in three experimental activities involvingwatching two Japanese videos with general or segmented Japanese captions and complete the Nielsen’s Attributes of Usability (NAU survey and the After Scenario Questionnaire (ASQ to evaluate the usability of the learning activities. The results of the system evaluation showed that the videos with the segmented captions could increase the participants’ learning motivation and willingness to adopt the word segmentation system to learn Japanese.

  3. KF46 METAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

  4. Review of applications of TLBO algorithm and a tutorial for beginners to solve the unconstrained and constrained optimization problems

    Directory of Open Access Journals (Sweden)

    R. Venkata Rao

    2016-01-01

    Full Text Available The teaching-learning-based optimization (TLBO algorithm is finding a large number of applications in different fields of engineering and science since its introduction in 2011. The major applications are found in electrical engineering, mechanical design, thermal engineering, manufacturing engineering, civil engineering, structural engineering, computer engineering, electronics engineering, physics, chemistry, biotechnology and economics. This paper presents a review of applications of TLBO algorithm and a tutorial for solving the unconstrained and constrained optimization problems. The tutorial is expected to be useful to the beginners.

  5. Catalytic effect of KF-846 on the reforming of the primary intermediates from the co-pyrolysis of pubescens and LDPE

    International Nuclear Information System (INIS)

    Liu, Wen-wu; Hu, Chang-wei; Tong, Dong-mei; Yang, Yu; Li, Gui-ying; Zhu, Liang-fang; Tang, Jin-Qiang

    2014-01-01

    Highlights: • Reforming reactions were inhibited by H 2 , decrease of acidity and low temperature. • There was a synergistic effect on producing hydrogen between Ni and Mo. • The lattice oxygen over catalyst employed might transfer into the intermediates. • Co-pyrolysis, low temperature and N 2 could restrain oxygen transfer to some extent. - Abstract: Co-pyrolysis is regarded as an effective approach to upgrade the quality of pyrolysis products. In this work the activity of KF-846 was evaluated by co-pyrolysis of pubescens and low density polyethylene under different experimental conditions including catalytic mode, pyrolytic atmosphere and temperature, etc. The results showed that the fresh KF-846 exerted strong effects of cyclization, aromatization, hydrogen transfer and vapor-catalytic reforming reactions on the primary intermediates from the co-pyrolysis. The hydrogen-rich gases indicated a synergistic effect between Ni and Mo over KF-846 on producing hydrogen. More importantly, the reforming reactions might be inhibited to some extent by H 2 atmosphere, the low temperature and the decrease of acidity over catalyst. Furthermore, it was deduced that the oxygen over the lattice of catalyst or some intermediates might transfer into other intermediates, possibly resulting in more products with high oxygen content, but it was presumed that the low temperature, co-pyrolysis process and N 2 atmosphere could repress the trend to a certain degree. The mass and energy balance of co-pyrolysis were analyzed, and the main reaction pathways were also proposed. The interference in pyrolysis by regulating the catalytic mode, pyrolytic atmosphere and temperature, acidity over catalyst might posses a certain guiding significance for the pyrolytic technology and the design/selection of catalysts employed

  6. The impact of covariance localization on the performance of an ocean EnKF system assimilating glider data in the Ligurian Sea

    Science.gov (United States)

    Falchetti, Silvia; Alvarez, Alberto

    2018-04-01

    Data assimilation through an ensemble Kalman filter (EnKF) is not exempt from deficiencies, including the generation of long-range unphysical correlations that degrade its performance. The covariance localization technique has been proposed and used in previous research to mitigate this effect. However, an evaluation of its performance is usually hindered by the sparseness and unsustained collection of independent observations. This article assesses the performance of an ocean prediction system composed of a multivariate EnKF coupled with a regional configuration of the Regional Ocean Model System (ROMS) with a covariance localization solution and data assimilation from an ocean glider that operated over a limited region of the Ligurian Sea. Simultaneous with the operation of the forecast system, a high-quality data set was repeatedly collected with a CTD sensor, i.e., every day during the period from 5 to 20 August 2013 (approximately 4 to 5 times the synoptic time scale of the area), located on board the NR/V Alliance for model validation. Comparisons between the validation data set and the forecasts provide evidence that the performance of the prediction system with covariance localization is superior to that observed using only EnKF assimilation without localization or using a free run ensemble. Furthermore, it is shown that covariance localization also increases the robustness of the model to the location of the assimilated data. Our analysis reveals that improvements are detected with regard to not only preventing the occurrence of spurious correlations but also preserving the spatial coherence in the updated covariance matrix. Covariance localization has been shown to be relevant in operational frameworks where short-term forecasts (on the order of days) are required.

  7. Resistance to pyridine-based inhibitor KF116 reveals an unexpected role of integrase in HIV-1 Gag-Pol polyprotein proteolytic processing.

    Science.gov (United States)

    Hoyte, Ashley C; Jamin, Augusta V; Koneru, Pratibha C; Kobe, Matthew J; Larue, Ross C; Fuchs, James R; Engelman, Alan N; Kvaratskhelia, Mamuka

    2017-12-01

    The pyridine-based multimerization selective HIV-1 integrase (IN) inhibitors (MINIs) are a distinct subclass of allosteric IN inhibitors. MINIs potently inhibit HIV-1 replication during virion maturation by inducing hyper- or aberrant IN multimerization but are largely ineffective during the early steps of viral replication. Here, we investigated the mechanism for the evolution of a triple IN substitution (T124N/V165I/T174I) that emerges in cell culture with a representative MINI, KF116. We show that HIV-1 NL4-3(IN T124N/V165I/T174I) confers marked (>2000-fold) resistance to KF116. Two IN substitutions (T124N/T174I) directly weaken inhibitor binding at the dimer interface of the catalytic core domain but at the same time markedly impair HIV-1 replication capacity. Unexpectedly, T124N/T174I IN substitutions inhibited proteolytic processing of HIV-1 polyproteins Gag and Gag-Pol, resulting in immature virions. Strikingly, the addition of the third IN substitution (V165I) restored polyprotein processing, virus particle maturation, and significant levels of replication capacity. These results reveal an unanticipated role of IN for polyprotein proteolytic processing during virion morphogenesis. The complex evolutionary pathway for the emergence of resistant viruses, which includes the need for the compensatory V165I IN substitution, highlights a relatively high genetic barrier exerted by MINI KF116. Additionally, we have solved the X-ray structure of the drug-resistant catalytic core domain protein, which provides means for rational development of second-generation MINIs. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

  8. EnKF OSSE Experiments Assessing the Impact of HIRAD Wind Speed and HIWRAP Radial Velocity Data on Analysis of Hurricane Karl (2010)

    Science.gov (United States)

    Albers, Cerese; Sippel, Jason A.; Braun, Scott A.; Miller, Timothy

    2012-01-01

    Previous studies (e.g., Zhang et al. 2009, Weng et al. 2011) have shown that radial velocity data from airborne and ground-based radars can be assimilated into ensemble Kalman filter (EnKF) systems to produce accurate analyses of tropical cyclone vortices, which can reduce forecast intensity error. Recently, wind speed data from SFMR technology has also been assimilated into the same types of systems and has been shown to improve the forecast intensity of mature tropical cyclones. Two instruments that measure these properties were present during the NASA Genesis and Rapid Intensification Processes (GRIP) field experiment in 2010 which sampled Hurricane Karl, and will next be co-located on the same aircraft for the subsequent NASA HS3 experiment. The High Altitude Wind and Rain Profiling Radar (HIWRAP) is a conically scanning Doppler radar mounted upon NASAs Global Hawk unmanned aerial vehicle, and the usefulness of its radial velocity data for assimilation has not been previously examined. Since the radar scans from above with a fairly large fixed elevation angle, it observes a large component of the vertical wind, which could degrade EnKF analyses compared to analyses with data taken from lesser elevation angles. The NASA Hurricane Imaging Radiometer (HIRAD) is a passive microwave radiometer similar to SFMR, and measures emissivity and retrieves hurricane surface wind speeds and rain rates over a much wider swath. Thus, this study examines the impact of assimilating simulated HIWRAP radial velocity data into an EnKF system, simulated HIRAD wind speed, and HIWRAP+HIRAD with the Weather Research and Forecasting (WRF) model and compares the results to no data assimilation and also to the Truth from which the data was simulated for both instruments.

  9. Adenosine A{sub 2A} receptor imaging with [{sup 11}C]KF18446 PET in the rat brain after quinolinic acid lesion. Comparison with the dopamine receptor imaging

    Energy Technology Data Exchange (ETDEWEB)

    Ishiwata, Kiichi; Ogi, Nobuo; Hayakawa, Nobutaka [Tokyo Metropolitan Inst. of Gerontology, Tokyo (Japan). Positron Medical Center] [and others

    2002-11-01

    We proposed [{sup 11}C]KF18446 as a selective radioligand for mapping the adenosine A{sub 2A} receptors being highly enriched in the striatum by positron emission tomography (PET). In the present study, we investigated whether [{sup 11}C]KF18446 PET can detect the change in the striatal adenosine A{sub 2A} receptors in the rat after unilateral injection of an excitotoxin quinolinic acid into the striatum, a Huntington's disease model, to demonstrate the usefulness of [{sup 11}C]KF18446. The extent of the striatal lesion was identified based on MRI, to which the PET was co-registered. The binding potential of [{sup 11}C]KF18446 significantly decreased in the quinolinic acid-lesioned striatum. The decrease was comparable to the decrease in the potential of [{sup 11}C] raclopride binding to dopamine D{sub 2} receptors in the lesioned striatum, but seemed to be larger than the decrease in the potential of [{sup 11}C]SCH23390 binding to dopamine D{sub 1} receptors. Ex vivo and in vitro autoradiography validated the PET signals. We concluded that [{sup 11}C]KF18446 PET can detect change in the adenosine A{sub 2A} receptors in the rat model, and will provide a new diagnostic tool for characterizing post-synaptic striatopallidal neurons in the stratum. (author)

  10. Interfacial phenomena in the reactions of Al-B, Al-Ti-B, and Al-Zr-B alloys with KF-AlF3 and NaF-AlF3 melts

    International Nuclear Information System (INIS)

    Lee, M.S.; Terry, B.S.; Grieveson, P.

    1993-01-01

    The interfacial phenomena occurring during the contacting of liquid Al-B, Al-Ti-B, and Al-Zr-B melts with KF-AlF 3 liquid fluxes have been investigated by optical examination of quenched metal drops previously immersed in the liquid fluxes. Reactions in the Al-B/KF-AlF 3 system involve the formation of metastable AlB 12 at the metal/flux interface. At high KBF 4 levels in the flux, the AlB 12 is dispersed in the flux and also at low KBF 4 levels in the metal. Reactions in the Al-Ti-B/KF-AlF 3 system involve the formation of TiB 2 , which may be dispersed in either the metal or the flux depending upon the composition of the flux. The results obtained for the Al-Ti-B/NaF-AlF 3 and Al-Zr-B/KF-AlF 3 systems were similar to those observed for the Al-Ti-B/KF-AlF 3 system

  11. Assessing Verbal Functioning in South African School Beginners from Diverse Socioeconomic Backgrounds: A Comparison between Verbal Working Memory and Vocabulary Measures

    Science.gov (United States)

    Cockcroft, Kate; Bloch, Lauren; Moolla, Azra

    2016-01-01

    This study investigated whether measures of verbal working memory are less sensitive to children's socioeconomic background than traditional vocabulary measures. Participants were 120 school beginners, divided into high and low socioeconomic groups. The groups contained equal numbers of English first-language and second-language speakers. All were…

  12. A Comparison between Verbal Working Memory and Vocabulary in Bilingual and Monolingual South African School Beginners: Implications for Bilingual Language Assessment

    Science.gov (United States)

    Cockcroft, Kate

    2016-01-01

    This study compared bilingual and monolingual school beginners on measures of simple and complex verbal working memory and receptive and expressive vocabulary. The aim was to determine whether the tests of working memory are fairer measures of language ability than the vocabulary tests for bilingual children when tested in their second language.…

  13. On the efficiency of the hybrid and the exact second-order sampling formulations of the EnKF: a reality-inspired 3-D test case for estimating biodegradation rates of chlorinated hydrocarbons at the port of Rotterdam

    KAUST Repository

    El Gharamti, Mohamad

    2016-11-15

    This study considers the assimilation problem of subsurface contaminants at the port of Rotterdam in the Netherlands. It involves the estimation of solute concentrations and biodegradation rates of four different chlorinated solvents. We focus on assessing the efficiency of an adaptive hybrid ensemble Kalman filter and optimal interpolation (EnKF-OI) and the exact second-order sampling formulation (EnKFESOS) for mitigating the undersampling of the estimation and observation errors covariances, respectively. A multi-dimensional and multi-species reactive transport model is coupled to simulate the migration of contaminants within a Pleistocene aquifer layer located around 25 m below mean sea level. The biodegradation chain of chlorinated hydrocarbons starting from tetrachloroethene and ending with vinyl chloride is modeled under anaerobic environmental conditions for 5 decades. Yearly pseudo-concentration data are used to condition the forecast concentration and degradation rates in the presence of model and observational errors. Assimilation results demonstrate the robustness of the hybrid EnKF-OI, for accurately calibrating the uncertain biodegradation rates. When implemented serially, the adaptive hybrid EnKF-OI scheme efficiently adjusts the weights of the involved covariances for each individual measurement. The EnKFESOS is shown to maintain the parameter ensemble spread much better leading to more robust estimates of the states and parameters. On average, a well tuned hybrid EnKF-OI and the EnKFESOS respectively suggest around 48 and 21 % improved concentration estimates, as well as around 70 and 23 % improved anaerobic degradation rates, over the standard EnKF. Incorporating large uncertainties in the flow model degrades the accuracy of the estimates of all schemes. Given that the performance of the hybrid EnKF-OI depends on the quality of the background statistics, satisfactory results were obtained only when the uncertainty imposed on the background

  14. ­Genomic data mining of the marine actinobacteria Streptomyces sp. H-KF8 unveils insights into multi-stress related genes and metabolic pathways involved in antimicrobial synthesis

    Directory of Open Access Journals (Sweden)

    Agustina Undabarrena

    2017-02-01

    Full Text Available Streptomyces sp. H-KF8 is an actinobacterial strain isolated from marine sediments of a Chilean Patagonian fjord. Morphological characterization together with antibacterial activity was assessed in various culture media, revealing a carbon-source dependent activity mainly against Gram-positive bacteria (S. aureus and L. monocytogenes. Genome mining of this antibacterial-producing bacterium revealed the presence of 26 biosynthetic gene clusters (BGCs for secondary metabolites, where among them, 81% have low similarities with known BGCs. In addition, a genomic search in Streptomyces sp. H-KF8 unveiled the presence of a wide variety of genetic determinants related to heavy metal resistance (49 genes, oxidative stress (69 genes and antibiotic resistance (97 genes. This study revealed that the marine-derived Streptomyces sp. H-KF8 bacterium has the capability to tolerate a diverse set of heavy metals such as copper, cobalt, mercury, chromate and nickel; as well as the highly toxic tellurite, a feature first time described for Streptomyces. In addition, Streptomyces sp. H-KF8 possesses a major resistance towards oxidative stress, in comparison to the soil reference strain Streptomyces violaceoruber A3(2. Moreover, Streptomyces sp. H-KF8 showed resistance to 88% of the antibiotics tested, indicating overall, a strong response to several abiotic stressors. The combination of these biological traits confirms the metabolic versatility of Streptomyces sp. H-KF8, a genetically well-prepared microorganism with the ability to confront the dynamics of the fjord-unique marine environment.

  15. ESTUDO DA ESTABILIDADE TÉRMICA DE FIBRA QUERATINA (KF DE PENAS DE FRANGO PARA OBTENÇÃO DE CARBONO (CF

    Directory of Open Access Journals (Sweden)

    Débora Damasceno Belarmino

    2012-07-01

    Full Text Available A fibra de queratina de penas de frango foi submetida à análise térmica (TG em sua forma natural e carbonizada, aumentando assim a expansão do reaproveitamento de materiais desperdiçados no Brasil. A partir das curvas obtidas por TG/DTG da pena natural (KF e tratadas (KFNaOH, SCFC e SCFD buscou-se um melhor ciclo de carbonização (pirólise para esse tipo de precursor. O trabalho também trata como um dos focos, o estudo comparativo do comportamento térmico desses materiais. Uma parte da KF foi tratada com hidróxido de sódio (NaOH, e observou-se pelo o resultado TG/DTG que a resistência térmica do material não foi influenciada. Outra parte de KF foi semicarbonizada (220°C sem controle do ambiente térmico e taxas de aquecimento e resfriamento, apresentando colorações diferentes, mais clara (SCFC e mais escura (SCFD. Foi constatado nas curvas de TG/DTG, que esse tratamento de carbonização não é ideal para a obtenção de carbono. Também foi verificado nas curvas de TG/DTG que na CF houve um aumento da estabilidade térmica comparada a todas as outras amostras. Essa pesquisa é uma inovação no que diz respeito à preparação e avaliação de fibras de penas de frango na obtenção de fibras sintetizadas, que atualmente são, em larga escala, derivados do petróleo, lembrando-se da diminuição das reservas de petróleo e da poluição que os mesmos geram ao meio ambiente.

  16. Elaboration and experimental study of the Borosilicate glass GP 98/12 for the vitrification of the radioactive wastes of KfKarlsruhe Centre (R.F.A.)

    International Nuclear Information System (INIS)

    Ghezal, A.

    1987-09-01

    The transformation into a vitrified block of highly radioactive liquid wastes is actually the best solution for the storage in long run. In West Germany, the research institute in the field of nuclear energy (KfK) has been oriented in this way by developing industrial processes of vitrification and by following studies on the behaviour of the final products. For the fission products, the chosen glasses present good stability characteristics and are used as a first barrier during confinement. Our work, which is part of the research program on radioactive waste vitrification, consists of preparing borosilicate glass GP 98/12 and studying physical and chemical characteristics. We have also contributed to the development and the realization of glass blocks sampling system prepared at pilot scale

  17. Green Michael addition of thiols to electron deficient alkenes using KF/alumina and recyclable solvent or solvent-free conditions

    Energy Technology Data Exchange (ETDEWEB)

    Lenardao, Eder J.; Trecha, Danusia O.; Ferreira, Patricia da C.; Jacob, Raquel G.; Perin, Gelson [Universidade Federal de Pelotas (UFPEL), Pelotas, RS (Brazil). Inst. de Quimica e Geociencias. Lab. de Sintese Organica Limpa (LASOL)]. E-mail: lenardao@ufpel.edu.br

    2009-07-01

    A general, clean and easy method for the conjugated addition of thiols to citral promoted by KF/Al{sub 2}O{sub 3} under solvent-free or using glycerin as recyclable solvent at room temperature is described. It was found that the solvent-free protocol is applicable to the direct reaction of thiophenol with the essential oil of lemon grass (Cymbopogon citratus) to afford directly 3,7-dimethyl-3-(phenylthio)oct-6-enal, a potential bactericide agent. The method was extended to other electron-poor alkenes with excellent results. For the solvent-free protocol, the use of microwave irradiation facilitated the procedure and accelerates the reaction. The catalytic system and glycerin can be reused up to three times without previous treatment with comparable activity. (author)

  18. User's guide for the portable microprocessor equipment: 'KfK K-edge densitometer' for quantitative determination of Th, U, Np, Pu, Am in solutions

    International Nuclear Information System (INIS)

    Michel-Piper, I.; Matussek, P.

    1985-06-01

    This report describes the hardware and software features, and the use of the microprocessor-controlled multichannel analyzer system SILENA + IRIS. The self-contained portable system, which permits independent accumulation and evaluation of spectral data from the KfK K-edge densitometer, provides one of the possible means for the authentication of resident instruments by safeguards inspectors. The 'K-Edge' program, written in PL/M language for compatibility with the system's firmware, allows fully automated assays of heavy element concentrations in solutions by means of X-ray absorption edge spectrometry. It is primarily intended for highly accurate determinations of the U and Pu content in process- and product solutions of a reprocessing plant. (orig.)

  19. Corrosion of superalloy Incoloy 800H/HT in eutectic mixture LiF-NaF-KF with different addition of chromium fluoride; Korozia superzliatiny Incoloy 800H/HT v eutektickej zmesi LiF-NaF-KF s ruznym pridavkom fluoridu chromiteho

    Energy Technology Data Exchange (ETDEWEB)

    Kontrik, M.; Pavlik, V.; Simko, F. [Slovenska Akademia Vied, Ustav Anorganickej Chemie, Oddelenie Taveninovych Sustav, 84636 Bratislava (Slovakia)

    2013-04-16

    Thesis deals with investigating the addition of chromium trifluoride to eutectic mixture of LiF-NaF-KF (46.5 - 11.5 - 42 mol %) on the corrosion of superalloy Incoloy 800H/HT with static tests. The corrosion losses of the alloy and type of corrosion attack was observed. It was found that the addition of chromium fluoride into the mixture generally increases of corrosion of the material. Several types of corrosion attacks were observed. On the surface of the samples the spotted, pitting and transgranular corrosions were found. On the cross-sections of the samples the subsurface and lamellar corrosions were detected. (authors)

  20. Structuring scientific works in the “Introduction, Methods, Results and Discussion” format – what a beginner ought to know

    Directory of Open Access Journals (Sweden)

    N. V. Avdeeva

    2016-01-01

    Full Text Available Reference materials about the “Introduction, Methods, Results and Discussion”, which is a commonly used international format for scientific works, have become available for Russian authors nowadays, still lack of knowledge about the format would pop up here or there, especially when we speak about beginners. The faults which would appear regularly in work structuring prompted the present research, the aim of which is to compare the information about the IMRAD format with the specific difficulties beginning authors would often face when preparing their works for publication.The main materials to be studied were sources in Russian and in English published mostly in 2010s and devoted to the problems of structuring works according to the meant above format. Besides, the present research considered the results of plagiarism tests (such tests used to be carried out at the Russia State Library within the period of 2013 – 2015 with the help of software “Automated system of specialized processing of textual documents”. The main methods of our research would remain structural and comparative analysis of texts.As a result, our research revealed the fact of inconsistency of the available information on the IMRAD structure. It would often demand deep thinking and explanations. Different authors of reference editions would as a rule differ one from another in their interpretation of the degree of necessity of this or that composition element, of the amount of details in descriptions, etc. Moreover, the very structure of scientific work looks differently for different authors. More often the structure supposes the integrity of the contents and its form, still sometimes its description would be replaced by outer elements, such as, for example, language clichés. The analysis of the most common faults in text structuring points that authors do not often have a clear idea of how to understand the different demands which are so obscurely described

  1. Purification of Biotransformation Products of Cis-Isoflavan-4-ol by Biphenyl Dioxygenase of Pseudomonas pseudoalcaligenes KF707 Strain Expressed in Escherichia coli

    Directory of Open Access Journals (Sweden)

    Tri Ratna Sulistiyani

    2013-04-01

    Full Text Available Isoflavone has multiple beneficial effects on human health, especially through its antioxidant and anticancer activities. The biotransformation of isoflavone using byphenyl dioxygenase could be performed to extend the diversity of flavonoids and to improve their biological and physiological properties. Biotransformation of two enantiomers (3R, 4R-cis-isoflavan-4-ol and (3S, 4S-cis-isoflavan-4-ol by E. coli JM109 (pJHF108 carrying a biphenyl dioxygenase gene from P. pseudoalcaligenesKF707 produced two products, designated as CM1 andCM2. The products had a retention time of 11.9 and 14.6 min, respectively, and the same absorption peaks at 204, 220, and 275 nm. CM1 and CM2 had [M-H2O+H]+ at m/z 225. Based on the molecular mass and hydrolysis products, we proposed that epoxidation occurred on cis-isoflavan-4-ol. Chloroform extraction instead of ethyl acetate extraction was performed to improve the stability of cismetabolites, CM1 and CM2.

  2. Storing Hydrogen, by Enhancing Diamond Powder Properties under Hydrogen Plasma with CaF2 and KF for Use in Fuel Cells

    International Nuclear Information System (INIS)

    Ochoa, Franklyn E. Colmenares

    2006-01-01

    A fuel cell is like a battery that instead of using electricity to recharge itself, it uses hydrogen. In the fuel cell industry, one of the main problems is storing hydrogen in a safe way and extracting it economically. Gaseous hydrogen requires high pressures which could be very dangerous in case of a collision. The success of hydrogen use depends largely on the development of an efficient storage and release method. In an effort to develop a better hydrogen storage system for fuel cells technology this research investigates the use of 99% pure diamond powder for storing hydrogen. Mixing this powder with a calcium fluoride and potassium fluoride compound in its solid form and treating the surface of the powder with hydrogen plasma, modifies the surface of the diamond. After some filtration through distilled water and drying, the modified diamond is treated with hydrogen. We expect hydrogen to be attracted to the diamond powder surface in higher quantities due to the CaF2 and KF treatment. Due to the large surface area of diamond nanopowder and the electronegative terminal bonds of the fluorine particles on the structure's surface, to the method shows promise in storing high densities of hydrogen

  3. EIR, KfK joint heat transfer experiment on a single rod, roughened with trapezoidal rounded ribs and cooled by various gases

    International Nuclear Information System (INIS)

    Hudina, M.; Huggenberger, M.; Dalle Donne, M.; Meyer, L.; Rehme, K.

    1978-10-01

    Heat transfer and pressure drop experiments with an identical fuel rod simulator have been performed at the two Research Establishments in Wuerenlingen and in Karlsruhe. The rod was artificially roughened with 'two-dimensional' ribs of trapezoidal shape and with rounded edges. The experiments at EIR were performed with CO 2 and the rough rod was contained in a smooth tube and centered by special spacers. The experiments at KfK were performed using helium and nitrogen in the same test section (rod and outer smooth tube with spacers) and air with the rod mounted in another outer smooth tube and with spacers located farther away from the measuring positions. The global measured friction factors and Stanton numbers for different gases agree reasonably well. The differences between the roughness parameters R and G are larger. The possible reasons for the uncertainties in the reduction of these parameters are discussed. It is recommended to perform further experiments with helium in a test section with spacers far apart, to investigate the effect of the temperature ratio on heat transfer and to check if the unfavourable data obtained by the experiment with air are too pessimistic for GCFR application. (orig.) [de

  4. Status report. KfK contribution to the development of DEMO-relevant test blankets for NET/ITER. Pt. 2: BOT helium cooled solid breeder blanket. Vol. 1

    International Nuclear Information System (INIS)

    Dalle Donne, M.; Boccaccini, L.V.; Bojarsky, E.; Deckers, H.; Dienst, W.; Doerr, L.; Fischer, U.; Giese, H.; Guenther, E.; Haefner, H.E.; Hofmann, P.; Kappler, F.; Knitter, R.; Kuechle, M.; Moellendorf, U. von; Norajitra, P.; Penzhorn, R.D.; Reimann, G.; Reiser, H.; Schulz, B.; Schumacher, G.; Schwenk-Ferrero, A.; Sordon, G.; Tsukiyama, T.; Wedemeyer, H.; Weimar, P.; Werle, H.; Wiegner, E.; Zimmermann, H.

    1991-10-01

    The BOT (Breeder Outside Tube) Helium Cooled Breeder Blanket for a fusion Demo reactor and the status of the R and D program is presented. This is the KfK contribution to the European Program for the Demo relevant test plankets to be irradiated in NET/ITER. Volume 1 (KfK 4928) contains the summary, volume 2 (KfK 4929) a more detailed version of the report. In both volumes are described the reasons for the selected design, the reference blanket design for the Demo reactor, the design of test blanket including the ancillary systems together with the present status of the relative R and D program in the fields of neutronic and thermohydraulic calculations, of the electromagnetic forces caused by disruptions, of the development and irradiation of the ceramic breeder material, of the tritium release and recovery, and of the technological investigations. An outlook is given on the required R and D program for the BOT Helium Cooled Solid Breeder Blanket prior to tests in NET/ITER and the proposed test program in NET/ITER. (orig.) [de

  5. Raman spectroscopic study of the minerals apophyllite-(KF) KCa4Si8O20F·8H2O and apophyllite-(KOH) KCa4Si8O20(F,OH)·8H2O

    Science.gov (United States)

    Frost, Ray L.; Xi, Yunfei

    2012-11-01

    Raman spectroscopy complimented with infrared spectroscopy has been used to study the variation in molecular structure of two minerals of the apophyllite mineral group, namely apophyllite-(KF) KCa4Si8O20F·8H2O and apophyllite-(KOH) KCa4Si8O20(F,OH)·8H2O. apophyllite-(KF) and apophyllite-(KOH) are different minerals only because of the difference in the percentage of fluorine to hydroxyl ions. The Raman spectra are dominated by a very intense sharp peak at 1059 cm-1. A band at around 846 cm-1 is assigned to the water librational mode. It is proposed that the difference between apophyllite-(KF) and apophyllite-(KOH) is the observation of two Raman bands in the OH stretching region at around 3563 and 3625 cm-1. Multiple water stretching and bending modes are observed showing that there is much variation in hydrogen bonding between water and the silicate surfaces.

  6. Status report. KfK contribution to the development of DEMO-relevant test blankets for NET/ITER. Pt. 2: BOT helium cooled solid breeder blanket. Vol. 2

    International Nuclear Information System (INIS)

    Dalle Donne, M.; Boccaccini, L.V.; Bojarsky, E.; Deckers, H.; Dienst, W.; Doerr, L.; Fischer, U.; Giese, H.; Guenther, E.; Haefner, H.E.; Hofmann, P.; Kappler, F.; Knitter, R.; Kuechle, M.; Moellendorf, U. von; Norajitra, P.; Penzhorn, R.D.; Reimann, G.; Reiser, H.; Schulz, B.; Schumacher, G.; Schwenk-Ferrero, A.; Sordon, G.; Tsukiyama, T.; Wedemeyer, H.; Weimar, P.; Werle, H.; Wiegner, E.; Zimmermann, H.

    1991-10-01

    The BOT (Breeder Outside Tube) Helium Cooled Solid Breeder Blanket for a fusion Demo reactor and the status of the R and D program is presented. This is the KfK contribution to the European Program for the Demo relevant test blankets to be irradiated in NET/ITER. Volume 1 (KfK 4928) contains the summary, volume 2 (KfK 4929) a more detailed version of the report. In both volumes are described the reasons for the selected design, the reference blanket design for the Demo reactor, the design of the test blanket including the ancillary systems together with the present status of the relative R and D program in the fields of neutronic and thermohydraulic calculations, of the electromagnetic forces caused by disruptions, of the development and irradiation of the ceramic breeder material, of the tritium release and recovery, and of the technological investigations. An outlook is given on the required R and D program for the BOT Helium Cooled Solid Breeder Blanket prior to tests in NET/ITER and the proposed test program in NET/ITER. (orig.) [de

  7. Effect of peripheral vision training on the attack of beginner indoor soccer players: a study during competition

    Directory of Open Access Journals (Sweden)

    Nelson Kautzner Marques Junior

    2009-01-01

    Full Text Available This study was conducted within the context of Human Motor Skill Science, in the area of Biophysical Dimension and following the research line of the Study of Learning Mechanisms and Processes and of Motor Conduct within the epistemological construct of phenomenological explanation. The objective of this study was to investigate peripheral vision training (PVT and its effect on attack runs during indoor soccer, taking into account dominant laterality (brain hemisphere function in both learning speed andoffensive skills. Ten beginner indoor soccer players aged 10.4 ± 2.31 years, from Lar da Criança Padre Franz Neumair, Ititioca, Niterói, Rio de Janeiro, Brazil, participated in the study. The boys were divided into an experimental group (EG, n = 5 and a controlgroup (CG, n = 5 with similar dominant laterality (brain hemisphere function (H (EG: 80% left H and 20% right H, CG: 60% left H and 40% right H. The players underwent nine training sessions, followed by a championship, and then six additional sessions, followed by a second championship. Each championship was filmed for scoutvideo analysis. Two-way ANOVA revealed a significant difference in peripheral vision during offensive runs between CG and EG, with marked acquisition of peripheral vision in EG. The quality of the attack runs was significant (two-way ANOVA. EG was the better team at the beginning of the attack runs and during attack development, whereas CG was better at attack finalization during the first championship. EG showed more competence in attack run finalization during the second championship. No significant difference in the number of goals scored was observed between the two groups (two-wayANOVA, p>0.05. The frequency of participation in the training sessions was significant (t-test for independent samples, p≤0.05, with EG attending more sessions. In conclusion, EG acquired peripheral vision, a finding suggesting that PVT improves the attack capacity of indoor soccer

  8. Effect of peripheral vision training on the attack of beginner indoor soccer players: a study during competition

    Directory of Open Access Journals (Sweden)

    Nelson Kautzner Marques Junior

    2009-01-01

    Full Text Available http://dx.doi.org/10.5007/1980-0037.2009v11n1p119   In the area of Biophysical Dimension and following the research line of the Study of Learning Mechanisms and Processes and of Motor Conduct within the epistemological construct of phenomenological explanation. The objective of this study was to investigate peripheral vision training (PVT and its effect on attack runs during indoor soccer, taking into account dominant laterality (brain hemisphere function in both learning speed and offensive skills. Ten beginner indoor soccer players aged 10.4 ± 2.31 years, from Lar da Criança Padre Franz Neumair, Ititioca, Niterói, Rio de Janeiro, Brazil, participated in the study. The boys were divided into an experimental group (EG, n = 5 and a control group (CG, n = 5 with similar dominant laterality (brain hemisphere function (H (EG: 80% left H and 20% right H, CG: 60% left H and 40% right H. The players underwent nine training sessions, followed by a championship, and then six additional sessions, followed by a second championship. Each championship was filmed for scout video analysis. Two-way ANOVA revealed a significant difference in peripheral vision during offensive runs between CG and EG, with marked acquisition of peripheral vision in EG. The quality of the attack runs was significant (two-way ANOVA. EG was the better team at the beginning of the attack runs and during attack development, whereas CG was better at attack finalization during the first championship. EG showed more competence in attack run finalization during the second championship. No significant difference in the number of goals scored was observed between the two groups (two-way ANOVA, p>0.05. The frequency of participation in the training sessions was significant (t-test for independent samples, p≤0.05, with EG attending more sessions. In conclusion, EG acquired peripheral vision, a finding suggesting that PVT improves the attack capacity of indoor soccer players.

  9. Jazz: A Beginner's Guide

    Science.gov (United States)

    Poliniak, Susan

    2011-01-01

    Introducing jazz music to elementary and middle school students can open a multitude of creative doors--provided that teachers know how and where to start. This article presents a sample of what Christine Nowmos teaches to her kindergarten-through-fourth-grade classrooms over the course of two months. During January and February each year, she has…

  10. E10 for beginners

    International Nuclear Information System (INIS)

    Gebert, R.W.; Nicolai, H.

    1995-01-01

    In this contribution, we summarize a recent attempt to understand hyperbolic Kac Moody algebras in terms of the string vertex operator construction. As is well known, Kac Moody algebras fall into one of three classes corresponding to whether the associated Cartan matrices are positive definite, positive semi-definite and indefinite. Of these, the first two are well understood, leading to finite and affine Lie algebras (the latter being equivalent to current algebras in two space-time dimensions). Virtually nothing is known, however, about the last class of Kac Moody algebras, based on indefinite Cartan matrices. Nonetheless these have been repeatedly suggested as natural candidates for the still elusive fundamental symmetry of string theory (see e.g. [24], [28] for recent proposals in this direction). Being vastly larger than affine Kac Moody algebras, they are certainly ''sufficiently big'' for this purpose, but an even more compelling argument supporting such speculations is the intimate link that exists between Kac Moody algebras and the vertex operator construction of string theory which has been known for a long time. More specifically, it has been established that the elements making up a Kac Moody algebra of finite or affine type can be explicitly realized in terms of tachyon and photon emission vertex operators of a compactified open bosonic string [9], [14]. On the basis of these results, it has been conjectured that Kac Moody algebras of indefinite type might not only furnish new symmetries of string theory, but might themselves be understood in terms of string vertex operators associated with the higher excited (massive) states of a compactified bosonic string [14], [8]. (orig.)

  11. Quantum physics for beginners

    CERN Document Server

    Ficek, Zbigniew

    2016-01-01

    The textbook introduces students to the main ideas of quantum physics and the basic mathematical methods and techniques used in the fields of advanced quantum physics, atomic physics, laser physics, nanotechnology, quantum chemistry, and theoretical mathematics. The textbook explains how microscopic objects (particles) behave in unusual ways, giving rise to what's called quantum effects. It contains a wide range of tutorial problems from simple confidence-builders to fairly challenging exercises that provide adequate understanding of the basic concepts of quantum physics.

  12. Hydrogen energy for beginners

    CERN Document Server

    2013-01-01

    This book highlights the outstanding role of hydrogen in energy processes, where it is the most functional element due to its unique peculiarities that are highlighted and emphasized in the book. The first half of the book covers the great natural hydrogen processes in biology, chemistry, and physics, showing that hydrogen is a trend that can unite all natural sciences. The second half of the book is devoted to the technological hydrogen processes that are under research and development with the aim to create the infrastructure for hydrogen energetics. The book describes the main features of hydrogen that make it inalienable player in processes such as fusion, photosynthesis, and metabolism. It also covers the methods of hydrogen production and storage, highlighting at the same time the exclusive importance of nanotechnologies in those processes.

  13. C++ for beginners... masters

    CERN Document Server

    Asthana, Ankit

    2007-01-01

    About the Book: The purpose of this book is to provide an introductory text for understanding the C++ language and to empower the reader to write C++ programs. The book also introduces reader to the paradigm of object oriented programming. The main strength and USP of this book is that it is written by a student for students but will be equally useful for intermediate level programmers, and software development professionals. The author is in the best position to identify and address issues and areas where a student needs maximum help in understanding the C++ concepts and developing programmi

  14. TCSA for beginners

    CERN Multimedia

    CERN. Geneva

    2014-01-01

    the basics of the approach I also give a brief overview of the recently introduced renormalization methods to deal with cut-off dependence, which led to a major improvement in precision and also widened the potential scope of applications.

  15. Kant for beginners

    CERN Document Server

    Want, Christopher; Appignanesi, Richard

    1996-01-01

    Immanuel Kant, philosopher of the Enlightenment, laid the foundations of modern Western thought. This work focuses on the three critiques of Pure Reason, Practical Reason and Judgement. It describes Kant's main formal concepts: the relation of mind to sensory experience, the question of freedom and the law and, above all, the revaluation of metaphysics. Kant emerges as a diehard rationalist yet also a Romantic, deeply committed to the power of the sublime to transform experience.

  16. Am Beginn des Hausbaus

    DEFF Research Database (Denmark)

    Kinzel, Moritz

    Architectural developments during the Neolithic period show important innovations, e.g., the discovery and use of the right angle and the use of activity floors placed on top of each other. Although these developments influenced our building history and our understanding of architecture in genera...

  17. Nuclear power for beginners

    International Nuclear Information System (INIS)

    Croall, S.; Sempler, K.

    1978-01-01

    A 'comic strip' account of nuclear power, covering weapons and weapons proliferation, reactor accidents involving human errors, radiation hazards, radioactive waste management and the fuel cycle, fast breeder reactors and plutonium, security, public relations and sociological aspects, energy consumption patterns, energy conservation and alternative energy sources, environmental aspects and anti-nuclear activities. (U.K.)

  18. Pulsars for the Beginner

    Science.gov (United States)

    DiLavore, Phillip; Wayland, James R.

    1971-01-01

    Presents the history of the discovery of pulsars, observations that have been made on pulsar radiation, and theories that have been presented for its presence and origin. Illustrations using pulsar's properties are presented in mechanics, electromagnetic radiation and thermodynamics. (DS)

  19. Android NDK beginner's guide

    CERN Document Server

    Ratabouil, Sylvain

    2015-01-01

    Are you an Android Java programmer who needs more performance? Are you a C/C++ developer who doesn't want to bother with the complexity of Java and its out-of-control garbage collector? Do you want to create fast intensive multimedia applications or games? If you've answered yes to any of these questions then this book is for you. With some general knowledge of C/C++ development, you will be able to dive headfirst into native Android development.

  20. Hamilton's principle for beginners

    International Nuclear Information System (INIS)

    Brun, J L

    2007-01-01

    I find that students have difficulty with Hamilton's principle, at least the first time they come into contact with it, and therefore it is worth designing some examples to help students grasp its complex meaning. This paper supplies the simplest example to consolidate the learning of the quoted principle: that of a free particle moving along a line. Next, students are challenged to add gravity to reinforce the argument and, finally, a two-dimensional motion in a vertical plane is considered. Furthermore these examples force us to be very clear about such an abstract principle

  1. PHENIX for beginners

    International Nuclear Information System (INIS)

    Zajc, W.A.; Fachini, P.

    2002-01-01

    An introduction to the PHENIX detector and to the PHENIX physics program is presented. The PHENIX physics results presented here are those from the the first RHIC (Relativistic Heavy Ion Collider) run with Au+Au collisions at √(S NN ) = 130 GeV. A brief overview of the PHENIX detector is provided. The systematic variation with centrality of charged particle multiplicity, transverse energy, identified particle spectra and yield ratios, production of charged hadrons and π0's at high transverse momenta are reported, together with first results on charm production at RHIC

  2. PHENIX for Beginners

    Science.gov (United States)

    Zajc, W. A.; Fachini, P.

    2002-10-01

    An introduction to the PHENIX detector and to the PHENIX physics program is presented. The PHENIX physics results presented here are those from the the first RHIC (Relativistic Heavy Ion Collider) run with Au+Au collisions at RADICAL:[[RADICAND:[SNN

  3. NS simulator for beginners

    CERN Document Server

    Altman, Eitan

    2012-01-01

    NS-2 is an open-source discrete event network simulator which is widely used by both the research community as well as by the people involved in the standardization protocols of IETF. The goal of this book is twofold: on one hand to learn how to use the NS-2 simulator, and on the other hand, to become acquainted with and to understand the operation of some of the simulated objects using NS-2 simulations. The book is intended to help students, engineers or researchers who need not have much background in programming or who want to learn through simple examples how to analyse some simulated obje

  4. Openlayers 3 beginner's guide

    CERN Document Server

    Gratier, Thomas; Hazzard, Erik

    2015-01-01

    Whether you are a hobbyist or a professional web developer, if you wish to use maps on your website, then this book is for you. A basic understanding of JavaScript will be helpful, but is not necessary. If you've never worked with maps before, this book will introduce you to some common mapping topics and will guide you through the OpenLayers library. Experienced developers can also use this book as a reference to OpenLayers 3 components and to further enhance their knowledge.

  5. A Facile and Efficient Synthesis of Diaryl Amines or Ethers under Microwave Irradiation at Presence of KF/Al2O3 without Solvent and Their Anti-Fungal Biological Activities against Six Phytopathogens

    Directory of Open Access Journals (Sweden)

    Tao Zhang

    2013-09-01

    Full Text Available A series of diaryl amines, ethers and thioethers were synthesized under microwave irradiation efficiently at presence of KF/Al2O3 in 83%–96% yields without any solvent. The salient characters of this method lie in short reaction time, high yields, general applicability to substrates and simple workup procedure. At the same time, their antifungal biological activities against six phytopathogen were evaluated. Most of the compounds (3b, 3c, 3g–o are more potent than thiophannate-methyl against to Magnaporthe oryzae. This implies that diaryl amine or ether moiety may be helpful in finding a fungicide against Magnaporthe oryzae.

  6. Status report. KfK contribution to the development of DEMO-relevant test blankets for NET/ITER. Pt. 1: Self-cooled liquid metal breeder blanket. Vol. 1

    International Nuclear Information System (INIS)

    Malang, S.; Reimann, J.; Sebening, H.; Barleon, L.; Bogusch, E.; Bojarsky, E.; Borgstedt, H.U.; Buehler, L.; Casal, V.; Deckers, H.; Feuerstein, H.; Fischer, U.; Frees, G.; Graebner, H.; John, H.; Jordan, T.; Kramer, W.; Krieg, R.; Lenhart, L.; Malang, S.; Meyder, R.; Norajitra, P.; Reimann, J.; Schwenk-Ferrero, A.; Schnauder, H.; Stieglitz, R.; Oschinski, J.; Wiegner, E.

    1991-12-01

    A self-cooled liquid metal breeder blanket for a fusion DEMO-reactor and the status of the development programme is described as a part of the European development programme of DEMO relevant test blankets for NET/ITER. Volume 1 (KfK 4907) contains a summary, Volume 2 (KfK 4908) a more detailed version of the report. Both volumes contain sections on previous studies on self-cooled liquid metal breeder blankets, the reference blanket design for a DEMO-reactor, a typical test blanket design including the ancillary loop system and the building requirements for NET/ITER together with the present status of the associated R and D-programme in the fields of neutronics, magnetohydrodynamics, tritium removal and recovery, liquid metal compatibility and purification, ancillary loop system, safety and reliability. An outlook is given regarding the required R and D-programme for the self-cooled liquid metal breeder blanket prior to tests in NET/ITER and the relevant test programme to be performed in NET/ITER. (orig.) [de

  7. Status report. KfK contribution to the development of DEMO-relevant test blankets for NET/ITER. Pt. 1: Self-cooled liquid metal breeder blanket. Vol. 2. Detailed version

    International Nuclear Information System (INIS)

    John, H.; Malang, S.; Sebening, H.

    1991-12-01

    A self-cooled liquid metal breeder blanket for a fusion DEMO-reactor and the status of the development programme is described as a part of the European development programme of DEMO relevant test blankets for NET/ITER. Volume 1 (KfK 4907) contains a summary. Volume 2 (KfK 4908) a more detailed version of the report. Both volumes contain sections on previous studies on self-cooled liquid metal breeder blankets, the reference blanket design for a DEMO-reactor, a typical test blanket design including the ancillary loop system and the building requirements for NET/ITER together with the present status of the associated RandD-programme in the fields of neutronics, magnetohydrodynamics, tritium removal and recovery, liquid metal compatibility and purification, ancillary loop system, safety and reliability. An outlook is given regarding the required RandD-programme for the self-cooled liquid metal breeder blanket prior to tests in NET/ITER and the relevant test programme to be performed in NET/ITER. (orig.) [de

  8. Using a task-based approach to teaching and learning Chinese as a Foreign Language in a university beginner's level class

    DEFF Research Database (Denmark)

    Ruan, Youjin; Duan, Xiaoju; Wang, Li

    2015-01-01

    to learning Chinese as a foreign language. Chinese culture elements were also integrated into the tasks and the learning process. By analysing seven items of a post-course survey, this paper investigates the learners’ opinions toward the task-based language teaching and learning method, as well as the methods......The task-based method is regarded as an effective approach for promoting interaction and collaboration in language learning. In a beginner Chinese language course offered as an elective at Aalborg University, Denmark, a selection of tasks was designed and used to attract the students’ interests...... used in integrating culture with the language learning in this course. The results indicated that course participants were generally positive about their learning experiences and processes during the course. They appreciated not only the task-based method, but also the ways in which culture...

  9. What on earth is a mainframe ? an introduction to IBM zSeries mainframes and z/OS operating systems for total beginners

    CERN Document Server

    Stephens, David

    2008-01-01

    Looking for a "Mainframes for Beginners" book? Need to learn about z/OS fast? Then this is the book you need. This is the perfect introduction to IBM System z Mainframes and z/OS. Avoiding technical jargon, it gives you the basic facts in clear, light-hearted, entertaining English. You'll quickly learn what Mainframes are, what they do, what runs on them, and terms and terminology you need to speak Mainframe-ese. But it's not all technical. There's also invaluable information about the people that work on Mainframes, Mainframe management issues, new Mainframe trends, and other facts that don't seem to be written down anywhere else. What On Earth is a Mainframe is the closest you'll get to a "Mainframes for Dummies" book. Programmers, managers, recruitment consultants, and industry commentators will all find this book their new best friend when trying to understand the Mainframe world.

  10. Oracle Application Express 5 for beginners a practical guide to rapidly develop data-centric web applications accessible from desktop, laptops, tablets, and smartphones

    CERN Document Server

    2015-01-01

    Oracle Application Express has taken another big leap towards becoming a true next generation RAD tool. It has entered into its fifth version to build robust web applications. One of the most significant feature in this release is a new page designer that helps developers create and edit page elements within a single page design view, which enormously maximizes developer productivity. Without involving the audience too much into the boring bits, this full colored edition adopts an inspiring approach that helps beginners practically evaluate almost every feature of Oracle Application Express, including all features new to version 5. The most convincing way to explore a technology is to apply it to a real world problem. In this book, you’ll develop a sales application that demonstrates almost every feature to practically expose the anatomy of Oracle Application Express 5. The short list below presents some main topics of Oracle APEX covered in this book: Rapid web application development for desktops, la...

  11. EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA); Scientific Opinion on the substantiation of a health claim related to KF2BL20 and maintenance of normal hair pursuant to Article 13(5) of Regulation (EC) No 1924/2006

    DEFF Research Database (Denmark)

    Tetens, Inge

    and contributes to reduce hair loss”. The target population proposed by the applicant is healthy adults in the general population. The Panel considers that maintenance of normal hair is a beneficial physiological effect. The applicant identified one single arm study as being pertinent to the health claim...... related to KF2BL20, which is a combination of keratin, copper, zinc, niacin, pantothenic acid, pyridoxine and D-biotin, and maintenance of normal hair. The Panel considers that KF2BL20 is sufficiently characterised. The claimed effect is “helps to reinforce hair strength and normal hair function....... The Panel notes that this study was uncontrolled and considers that no conclusions can be drawn from this study for the scientific substantiation of the claim. The Panel concludes that a cause and effect relationship has not been established between the consumption of KF2BL20 and maintenance of normal hair....

  12. A Web-Based, Social Networking Beginners' Running Intervention for Adults Aged 18 to 50 Years Delivered via a Facebook Group: Randomized Controlled Trial.

    Science.gov (United States)

    Looyestyn, Jemma; Kernot, Jocelyn; Boshoff, Kobie; Maher, Carol

    2018-02-26

    Online social networks continue to grow in popularity, with 1.7 billion users worldwide accessing Facebook each month. The use of social networking sites such as Facebook for the delivery of health behavior programs is relatively new. The primary aim of this study was to determine the effectiveness of a Web-based beginners' running program for adults aged 18 to 50 years, delivered via a Facebook group, in increasing physical activity (PA) and cardiorespiratory fitness. A total of 89 adults with a mean age of 35.2 years (SD 10.9) were recruited online and via print media. Participants were randomly allocated to receive the UniSA Run Free program, an 8-week Web-based beginners' running intervention, delivered via a closed Facebook group (n=41) that included daily interactive posts (information with links, motivational quotes, opinion polls, or questions) and details of the running sessions; or to the control group who received a hard copy of the running program (n=48). Assessments were completed online at baseline, 2 months, and 5 months. The primary outcome measures were self-reported weekly moderate to vigorous physical activity (MVPA) and objectively measured cardiorespiratory fitness. Secondary outcomes were social support, exercise attitudes, and self-efficacy. Analyses were undertaken using random effects mixed modeling. Compliance with the running program and engagement with the Facebook group were analyzed descriptively. Both groups significantly increased MVPA across the study period (P=.004); however, this was significantly higher in the Facebook group (P=.04). The Facebook group increased their MVPA from baseline by 140 min/week versus 91 min for the control at 2 months. MVPA remained elevated for the Facebook group (from baseline) by 129 min/week versus a 50 min/week decrease for the control at 5 months. Both groups had significant increases in social support scores at 2 months (P=.02); however, there were no group by time differences (P=.16). There were

  13. Effect of pre-entry instruction as an additional part of radiation training beginner's course on reduction of radioactive contamination in two independent unsealed radioisotope facilities

    International Nuclear Information System (INIS)

    Matsuda, Naoki; Yoshida, Masahiro; Takao, Hideaki; Kaneko, Mamoru; Okumura, Yutaka; Shimasaki, Tatsuya; Kojima, Akihiro; Shiraishi, Yoshioki; Horiuchi, Seikoh

    2005-01-01

    The education for radiation workers is essential for the safety of radiation facility that stands on radiation protection practice by each worker. Japanese laws concerning radiation safety requires each radiation worker attending the 6 hours beginner's training course before entering the control area. However, in unsealed radioisotope facilities, radioactive contaminations in the control area may still take place because practical procedures for radiation safety vary depending on the type of experiments and the characteristics of radioisotopes. Therefore, an additional and practical training for each radiation worker is needed. In an attempt to give the workers an additional training of this kind, the pre-entry instruction was performed independently in Center for Frontier Life Sciences, Nagasaki University and in Institute of Resource Development and Analysis Kumamoto University. In this study, the efficacy of the instruction in each facility was assessed quantitatively on the basis of the incidence of contamination in the control area. The instruction covered laboratory rules, radioisotope ordering information, description of sign-up sheets, radioactive waste management, use of survey meters, and lab tour with an appropriate modification to meet with a specificity of each experiment. The instruction was given to beginners and to refreshers who have not handled radioisotopes for a long period, in a face-to-face manner for 1 hour before they start working radioisotopes. To examine the education effect on the reduction of contamination in a typical and frequently used laboratory, the contamination in molecular biology room of Nagasaki University was surveyed directly by a GM survey meter on a daily basis. In Kumamoto University, contamination on the surface of the entire floor in the control area was surveyed monthly by the smear method to know the education effect on general reduction of contamination. The results revealed that the number of contamination decreased

  14. The integration of Mathematics, Science and Technology in early childhood education and the foundation phase: The role of the formation of the professional identities of beginner teachers

    Directory of Open Access Journals (Sweden)

    Marie Botha

    2015-02-01

    Full Text Available This article focuses on the professional identity formation of six beginner teachers (three in early childhood education and three in the foundation phase, involved in the teaching of Mathematics, Science and Technology (MST. Attention is in particular being paid to the role of professional identity in how they applied innovative teaching methods such as enquiry-based teaching. The study is based on the personal narratives of the six teachers, regarding their own learning experiences in MST, the impact of their professional training at an institution of higher education, as well as their first experiences as MST teachers in the workplace. A qualitative research design was applied and data was obtained through visual (photo collages and written stories, observation and interviews. Whilst all the teachers held negative attitudes towards Mathematics, this situation was turned around during their university training. The three teachers in early childhood education experienced their entrance to the profession as positive, due mainly to the support of colleagues in their application of innovative teaching methods. Two teachers in the foundation phase, however, experienced the opposite. The findings emphasise the complex processes in the moulding of a professional teacher identity and how teaching practices are influenced by these processes.

  15. Changes in self-reported symptoms of depression and physical well-being in healthy individuals following a Taiji beginner course - Results of a randomized controlled trial.

    Science.gov (United States)

    Schitter, Agnes Maria; Nedeljkovic, Marko; Ausfeld-Hafter, Brigitte; Fleckenstein, Johannes

    2016-04-01

    Taiji is a mind-body practice being increasingly investigated for its therapeutic benefits in a broad range of mental and physical conditions. The aim of this study was to investigate the potential preventive effects of Taiji practice in healthy individuals with regard to their depressive symptomatology and physical well-being. Seventy healthy Taiji novices were randomly assigned to a Taiji intervention group, that is, Taiji beginner course (Yang-Style Taiji, 2 h per week, 12 weeks) or a control group comprised of the waiting list for the course. Self-reported symptoms of depression (CES-D) and physical well-being (FEW-16) were assessed at baseline, at the end of the intervention, as well as 2 months later. The included participants had a mean age of 35.5 years. Physical well-being in the Taiji group significantly increased when comparing baseline to follow-up (FEW-16 sum score T(27) = 3.94, P = 0.001, 95% CI 0.17 to 0.55). Pearson's correlation coefficients displayed a strong negative relationship between self-reported symptoms of depression and physical well-being (P's healthy individuals, with improvements pronouncing over time. Physical well-being was shown to have a strong relationship with depressive symptoms. Based on these results, the consideration of Taiji as one therapeutic option in the development of multimodal approaches in the prevention of depression seems justifiable.

  16. For beginners in anaesthesia, self-training with an audiovisual checklist improves safety during anaesthesia induction: A prospective, randomised, controlled two-centre study.

    Science.gov (United States)

    Beck, Stefanie; Reich, Christian; Krause, Dorothea; Ruhnke, Bjarne; Daubmann, Anne; Weimann, Jörg; Zöllner, Christian; Kubitz, Jens

    2018-01-31

    Beginners in residency programmes in anaesthesia are challenged because working environment is complex, and they cannot rely on experience to meet challenges. During this early stage, residents need rules and structures to guide their actions and ensure patient safety. We investigated whether self-training with an electronic audiovisual checklist app on a mobile phone would produce a long-term improvement in the safety-relevant actions during induction of general anaesthesia. During the first month of their anaesthesia residency, we randomised 26 residents to the intervention and control groups. The study was performed between August 2013 and December 2014 in two university hospitals in Germany. In addition to normal training, the residents of the intervention group trained themselves on well tolerated induction using the electronic checklist for at least 60 consecutive general anaesthesia inductions. After an initial learning phase, all residents were observed during one induction of general anaesthesia. The primary outcome was the number of safety items completed during this anaesthesia induction. Secondary outcomes were similar observations 4 and 8 weeks later. Immediately, and 4 weeks after the first learning phase, residents in the intervention group completed a significantly greater number of safety checks than residents in the control group 2.8 [95% confidence interval (CI) 0.4 to 5.1, P = 0.021, Cohen's d = 0.47] and 3.7 (95% CI 1.3 to 6.1, P = 0.003, Cohen's d = 0.61), respectively. The difference between the groups had disappeared by 8 weeks: mean difference in the number of safety checks at 8 weeks was 0.4, 95% CI -2.0 to 2.8, P = 0.736, Cohen's d = 0.07). The use of an audiovisual self-training checklists improves safety-relevant behaviour in the early stages of a residency training programme in anaesthesia.

  17. Planet earth a beginner's guide

    CERN Document Server

    Gribbin, John

    2012-01-01

    In this incredible expedition into the origins, workings, and evolution of our home planet, John Gribbin, bestselling author of In Search of Schrödinger's Cat, The Scientists, and In Search of the Multiverse, does what he does best: taking four and a half billion years of mind-boggling science and digging out the best bits. From the physics of Newton and the geology of Wegener, to the environmentalism of Lovelock, this is a must read for Earth's scientists and residents alike. Trained as an astrophysicist at Cambridge University, John Gribbin is currently Visiting Fellow in Astronomy at the University of Sussex, England.

  18. Quantum physics a beginner's guide

    CERN Document Server

    Rae, Alastair I M

    2005-01-01

    As Alastair Rae points out in his introduction, ""quantum physics is not rocket science"". It may have gained a reputation as the theory that no one really understands, but its practical applications are all around us in everyday life. If it were not for quantum physics, computers would not function, metals would not conduct electricity, and the power stations that heat our homes would not produce energy. Assuming no prior scientific or mathematical knowledge, this clear and concise introduction provides a step-by-step guide to quantum theory, right from the very basic principles to the most c

  19. Protein blotting protocol for beginners.

    Science.gov (United States)

    Petrasovits, Lars A

    2014-01-01

    The transfer and immobilization of biological macromolecules onto solid nitrocellulose or nylon (polyvinylidene difluoride (PVDF)) membranes subsequently followed by specific detection is referred to as blotting. DNA blots are called Southerns after the inventor of the technique, Edwin Southern. By analogy, RNA blots are referred to as northerns and protein blots as westerns (Burnette, Anal Biochem 112:195-203, 1981). With few exceptions, western blotting involves five steps, namely, sample collection, preparation, separation, immobilization, and detection. In this chapter, protocols for the entire process from sample collection to detection are described.

  20. Java 7 A Beginner's Tutorial

    CERN Document Server

    Kurniawan, Budi

    2011-01-01

    A Books24x7's TOP 10 title for 4 consecutive years! Java is an easy language to learn. However, you need to master more than the language syntax to be a professional Java programmer. For one, object-oriented programming (OOP) skill is key to developing robust and effective Java applications. In addition, knowing how to use the vast collection of libraries makes development more rapid. This book introduces you to important programming concepts and teaches how to use the Java core libraries. It is a guide to building real-world applications, both desktop and Web-based. The coverage is the

  1. Livecode mobile development beginner's guide

    CERN Document Server

    Holgate, Colin

    2015-01-01

    The ideal reader for this book would be someone who already knows LiveCode, is interested in creating mobile apps, and wants to save the many hours it took for me to track down all of the information on how to get started! Chapter 1, LiveCode Fundamentals, will help those of you who know programming but are not familiar with LiveCode. The knowledge you've acquired should be enough for you to benefit from the remainder of the book.

  2. Minimal Materials for ESL Beginners

    Directory of Open Access Journals (Sweden)

    N. S. Prabhu

    2010-01-01

    Full Text Available In November 2006, the government of the state of Karnataka in India announced its decision to start teaching English as a school subject from class 1 onwards in all primary schools in the state, instead of from class 5 as hitherto.

  3. Pentaho data integration beginner's guide

    CERN Document Server

    Roldán, María Carina

    2013-01-01

    This book focuses on teaching you by example. The book walks you through every aspect of Pentaho Data Integration, giving systematic instructions in a friendly style, allowing you to learn in front of your computer, playing with the tool. The extensive use of drawings and screenshots make the process of learning Pentaho Data Integration easy. Throughout the book, numerous tips and helpful hints are provided that you will not find anywhere else.This book is a must-have for software developers, database administrators, IT students, and everyone involved or interested in developing ETL solutions,

  4. Artificial intelligence a beginner's guide

    CERN Document Server

    Whitby, Blay

    2012-01-01

    Tomorrow begins right here as we embark on an enthralling and jargon-free journey into the world of computers and the inner recesses of the human mind. Readers encounter everything from the nanotechnology used to make insect-like robots, to computers that perform surgery, in addition to discovering the biggest controversies to dog the field of AI. Blay Whitby is a Lecturer on Cognitive Science and Artificial Intelligence at the University of Sussex UK. He is the author of two books and numerous papers.

  5. Seven Myths about Beginners' Language

    DEFF Research Database (Denmark)

    Lund, Karen; Kirkebæk, Mads Jakob

    2015-01-01

    In the article the authors have selected seven myths about beginners’ language for discussion, reflection and possible rejection. These are (1) the myth about the necessity of mastering the system before being able to speak the language, (2) the myth about limited capacity on the ‘hard disc’, (3......) the myth about ‘the only thing’ (the method), (4) the myth about “we tried that before”, (5) the myth about “one people and one teaching method, (6) the myth about easy and difficult languages, and (7) the myth about students with no competences and a worthless past. The article suggests language teachers...

  6. Mac Programming for Absolute Beginners

    CERN Document Server

    Wang, Wallace

    2011-01-01

    Want to learn how to program on your Mac? Not sure where to begin? Best-selling author Wallace Wang will explain how to get started with Cocoa, Objective-C, and Xcode. Whether you are an experienced Windows coder moving to the Mac, or you are completely new to programming, you'll see how the basic design of a Mac OS X program works, how Objective-C differs from other languages you may have used, and how to use the Xcode development environment. Most importantly, you'll learn how to use elements of the Cocoa framework to create windows, store data, and respond to users in your own Mac programs.

  7. Kayh am Beginn der Neuzeit

    OpenAIRE

    Trugenberger, Volker

    1990-01-01

    Die Kayher Gegend barg in ihrem Boden einen besonderen Schatz: Alabaster. Herzog Ludwig von Württemberg kaufte eigens zwischen 1581 und 1586 von den Kayher Bürgern Urban Binder, Jakob Schwarz und Martin Noppel deren auf Altinger Markung uffm kreidengraben gelegene Äcker mit alapasterstein, insgesamt 2 Morgen. Der darauf gebrochene Alabaster wurde für Kunstwerke verwandt, die im Auftrag des Herzogs angefertigt wurden; er wurde nicht abgebaut, um ihn anderweitig zu verkaufen und damit Gewinne z...

  8. Quantum error correction for beginners

    International Nuclear Information System (INIS)

    Devitt, Simon J; Nemoto, Kae; Munro, William J

    2013-01-01

    Quantum error correction (QEC) and fault-tolerant quantum computation represent one of the most vital theoretical aspects of quantum information processing. It was well known from the early developments of this exciting field that the fragility of coherent quantum systems would be a catastrophic obstacle to the development of large-scale quantum computers. The introduction of quantum error correction in 1995 showed that active techniques could be employed to mitigate this fatal problem. However, quantum error correction and fault-tolerant computation is now a much larger field and many new codes, techniques, and methodologies have been developed to implement error correction for large-scale quantum algorithms. In response, we have attempted to summarize the basic aspects of quantum error correction and fault-tolerance, not as a detailed guide, but rather as a basic introduction. The development in this area has been so pronounced that many in the field of quantum information, specifically researchers who are new to quantum information or people focused on the many other important issues in quantum computation, have found it difficult to keep up with the general formalisms and methodologies employed in this area. Rather than introducing these concepts from a rigorous mathematical and computer science framework, we instead examine error correction and fault-tolerance largely through detailed examples, which are more relevant to experimentalists today and in the near future. (review article)

  9. Python 3 for Absolute Beginners

    CERN Document Server

    Hall, Tim

    2009-01-01

    There are many more people who want to study programming other than aspiring computer scientists with a passing grade in advanced calculus. This guide appeals to your intelligence and ability to solve practical problems, while gently teaching the most recent revision of the programming language Python. You can learn solid software design skills and accomplish practical programming tasks, like extending applications and automating everyday processes, even if you have no programming experience at all. Authors Tim Hall and J-P Stacey use everyday language to decode programming jargon and teach Py

  10. PIC microcomputer guide for beginner

    International Nuclear Information System (INIS)

    Shin, Chulho

    2001-03-01

    This book comprised of four parts. The first part deals with computer one chip, voltage current, resistance, electronic components, logical element, TTL and CMOS, memory and I/O and MDS. The second part is about PIC16C84 which describes its memory structure, registers and PIC16C84 command. The third part deals with LED control program, jet car LED, quiz buzzer program, LED spectrum, digital dice, two digital dices and time bomb. The last part introduces PIC16C71 and temperature controller.

  11. Neural Networks for the Beginner.

    Science.gov (United States)

    Snyder, Robin M.

    Motivated by the brain, neural networks are a right-brained approach to artificial intelligence that is used to recognize patterns based on previous training. In practice, one would not program an expert system to recognize a pattern and one would not train a neural network to make decisions from rules; but one could combine the best features of…

  12. Using a Blog to Guide Beginner Students to Use Adjectives Appropriately When Writing Descriptions in English (El uso de una bitácora o "blog" para guiar a estudiantes principiantes en el uso apropiado de los adjetivos cuando escriben descripciones en inglés)

    Science.gov (United States)

    Lizarazo Jara, Omar Yesid

    2012-01-01

    Beginner students often have difficulties using adjectives when they write descriptions in English. This article focuses on the procedures used to help my sixth grade students understand and use adjectives in the correct order by using a blog. To achieve the objective of the project I decided to implement an innovation in and out of class…

  13. [MRI changes of Achilles tendon and hindfoot in experienced runners and beginners during training and after a (half)-marathon competition].

    Science.gov (United States)

    Freund, W; Billich, C; Brambs, H-J; Weber, F; Schütz, U H

    2011-08-01

    Marathon running is gaining in popularity. Its benefits regarding the cardiovascular system as well as the metabolism are beyond doubt. However, whether or not there are detrimental side effects to the musculoskeletal system such as wear and tear is an unsolved question. We therefore prospectively looked at beginners and experienced runners at a city marathon during training and after the competition for lesions to the Achilles tendon (AT) or hindfoot. 73 healthy subjects were prospectively included in our study. They were recruited from the applicants of the city marathon or half-marathon. They underwent an initial clinical orthopaedic as well as three magnetic resonance (MRI) examinations. The MRI were conducted at the time point of study enrolment, near the end of training and directly (up to 72 hours) after the run. MRI evaluation (fat saturated T (2)-weighted sagittal STIR sequence) was performed by two independent experienced radiologists blinded to the clinical context. The results were compared for subgroups of runners, also a factorial analysis was performed. Statistical results were deemed significant for p ≤ 0.05. 32 women and 41 men were included. In the end there were 53 finishers and 20 non-finishers; 28 seasoned runners and 25 novices. 57 runners had no foot complaints, while 14 had foot pain during training and 13 during the marathon. Mean body weight was 71.6 kg, height was 173 cm, age was 40.2 years. Mean AT diameter was 7.0 mm and showed no change during training or after the marathon. There was no significant influence of gender on other variables investigated. There was a significant and positive correlation between AT diameter and weight (r = 0.37), also AT and height (r = 0.34), while there was negative correlation between height and signal intensity of calcaneus (r = -0.50). The signal intensity of the AT decreased during training. The signal intensity of the calcaneus decreased from inclusion until after the marathon

  14. Disease specific stress of tumor patients at the beginning of radiotherapy. Effect on psychosocial support requirement; Krankheitsspezifische Belastungen von Tumorpatienten zu Beginn einer Strahlentherapie. Auswirkungen auf den psychosozialen Betreuungsbedarf

    Energy Technology Data Exchange (ETDEWEB)

    Sehlen, S.; Hollenhorst, H.; Schymura, B.; Firsching, M.; Duehmke, E. [Ludwig-Maximilians-Univ., Muenchen (Germany). Klinik und Poliklinik fuer Strahlentherapie und Radioonkologie; Aydemir, U. [Inst. fuer Biometrie und Epidemiologie, Klinikum Grosshadern, Ludwig-Maximilians-Univ., Muenchen (Germany); Herschbach, P. [Technische Univ. Muenchen (Germany). Inst. und Poliklinik fuer Psychosomatische Medizin, Psychotherapie und medizinische Psychologie

    2001-10-01

    requirement. (orig.) [German] Hintergrund: Die Radiotherapie bringt Tumorpatienten in eine besondere Lebenssituation, in der sie eine Reihe von unterschiedlichen Faktoren ausgesetzt werden, deren Auspraegung weitgehend unbekannt ist. Intention dieser Querschnittsstudie war es, erstmals systematisch die spezifischen Belastungen von Tumorpatienten zu Beginn einer Strahlentherapie aufzuzeigen und einen belastungsabhaengigen Betreuungswunsch zu erheben mit dem Ziel einer Belastungsreduktion und Verbesserung von Lebensqualitaet und Compliance waehrend einer radioonkologischen Behandlung. Patienten und Methoden: 732 Patienten wurden zunaechst in die Studie aufgenommen, von denen 446 (60,9%) die Einschlusskriterien erfuellten (Ablehnung 21,0%, Karnofsky-Index 6,6%, organisatorische Probleme 3,4%, Sprachbarrieren 3,0%, kognitive Einschraenkung 2,6%, Tod 2,5%). Folgende Erhebungsinstrumente gingen in die Auswertung zu Beginn der Strahlentherapie ein: medizinische und soziodemographische Daten, Lebenssituation (LS), Fragebogen zur Belastung von Krebspatienten (FBK), selbst definierter Betreuungswunsch (BB). 262 Maenner und 184 Frauen (medianes Alter 60,0 Jahre) mit unterschiedlichen Diagnosen wurden untersucht. Ergebnisse: Auf Skalenebene des Fragebogens zur Belastung von Krebspatienten zeigte sich vor allem eine Belastung durch Einschraenkung der Leistungsfaehigkeit, Angst und Schmerz. Frauen hatten signifikant hoehere Belastungswerte in den Bereichen Schmerz (p=0,016) und Angst (p=0,009), Patienten unter 45 Jahren im Bereich Information (p=0,002) und Patienten zwischen 45 und 60 Jahren in den Bereichen Angst (p=0,002) und Gesamtbelastung (p=0,003). Patientinnen mit einem Mammakarzinom waren am staerksten belastet. Der Anteil von stark belasteten Patienten war in den Skalen Leistungsfaehigkeit (43%) und Angst (40%) am hoechsten. Es bestand ein signifikanter Zusammenhang zwischen hoher Belastung und hohem Betreuungswunsch (insbesondere nach Arzt-/Psychologengespraechen und Information

  15. Treino musical e capacidade da memória operacional em crianças iniciantes, veteranas e sem conhecimentos musicais Musical training and working memory span in beginners, veterans and with no musical knowledge children

    Directory of Open Access Journals (Sweden)

    Fabiana Silva Ribeiro

    2012-01-01

    Full Text Available A memória operacional e a atividade musical ativam áreas encefálicas recíprocas e homólogas, contudo não há evidências se o treino musical pode ampliar a capacidade da memória operacional. Objetivo: Avaliar o desempenho do treino musical sob a memória operacional em crianças de 9 e 10 anos de idade, praticantes de treino musical e sem experiência musical. PARTICIPANTES: Crianças Iniciantes (n=20, Veteranas (n=20 e Grupo Controle (n=20. MATERIAIS: Instrumentos computadorizados para avaliação da memória operacional. RESULTADOS: Crianças veteranas apresentaram melhores pontuações no BCPR (Teste de Repetição de Pseudopalavras para crianças brasileiras e em subtestes da AWMA (Avaliação Automatizada da Memória Operacional. CONCLUSÃO: O treino musical parece ter contribuído para o desenvolvimento da memória operacional em crianças veteranas no programa de treino musical.Working memory and musical activity activate reciprocal and homologues brain areas. However, there is a lack of evidence if musical training can amplify the working memory span. Objective: To assess the performance of musical training on working memory in children aged 9 and 10 years old who regularly have musical training or with no musical training at all. PARTICIPANTS: Beginners (n=20, Veterans (n=20 and a Control Group (n=20. MATERIALS: Computerized instruments to assess working memory. RESULTS: Veteran children presented higher scores in BCPR (Brazilian Children's Test of Pseudoword Repetition and in specific tasks of AWMA (Automated Working Memory Assessment. CONCLUSION: Musical training seems to have contributed for working memory development in veteran children under musical training programs.

  16. Drupal 7 Mobile Web Development Beginner's Guide

    CERN Document Server

    StovallTom

    2012-01-01

    Follow the fun example of a family pizza restaurant to help you adapt your own website to one that is fullyfunctional in a mobile environment. Each chapter covers a different aspect of mobile web development with plenty of step-by-step instructions and screenshots to make things clearer. This book is for independent developers who may or may not have had experience with Drupal websites. We take some "deep dives" into customized functionality that will take your Drupal development and your development workflow to the next level.

  17. Engineering haptic devices a beginner's guide

    CERN Document Server

    Hatzfeld, Christian

    2014-01-01

    In this greatly reworked second edition of Engineering Haptic Devices the psychophysic content has been thoroughly revised and updated. Chapters on haptic interaction, system structures and design methodology were rewritten from scratch to include further basic principles and recent findings. New chapters on the evaluation of haptic systems and the design of three exemplary haptic systems from science and industry have been added. This book was written for students and engineers that are faced with the development of a task-specific haptic system. It is a reference book for the basics of hap

  18. Web application security: a beginner's guide

    National Research Council Canada - National Science Library

    Sullivan, Bryan; Liu, Vincent

    2012-01-01

    .... This practical resource includes chapters on authentication, authorization, and session management, along with browser, database, and file security--all supported by true stories from industry...

  19. Evaluation of Beginner Driver Education in Oregon

    Directory of Open Access Journals (Sweden)

    Dan Mayhew

    2017-02-01

    Full Text Available Although driver education (DE is widely accepted as an effective teen driver safety measure and widely available in the United States, Canada and elsewhere, evaluations have generally failed to show that such formal programs actually produce safer drivers. To address the issue of safety effects as part of a larger investigation, two studies were conducted to examine whether the Oregon Department of Transportation (ODOT-approved DE program was associated with reductions in collisions and convictions. In the first study, DE status among a relatively small sample of teens who completed an online survey was not found to have a significant effect on collisions and convictions. In the second study, of a much larger population of teen drivers, DE status was associated with a lower incidence of collisions and convictions. On balance, this suggests that the safety effects of DE are either neutral, based on the results of the first Oregon study, or cautiously optimistic based on the results of the second study. The implications of these findings are discussed in terms of making improvements in DE that are evidence-based, and the need for further evaluation to establish that improved and new programs meet their safety objectives.

  20. Web application security: a beginner's guide

    National Research Council Canada - National Science Library

    Sullivan, Bryan; Liu, Vincent

    2012-01-01

    .... Sullivan and Liu have created a savvy, essentials-based approach to web app security packed with immediately applicable tools for any information security practitioner sharpening his or her tools or just starting...

  1. Colloquial English the complete course for beginners

    CERN Document Server

    King, Gareth

    2015-01-01

    Colloquial English provides a step-by-step course in English as it is written and spoken today. Combining a user-friendly approach with a thorough treatment of the language, it equips learners with the essential skills needed to communicate confidently and effectively in English in a broad range of situations. Key features include:progressive coverage of speaking, listening, reading and writing skillsstructured, jargon-free explanations of grammaran extensive range of focused and stimulating exercisesrealistic and entertaining dialogues covering a broad variety of scenariosuseful explanations

  2. GNOME 3 application development beginner's guide

    CERN Document Server

    Anwari, Mohammad

    2013-01-01

    This book is a step-by-step guide with ready-to-run codes to guide you in developing applications with GNOME. If you have programming skill either in Linux or other operating systems and want to have GNOME 3 as one of your deployment targets, then this book is for you. This book is also for commercial software developers or an open source software hacker. The reader needs to be familiar with Vala and JavaScript before starting to develop Gtk+ and Clutter applications.

  3. Geometric measure theory a beginner's guide

    CERN Document Server

    Morgan, Frank

    1995-01-01

    Geometric measure theory is the mathematical framework for the study of crystal growth, clusters of soap bubbles, and similar structures involving minimization of energy. Morgan emphasizes geometry over proofs and technicalities, and includes a bibliography and abundant illustrations and examples. This Second Edition features a new chapter on soap bubbles as well as updated sections addressing volume constraints, surfaces in manifolds, free boundaries, and Besicovitch constant results. The text will introduce newcomers to the field and appeal to mathematicians working in the field.

  4. A beginners guide for video production

    Energy Technology Data Exchange (ETDEWEB)

    1991-11-01

    The Seattle-King County Hazardous Waste Management Plan provides the framework for an intensive effort to keep Household Hazardous Waste (HHW) and Small Quantity Generator (SQG) wastes from entering the municipal solid and liquid waste streams. Many innovative programs for managing small sources of hazardous waste have been developed in response to the Plan. With the assistance of Urban Consortium grants, the City of Seattle has researched and developed a series of reports describing the planning, operation and evaluation of the plan`s HHW collection programs. Three of the Plan`s programs of particular interest to other jurisdictions are the fixed site and mobile HHW Collection Facilities, and the Business Waste Consultations provided to SQG`s. In 1991, Seattle received an Urban Consortium grant to produce two videos showing how the HHW Collection Facilities and Business Consultations programs work. This report provides an overviews of the video development and production process and a discussion of the lessons learned by the staff directing the production.

  5. A beginners guide to the SVXII

    International Nuclear Information System (INIS)

    Yarema, R.; Kipnis, I.; Kleinfelder, S.; Luo, L.; Milgrome, O.; Sarraj, M.; Yarema, R.; Zimmerman, T.

    1994-06-01

    In the late 1980's, several versions of a full custom chip called the SVX were built and tested. The chip was designed to be a second generation silicon strip readout chip incorporating new features such as data sparsification for silicon strip detectors. The SVX designed by Stuart Kleinfelder and others at LBL contained 128 channels of electronics and proved to be very popular. Initially the chip was fabricated in 3.0 micron process and later transferred to a 1.2 micron radiation hard process. Based on the success of the first SVX (referred herein as SVXI), a need arose for a third generation device. This new 128 channel device called the SVXII was developed by a collaboration of engineers at Fermilab and Lawrence Berkeley Laboratory. The SVXII, designed in a 1.2 micron process, contains many new features including analog storage and digitization of the analog information. In addition to the new features, the SXVII is intended to operate with interaction times approximately 25 times faster than the original SVX, have the same or better noise characteristics, and have a minimal increase in power. The SVXII is an engineering challenge. This report is a first detailed attempt to introduce the SVXIII to the user. Knowledge of the original SVX and its operation would be helpful and can be obtained from references 1--3

  6. ACER Checklists for School Beginners: Manual.

    Science.gov (United States)

    Rowe, Helga A. H.

    This assessment package consists of a checklist for teachers, a checklist for parents, a class record sheet, and a manual designed to be used by teachers to highlight the strengths and weaknesses of individual children soon after their entry into school or during their last term in preschool or kindergarten classes. The Checklist for Teachers…

  7. JavaScript for Absolute Beginners

    CERN Document Server

    McNavage, T

    2010-01-01

    If you are new to both JavaScript and programming, this hands-on book is for you. Rather than staring blankly at gobbledygook, you'll explore JavaScript by entering and running hundreds of code samples in Firebug, a free JavaScript debugger. Then in the last two chapters, you'll leave the safety of Firebug and hand-code an uber cool JavaScript application in your preferred text editor. Written in a friendly, engaging narrative style, this innovative JavaScript tutorial covers the following essentials: * Core JavaScript syntax, such as value types, operators, expressions, and statements provide

  8. A Beginner's Guide to the Solow Model

    Science.gov (United States)

    Stein, Sheldon H.

    2007-01-01

    The Solow model is widely regarded as the workhorse model of the theory of economic growth. Although at one point this model was first encountered in graduate school, it has since filtered down to the intermediate and, occasionally, to the principles of macroeconomics course. Many have commented on how difficult it is to teach the Solow model to…

  9. Renormalization Methods - A Guide For Beginners

    International Nuclear Information System (INIS)

    Cardy, J

    2004-01-01

    The stated goal of this book is to fill a perceived gap between undergraduate texts on critical phenomena and advanced texts on quantum field theory, in the general area of renormalization methods. It is debatable whether this gap really exists nowadays, as a number of books have appeared in which it is made clear that field-theoretic renormalization group methods are not the preserve of particle theory, and indeed are far more easily appreciated in the contexts of statistical and condensed matter physics. Nevertheless, this volume does have a fresh aspect to it, perhaps because of the author's background in fluid dynamics and turbulence theory, rather than through the more traditional migration from particle physics. The book begins at a very elementary level, in an effort to motivate the use of renormalization methods. This is a worthy effort, but it is likely that most of this section will be thought too elementary by readers wanting to get their teeth into the subject, while those for whom this section is apparently written are likely to find the later chapters rather challenging. The author's particular approach then leads him to emphasise the role of renormalized perturbation theory (rather than the renormalization group) in a number of problems, including non-linear systems and turbulence. Some of these ideas will be novel and perhaps even surprising to traditionally trained field theorists. Most of the rest of the book is on far more familiar territory: the momentum-space renormalization group, epsilon-expansion, and so on. This is standard stuff, and, like many other textbooks, it takes a considerable chunk of the book to explain all the formalism. As a result, there is only space to discuss the standard φ 4 field theory as applied to the Ising model (even the N-vector model is not covered) so that no impression is conveyed of the power and extent of all the applications and generalizations of the techniques. It is regrettable that so much space is spent on rather oversimplified and unrelated models in the first part of the book that, in the end, the reader is left breathless on the threshold of the really interesting material. Despite the earlier emphasis on the application of renormalization ideas in dynamics, in the end the full power of the field-theoretical approach is not applied to the obvious arena of dynamic critical phenomena (where there certainly is currently a gap in the literature) but to the Navier--Stokes equations. The development of the book is somewhat illogical in places. Mean field theory interrupts discussion of block spin methods and scaling arguments---the two are distinct approaches. The Callan--Symanzik equation is introduced before Feynman diagrams are explained, so that there is a hiatus before the actual results for the critical exponents can be found. I think this book is too broad in some respects, and too limited in others, to be a really useful textbook for a course on renormalization methods. Those who have learned these ideas either from field theory, or from nonlinear systems, will find it more rewarding for the sections covering the topics with which they are less familiar. For this reason alone, the book should at least find a place on most library reference shelves. (book review)

  10. Colloquial French the complete course for beginners

    CERN Document Server

    Demouy, Valérie

    2014-01-01

     COLLOQUIAL FRENCH is easy to use and completely up to date!Specially written by experienced teachers for self-study or class use, the course offers a step-by-step approach to written and spoken French. No prior knowledge of the language is required.What makes COLLOQUIAL FRENCH your best choice in personal language learning?Interactive - lots of exercises for regular practiceClear - concise grammar notesPractical - useful vocabulary and pronunciation guideComplete - including answer key and reference sectionWhether you''re a business traveller, or about to take up a daring challenge in adventu

  11. 4-H Textile Science Beginner Projects.

    Science.gov (United States)

    Scholl, Jan

    This packet contains three 4-H projects for students beginning the sewing sequence of the textile sciences area. The projects cover basics of sewing using sewing machines, more difficult sewing machine techniques, and hand sewing. Each project provides an overview of what the student will learn, what materials are needed, and suggested projects…

  12. Kali Linux wireless penetration testing beginner's guide

    CERN Document Server

    Ramachandran, Vivek

    2015-01-01

    If you are a security professional, pentester, or anyone interested in getting to grips with wireless penetration testing, this is the book for you. Some familiarity with Kali Linux and wireless concepts is beneficial.

  13. The Glymphatic System – A Beginner's Guide

    Science.gov (United States)

    Jessen, Nadia Aalling; Munk, Anne Sofie Finmann; Lundgaard, Iben; Nedergaard, Maiken

    2015-01-01

    The glymphatic system is a recently discovered macroscopic waste clearance system that utilizes a unique system of perivascular channels, formed by astroglial cells, to promote efficient elimination of soluble proteins and metabolites from the central nervous system. Besides waste elimination, the glymphatic system may also function to help distribute non-waste compounds, such as glucose, lipids, amino acids, and neurotransmitters related to volume transmission, in the brain. Intriguingly, the glymphatic system function mainly during sleep and is largely disengaged during wakefulness. The biological need for sleep across all species may therefore reflect that the brain must enter a state of activity that enables elimination of potentially neurotoxic waste products, including β-amyloid. Since the concept of the glymphatic system is relatively new, we will here review its basic structural elements, organization, regulation, and functions. We will also discuss recent studies indicating that glymphatic function is suppressed in various diseases and that failure of glymphatic function in turn might contribute to pathology in neurodegenerative disorders, traumatic brain injury and stroke. PMID:25947369

  14. The Glymphatic System – A Beginner's Guide

    OpenAIRE

    Jessen, Nadia Aalling; Munk, Anne Sofie Finmann; Lundgaard, Iben; Nedergaard, Maiken

    2015-01-01

    The glymphatic system is a recently discovered macroscopic waste clearance system that utilizes a unique system of perivascular channels, formed by astroglial cells, to promote efficient elimination of soluble proteins and metabolites from the central nervous system. Besides waste elimination, the glymphatic system may also function to help distribute non-waste compounds, such as glucose, lipids, amino acids, and neurotransmitters related to volume transmission, in the brain. Intriguingly, th...

  15. The Glymphatic System: A Beginner's Guide.

    Science.gov (United States)

    Jessen, Nadia Aalling; Munk, Anne Sofie Finmann; Lundgaard, Iben; Nedergaard, Maiken

    2015-12-01

    The glymphatic system is a recently discovered macroscopic waste clearance system that utilizes a unique system of perivascular tunnels, formed by astroglial cells, to promote efficient elimination of soluble proteins and metabolites from the central nervous system. Besides waste elimination, the glymphatic system also facilitates  brain-wide distribution of several compounds, including glucose, lipids, amino acids, growth factors, and neuromodulators. Intriguingly, the glymphatic system function mainly during sleep and is largely disengaged during wakefulness. The biological need for sleep across all species may therefore reflect that the brain must enter a state of activity that enables elimination of potentially neurotoxic waste products, including β-amyloid. Since the concept of the glymphatic system is relatively new, we will here review its basic structural elements, organization, regulation, and functions. We will also discuss recent studies indicating that glymphatic function is suppressed in various diseases and that failure of glymphatic function in turn might contribute to pathology in neurodegenerative disorders, traumatic brain injury and stroke.

  16. A beginner's guide to mathematical logic

    CERN Document Server

    Smullyan, Raymond M

    2014-01-01

    Combining stories of great philosophers, quotations, and riddles with the fundamentals of mathematical logic, this new textbook for first courses in mathematical logic was written by the subject's creative master. Raymond Smullyan offers clear, incremental presentations of difficult logic concepts with creative explanations and unique problems related to proofs, propositional logic and first-order logic, undecidability, recursion theory, and other topics.

  17. A Beginner's Sequence of Programming Activities.

    Science.gov (United States)

    Slesnick, Twila

    1984-01-01

    Presents various programing activities using the BASIC and LOGO programing languages. Activities are included in separate sections with a title indicating the nature of the activities and the "tools" (commands) needed. For example, "Old-fashioned drawing" requires several tools (PRINT, LIST, RUN, GOTO) to make drawings using…

  18. An Analysis of Programming Beginners' Source Programs

    Science.gov (United States)

    Matsuyama, Chieko; Nakashima, Toyoshiro; Ishii, Naohiro

    The production of animations was made the subject of a university programming course in order to make students understand the process of program creation, and so that students could tackle programming with interest. In this paper, the formats and composition of the programs which students produced were investigated. As a result, it was found that there were a lot of problems related to such matters as how to use indent, how to apply comments and functions etc. for the format and the composition of the source codes.

  19. Teaching Beginners to Program: Some Cognitive Considerations.

    Science.gov (United States)

    Rogers, Jean B.

    Learning to program involves developing an understanding of two hierarchies of concepts. One hierarchy consists of data and extends from very literal data (which represents only itself) to very abstract data incorporating variable values in complex interrelationships. The other hierarchy consists of the operations performed on the data and extends…

  20. A derékfájás

    DEFF Research Database (Denmark)

    Tamás, Illés S.

    2015-01-01

    goal of the treatment is to prevent becoming chronic the symptomatology. Objectives of the management of chronic low back pain are effective pain reduction, continuous maintainance of physical activity, prevention of permanent disability, and restoration of working ability. Analgesics, non steroid anti...

  1. Reference manual for the KfK code PCROSS

    International Nuclear Information System (INIS)

    Ravndal, S.; Oblozinsky, P.; Kelzenberg, S.; Cierjacks, S.

    1991-12-01

    The PCROSS code calculates the so-called 'pseudo' cross sections for sequential (x,n) reactions and merges them together with 'effective' cross section for neutron induced reactions into one file of 'collapsed' cross sections. The file is tailored to provide an input for the FISPACT inventory code that calculates the activation and related radiological quantities of material irradiated in given neutron fields. The report summarizes calculational procedure and provides the reader with essential technical details of the code PCROSS (version 1.0) such as description of parameters, common blocks and subroutines. (orig.) [de

  2. KfA Institute of Nuclear Physics. Annual report 1987

    International Nuclear Information System (INIS)

    Gruemmer, F.; Kilian, K.; Schult, O.; Seyfarth, H.; Speth, J.; Turek, P.

    1988-04-01

    This annual report contains extended abstracts about the work performed at the named institute together with a list of publications and speeches. The work concerns nuclear reactions, nuclear spectroscopy, intermediate-energy physics, nuclear structure, developments of the isochronous cyclotron and the ISIS ion source, construction of spectrometers, detectors, and targets, computer development, counting electronics, and radiation protection. (HSI)

  3. Advanced robotics R+D at KfK

    International Nuclear Information System (INIS)

    Rininsland, H.; Smidt, D.; Trauboth, H.; Kernforschungszentrum Karlsruhe G.m.b.H.; Kernforschungszentrum Karlsruhe G.m.b.H.

    1987-01-01

    Particular considerations for teleoperated and very long reach robotic systems are given. Robotic systems involving long reach referred to, include the TFTR maintenance boom developed for the Princeton fusion reactor and future automated cranes and bridge inspection equipment. A project to develop such long reach booms currently involves Putzmeister and the NRC, who will be responsible for developing the collision avoidance algorithms as part of a 'computer aided telemanipulation' approach. Problems encountered with operating equipment of this kind remotely were addressed during the recent Chernobyl disaster at which a range of equipment developed by Putzmeister was applied to combat the disaster. (orig./HP)

  4. 1948-IJBCS-Article-Akinwunmi K.F

    African Journals Online (AJOL)

    hp

    bilirubin, creatinine, uric acid, urea levels in the liver and plasma of treated animals. Moreover, some activities ... brown fixed oil which is mainly linoleic acid. (46.9%), oleic acid ...... of rosmarinic acid extracts on porcine pancreatic amylase in ...

  5. KfW Water Symposium 2009 : Financing Sanitation

    OpenAIRE

    KfW Development Bank

    2010-01-01

    "The central objective of the International Year of Sanitation was to put the global community on track to achieve the Millennium Development Goals MDG sanitation target. However, one year later, it is still difficult to keep sanitation high on the agenda, while practical action is required to encourage demand driven and sustainable solutions. With the support of the German Ministry for Development and Cooperation and together with the European Investment Bank EIB and the French Developm...

  6. Effect of a mentoring through reflection program on the verbal behavior of beginner volleyball coaches: a case study. Efecto de un programa de supervisión reflexiva sobre la conducta verbal de entrenadores principiantes de voleibol: un estudio de casos.

    Directory of Open Access Journals (Sweden)

    Moreno Domínguez, Alberto

    2007-07-01

    Full Text Available AbstractThe purpose of this study was to modify the verbal behavior of volleyball coaches during competition. Three beginner volleyball coaches were included in a formative program that included supervisory feedback plus systematic analysis of the coaches´ verbal feedback, as well as the coaches´ own observations and self-corrections of their behavior during the competitive season. The outcome variable of interest was the verbal behavior of the coach during timeouts during games, with consideration given for two specific dimensions of behavior: the type of information provided to the team and the team to which the coach made reference. The results revealed a change in the verbal behavior of the coaches, which was principally demonstrated in an increase in amount of tactical information and information provided about the opponent.ResumenEl propósito de este estudio fue modificar la conducta verbal del entrenador de voleibol durante la competición. Tres entrenadores de voleibol fueron sometidos a un programa formativo (feedback de supervisión con análisis sistemático de la conducta verbal del entrenador, y visionado de la actuación durante una temporada de competición. La variable dependiente de la investigación fue la conducta verbal del entrenador durante los tiempos muertos, considerándose dos dimensiones en la misma: tipo de información, equipo al que hace referencia la información. Los resultados obtenidos muestran una modificación en la conducta verbal de los entrenadores, manifestada fundamentalmente en el incremento de información táctica y sobre el equipo contrario.

  7. The Use of Communication Strategies in the Beginner EFL Classroom

    Science.gov (United States)

    Rodríguez Cervantes, Carmen A.; Roux Rodriguez, Ruth

    2012-01-01

    When language learners do not know how to say a word in English, they can communicate effectively by using their hands, imitating sounds, inventing new words, or describing what they mean. These ways of communicating are communication strategies (CSs). EFL teachers are not always aware of the importance of teaching communication strategies to…

  8. iPhone Location Aware Apps by Example - Beginners Guide

    CERN Document Server

    Chawdhary, Zeeshan

    2012-01-01

    Using a By example approach you will master the essentials of location awareness and augmented reality by building five complete apps using easy to follow step by step instructions geared towards newcomers. Novice to professional level iOS programmers who want to master location awareness and augmented reality. Build five practical location-based iOS Apps from scratch, a first for any book, converting learning into actual implementation.

  9. Beginner teacher professional development: An action research and ...

    African Journals Online (AJOL)

    Tanya

    Department of Humanities Education, Faculty of Education, University of Pretoria, South ... her mentorship practice, thereby enacting the role of transformative leader ... Keywords: Action research; learning styles; mentoring practice; professional ... in an 'education sink or swim gala' be empowered to help transform society?

  10. Beginn und Dosisanpassung einer intensivierten konventionellen Insulintherapie (ICT beim Erwachsenen

    Directory of Open Access Journals (Sweden)

    Lohr R

    2012-01-01

    Full Text Available Eine intensivierte Insulintherapie (ICT ist die Behandlung der Wahl bei Diabetes mellitus Typ 1 und auch bei vielen Menschen mit insulinpflichtigem Typ-2-Diabetes. Bei Therapiebeginn müssen individuell Insuline ausgewählt und die richtige Dosierung festgelegt werden. Im weiteren Verlauf ist dann die Anpassung der Insulintherapie an besondere Alltagssituationen wie Sport oder akute Erkrankungen vorrangig. Eine gute Patientenschulung und eine gute Zusammenarbeit zwischen Betroffenem und Behandlerteam sind entscheidend, um diese komplizierte Therapie erfolgreich umzusetzen.

  11. The Beginner’s Guide to Nation-Building

    Science.gov (United States)

    2007-01-01

    1979–1996 Guatemala 1997–1999 1962–1996 Nigeria 1999–2001 1966–1999 Peru 2000–2002 1980–2000 Uruguay 2000–2001 1973–1985 Panama 2001–2002 1968–1989...chronic illnesses such as diabetes and heart disease. To deliver these services, the inter- vening authorities, host government, and ministry of health

  12. StarTeX - a TeX for beginners

    OpenAIRE

    Langmyhr, Dag

    1996-01-01

    This article describes StarTEX, a new TEX format for students writing their first report and other novice users. Its aim is to provide a simpler and more robust tool for users with no previous knowledge of TEX and LATEX.V

  13. Blend for visual studio 2012 by example beginner's guide

    CERN Document Server

    Shukla, Abhishek

    2015-01-01

    This book is aimed at developers and designers who are new to Blend and looking to learn Blend, not just practically, but also conceptually. This book does not assume any knowledge about Blend on the part of developers; however, some experience in design or development might be useful in understanding the concepts faster, but this book explains everything very simply so that you are able to understand everything with little or no effort.

  14. Practical guide to ICP-MS: a tutorial for beginners

    National Research Council Canada - National Science Library

    Thomas, Robert

    2013-01-01

    ... for those with limited knowledge of the technique. Written by an insider with more than 20 years experience in product development, customer support, and technical marketing for an ICP-MS instrument vendor, the book highlights this powerful ultra...

  15. A beginner's guide to the use of WIMS

    International Nuclear Information System (INIS)

    Halsall, M.J.

    1987-04-01

    The WIMS codes are widely used for calculating the characteristics of thermal reactor lattices. WIMSD has changed little since the 1960s and is most useful for pincell and cluster calculations, WIMS-E is a modular scheme with more flexibility, and LWRWIMS is specifically for PWR and BWR assembly representations. This report provides a brief introductory guide for inexperienced users of the WIMS codes. There is an introductory part to explain why and when to use WIMS, with particular reference to the advantages of deterministic methods over stochastic (Monte Carlo) methods. A few comments on which version to use are then followed by a summary of commonly used options with examples. References are given to more complete documentation describing the input in greater detail; users are expected to move on to this as they gain experience. (author)

  16. Getting started in radio astronomy beginner projects for the amateur

    CERN Document Server

    Arnold, Steven

    2013-01-01

    Radio astronomy is a mystery to the majority of amateur astronomers, yet it is the best subject to turn to when desirous of an expanded knowledge of the sky. This guide intends to instruct complete newcomers to radio astronomy, and provides help for the first steps on the road towards the study of this fascinating subject. In addition to a history of the science behind the pursuit, directions are included for four easy-to-build projects, based around long-term NASA and Stanford Solar Center projects. The first three projects constitute self-contained units available as kits, so there is no nee

  17. A beginner's guide to nutritional profiling in physiology and ecology.

    Science.gov (United States)

    Frost, Paul C; Song, Keunyea; Wagner, Nicole D

    2014-11-01

    The nutritional history of an organism is often difficult to ascertain. Nonetheless, this information on past diet can be particularly important when explaining the role of nutrition in physiological responses and ecological dynamics. One approach to infer the past dietary history of an individual is through characterization of its nutritional phenotype, an interrelated set of molecular and physiological properties that are sensitive to dietary stress. Comparisons of nutritional phenotypes between a study organism and reference phenotypes have the potential to provide insight into the type and intensity of past dietary constraints. Here, we describe this process of nutritional profiling for ecophysiological research in which a suite of molecular and physiological responses are cataloged for animals experiencing known types and intensities of dietary stress and are quantitatively compared with those of unknown individuals. We supplement this delineation of the process of nutritional profiling with a first-order analysis of its sensitivity to the number of response variables in the reference database, their responsiveness to diet, and the size of reference populations. In doing so, we demonstrate the considerable promise this approach has to transform future studies of nutrition by its ability to provide more and better information on responses to dietary stress in animals and their populations. © The Author 2014. Published by Oxford University Press on behalf of the Society for Integrative and Comparative Biology. All rights reserved. For permissions please email: journals.permissions@oup.com.

  18. Normalizing Social Networking in a Beginners' Japanese Course

    Science.gov (United States)

    Morofushi, Mari; Pasfield-Neofitou, Sarah Ellen

    2014-01-01

    With the spread of the Internet, students now have greater opportunities to use Japanese outside of the classroom. For example, they can interact with other Japanese speakers through instant messaging or social networking, or utilize online dictionaries and translation tools to decipher websites in ways that would be impossible with traditional…

  19. Early numeracy performance of South African school beginners

    Directory of Open Access Journals (Sweden)

    Pirjo Aunio

    2016-12-01

    Full Text Available Early numeracy skills are highly relevant for children’s mathematics learning at school, especially in the initial years when much mathematics learning relies on early numeracy competence. The aim of this study was to investigate the level of early numeracy skills in a sample of South African children in the first months of formal schooling. In this cross- sectional study, there were 443 first graders (206 girls and 237 boys from Gauteng Province schools. The mean age of the children was 81.61 months (6 years 10 months (SD 5.40 months. Their early numeracy skills were measured with the ThinkMath Scale. The main finding of this study was that there were statistically significant differences in early numeracy skills between the children when they started first grade. The differences were related to the home language of the first graders in the English medium schools, as well as the type of school (public vs. private. This article concludes that the numeracy competence of the children from the sample was notably varied in the beginning of their formal schooling, which has implications for teaching in the vastly different classroom populations that are all served by one national curriculum.

  20. A finite element primer for beginners the basics

    CERN Document Server

    Zohdi, Tarek I

    2014-01-01

    The purpose of this primer is to provide the basics of the Finite Element Method, primarily illustrated through a classical model problem, linearized elasticity. The topics covered are:(1) Weighted residual methods and Galerkin approximations,(2) A model problem for one-dimensional?linear elastostatics,(3) Weak formulations in one dimension,(4) Minimum principles in one dimension,(5) Error estimation in one dimension,(5) Construction of Finite Element basis functions in one dimension,(6) Gaussian Quadrature,(7) Iterative solvers and element by element data structures,(8) A model problem for th

  1. Audio engineering 101 a beginner's guide to music production

    CERN Document Server

    Dittmar, Tim

    2013-01-01

    Audio Engineering 101 is a real world guide for starting out in the recording industry. If you have the dream, the ideas, the music and the creativity but don't know where to start, then this book is for you!Filled with practical advice on how to navigate the recording world, from an author with first-hand, real-life experience, Audio Engineering 101 will help you succeed in the exciting, but tough and confusing, music industry. Covering all you need to know about the recording process, from the characteristics of sound to a guide to microphones to analog versus digital

  2. Smart Cards 101: Everything a Beginner Needs To Get Started.

    Science.gov (United States)

    Wiens, Janet

    2001-01-01

    Discusses how to implement a smart card system at a college or university, and explains what smart cards are, their potential applications, benefits, and costs. Provides a resource for obtaining additional information about smart cards. (GR)

  3. Google SketchUp for Game Design Beginner's Guide

    CERN Document Server

    de Jongh, Robin

    2011-01-01

    The book takes a clear, step-by-step approach to building a complete game level using SketchUp with many props and textures. This book is designed for anyone who wants to create entire 3D worlds in freely available game engines such as Unity 3D, CryEngine, Ogre, Panda3D, Unreal Engine, and Blender Game Engine. It also targets all those who wish to create new levels and assets to sell in game asset stores or use in visualization or animation.

  4. Modern cryptography and elliptic curves a beginner's guide

    CERN Document Server

    Shemanske, Thomas R

    2017-01-01

    This book offers the beginning undergraduate student some of the vista of modern mathematics by developing and presenting the tools needed to gain an understanding of the arithmetic of elliptic curves over finite fields and their applications to modern cryptography. This gradual introduction also makes a significant effort to teach students how to produce or discover a proof by presenting mathematics as an exploration, and at the same time, it provides the necessary mathematical underpinnings to investigate the practical and implementation side of elliptic curve cryptography (ECC). Elements of abstract algebra, number theory, and affine and projective geometry are introduced and developed, and their interplay is exploited. Algebra and geometry combine to characterize congruent numbers via rational points on the unit circle, and group law for the set of points on an elliptic curve arises from geometric intuition provided by Bézout's theorem as well as the construction of projective space. The structure of the...

  5. Microstructure characterization via stereological relations — A shortcut for beginners

    Energy Technology Data Exchange (ETDEWEB)

    Pabst, Willi, E-mail: pabstw@vscht.cz; Gregorová, Eva; Uhlířová, Tereza

    2015-07-15

    Stereological relations that can be routinely applied for the quantitative characterization of microstructures of heterogeneous single- and two-phase materials via global microstructural descriptors are reviewed. It is shown that in the case of dense, single-phase polycrystalline materials (e.g., transparent yttrium aluminum garnet ceramics) two quantities have to be determined, the interface density (or, equivalently, the mean chord length of the grains) and the mean curvature integral density (or, equivalently, the Jeffries grain size), while for two-phase materials (e.g., highly porous, cellular alumina ceramics), one additional quantity, the volume fraction (porosity), is required. The Delesse–Rosiwal law is recalled and size measures are discussed. It is shown that the Jeffries grain size is based on the triple junction line length density, while the mean chord length of grains is based on the interface density (grain boundary area density). In contrast to widespread belief, however, these two size measures are not alternative, but independent (and thus complementary), measures of grain size. Concomitant with this fact, a clear distinction between linear and planar grain size numbers is proposed. Finally, based on our concept of phase-specific quantities, it is shown that under certain conditions it is possible to define a Jeffries size also for two-phase materials and that the ratio of the mean chord length and the Jeffries size has to be considered as an invariant number for a certain type of microstructure, i.e., a characteristic value that is independent of the absolute size of the microstructural features (e.g., grains, inclusions or pores). - Highlights: • Stereology-based image analysis is reviewed, including error considerations. • Recipes are provided for measuring global metric microstructural descriptors. • Size measures are based on interface density and mean curvature integral density. • Phase-specific quantities and a generalized Jeffries size are introduced. • Linear and planar grain size numbers are clearly distinguished and explained.

  6. A beginner's guide to ethnographic observation in nursing research.

    Science.gov (United States)

    Conroy, Tiffany

    2017-03-22

    Background Observation is mentioned in most ethnographic textbooks, but specific details about how it should be conducted and the practicalities to be considered in ethnographic nursing research are not always explicit. This paper explores the experiences of and challenges faced by a novice nurse researcher who used observation to collect data. Aim To provide a novice researcher's perspective of observation in ethnographic nursing research and to highlight the associated challenges. Discussion Challenges that arose in observation began with determining which perspective to take, followed by rehearsing observation, developing and maintaining a constructive relationship with the observation site, being aware of the influence of the observer, managing interactions between the observed and the observer, and responding to ethical issues. Conclusion Novice nurse researchers considering using observation to collect data should be aware of the potential challenges they might encounter. Implications for practice The information presented in this paper will enable novice researchers to anticipate these issues and develop strategies to prevent or address them.

  7. A Practical Beginner's Guide to Cyclic Voltammetry

    Science.gov (United States)

    Elgrishi, Noémie; Rountree, Kelley J.; McCarthy, Brian D.; Rountree, Eric S.; Eisenhart, Thomas T.; Dempsey, Jillian L.

    2018-01-01

    Despite the growing popularity of cyclic voltammetry, many students do not receive formalized training in this technique as part of their coursework. Confronted with self-instruction, students can be left wondering where to start. Here, a short introduction to cyclic voltammetry is provided to help the reader with data acquisition and…

  8. A beginner's guide to the modern theory of polarization

    International Nuclear Information System (INIS)

    Spaldin, Nicola A.

    2012-01-01

    The so-called Modern Theory of Polarization, which rigorously defines the spontaneous polarization of a periodic solid and provides a route for its computation in electronic structure codes through the Berry phase, is introduced in a simple qualitative discussion. - Graphical abstract: Cartoon of Wannier functions in a covalent solid shifting to contribute to the ferroelectric polarization.

  9. Bingo for Beginners: A Game Strategy for Facilitating Active Learning.

    Science.gov (United States)

    Coco, Angela; Woodward, Ian; Shaw, Kirstyn; Cody, Alex; Lupton, Gillian; Peake, Andrew

    2001-01-01

    Describes a bingo game that focuses on sociology of the body in which students answer questions with either a yes or no as opposed to the traditional way the game is played. Explains how to construct the game and addresses practical strategies to use after the game. (CMK)

  10. Successful qualitative research: A practical guide for beginners

    OpenAIRE

    Clarke, V.; Braun, V.

    2013-01-01

    For Chapter 1: This chapter introduces qualitative research to a reader new to the area, and sets the scene for the rest of the book. It clearly specifies what defines qualitative research, and differentiates the use of a whole qualitative paradigm, or Big Q approach, with the more limited use of qualitative data within a more positivist paradigm. It contextualises qualitative research – within psychology – by providing a brief history of the approach, and by locating it within the learning-c...

  11. PrestaShop 1.5 beginner's guide

    CERN Document Server

    Caro, Jose Antonio Tizon

    2013-01-01

    This book is written in a friendly voice with lots of tips, tricks, and screenshots to help you set up, extend, and personalize your own online shop. If you want to start your own e-commerce business, then this book will help you do that.This book is for people who are interested in creating an online shop. Basic HTML and CSS skills would be beneficial but are not required as we will provide you with all the code and know-how you need.

  12. jQuery 2.0 animation techniques beginner's guide

    CERN Document Server

    Culpepper, Adam

    2013-01-01

    This book is a guide to help you create attractive web page animations using jQuery. Written in a friendly and engaging approach this book is designed to be placed alongside your computer as a mentor.If you are a web designer or a frontend developer or if you want to learn how to animate the user interface of your web applications with jQuery, this book is for you. Experience with jQuery or Javascript would be helpful but solid knowledge base of HTML and CSS is assumed.

  13. Albert Einstein for beginners. 12. enl. and rev. ed.

    International Nuclear Information System (INIS)

    Karamanolis, Stratis

    2008-01-01

    He was called the most important jew since the birth of Christus. Others however believed however he has came like no other nearer to the gods. Thought is Albrt Einstein, the scientific work of him and especially his relativity theory has the world changed radically both in scientific and in political regard. The present 12th extended and strongly revised edition of the book, which came out firstly above 20 years ago and until today thousands of readers - young and old - has always enthused, describes not only the relativity theory but also the role, which Einstein played in the development of the first atomic bomb. A short biographical part mediates to the reader also something about the man Einstein

  14. Pentaho 5.0 reporting by example beginner's guide

    CERN Document Server

    Mattío, Mariano García

    2013-01-01

    This is a Cookbook with easy-to-follow recipes, containing practical and detailed examples which are all fully backed up with code, illustrations, and tips to dig deep into Backbone.js.This book is great for JavaScript developers who want to learn how to build advanced frontend applications with the Backbone.js framework. This book can be used in educational institutions to teach students how to build frontend applications in an MVC manner.It's assumed that you have some experience in jQuery, and are familiar with HTML.

  15. Microsoft SQL Server 2014 Business Intelligence development beginner's guide

    CERN Document Server

    Rad, Reza

    2014-01-01

    Written in an easy-to-follow, example-driven format, there are plenty of step-by-step instructions to help get you started! The book has a friendly approach, with the opportunity to learn by experimenting.If you are a BI and Data Warehouse developer new to Microsoft Business Intelligence, and looking to get a good understanding of the different components of Microsoft SQL Server for Business Intelligence, this book is for you.It's assumed that you will have some experience in databases systems and T-SQL. This book is will give you a good upshot view of each component and scenarios featuring th

  16. ESL for Hotel/Hospitality Industry. Level: Beginner.

    Science.gov (United States)

    Western Suffolk County Board of Cooperative Educational Services, Northport, NY.

    This document contains eight lesson plans for a beginning course in work-related English for non-English or limited-English speaking entry-level employees in the hotel and hospitality industry. Course objectives include the following: helping participants understand and use job-specific vocabulary; receive and understand job-related instructions;…

  17. What Germany’s University Beginners Think about Water Reuse

    Directory of Open Access Journals (Sweden)

    Sarah Schmid

    2018-06-01

    Full Text Available Water reuse is a new technology, not yet implemented, but discussed for use in Germany. Public opinion plays a major role in the success of the introduction of this new technology and was not yet analyzed for Germany. When monitoring 340 university beginners’ conceptions regarding water reuse, a variety of conceptions appeared. While usage of tap water is accepted for drinking purposes, acceptance of recycled water for oral consumption was low. When asked for reasons for (not using recycled water, three groups of respondents were extracted: (a The acceptors (convinced of quality, or naming sustainability as a reason; (b the undecided (doubts about quality, rejection of its use for consumption, and psychological conflicts of logic and disgust; (c the non-acceptors (unconvinced of quality and preference for bottled water. When asked about factors that would lead to accepting the use of recycled water, insights into treatment processes were identified as the most convincing, followed by educational films and guided tours. Participants showed high conviction about currently existing tap-water qualities. Having water that is cleaned before it reaches the consumer was reported to have high priority. To increase acceptance of water reuse, recommendations for appropriate outreach programs are discussed.

  18. First French reader a beginner's dual-language book

    CERN Document Server

    Appelbaum, Stanley

    2008-01-01

    This excellent anthology offers the beginning French-language student a first taste of some of the world's most significant prose. Chosen for both their eloquence and ease of reading, excerpts from such masterpieces as Les Misérables, The Red and the Black, Madame Bovary, Carmen, and The Three Musketeers will open new worlds for linguists. Readers will savor the words of fifty great writers of multiple genres from the seventeenth through twentieth centuries, including Voltaire, Rousseau, Balzac, Baudelaire, Dumas, Proust, and other literary virtuosos.Lucid and accessible, the unabridged Englis

  19. Some Applications of Fourier's Great Discovery for Beginners

    Science.gov (United States)

    Kraftmakher, Yaakov

    2012-01-01

    Nearly two centuries ago, Fourier discovered that any periodic function of period T can be presented as a sum of sine waveforms of frequencies equal to an integer times the fundamental frequency [omega] = 2[pi]/T (Fourier's series). It is impossible to overestimate the importance of Fourier's discovery, and all physics or engineering students…

  20. Some applications of Fourier's great discovery for beginners

    International Nuclear Information System (INIS)

    Kraftmakher, Yaakov

    2012-01-01

    Nearly two centuries ago, Fourier discovered that any periodic function of period T can be presented as a sum of sine waveforms of frequencies equal to an integer times the fundamental frequency ω = 2π/T (Fourier's series). It is impossible to overestimate the importance of Fourier's discovery, and all physics or engineering students should be familiar with this subject. A suitable device for demonstrating spectra of electrical signals is a digital storage oscilloscope. Spectra of various waveforms and of AM and FM signals are demonstrated, as well as AM signals from a broadcasting station. Changes in the signals filtered by frequency-selective circuits are seen by comparing the spectra of the input and output voltages. All the experiments are suitable for undergraduate laboratories and usable as classroom demonstrations. (paper)

  1. Introduction to nanoparticles, nanocomposites, nanomaterials an introduction for beginners

    CERN Document Server

    Vollath, Dieter

    2013-01-01

    Meeting the demand for a readily understandable introduction to nanomaterials and nanotechnology, this textbook specifically addresses the needs of students - and engineers - who need to get the gist of nanoscale phenomena in materials without having to delve too deeply into the physical and chemical details. The book begins with an overview of the consequences of small particle size, such as the growing importance of surface effects, and covers successful, field-tested synthesis techniques of nanomaterials. The largest part of the book is devoted to the particular magnetic, optical, electrical and mechanical properties of materials at the nanoscale, leading on to emerging and already commercialized applications, such as nanofluids in magnetic resonance imaging, high-performance nanocomposites and carbon nanotube-based electronics. Based on the author's experience in teaching nanomaterials courses and adapted, in style and level, for students with only limited background knowledge, the textbook includes fur...

  2. WS-BPEL 2.0 beginner's guide

    CERN Document Server

    Juric, Matjaz B

    2014-01-01

    If you are a software architect, a designer, a software developer, an SOA and BPM architect, a project manager, or a business process analyst who is responsible for the design and development of business processes, composite applications, and BPM/SOA solutions, then this book is for you. You should have a clear grasp of general SOA concepts including business processes and web services, but no prior knowledge of the BPEL language is required.

  3. A Beginner's Guide to BASIC Programming, Part 2.

    Science.gov (United States)

    Hughes, Elizabeth

    1982-01-01

    Discusses a number of important structures which can be used in programming with BASIC, including loops, subroutines, and arrays. To illustrate these structures, a simple grade-averaging program is presented and explained. Commands introduced in Part 1 of the guide are listed in a table. (JL)

  4. Getting Started with Microcomputers--A Practical Beginner's Guide.

    Science.gov (United States)

    Davies, Norman F.

    1985-01-01

    Discusses the results of a questionnaire sent to experts in the field of computer assisted language learning. Covers such topics as: 1) points to consider before buying a microcomputer; 2) recommended brands and peripheral equipment; 3) software; 4) utilizing programming languages; and 5) literature and contact organizations. (SED)

  5. Kissed awake. From timbered house to a KfW efficiency house monument; Wachgekuesst. Vom Fachwerkhaus zum KfW-Effizienzhaus Denkmal

    Energy Technology Data Exchange (ETDEWEB)

    Siegele, Klaus

    2013-02-15

    More than twenty years after acquisition of a courtyard area from the 18th century the owners decided to retrofit the building comprehensively and gently. This building is under preservation order. An interior thermal insulation using wood fibre boards with wall heating and clay plaster, framed windows as well as a new pellet-fuelled heating system halved the heat requirement and enhanced the indoor comfort in the gorgeous timbered house.

  6. User and reference manual for the KfK code INS

    International Nuclear Information System (INIS)

    Daum, E.

    1993-09-01

    The INS code (Intense Neutron Source) serves to calculate uncollided neutron flux contours, neutron flux volumes and spatial-dependent neutron flux spectra in the test cell of an intense neutron source, of the t-H 2 O or d-Li concept. With the information of the neutron flux spectra the neutron irradiation damage like displacements per atom (DPA), H- and He-production rates and the generation of foreign elements by transmutations can be calculated for any element at any position in the test cell. This manual gives an introduction into the theory of neutron flux calculation of thick targets and neutron irradiation damage calculations. It is explained how the code is working and the handling of the input and output parameters. For each application of the several code modules an example is given. The results like contours, spectra, flux volumes and damage rates are summarized in tabular form and graphically. Damage and element transmutation data have been calculated for 23 isotopes and compared with the DEMO 1st wall values. (orig./HP) [de

  7. Nuclear fusion project. Annual report of the Association KfK/EURATOM

    International Nuclear Information System (INIS)

    Kast, G.

    1990-09-01

    Report on the technology program for NET: Plasma facing components, magnets, tritium fuel cycle, basic blanket, remote handling and maintenance, safety and environment, solid breeder and liquid metal test blankets, mechanical properties of pre- and post-irradiation of 1.4914 steel (MANET). ECRH power sources, NET study contracts. (HP)

  8. Nuclear Fusion Project. Semi-annual report of the Association KfK/EURATOM

    International Nuclear Information System (INIS)

    Kast, G.

    1988-10-01

    Report on technology tasks: Blanket designs studies; Computational tools for neutronics; Corrosion and fatigue of structural materials in Pb-17Li; Tritium extraction from liquid Pb-17Li by the use of solid getters; Development of ceramic breeder materials; The large coil task; Development of high field composite conductors; Superconducting poloidal field coil development; Poloidal field coil for TORE SUPRA as NET-Prototype Coil; Structural materials Fatigue characterization at 4 K; Low electrical conductivity structures development; MANET 1; Pre- and post-irradiation fatigue properties and fracture toughness of 1.4914 martensitic steel; In-pile creep-fatigue testing of type 316 and 1.4914 steels; Ceramics for first-wall protection and for RF windows; Development of low activation ferritic-martensitic steels; Design study of plasma facing components and shield; Procedures and tools for structural design evaluation; Theory and tools for evaluation of magnetic field effects on liquid-metal breeder blankets; Studies of pebble beds of ceramic compounds; Background studies on remote maintenance; Handling equipment for in-vessel components; Safety aspects of the cryosystem and superconducting magnets; Overall plant accident scenarios and safety guidelines for NET; Generic environmental impact assessment for a fusion facility; Industrial development of large components for plasma exhaust pumping; Optimization of cryogenic vacuum pumping of helium; Plasma exhaust purification by means of cryosorption on molecular-sieves or alternative absorbents and use of hot-metal getters; Adsorption of DT on heated metal beds other than uranium; Catalyst development for the exhaust purification process; Development of ECRH power sources. NET study contracts: Availability of the LCT plant; Investigation of the vacuum and exhaust performation of NET; Study about the NET TF pancake test; Evaluation of crack growth delay in multilayer sheets. (orig./AH)

  9. Light ion beam experiments with pinch reflex diodes on KfK's pulse generator KALIF

    International Nuclear Information System (INIS)

    Bluhm, H.; Buth, L.; Bohnel, K.; Harke, W.; Hoppe, P.; Karow, H.U.; Rusch, D.; Schulken, H.; Singer, J.

    1985-01-01

    The authors report on intense LI beam experiments currently performed with pinch reflex ion diodes on 2 ohms/1.4 TW-pulse generator KALIF (Karlsruhe Light Ion Facility). The goals of this work are the generation of highly focussed LI beams of well-defined ion composition, and the undertaking of beam-target experiments. The experimental studies with axial 6 cm phi-pinch reflex proton diodes have been aiming at the focussing characteristics of the diode, and at the ion species composition of the beam. Experiments have been performed using different diode geometries (anode/cathode/beam window foil shapes), and different anode return current paths, respectively. A variety of diagnostique techniques have been used in these studies: Electron pinch phenomena in the diode are observed by static and by gated X-ray cameras. Beam diagnostiques is based on measuring in the vacuum feed the electric parameters of the diode (electron and ion currents, diode voltage) on probing the ion composition and ion energy in the beam (by use of a Thomson Parabola spectrometer), and on the investigation of the beam focus (by use of different techniques: shadow box analysis, α-pin hole imaging, nuclear activation methods). Measurements of beam stopping power of ion beam-heated thin targets are underway using a streaked ion energy-spectrometer. The results obtained so far in these experimental efforts are presented

  10. KfK, Institute for Radiochemistry. Report on the results of research and development performances 1989

    International Nuclear Information System (INIS)

    1990-03-01

    In 1989 the Institute for Radiochemistry became involved with research and development tasks in the context of the following projects: 'Reprocessing and Waste Treatment' (PWA), 'Fast Breeder' (PSB), 'Nuclear Fusion' (PKF) and 'Terminal Storage' (ELA). Environmental analysis and water technology within the Institute were amongst the programmes collected together in the project 'Environment and Safety'. Problems to do with surface chemistry and analysis were dealt with under 'Microtechnology'. Within the 'Reprocessing and Waste Treatment Project', the studies carried out in the Institute concentrated chiefly on investigating ways of simplifying the reprocessing process, especially in the reprocessing of fast-breeder fuels and waste reduction and treatment. In the 'Fast Breeder' project, further investigations were carried out on oxide fuel rods. In the 'Nuclear Fusion' project, the subject of investigation was chemical problems in the field of tritium technology as they arise during the recovery of tritium from tritium compounds in the internal or external fuel cycle of a fusion reactor. To this end, studies were carried out on the physical-chemical analysis of ceramic breeder materials. Research were carried out on the analysis and description of surfaces and on the reactions occurring on these surfaces and on the reactions occurring on these surfaces with regard to the application of knowledge gained from this programme to problems within environmental research, nuclear technology and microtechnology. The Water Chemistry Department working mainly on 'Environment and Safety' carried out chemical research and method development in the following subject areas: New technologies for the removal of problem constituents from water, the production of useable water and sewage recycling and the analysis and description of water pollutants. (orig./HK) [de

  11. KfK Institute for Radiochemistry. Progress report on research and development activities in 1990

    International Nuclear Information System (INIS)

    1991-03-01

    The activities undertaken by the Institue of Radiochemistry (IRCH) in 1990 under the following projects are presented: (1) Pollutant control in the environment (water and soil, systems analysis and environmental engineering; (2) nuclear fusion (blanket development, tritium technology); (3) radioactive waste management (basic works on reprocessing technologies, waste products, and ultimate storage facilities); (4) microtechnology (chemical microsensor development, and (5) other research projects (institute-related non-sponsored research). In the annex the publications by the IRCH staff are listed. (BBR) [de

  12. Nuclear fusion project. Semi-annual report of the Association KfK/Euratom

    International Nuclear Information System (INIS)

    Kast, G.

    1989-11-01

    Report on the technology program for NET: Plasma facing components, magnets, tritium fuel cycle, basic blanket, remote handling and maintenance, safety and environment, solid breeder and liquid metal test blankets, mechanical properties of pre- and post-irradiation of 1.4914 steel (MANET), ECRH power sources, NET study contracts. (HP)

  13. Progress report on research and development in 1991, Institute of Reactor Development, KfK

    International Nuclear Information System (INIS)

    1992-03-01

    Progress report on research and development in 1991 Institute of Reactor Development. The papers on nuclear fusion concentrate on the design and material selection for highly stressed components as well as on safety matters. Experiments with the thermomechanical behaviour of different material samples continued, with selected materials being put to a load of up to 10 000 cycles. Carbon fiber reinforced composite materials proved to be very stable as regards their form, and unproblematic from a thermomechanical viewpoint, even at high cycle numbers. The papers on handling techniques refer to specific requirements of nuclear fusion with applications at JET and NET, to the development of system solutions to be used in the classical industrial area, and to standardization accompanying the developments. The system for physical simulation of working scenes was refined and extended by models for the prototype of a testing device to be handled in the torus of a fusion machine. Control of the articulated boom has been further improved. Under the nuclear safety research project, studies have been made of the dynamic behaviour of fast reactors under incident conditions, of the possible propagation of local cooling incidents in the reactor core as well as of core monitoring. The further development of physical models and computer programs on the dynamic behaviour of fast sodium-cooled reactors has been supported by experimental results. (orig./DG) [de

  14. KfK, Institute for Reactor Development. Results of research and development activities in 1990

    International Nuclear Information System (INIS)

    1991-03-01

    R and D activities at IRE (Institut fuer Reaktorentwicklung-Institute for Reactor Development) are dedicated to power engineering and handling processes in the framework of the point-of-main-effort projects 'nuclear fusion', 'solid-state and materials research', 'handling', 'nuclear safety' and 'miscellaneous research'. Nuclear fusion contributions deal with special vacuum system design problems, heavy-duty design and materials selection and safety aspects. Specimens from 30 different carbon-based materials were subjected to comparative tests in a plasma spraying plant. In the framework of solid-state and materials research activities a viscoplastic model for mechanical component analysis was investigated for its compatibility with elementary physical laws under complex loads. The handling project was dedicated to the specific requirements of nuclear fusion with regard to JET and NET uses, the development of system solutions for flexible industrial techniques, and to standardization. A study on the control system of a work station for NET remote handling tasks was completed. In the framework of the nuclear safety project one currently investigates the dynamics of fast reactors under failure conditions, the possible propagation of local cooling failures in the reactor core, and core monitoring problems. (orig./GL) [de

  15. Annual report 1985 of the KfK Central Safety Department

    International Nuclear Information System (INIS)

    Kiefer, H.; Koelzer, W.; Koenig, L.A.

    1986-04-01

    The Central Safety Department is responsible for handling all problems of radiation protection, safety and security of the institutes and departments of the Karlsruhe Nuclear Research Center, for waste water activity measurements and environmental monitoring of the whole area of the Center, and for research and development work mainly focusing on nuclear safety and radiation protection measures. The r+d work concentrates on the following aspects: physical and chemical behavior of biologically particularly active radionuclides, behavior of HT in the air/plant/soil system, biophysics of multicellular systems, improvement in radiation protection measurement and personnel dosimetry. This report gives details of the different duties, indicates the results of 1985 routine tasks and reports about results of investigations and developments of the working groups of the Department. The reader is referred to the English translation of the Table of Contents and of Chapter 1 describing the duties and organization of the Central Safety Department. (orig./HP) [de

  16. KfK Institute for Radiochemistry. Progress report on research and development activities in 1991

    International Nuclear Information System (INIS)

    1992-03-01

    The activities undertaken by the Institute of Radiochemistry (IRCH) in 1991 under the following projects are presented: (1) Pollutant control in the environment (water and soil, systems analysis and environmental engineering; (2) nuclear fusion (blanket development, tritium technology); (3) radioactive waste management (basic works on reprocessing technologies, waste products, and ultimate storage facilities); (4) microtechnology (chemical microsensor development, and (5) other research projects (institute-related non-sponsored research). In the annex the publications by the IRCH staff are listed. (orig.) [de

  17. KfK Institute for Hot Atom Chemistry. Results report on research and development activities 1989

    International Nuclear Information System (INIS)

    1990-03-01

    The Institute for Hot Atom Chemistry is concerned with R and D tasks in nuclear fuel reprocessing. The aim is to optimize reprocessing technology with a view to safety and economic efficiency. Work is carried out within the framework of the projects reprocessing and waste management, and fast breeder in contact with WAK. The Institute increasingly carries out work within the framework of the project pollution abatement in the environment; the emphasis lies on dioxin chemistry. After the Wackersdorf task, subjects of waste management, in particular special wastes, have been added. (orig.) [de

  18. Nuclear fusion project. Annual report of the Association KfK/EURATOM. October 1992 - September 1993

    International Nuclear Information System (INIS)

    Kast, G.

    1993-12-01

    The central areas of work are: 1) Structural materials, plasma forming components, plasma engineering; 2) superconducting magnets; 3) vacuum systems; 4) basic blanket; 5) remote handling and maintenance; 6) safety and environment; 7) material development, mechanical properties of pre- and post-irradiation of MANET (steel 1.4914); 8) solid breeder and liquid metal test blankets; 9) ECRH power sources; 10) TRT-1=tritium supply and management; 11) study contracts for ITER/NET. (HP)

  19. KfK, Institute for Reactor Components. Results of research and development activities in 1989

    International Nuclear Information System (INIS)

    1990-03-01

    R and D activities at IRB (Institut fuer Reaktorbauelemente - Institute for Reactor Components) are dedicated to thermodynamics and fluid dynamics. Emphasis is on the design of nuclear reactor and fusion reactor components. Environmental engineering was added recently. Most activities are applications-oriented. Fundamental investigations focus on energy research and energy technology. The activities are carried out in the framework of different projects (PKF/nuclear fusion, PSF/nuclear safety, PSU/pollution control). Points of main effort are the development of basic liquid-metal-cooled blanket solutions, investigations on natural convection in reactor tanks, and the cooling properties of future containments for pressurized water reactors in the case of nuclear fusion accidents. (orig./GL) [de

  20. Nuclear Fusion Project. Annual report of the Association KfK/EURATOM

    International Nuclear Information System (INIS)

    Kast, G.

    1991-10-01

    Report on the technology program for NET: Plasma facing components magnets, tritium fuel cycle, basic blanket, remote handling and maintenance, safety and environment, solid breeder and liquid metal test blankets, mechanical properties of pre- and post-irradiation of 1.4914 steel (MANET). ECRH power sources, NET study contracts. (orig.)

  1. Antimicrobial activities of the Streptomyces ceolicolor strain AOB KF977550 isolated from a tropical estuary

    Directory of Open Access Journals (Sweden)

    Bamidele T. Odumosu

    2017-11-01

    Full Text Available The aim of this study was to screen for important antibiotic producing species of the genus Streptomyces from a tropical estuary. Five bacterial strains were isolated from the Lagos lagoon and identified by 16S rDNA gene sequencing as Streptomyces albogriseolus, S. aureus, S. coelicolor, S. albus, and S. pseudogriseolus. Ethyl acetate extracts of Streptomyces spp. fermented broths were evaluated against laboratory strains of MRSA Methicillin-resistant Staphyloccus aureus (MRSA 144 m, Bacillus coagulans UL001, and Escherichia coli as well as the standard strains Klebsiella pneumonia ATCC 8308, Gardnerella vaginalis ATCC 27853 and Salmonella typhi ATCC 13311 using the well diffusion method. The presence of secondary metabolites was determined and analysed using gas chromatography-mass spectrometry (GC-MS. A broad spectrum of activity was only observed for S. coelicolor on all of the tested bacteria except S. typhi, ant GC-MS analysis revealed the presence of 16 secondary metabolites with relevant antibiotic properties. The result of this study suggest that Lagos Lagoon is a potential source and reservoir of novel antibiotics. Keywords: Streptomyces, Antibiotics, Resistance, Secondary Metabolites

  2. Momentum distribution near k = 3kF in the Tomonaga-Luttinger model

    International Nuclear Information System (INIS)

    Solyom, J.; Penc, K.

    1992-01-01

    In this paper a survey is presented of recent experimental and analytical work carried out under a joint program at the Harwell Laboratory and Imperial College, placing the new work into the context of earlier developments. The basic balance equations for annular flow are introduced and the well-known triangular relationship reiterated. Then, interfacial waves and interfacial friction are reviewed, including some new results in both areas. A key feature in annular flow is the prediction of deposition and entrainment and recent developments are described. The various studies have led to a new framework for predictions of annular flow systems and the application of this framework to adiabatic flows, evaporating flows, steady-state dryout and transient dryout is described. Finally, new models covering the full range of dryout (CHF) ranging from subcooled conditions to high quality conditions are described; here dryout is limited by either film dryout (in annular flow) or by bubble wall crowding (at low quality ) and the new modelling structure allows a natural transition between the two

  3. KfK Laboratory for Isotope Technology. Progress report on research and development activities in 1990

    International Nuclear Information System (INIS)

    1991-03-01

    The R and D work done by the laboratory for isotope technology (LIT) in 1990 under the project of pollutant control in the environment, concentrated on thermal waste treatment processes, above all on the classical refuse incineration, for which closed-circuit pollutant balances were established, and process engineering studies were made aimed at reducing pollutants in waste gas. The central research facility of the LIT is the semi-technical pilot plant TAMARA (test plant for refuse incineration, waste gas purification, residue recycling, waste water treatment) with a throughput of 200 kg/hour of refuse. It was put into operation in 1986. The annex lists the publications by the LIT staff. (BBR) [de

  4. A probabilistic parametrization for geological uncertainty estimation using the ensemble Kalman filter (EnKF)

    NARCIS (Netherlands)

    Sebacher, B.; Hanea, R.G.; Heemink, A.

    2013-01-01

    In the past years, many applications of historymatching methods in general and ensemble Kalman filter in particular have been proposed, especially in order to estimate fields that provide uncertainty in the stochastic process defined by the dynamical system of hydrocarbon recovery. Such fields can

  5. Using SPSS syntax: a beginner's guide Jacqueline Collier Using SPSS syntax: a beginner's guide Sage Pages: 216 £24.99 9781412922180 1412922186 [Formula: see text].

    Science.gov (United States)

    2011-01-21

    As someone who is comfortable with analysing data in SAS using coding language, it is perplexing that I run from the use of syntax in SPSS. But, my apprehension has subsided with the Collier's guide. Syntax command can automate processes, increase reproducibility and give the user broader access to features otherwise unavailable in SPSS.

  6. Spectacular energy technology: Panorama-Sauna Holzweiler. KfW funds indoor swimming pools as 'process heat'; Energetisch spektakulaer: Panorama-Sauna Holzweiler. KfW foerdert Schwimmbaeder als 'Prozesswaerme'

    Energy Technology Data Exchange (ETDEWEB)

    Meissner, Rolf

    2008-11-15

    The ''Panorama-Sauna'' at Grafschaft is a big indoor swimming pool and Sauna centre in a rural region not far from Cologne and Koblenz. The charm of this spectacular solar project is in its minimalism. Conventional solar thermal power systems, in contrast, tend to be complex and prone to failure. (orig.)

  7. Satellite lithium-ion battery remaining useful life estimation with an iterative updated RVM fused with the KF algorithm

    Institute of Scientific and Technical Information of China (English)

    Yuchen SONG; Datong LIU; Yandong HOU; Jinxiang YU; Yu PENG

    2018-01-01

    Lithium-ion batteries have become the third-generation space batteries and are widely utilized in a series of spacecraft. Remaining Useful Life (RUL) estimation is essential to a spacecraft as the battery is a critical part and determines the lifetime and reliability. The Relevance Vector Machine (RVM) is a data-driven algorithm used to estimate a battery's RUL due to its sparse fea-ture and uncertainty management capability. Especially, some of the regressive cases indicate that the RVM can obtain a better short-term prediction performance rather than long-term prediction. As a nonlinear kernel learning algorithm, the coefficient matrix and relevance vectors are fixed once the RVM training is conducted. Moreover, the RVM can be simply influenced by the noise with the training data. Thus, this work proposes an iterative updated approach to improve the long-term prediction performance for a battery's RUL prediction. Firstly, when a new estimator is output by the RVM, the Kalman filter is applied to optimize this estimator with a physical degradation model. Then, this optimized estimator is added into the training set as an on-line sample, the RVM model is re-trained, and the coefficient matrix and relevance vectors can be dynamically adjusted to make next iterative prediction. Experimental results with a commercial battery test data set and a satellite battery data set both indicate that the proposed method can achieve a better per-formance for RUL estimation.

  8. Summarizing annual report 1989, on R and D work performed by the KfK Institute for Microstructural Engineering, IMT

    International Nuclear Information System (INIS)

    1990-03-01

    The main activities of the institute in the year under review continued the work with the separation nozzle method for U-235 enrichment, the testing of separation nozzle elements and the related methods for UF 6 production, and the design and testing of components for separation systems. In another working area, activities centered on microstructural techniques, as e.g. the production of masking blanks or structural masks for the deep-etch synchrotron radiation lithography, on the development of synchrotron radiation sources, or the design of irradiation facilities or wet chemical processes for microstructural techniques. The latter include molding of metals or plastics, surface etching and thin-film deposition. Experiments were carried out for microstructural process development, and product control and analyses for the purpose of quality assurance of microstructures. (HK) [de

  9. Progress report on research and development in 1991, Institute of Neutron Physics and Reactor Engineering, KfK

    International Nuclear Information System (INIS)

    1992-03-01

    Progress report on research and development in 1991 Institute of Neutron Physics and Reactor Engineering. The Institute of Neutron Physics and Reactor Engineering is concerned with research work in the field of nuclear engineering related to the safety of fast and thermal reactors as well as with specific problems of fusion reactor technology. Under the project of nuclear safety research, the Institute works on concepts designed to drastically improve reactor safety. Apart from that, methods to estimate and minimize the radiological consequences of reactor accidents are developed. Under the fusion technology project, the Institute deals with neutron physics and technological questions of the breeding blanket. Basic research covers technico-physical questions of the interaction between light ion radiation of a high energy density and matter. In addition and to a small extent, questions of employing hydrogen in the transport area are studied. For all these tasks it is indispensable to use up-to-date data processing methods and equipment, from the highest capacity computer to the integrated minicomputer system. (orig./DG) [de

  10. KfK Institute of Nuclear Solid State Physics. Progress report on research and development activities in 1991

    International Nuclear Information System (INIS)

    1992-03-01

    The INFP is primarily occupied with basic research work in the field of solid state physics and materials science, with preference being given to subjects and problems of interest from the point of view of potential applications. This is particularly true for research work devoted to the high-temperature superconductors, which currently are the area of main effort of the Institute, but also for work performed in the fields of interface and microstructure research. In 1991, about 80% of the activities were superconductivity research. (orig./MM) [de

  11. KfK, Institute for Nuclear Solid-State Physics. Report of results on research and development work 1985

    International Nuclear Information System (INIS)

    1986-02-01

    The Institute for Nuclear Solid-State Physics pursues at time mainly basis-oriented work in the fields of superconductivity and the boundary-surface and microstructure research. The experimental and theoretical works aim to a better understanding of the microscopical and macroscopical properties of certain solids. At time superconductors with high transition point, highly correlated electron systems, conducting polymers, and amorphous substances are studied especially intensively. Technologically relevant materials have in the comparative case preference. Beside the experimental methods of nuclear solid-state physics (neutron scattering, Moessbauer spectroscopy, ion-implantation technology, irradiation and analysis with fast ions) the institute disposes of further highly specificated techniques, like electron-energy-loss-spectroscopy, special material preparation, X-ray diffractometry, and two UHV facilities for the study of the first surface respectively near-surface regions with thermal helium atoms as well as with fast ions. (orig./HSI) [de

  12. Change in muzzle velocity due to freezing and water immersion of .22, long rifle, K.F. cartridges.

    Science.gov (United States)

    Jauhari, M; Chatterjee, S M; Ghosh, P K

    1975-01-01

    A study of change in muzzle velocity due to freezing and water immersion of .22, long rifle, K. F. cartridges has been presented. A statistical criterion has been formulated to ascertain whether or not a cartridge undergoes a change in muzzle velocity due to a particular treatment. The muzzle velocity data of .22, long rifle, K. F. cartridges, obtained by an electronic timer before and after the various treatments, have been analyzed in the light of this criterion. These cartridges have generally been found to suffer considerable loss in muzzle velocity when immersed in water for three weeks and also when immersed in water for three days and simultaneously cooled to 0 degrees C. The forensic significance of this loss in muzzle velocity has been discussed.

  13. Results of 1989/90 research and development activities at KfK Institute for Reactor Components

    International Nuclear Information System (INIS)

    1991-03-01

    R and D activities at IRB (Institut fuer Reaktorbauelemente - Institute for Reactor Components) are dedicated to thermodynamics and fluid dynamics. Emphasis is on the design of nuclear reactor and fusion reactor components. Environmental engineering was added recently. Most activities are applications-oriented. Fundamental investigations focus on energy research and energy technology. The activities are carried out in the framework of different projects (PKF/nuclear fusion, PSF/nuclear safety, PSU/pollution control). Points of main effort are the development of basic liquid-metal-cooled blanket solutions, investigations on natural convection in reactor ranks, and the cooling properties of future containments for pressurized water reactors in the case of nuclear fusion accidents. (orig./GL) [de

  14. KfK Institute of Nuclear Solid State Physics. Progress report on research and development activities in 1990

    International Nuclear Information System (INIS)

    1991-03-01

    The INFP is primarily occupied with basic research work in the field of solid state physics and materials science, with preference being given to subjects and problems of interest from the point of view of potential applications. This is particularly true for research work devoted to the high-temperature superconductors, which currently are the area of main effort of the Institute, but also for work performed in the fields of interface and microstructure research, polymer physics, or studies on amorphous and glassy materials. In 1990, about 70% of the activities were superconductivity research. Basic research investigated the lattice dynamics and electronic structure of HT superconductors by means of inelastic neutron scattering, or electron energy loss spectroscopy and tunnel spectroscopy. Application-oriented work concentrated on the development of HTSC-films required for equipment in microwave engineering, microelectronics, and sensor engineering. (orig./MM) [de

  15. KfK Laboratory for Aerosol Physics and Filter Technology. Progress report and development activities in 1990

    International Nuclear Information System (INIS)

    1991-03-01

    The activities undertaken by the laboratory for aerosol physics and filter technology (LAF) in 1990 under the following projects are described: (1) nuclear safety research (safety and material problems of fast breeders, IWR-oriented safety research); (2) pollutant control in the environment (communal waste management, emission-reducing processes, climate research - pollutants' behaviour in the atmosphere), and (3) radioactive waste management (basic work on reprocessing technologies). The annex lists the publications by the LAF staff. (BBR) [de

  16. Satellite lithium-ion battery remaining useful life estimation with an iterative updated RVM fused with the KF algorithm

    Directory of Open Access Journals (Sweden)

    Yuchen SONG

    2018-01-01

    Full Text Available Lithium-ion batteries have become the third-generation space batteries and are widely utilized in a series of spacecraft. Remaining Useful Life (RUL estimation is essential to a spacecraft as the battery is a critical part and determines the lifetime and reliability. The Relevance Vector Machine (RVM is a data-driven algorithm used to estimate a battery’s RUL due to its sparse feature and uncertainty management capability. Especially, some of the regressive cases indicate that the RVM can obtain a better short-term prediction performance rather than long-term prediction. As a nonlinear kernel learning algorithm, the coefficient matrix and relevance vectors are fixed once the RVM training is conducted. Moreover, the RVM can be simply influenced by the noise with the training data. Thus, this work proposes an iterative updated approach to improve the long-term prediction performance for a battery’s RUL prediction. Firstly, when a new estimator is output by the RVM, the Kalman filter is applied to optimize this estimator with a physical degradation model. Then, this optimized estimator is added into the training set as an on-line sample, the RVM model is re-trained, and the coefficient matrix and relevance vectors can be dynamically adjusted to make next iterative prediction. Experimental results with a commercial battery test data set and a satellite battery data set both indicate that the proposed method can achieve a better performance for RUL estimation.

  17. Status report on the waste management cooperation programme jointly undertaken by KfK/INE-NUCLEBRAS/CDTN

    International Nuclear Information System (INIS)

    Teh Whei Miaw, S.; Krause, H.

    1988-04-01

    The prime objective of the first phase of the programme was to develop processes for the treatment of the wastes arising at CDTN and to qualify waste forms for final disposal. Chemical precipitation and evaporation have been selected as the main processes for the treatment of low-level liquid wastes. Operating conditions for flocculation have been specified in laboratory-scale experiments. The plant has already been operated successfully. The evaporator nears completion. Two pilot plants for cementation have been erected and investigated, one with an in-drum mixer, the other with an in-tank mixer. Laboratory experiments on cementation have provided the basis for solidification of first batches of waste concentrates. Laboratory experiments on bituminization have started recently. A small-scale bitumen extruder will be put into operation soon. There have also been activities on the development, improvement and test of drums, containers and shielding casks for radioactive wastes. (orig./HP) [de

  18. KF-loaded mesoporous Mg-Fe bi-metal oxides: high performance transesterification catalysts for biodiesel production.

    Science.gov (United States)

    Tao, Guiju; Hua, Zile; Gao, Zhe; Zhu, Yan; Zhu, Yan; Chen, Yu; Shu, Zhu; Zhang, Lingxia; Shi, Jianlin

    2013-09-21

    Using newly developed mesoporous Mg-Fe bi-metal oxides as supports, a novel kind of high performance transesterification catalysts for biodiesel production has been synthesized. More importantly, the impregnation solvent was for the first time found to substantially affect the structures and catalytic performances of the resultant transesterification catalysts.

  19. "We Are All Beginners": Amazigh in Language Policy and Educational Practice in Morocco

    Science.gov (United States)

    El Aissati, Abderrahman; Karsmakers, Suzanne; Kurvers, Jeanne

    2011-01-01

    In 2003, the Amazigh (Berber) language and the Tifinagh script were, for the first time in history, introduced as a subject for all students in public primary schools in Morocco. This study first investigates the language planning policy behind the introduction of the new Amazigh curriculum: selection, codification, standardization, curriculum…

  20. Transcranial Direct Current Stimulation (tDCS: A Beginner's Guide for Design and Implementation

    Directory of Open Access Journals (Sweden)

    Hayley Thair

    2017-11-01

    Full Text Available Transcranial direct current stimulation (tDCS is a popular brain stimulation method that is used to modulate cortical excitability, producing facilitatory or inhibitory effects upon a variety of behaviors. There is, however, a current lack of consensus between studies, with many results suggesting that polarity-specific effects are difficult to obtain. This article explores some of these differences and highlights the experimental parameters that may underlie their occurrence. We provide a general, practical snapshot of tDCS methodology, including what it is used for, how to use it, and considerations for designing an effective and safe experiment. Our aim is to equip researchers who are new to tDCS with the essential knowledge so that they can make informed and well-rounded decisions when designing and running successful experiments. By summarizing the varied approaches, stimulation parameters, and outcomes, this article should help inform future tDCS research in a variety of fields.

  1. Transcranial Direct Current Stimulation (tDCS): A Beginner's Guide for Design and Implementation

    Science.gov (United States)

    Thair, Hayley; Holloway, Amy L.; Newport, Roger; Smith, Alastair D.

    2017-01-01

    Transcranial direct current stimulation (tDCS) is a popular brain stimulation method that is used to modulate cortical excitability, producing facilitatory or inhibitory effects upon a variety of behaviors. There is, however, a current lack of consensus between studies, with many results suggesting that polarity-specific effects are difficult to obtain. This article explores some of these differences and highlights the experimental parameters that may underlie their occurrence. We provide a general, practical snapshot of tDCS methodology, including what it is used for, how to use it, and considerations for designing an effective and safe experiment. Our aim is to equip researchers who are new to tDCS with the essential knowledge so that they can make informed and well-rounded decisions when designing and running successful experiments. By summarizing the varied approaches, stimulation parameters, and outcomes, this article should help inform future tDCS research in a variety of fields. PMID:29213226

  2. SNS for Learners at Beginner Level: An Alternative Use of FB

    Science.gov (United States)

    Carpi, Tiziana

    2014-01-01

    Despite that previous studies have shown that the implementation of Social Network Sites (SNSs) into the classroom may bring several learning benefits, the focus has been mainly restricted to learners at intermediate language level with a focus on use of SNSs for fostering communicative competence or as class management. This project, implemented…

  3. Die Energiebranche am Beginn der digitalen Transformation: aus Versorgern werden Utilities 4.0

    Science.gov (United States)

    Doleski, Oliver D.

    Die traditionelle Energieversorgung befindet sich in einer Zäsur. Das seit Jahrzehnten bewährte und stabile Geschäftsmodell einer zuverlässig planbaren, zentralen Energieerzeugung mit anschließender unidirektionaler Verteilung geriet spätestens seit der Energiewende des Jahres 2011 immer mehr unter Druck. Angesichts fortschreitender Digitalisierung und Dezentralisierung einerseits und gestiegener Erwartungshaltung der Kunden gegenüber "ihrem" Versorger andererseits sieht sich die Energiebranche heute einem epochalen Transformationsprozess gegenübergestellt. Bei diesem entwickeln sich aus den monopolistischen Versorgern des 19. und 20. Jahrhunderts (Utility 1.0), über die liberalisierten Energieversorgungsunternehmen (Utility 2.0) und Energiedienstleistungsunternehmen (Utility 3.0) heutiger Prägung, die digitalen Energiedienstleistungsunternehmen (Utility 4.0) von morgen. Oliver D. Doleski beschränkt sich in seinem Beitrag nicht auf die reine Beschreibung dieses Veränderungsprozesses an sich. Vielmehr werden darüber hinaus sowohl die mit dieser Entwicklung verbundenen übergeordneten Ziele als auch die wesentlichen Anforderungen an erfolgreiche Utilities 4.0 skizziert. Das Kapitel endet mit einem prägnanten Überblick profitabler Betätigungsfelder, die zur Sicherung der ökonomischen Zukunft von Energiekonzernen, Regionalversorgern und Stadtwerken beitragen können.

  4. Reflecting on the Japan-Chile Task-Based Telecollaboration Project for Beginner-Level Learners

    Science.gov (United States)

    Dunne, B. Greg

    2014-01-01

    Using O'Dowd and Ritter's (2006) Inventory of Reasons for Failed Communication in Telecollaborative Projects as a barometer, this article details the considerations and procedures followed in a task-based, asynchronous email telecollaboration project between EFL (English as a Foreign Language) learners in Japan and Chile. In a climate where…

  5. Constructing a "Fast Protocol" for Middle School Beginner Violin Classes in Japan

    Science.gov (United States)

    Akutsu, Taichi

    2018-01-01

    This study aimed to investigate the process of constructing a "fast-protocol" for violin instruction. Since learning string instruments has not been common, and because there are limited hours for music in Japanese schools, the author, a violinist, collaborated with the general music teacher at a middle school in the Tokyo metropolitan…

  6. Language and Culture Pedagogy for Motivating Chinese Learning Beginners in the Danish context

    DEFF Research Database (Denmark)

    Du, Xiangyun; Bao, Rui; Egekvist, Ulla Egidiussen

    Paper presented at International conference: From the specific patterns of Chinese language to its teaching, 12-13 January 2012......Paper presented at International conference: From the specific patterns of Chinese language to its teaching, 12-13 January 2012...

  7. Deconvolutions based on singular value decomposition and the pseudoinverse: a guide for beginners.

    Science.gov (United States)

    Hendler, R W; Shrager, R I

    1994-01-01

    Singular value decomposition (SVD) is deeply rooted in the theory of linear algebra, and because of this is not readily understood by a large group of researchers who could profit from its application. In this paper, we discuss the subject on a level that should be understandable to scientists who are not well versed in linear algebra. However, because it is necessary that certain key concepts in linear algebra be appreciated in order to comprehend what is accomplished by SVD, we present the section, 'Bare basics of linear algebra'. This is followed by a discussion of the theory of SVD. Next we present step-by-step examples to illustrate how SVD is applied to deconvolute a titration involving a mixture of three pH indicators. One noiseless case is presented as well as two cases where either a fixed or varying noise level is present. Finally, we discuss additional deconvolutions of mixed spectra based on the use of the pseudoinverse.

  8. Learning through Teaching: Exploring What Conservatoire Students Learn from Teaching Beginner Older Adults

    Science.gov (United States)

    Perkins, Rosie; Aufegger, Lisa; Williamon, Aaron

    2015-01-01

    Music is increasingly recognised as important in facilitating healthy ageing, yet little is known of what musicians themselves learn when they teach older adults. This article reports the practices of the "Rhythm for Life" project at the Royal College of Music in the UK, in which conservatoire students taught 10-week programmes of group…

  9. Leaf morphology, taxonomy and geometric morphometrics: a simplified protocol for beginners.

    Directory of Open Access Journals (Sweden)

    Vincenzo Viscosi

    Full Text Available Taxonomy relies greatly on morphology to discriminate groups. Computerized geometric morphometric methods for quantitative shape analysis measure, test and visualize differences in form in a highly effective, reproducible, accurate and statistically powerful way. Plant leaves are commonly used in taxonomic analyses and are particularly suitable to landmark based geometric morphometrics. However, botanists do not yet seem to have taken advantage of this set of methods in their studies as much as zoologists have done. Using free software and an example dataset from two geographical populations of sessile oak leaves, we describe in detailed but simple terms how to: a compute size and shape variables using Procrustes methods; b test measurement error and the main levels of variation (population and trees using a hierachical design; c estimate the accuracy of group discrimination; d repeat this estimate after controlling for the effect of size differences on shape (i.e., allometry. Measurement error was completely negligible; individual variation in leaf morphology was large and differences between trees were generally bigger than within trees; differences between the two geographic populations were small in both size and shape; despite a weak allometric trend, controlling for the effect of size on shape slighly increased discrimination accuracy. Procrustes based methods for the analysis of landmarks were highly efficient in measuring the hierarchical structure of differences in leaves and in revealing very small-scale variation. In taxonomy and many other fields of botany and biology, the application of geometric morphometrics contributes to increase scientific rigour in the description of important aspects of the phenotypic dimension of biodiversity. Easy to follow but detailed step by step example studies can promote a more extensive use of these numerical methods, as they provide an introduction to the discipline which, for many biologists, is less intimidating than the often inaccessible specialistic literature.

  10. The NKS-NORCMAS guide to beginners in IP-MS

    Energy Technology Data Exchange (ETDEWEB)

    Ross, P. [Risoe National Lab. (Denmark); Appelblad, P. [Swedish Defence Research Agency, FOI (Sweden); Kipperud, L.; Sjoegren, A. [Norwegian Univ. of Life Sciences (Norway)

    2006-04-15

    This text is meant as a guide for those who wishes to approach the field of ICP mass spectrometry for one purpose or another. In principle any mass spectrometer consists of three parts: An ion source, a mass analyser and a detector. These three parts will be treated separately in the text before focusing on the specific issues concerning ultra trace measurements and isotope ratios of radioisotopes. The text includes some general considerations with practical tips which are useful to the novel user when doing sample analysis with ICP-MS. It also includes a short training course consisting of five exercises. (au)

  11. PAVING THE WAY: CONDITIONS OF INCLUSION OF THE EDUCATORS BEGINNERS IN NORTHERN MEXICO

    Directory of Open Access Journals (Sweden)

    Evangelina Cervantes H

    2013-09-01

    Full Text Available In the present paper the authors analyzes the knowledge process and labor conditions in the teaching work of the graduates students of the Bachelor of education offered by the Universidad Autónoma de Ciudad Juárez. Through the qualitative method the authors provide testimonies of the novels teachers in theirs first work. The search offer a perspective of the trajectories of this teachers in the basic educational system in Juarez city, Chih., observed laboral precarious conditions of teachers careers in university preparation, in effect, exist incidence the discords elements in their certification, qualification and development in relation with the graduates students of Escuelas Normales.

  12. Get It Right First Time: A Beginner's Guide to Document Management.

    Science.gov (United States)

    Hayes, Mike

    1997-01-01

    Document management (DM) systems capture, store, index, retrieve, route, distribute, and archive information in organizations. Discusses "passive" electronic libraries and "active" systems; characteristics of effective systems; implementing a system; fitting a new system to an existing infrastructure; budgets; system…

  13. The NKS-NORCMAS guide to beginners in IP-MS

    International Nuclear Information System (INIS)

    Ross, P.; Appelblad, P.; Skipperud, L.; Sjoegren, A.

    2006-04-01

    This text is meant as a guide for those who wishes to approach the field of ICP mass spectrometry for one purpose or another. In principle any mass spectrometer consists of three parts: An ion source, a mass analyser and a detector. These three parts will be treated separately in the text before focusing on the specific issues concerning ultra trace measurements and isotope ratios of radioisotopes. The text includes some general considerations with practical tips which are useful to the novel user when doing sample analysis with ICP-MS. It also includes a short training course consisting of five exercises. (au)

  14. What Do Beginner Biology Teacher Candidates Know of Genetics and Genes?

    Science.gov (United States)

    Oztas, Fulya; Oztas, Haydar

    2016-01-01

    Misconceptions are a barrier to understanding biology hence, to promote meaningful learning, it is necessary to overcome these difficulties with the help of different instructional methods rather than traditional instructional methods. Therefore it could be very interesting to find out "how students' prior knowledge of genetics affects…

  15. From Special Relativity to Feynman Diagrams A Course of Theoretical Particle Physics for Beginners

    CERN Document Server

    D'Auria, Riccardo

    2012-01-01

    This books aims at filling a gap between the basics courses of classical and quantum mechanics and advanced courses of (relativistic) quantum mechanics and field theory. Particular emphasis is given to the role of symmetry in modern theoretical physics. For this reason this book is particularly suited to those students who are interested in a deeper knowledge of modern developments in elementary particle physics and relativity, even if they choose not to specialize in this branch of research. This target of readers includes, besides experimental and applied physicists, also those engineers who need advanced notions of theoretical high energy physics, in view of future research activity in the field theory approach to condensed matter, in accelerator physics and in all those modern technology sectors which require a more advanced and sophisticated theoretical physics background. Courses motivated by these objectives are present in several polytechnic institutes around the world. The last chapters of this book,...

  16. Leder und Pelz am Ende des Mittelalters und zu Beginn der Neuzeit

    DEFF Research Database (Denmark)

    Atzbach, Rainer

    In the center of the former imperial town Kempten thousands of everyday objects had been discovered. The thesis analyzes the leather and fur finds, which had been concealed between the late 15th and the late 16th century in blind floors and between the walls of a group of late medieval citizen...

  17. A Computer Environment for Beginners' Learning of Sorting Algorithms: Design and Pilot Evaluation

    Science.gov (United States)

    Kordaki, M.; Miatidis, M.; Kapsampelis, G.

    2008-01-01

    This paper presents the design, features and pilot evaluation study of a web-based environment--the SORTING environment--for the learning of sorting algorithms by secondary level education students. The design of this environment is based on modeling methodology, taking into account modern constructivist and social theories of learning while at…

  18. [Arduous working conditions for beginners: when workplace prevention becomes an economic risk].

    Science.gov (United States)

    Latil, François

    2015-01-01

    The French law of 20.01.2014 recently instituted an arduous working conditions allowance. This innovated legislation is designed to improve the status of workers subject to arduous working conditions either by allowing lighter work schedules or job reclassification or early retirement. The impact of arduous working conditions on health has been clearly established, but no consensual solution has yet been proposed. Life expectancy without disability can differ by as much as 9 years between higher executives and manual workers, but the proposed solutions comprise a multitude of perverse effects. Workers may benefit from maintaining their arduous working conditions in order to preserve their right to early retirement. Companies do not necessarily have the desire or the resources to invest in prevention, which is the only consensually accepted effective measure, if they are also required to finance both training and retirement. In particular, management of the arduous working conditions allowance is very complex and entirely financed by companies. Consequently, company productivity can be impacted, leading to transfers of company headquarters, outsourcing to interim workers, replacement of jobs by automation. Unemployment could be the big winner of this conflict. Politically, arduous working conditions allowance appears to be very difficult to put into practice and can be considered to be more a promise by the government to the left and to the trade unions.

  19. The path to VICTORy - a beginner's guide to success using commercial research antibodies.

    Science.gov (United States)

    Goodman, Simon L

    2018-05-15

    Commercial research antibodies are crucial tools in modern cell biology and biochemistry. In the USA some $2 billion a year are spent on them, but many are apparently not fit-for-purpose, and this may contribute to the 'reproducibility crisis' in biological sciences. Inadequate antibody validation and characterization, lack of user awareness, and occasional incompetence amongst suppliers have had immense scientific and personal costs. In this Opinion, I suggest some paths to make the use of these vital tools more successful. I have attempted to summarize and extend expert views from the literature to suggest that sustained routine efforts should made in: (1) the validation of antibodies, (2) their identification, (3) communication and controls, (4) the training of potential users, (5) the transparency of original equipment manufacturer (OEM) marketing agreements, and (5) in a more widespread use of recombinant antibodies (together denoted the 'VICTOR' approach). © 2018. Published by The Company of Biologists Ltd.

  20. Employment and First Year Experience of Beginner Primary School Teachers at Private Educational Institutions

    Directory of Open Access Journals (Sweden)

    Turgay ÖNTAŞ

    2016-10-01

    Full Text Available In this study to demonstrate primary school teachers' employment process and their first year teaching in private educational organizations is aimed. The major employer of primary school teachers is public schools that are funded by state. There will be a gap between grade inflation and employment rate when all of the teacher candidates claim to be appointed to public schools. Hence private educational organizations provide alternative career opportunities for teacher candidates. Qualitative methods will be used in this study to display real evidence from the eyes of teachers and also principals. The data have been obtained through documents and interview techniques. After the data have been collected, descriptive analysis has been used. The findings of the study were given within the frame of themes and codes which were determined based on the problem statement. The first theme, career was presented in the context of choosing sector, recruitment and selecting process, professional development, leave the profession. The second theme, factors affecting first years' success was explained in the context of teaching factors, consistency and skills focus. The third theme was presented in a category of pressure, workload, complaining psychological and physical exhaustion, flexible working conditions.

  1. Employment and First Year Experience of Beginner Primary School Teachers at Private Educational Institutions

    OpenAIRE

    Turgay ÖNTAŞ

    2016-01-01

    In this study to demonstrate primary school teachers' employment process and their first year teaching in private educational organizations is aimed. The major employer of primary school teachers is public schools that are funded by state. There will be a gap between grade inflation and employment rate when all of the teacher candidates claim to be appointed to public schools. Hence private educational organizations provide alternative career opportunities for teacher candidates. Qualitative ...

  2. iPhone and iPad apps for absolute beginners

    CERN Document Server

    Lewis, Rory

    2013-01-01

    So how do you build an application for the iPhone and iPad? Don't you need to spend years learning complicated programming languages? What about Objective-C and Cocoa touch? The answer is that you don't need to know any of those things! Anybody can start building simple apps for the iPhone and iPad, and this book will show you how. This update of an Apress bestseller walks you through creating your first app, using plain English and practical examples using the iOS 6 software development platform and more. It cuts through the fog of jargon and misinformation that surrounds iPhone and iPad app

  3. Observational learning :Tell beginners what they are about to watch and they will learn better

    Directory of Open Access Journals (Sweden)

    Mathieu eAndrieux

    2016-01-01

    Full Text Available Observation aids motor skill learning. When multiple models or different levels of performance are observed, does learning improve when the observer is informed of the performance quality prior to each observation trial or after each trial? We used a knockdown barrier task and asked participants to learn a new relative timing pattern that differed from that naturally emerging from the task constraints (Blandin, Lhuisset, & Proteau, 1999. Following a physical execution pre-test, the participants observed two models demonstrating different levels of performance and were either informed of this performance prior to or after each observation trial. The results of the physical execution retention tests of the two experiments reported in the present study indicated that informing the observers of the demonstration quality they were about to see aided learning more than when this information was provided after each observation trial. Our results suggest that providing advanced information concerning the quality of the observation may help participants detect errors in the model’s performance, which is something that novice participants have difficulty doing, and then learn from these observations.

  4. Beginners Remember Orthography when They Learn to Read Words: The Case of Doubled Letters

    Science.gov (United States)

    Wright, Donna-Marie; Ehri, Linnea C.

    2007-01-01

    Sight word learning and memory were studied to clarify how early during development readers process visual letter patterns that are not dictated by phonology, and whether their word learning is influenced by the legality of letter patterns. Forty kindergartners and first graders were taught to read 12 words containing either single consonants…

  5. Cacti beginner's guide leverage Cacti to design a robust network operations center

    CERN Document Server

    Urban, Thomas

    2017-01-01

    The book is designed in such a way that you can explore it chapter-by-chapter or skip any chapter without missing a beat. If you are a network operator and want to use Cacti for implementing performance measurement for trending, troubleshooting, and reporting purposes, then this book is for you. You only need to know the basics of network ...

  6. Clean Up Your Image: A Beginner's Guide to Scanning and Photoshop

    Science.gov (United States)

    Stitzer, Michael S.

    2005-01-01

    In this article, the author addresses the key steps of scanning and illustrates the process with screen shots taken from a Macintosh G4 Powerbook computer running OSX and Adobe Photoshop 7.0. After reviewing scanning procedures, the author describes how to use Photoshop 7.0 to manipulate a scanned image. This activity gives students a good general…

  7. A kinematic and metabolic analysis of the first Lu of Tai Chi in experts and beginners.

    Science.gov (United States)

    Zorzi, Elena; Nardello, Francesca; Fracasso, Enrico; Franchi, Sara; Clauti, Anna; Cesari, Paola; Zamparo, Paola

    2015-10-01

    The aim of this study was to compare movement kinematics, cocontraction times, and metabolic data in expert and nonexpert Tai Chi practitioners. Significant differences were observed for all kinematic parameters: experts moved smoothly (lower jerk) and with a lower frequency. No differences in metabolic and electromyography data were observed but for the breathing pattern (experts breathed slowly and deeply). Movement frequency and breathing pattern are thus the main features that distinguish expert and nonexpert practitioners.

  8. Plagiarism for beginners: how do we communicate academic honesty with students?

    OpenAIRE

    Pejić Bach, Mirjana; Stojanovski, Jadranka

    2017-01-01

    Abstract. Plagiarism can be considered one of the most important topics related to scientific work. Previous research has indicated that plagiarism occurs more often in countries with the lower level of scientific output measured in number of papers cited in top journals. These countries at the same time have in most of the cases longer tradition of scientific research [1]. Plagiarism, like any other fraud, can be fought in three manners [2]. First, educational actions can be implemented in o...

  9. Lesekurse fuer Anfaenger-Fachbereich Psychologie (Reading Courses for Beginners-Psychology)

    Science.gov (United States)

    Armaleo-Popper, Lore

    1976-01-01

    Describes a German course for psychologists, given in Italy by the author, using eight original texts by Freud and Mitscherlich. These were assigned for 40-50 hours' continuation reading at home, or were discussed in the 100-120 hours in the classroom. (Text is in German.) (IFS/WGA)

  10. Simply rails 2 the ultimate beginner's guide to Ruby on rails

    CERN Document Server

    Lenz, Patrick

    2008-01-01

    Want to learn all about Ruby on Rails 2.0, the web application framework that is inspiring developers around the world? The second edition of this practical, hands on book will: show you how to install Ruby on Rails on Windows, Mac, or Linux walk you, step by step, through the development of a Web 2.0 social news application, just like digg.com show you how to test, debug, benchmark, and deploy your Rails application Unlike other Rails books, this book doesn't assume that you are an experienced web developer, or that you've used Ruby before. An entire chapter is devoted to learning Ruby in a fun way, using the interactive Ruby console, so you can follow along at home. You'll be an accomplished Ruby programmer in no time! The example application that the book builds - a user-generated news web site - is built upon with each following chapter, and concepts such as sessions, cookies and basic AJAX usage are gradually introduced. Different aspects of Rails, such as user authentication, session cookies, and automa...

  11. The HiggsTools handbook: a beginners guide to decoding the Higgs sector

    Science.gov (United States)

    Boggia, M.; Cruz-Martinez, J. M.; Frellesvig, H.; Glover, N.; Gomez-Ambrosio, R.; Gonella, G.; Haddad, Y.; Ilnicka, A.; Jones, S.; Kassabov, Z.; Krauss, F.; Megy, T.; Melini, D.; Napoletano, D.; Passarino, G.; Patel, S.; Rodriguez-Vazquez, M.; Wolf, T.

    2018-06-01

    This report summarises some of the activities of the HiggsTools initial training network working group in the period 2015–2017. The main goal of this working group was to produce a document discussing various aspects of state-of-the-art Higgs physics at the large hadron collider (LHC) in a pedagogic manner. The first part of the report is devoted to a description of phenomenological searches for new physics (NP) at the LHC. All of the available studies of the couplings of the new resonance discovered in 2012 by the ATLAS and CMS experiments (Aad et al (ATLAS Collaboration) 2012 Phys. Lett. B 716 1–29 Chatrchyan et al (CMS Collaboration) 2012 Phys. Lett. B 716 30–61) conclude that it is compatible with the Higgs boson of the standard model (SM) within present precision. So far the LHC experiments have given no direct evidence for any physical phenomena that cannot be described by the SM. As the experimental measurements become more and more precise, there is a pressing need for a consistent framework in which deviations from the SM predictions can be computed precisely. Such a framework should be applicable to measurements in all sectors of particle physics, not only LHC Higgs measurements but also electroweak precision data, etc. We critically review the use of the κ-framework, fiducial and simplified template cross sections, effective field theories, pseudoobservables and phenomenological Lagrangians. Some of the concepts presented here are well known and were used already at the time of the large electron–positron collider (LEP) experiment. However, after years of theoretical and experimental development, these techniques have been refined, and we describe new tools that have been introduced in order to improve the comparison between theory and experimental data. In the second part of the report, we propose {φ }η * as a new and complementary observable for studying Higgs boson production at large transverse momentum in the case where the Higgs boson decays to two photons. The {φ }η * variable depends on measurements of the angular directions and rapidities of the two Higgs decay products rather than the energies, and exploits the information provided by the calorimeter in the detector. We show that, even without tracking information, the experimental resolution for {φ }η * is better than that of the transverse momentum of the photon pair, particularly at low transverse momentum. We make a detailed study of the phenomenology of the {φ }η * variable, contrasting the behaviour with the Higgs transverse momentum distribution using a variety of theoretical tools including event generators and fixed order perturbative computations. We consider the theoretical uncertainties associated with both {p}{TH} and {φ }η * distributions. Unlike the transverse momentum distribution, the {φ }η * distribution is well predicted using the Higgs effective field theory in which the top quark is integrated out—even at large values of {φ }η * —thereby making this a better observable for extracting the parameters of the Higgs interaction. In contrast, the potential of the {φ }η * distribution as a probe of NP is rather limited, since although the overall rate is affected by the presence of additional heavy fields, the shape of the {φ }η * distribution is relatively insensitive to heavy particle thresholds.

  12. English Orthographic Learning in Chinese-L1 Young EFL Beginners.

    Science.gov (United States)

    Cheng, Yu-Lin

    2017-12-01

    English orthographic learning, among Chinese-L1 children who were beginning to learn English as a foreign language, was documented when: (1) only visual memory was at their disposal, (2) visual memory and either some letter-sound knowledge or some semantic information was available, and (3) visual memory, some letter-sound knowledge and some semantic information were all available. When only visual memory was available, orthographic learning (measured via an orthographic choice test) was meagre. Orthographic learning was significant when either semantic information or letter-sound knowledge supplemented visual memory, with letter-sound knowledge generating greater significance. Although the results suggest that letter-sound knowledge plays a more important role than semantic information, letter-sound knowledge alone does not suffice to achieve perfect orthographic learning, as orthographic learning was greatest when letter-sound knowledge and semantic information were both available. The present findings are congruent with a view that the orthography of a foreign language drives its orthographic learning more than L1 orthographic learning experience, thus extending Share's (Cognition 55:151-218, 1995) self-teaching hypothesis to include non-alphabetic L1 children's orthographic learning of an alphabetic foreign language. The little letter-sound knowledge development observed in the experiment-I control group indicates that very little letter-sound knowledge develops in the absence of dedicated letter-sound training. Given the important role of letter-sound knowledge in English orthographic learning, dedicated letter-sound instruction is highly recommended.

  13. Radiation protection and environmental radioactivity. A voyage to the World Wide Web for beginners

    International Nuclear Information System (INIS)

    Weimer, S.

    1998-01-01

    According to the enormous growth of the Internet service 'World Wide Web' there is also a big growth in the number of web sites in connection with radiation protection. An introduction is given of some practical basis of the WWW. The structure of WWW addresses and navigating through the web with hyperlinks is explained. Further some search engines are presented. The paper lists a number of WWW addresses of interesting sites with radiological protection informations. (orig.) [de

  14. Eesti-Saksamaa diplomaatiliste suhete algusest = der Beginn der Estnisch-Deutschen Diplomatischen Beziehungen / Eero Medijainen

    Index Scriptorium Estoniae

    Medijainen, Eero

    2007-01-01

    Eesti esimene valitud esinduskogu Maapäev hakkas 1917. a. suvel ja sügisel välispoliitilisi küsimusi arutama seoses keiserliku Saksamaa vägede edasiliikumisega. 1919. aasta kevadel pani Eesti juhtivaid sotsiaaldemokraate Mihkel Martna aluse saatkonnale Saksamaal. Eesti esindajate põhimureks oli Eesti ja Saksamaa hea vahekorra säilitamine nii keerulistel Weimari Vabariigi aastatel kui natside võimuloleku päevil. Eesti esinduse taastmise katsetest Teise maailmasõja järel

  15. Transforaminal Percutaneous Endoscopic Discectomy using Transforaminal Endoscopic Spine System technique: Pitfalls that a beginner should avoid.

    Science.gov (United States)

    Kapetanakis, Stylianos; Gkasdaris, Grigorios; Angoules, Antonios G; Givissis, Panagiotis

    2017-12-18

    Transforaminal Percutaneous Endoscopic Discectomy (TPED) is a minimally invasive technique mainly used for the treatment of lumbar disc herniation from a lateral approach. Performed under local anesthesia, TPED has been proven to be a safe and effective technique which has been also associated with shorter rehabilitation period, reduced blood loss, trauma, and scar tissue compared to conventional procedures. However, the procedure should be performed by a spine surgeon experienced in the specific technique and capable of recognizing or avoiding various challenging conditions. In this review, pitfalls that a novice surgeon has to be mindful of, are reported and analyzed.

  16. Graphics and Animation on iOS A Beginner's Guide to Core Graphics and Core Animation

    CERN Document Server

    Nahavandipoor, Vandad

    2011-01-01

    Jazz up your iPhone and iPad apps with some slick graphics and animation-and keep users from looking elsewhere. This short and concise book shows developers with even little Cocoa programming experience how to create impressive graphics and animation effects with relatively easy coding. Learn how to incorporate smooth animations and draw images in your apps to achieve the classy look you want. The recipes in this book include step-by-step instructions and simple code solutions that you can put to work right away. Learn basic concepts for adapting to different screen sizesConstruct, set, and

  17. Learners' Perceptions of Online Elements in a Beginners' Language Blended Course--Implications for CALL Design

    Science.gov (United States)

    Pulker, Hélène; Vialleton, Elodie

    2015-01-01

    Much research has been done on blended learning and the design of tasks most appropriate for online environments and computer-mediated communication. Increasingly, language teachers and Second Language Acquisition (SLA) practitioners recognise the different nature of communications in online settings and in face-to-face settings; teachers do not…

  18. Introduction to Differential Calculus Systematic Studies with Engineering Applications for Beginners

    CERN Document Server

    Rohde, Ulrich L; Poddar, Ajay K; Ghosh, A K

    2011-01-01

    Enables readers to apply the fundamentals of differential calculus to solve real-life problems in engineering and the physical sciences Introduction to Differential Calculus fully engages readers by presenting the fundamental theories and methods of differential calculus and then showcasing how the discussed concepts can be applied to real-world problems in engineering and the physical sciences. With its easy-to-follow style and accessible explanations, the book sets a solid foundation before advancing to specific calculus methods, demonstrating the connections between differential calculus

  19. The Campcraft Book: A Beginner's Guide to Outdoor Living Skills. Revised Edition.

    Science.gov (United States)

    Hammett, Catherine T.

    This handbook contains information designed to help develop campcraft skills. This basic guide to outdoor living contains the following chapters: (1) Come On Out; (2) On the Trail; (3) Your Own Outdoor Equipment; (4) Campcraft Skills; (5) Fire Building and Fireplaces; (6) Outdoor Food; (7) Knotcraft; (8) Lashing; (9) Toolcraft; (10) Finding Your…

  20. Supporting Beginner Teacher Identity Development: External Mentors and the Third Space

    Science.gov (United States)

    McIntyre, Joanna; Hobson, Andrew J.

    2016-01-01

    This paper reports findings from a study of support provided by non-school-based mentors of secondary science teachers in England. It focuses on the identity development of beginning teachers of physics, some of the recipients of the mentoring. Drawing on the analysis of interview and case study data, and utilising third space theory, the authors…

  1. An Exploratory Study of Translanguaging Practices in an Online Beginner-Level Foreign Language Classroom

    Science.gov (United States)

    Adinolfi, Lina; Astruc, Lluïsa

    2017-01-01

    Translanguaging, the movement between communicative modes and features of different languages, is becoming an established research tradition in content-focused second language learning contexts. Pedagogic translanguaging practices nevertheless remain under-applied and under-researched in foreign language instructional settings, whether…

  2. Staatschuld, Verfassung und Revolutionsprävention: Friedrich Buchholz und der Beginn der Sozialwissenschaft

    Directory of Open Access Journals (Sweden)

    Axel Rüdiger

    2011-09-01

    Full Text Available From within the environment of the Prussian reforms at the beginning of the 19th century, FriedrichBuchholz developed the social-scientific concept of Zukunftspolitik, which deals with the constitutionalsafeguard of public credit and the prevention of destructive revolution through targetedpolitical reforms. In contrast to political romanticism (Adam Müller and others, Buchholz orientshimself not toward the English system of representation, but toward the French model, to combinerevolutionary popular sovereignty with representative government. Using the example of Englishpublic debt in the 18th century, he develops the political dialectic of materialist necessity and arbitrarycontingency. Whereas sovereignty without representation in the maintenance of public creditinevitably leads to Jacobin Terror, parliamentarian representation without sovereignty leads to, inthe English model, a general state of war. Europe’s future, according to Buchholz, thus depends onthe reform of English Parliamentarianism.

  3. ESL for Hotel/Hospitality Industry. Level: Advanced Beginner/Intermediate.

    Science.gov (United States)

    Western Suffolk County Board of Cooperative Educational Services, Northport, NY.

    This document contains 16 lesson plans for an advanced beginning and intermediate course in work-related English for non-English- or limited-English-speaking entry-level employees in the hotel and hospitality industry. Course objectives are as follows: helping participants understand and use job-specific vocabulary; receive and understand…

  4. Cartan for beginners differential geometry via moving frames and exterior differential systems

    CERN Document Server

    Ivey, Thomas A

    2016-01-01

    Two central aspects of Cartan's approach to differential geometry are the theory of exterior differential systems (EDS) and the method of moving frames. This book presents thorough and modern treatments of both subjects, including their applications to both classic and contemporary problems in geometry. It begins with the classical differential geometry of surfaces and basic Riemannian geometry in the language of moving frames, along with an elementary introduction to exterior differential systems. Key concepts are developed incrementally, with motivating examples leading to definitions, theorems, and proofs. Once the basics of the methods are established, the authors develop applications and advanced topics. One notable application is to complex algebraic geometry, where they expand and update important results from projective differential geometry. As well, the book features an introduction to G-structures and a treatment of the theory of connections. The techniques of EDS are also applied to obtain explici...

  5. A Beginner’s Guide to Factor Analysis: Focusing on Exploratory Factor Analysis

    Directory of Open Access Journals (Sweden)

    An Gie Yong

    2013-10-01

    Full Text Available The following paper discusses exploratory factor analysis and gives an overview of the statistical technique and how it is used in various research designs and applications. A basic outline of how the technique works and its criteria, including its main assumptions are discussed as well as when it should be used. Mathematical theories are explored to enlighten students on how exploratory factor analysis works, an example of how to run an exploratory factor analysis on SPSS is given, and finally a section on how to write up the results is provided. This will allow readers to develop a better understanding of when to employ factor analysis and how to interpret the tables and graphs in the output.

  6. Adult Beginner Instrumentalists' Practice, Self-Regulation, and Self-Efficacy: A Pilot Study

    Science.gov (United States)

    Ritchie, Laura; Kearney, Phil

    2018-01-01

    The self-regulation of practice behaviour has repeatedly been shown to distinguish between novice and expert performers, however interventions designed to encourage self-regulation by novice musicians have shown limited effectiveness. Guided by successful research in sporting contexts, the present study investigated the behaviours of beginner…

  7. Four Points Beginner Risk Managers Should Learn from Jeff Holman's Mistakes in the Discussion of Antifragile

    OpenAIRE

    Nassim Nicholas Taleb

    2014-01-01

    Using Jeff Holman's comments in Quantitative Finance to illustrate 4 critical errors students should learn to avoid: 1) Mistaking tails (4th moment) for volatility (2nd moment), 2) Missing Jensen's Inequality, 3) Analyzing the hedging wihout the underlying, 4) The necessity of a numeraire in finance.

  8. Introduction to Integral Calculus Systematic Studies with Engineering Applications for Beginners

    CERN Document Server

    Rohde, Ulrich L; Poddar, Ajay K; Ghosh, A K

    2011-01-01

    An accessible introduction to the fundamentals of calculus needed to solve current problems in engineering and the physical sciences I ntegration is an important function of calculus, and Introduction to Integral Calculus combines fundamental concepts with scientific problems to develop intuition and skills for solving mathematical problems related to engineering and the physical sciences. The authors provide a solid introduction to integral calculus and feature applications of integration, solutions of differential equations, and evaluation methods. With logical organization coupled with cle

  9. A Beginner’s Guide to METAPOST for Creating High-quality Graphics

    Science.gov (United States)

    2016-03-31

    structures and flow control , and compilation of the METAPOST source code yields EPS graphics. These features provide an elegant method for generating...decided. Choosing a width of 144 bp and a height of 89 bp, a minimally controlled plot (as in Figure 11) of this data can be generated by draw begingraph...graphics. The graphics are vectorial and thus can be scaled to any resolution without degradation. There are many advanced topics that are not discussed

  10. Swimming at low Reynolds number: a beginners guide to undulatory locomotion

    Science.gov (United States)

    Cohen, Netta; Boyle, Jordan H.

    2010-03-01

    Undulatory locomotion is a means of self-propulsion that relies on the generation and propagation of waves along a body. As a mode of locomotion it is primitive and relatively simple, yet can be remarkably robust. No wonder then, that it is so prevalent across a range of biological scales from motile bacteria to gigantic prehistoric snakes. Key to understanding undulatory locomotion is the body's interplay with the physical environment, which the swimmer or crawler will exploit to generate propulsion, and in some cases, even to generate the underlying undulations. This review focuses by and large on undulators in the low Reynolds number regime, where the physics of the environment can be much more tractable. We review some key concepts and theoretical advances, as well as simulation tools and results applied to selected examples of biological swimmers. In particular, we extend the discussion to some simple cases of locomotion in non-Newtonian media as well as to small animals, in which the nervous system, motor control, body properties and the environment must all be considered to understand how undulations are generated and modulated. To conclude, we review recent progress in microrobotic undulators that may one day become commonplace in applications ranging from toxic waste disposal to minimally invasive surgery.

  11. Teaching Non-Beginner Programmers with App Inventor: Survey Results and Implications

    Science.gov (United States)

    Soares, Andrey; Martin, Nancy L.

    2015-01-01

    This paper reports the results of a survey with 40 students enrolled in an Android Application Development course offered during the spring semester of 2013 and 2014. The course used App Inventor to build the apps and required students to have an introduction to programming course as a prerequisite. The survey asked for demographic information and…

  12. Reflections on Teaching App Inventor for Non-Beginner Programmers: Issues, Challenges and Opportunities

    Science.gov (United States)

    Soares, Andrey

    2014-01-01

    App Inventor has been used successfully to teach introduction to programming course for CS/IS/IT and Non-CS majors. Now, researchers are looking on how to include the tool in the curriculum of more advanced computing courses. This paper presents some Issues, Challenges and Opportunities observed while teaching courses on Mobile Application…

  13. Programming Basics for Beginners. Experience of the Institute of Informatics at Tallinn University of Technology

    Directory of Open Access Journals (Sweden)

    Olga Mironova

    2017-11-01

    Full Text Available The present paper demonstrates the teaching approach in programming basics course for novices: schoolchildren of different ages and schoolteachers. This programming course was developed at the Institute of Informatics at Tallinn University of Technology in Tallinn, Estonia and it based on many years experience in teaching programming for non-IT first year students. The main aim of the chosen teaching approach in the course is to raise the motivation and keep the learners’ interest in programming field on the high level. The idea of developed teaching technique is the implementation of the visual programming before a serious textual coding. Furthermore, authors suggest readers some ways and methods to overcome learners’ difficulties in the first stage in a textual coding.

  14. Qualitative XRD - use of the PDF for beginners and the evolution of the ICDD

    International Nuclear Information System (INIS)

    Hubbard, C.R.

    2002-01-01

    Full text: The Powder Diffraction File (PDF), published by the International Centre for Diffraction Data (ICDD), has traditionally been used for phase identification by x-ray diffraction methods and is widely used in establishing the phases present in reaction, corrosion and decomposition products in fields including mineralogy, materials science, manufacturing and pharmaceuticals. The X-ray diffraction reference patterns of the PDF have been collected and edited by the non profit organization known today as the International Centre for Diffraction Data (ICDD). Recent activities by the ICDD have greatly enhanced the PDF based on collaboration with structural data centers, expanding the pattern producing Grants-in-Aid program, and focussing efforts of task groups of the ICDD Technical Committee. The currently evolving needs of combinatorial scientists, pharmaceutical laboratories, and computational materials science will impact the PDF in coming years. One opportunity is for greater cross-linking of characterization and property databases and the efforts to explore this future will be discussed. This presentation will survey the evolution of the organization and the PDF emphasizing the more recent changes, summarize the contents of the PDF, present highlights of how to use the powder diffraction file for phase identification, and highlight advantages of the forthcoming relational database format for the PDF. Copyright (2002) Australian X-ray Analytical Association Inc

  15. From Surfing to Diving: A Beginner's Guide to Enhancing the Foreign Language Classroom through Templates.

    Science.gov (United States)

    Lally, Carolyn

    1998-01-01

    Provides a background to the development of the Internet; discusses Web sites as foreign-language-learning tools; and describes the Nicenet Internet Classroom Assistant that can be used as a software template for teachers to create their own Internet pages for foreign-language instruction. (Author/LRW)

  16. Easy robot programming for beginners and kids using augmented reality environments

    Science.gov (United States)

    Sakamoto, Kunio; Nishiguchi, Masahiro

    2010-11-01

    The authors have developed the mobile robot which can be programmed by command and instruction cards. All you have to do is to arrange cards on a table and to shot the programming stage by a camera. Our card programming system recognizes instruction cards and translates icon commands into the motor driver program. This card programming environment also provides low-level structure programming.

  17. Can Tasks Be Used to Teach Chinese Culture at the Beginner Level?

    DEFF Research Database (Denmark)

    Ruan, Youjin

    2012-01-01

    In the autumn term of 2011, the Confucius Institute for Learning and Innovation (CI) at Aalborg University (AAU) offered a Chinese course as part of an international program at Gug School. The course introduced Chinese culture and information about modern China as well as limited Chinese language...

  18. A. Kim, k.f. Anderson, j. Berliner, j. Hassan, j. Jensen, h.j. Mertz, h. Pietsch, a. Rao, R. Scherer, and a. Sutterfield.

    Science.gov (United States)

    Kim, A; Anderson, K F; Berliner, J; Hassan, J; Jensen, J; Mertz, H J; Pietsch, H; Rao, A; Scherer, R; Sutterfield, A

    2003-10-01

    In this study, three dummies were evaluated on the component level and as a whole. Their responses were compared with available volunteer and embalmed Post Mortem Human Subject (PMHS) data obtained under similar test conditions to evaluate their biofidelity. The volunteer and PMHS data, used as comparators in this study, were used previously to establish some of the biofidelity requirements of the Hybrid III. The BioRID II, the Hybrid III, and the RID2 were all subjected to rear impact HYGE sled tests with deltaVs of 17 and 28 km/hr to determine their biofidelity in these conditions. A static pull test, where a load was manually applied to the head of each dummy, was used to evaluate the static strength of their necks in flexion and extension. Finally, pendulum tests were conducted with the Hybrid III and RID2 to evaluate the dynamic characteristics of their necks in flexion and extension. The sled test results indicate that out of the three dummies, the overall flexibility of the Hybrid III is comparable to that of the volunteer anticipating the impact. The overall flexibilities of the BioRID II and the RID2 are greater than those of all the comparators used in this study (the tensed volunteer and the two embalmed PMHSs). The responses of the Hybrid III are closer to those of the tensed volunteer than those of the PMHSs. The responses of the BioRID II and the RID2 are closer to those of the PMHSs than to the tensed volunteer.

  19. Effect of Litter Fall on Soil Nutrient Content and pH, and its Consequences in View of Climate Change (Síkf

    OpenAIRE

    TÓTH, János Attila; NAGY, Péter Tamás; KRAKOMPERGER, Zsolt; VERES, Zsuzsa; KOTROCZÓ, Zsolt; KINCSES, Sándorné; FEKETE, István; PAPP, Mária; LAJTHA, Kate

    2011-01-01

    In the DIRT (Detritus Input and Removal Treatment) field experiments established at theSíkfkút Site (North Hungary) in October 2000, an experiment was initiated to study the long-termeffects of litter quality and quantity on pH and nutrient content (organic carbon, N forms, PO43–, K+,Mg2+, Ca2+) of soil in a Quercetum petraeae-cerris forest. An eight-year litter manipulationdemonstrated a close connection between the changes in pH and Mg2+ and Ca2+ concentration. Thedecline of litter producti...

  20. Electrodeposition of uranium metal by reduction of uranium oxides in molten Lif-KF=NaF-CaF 2-UF4

    International Nuclear Information System (INIS)

    Pao, D.S.; Burris, L.; Steunenberg, R.K.; Tomczuk, Z.

    1990-01-01

    Although electrolytic reduction of uranium oxides was shown to be feasible in the early 1960's it is recognized that considerable improvement in the electrolytic reduction technology must be achieved for practical applications. This exploratory work on electrolytic reduction of uranium oxide was undertaken to investigate potential improvements in the technology. The approach taken was to deposit solid uranium metal directly on a solid cathode at temperatures below the melting point of uranium (1132 degrees C). The lower temperature electrolytic reduction process has several advantages over the existing chemical reduction processes. It lessens materials problems and special heating and insulating requirements associated with high-temperature operations. It removes most impurities. It does not produce the large quantities of byproduct oxides wastes typical of chemical reduction processes

  1. Gas-liquid countercurrent integration process for continuous biodiesel production using a microporous solid base KF/CaO as catalyst.

    Science.gov (United States)

    Hu, Shengyang; Wen, Libai; Wang, Yun; Zheng, Xinsheng; Han, Heyou

    2012-11-01

    A continuous-flow integration process was developed for biodiesel production using rapeseed oil as feedstock, based on the countercurrent contact reaction between gas and liquid, separation of glycerol on-line and cyclic utilization of methanol. Orthogonal experimental design and response surface methodology were adopted to optimize technological parameters. A second-order polynomial model for the biodiesel yield was established and validated experimentally. The high determination coefficient (R(2)=98.98%) and the low probability value (Prcontinuous-flow process has good potential in the manufacture of biodiesel. Copyright © 2012 Elsevier Ltd. All rights reserved.

  2. TEACHING THE GRAMMAR OF RUSSIAN LANGUAGE AS FOREIGN IN RUSSIAN TEXTBOOKS FOR BEGINNERS (OPINION OF THE CHINESE TEACHER)

    OpenAIRE

    Zeng, T.

    2017-01-01

    Increased interest towards studying the Russian language in China evokes the interest of Chinese teachers of the Russian language to educational and methodological materials created by their Russian colleagues. First and foremost, Chinese philologists are interested in nationally oriented textbooks. In this article, we discuss the main features of grammar in Russian textbooks aimed at Chinese students who are just beginning to learn Russian. This paper compares nationally oriented textbooks “...

  3. Understanding the Role of Teaching Materials in a Beginners' Level English as a Foreign Language Course: A Case Study

    Science.gov (United States)

    Cruz Rondón, Elio Jesús; Velasco Vera, Leidy Fernanda

    2016-01-01

    Learning a foreign language may be a challenge for most people due to differences in the form and structure between one's mother tongue and a new one. However, there are some tools that facilitate the teaching and learning of a foreign language, for instance, new applications for digital devices, video blogs, educational platforms, and teaching…

  4. A Constructivist Approach to Game-Based Language Learning: Student Perceptions in a Beginner-Level EFL Context

    Science.gov (United States)

    York, James; deHaan, Jonathan William

    2018-01-01

    This article provides information on an action research project in a low-level EFL setting in Japan. The project aims were to (1) foster spoken communication skills and (2) help students engage with their own learning. The project investigated the applicability of board games as a mediating tool for authentic communication as part of a wider TBLT…

  5. MOOCs for Language Learning-Opportunities and Challenges: The Case of the Open University Italian Beginners' MOOCs

    Science.gov (United States)

    Motzo, Anna; Proudfoot, Anna

    2017-01-01

    Massive Open Online Courses (MOOCs) are a fairly recent development in online education. Language MOOCs (LMOOCs) have recently been added to the ever-growing list of open courses offered by various providers, including FutureLearn. For learners, MOOCs offer an innovative and inexpensive alternative to formal and traditional learning. For course…

  6. A beginners guide for video production. [Prepared by the Energy Task Force of the Urban Consortium for Technology Initiatives

    Energy Technology Data Exchange (ETDEWEB)

    1991-11-01

    The Seattle-King County Hazardous Waste Management Plan provides the framework for an intensive effort to keep Household Hazardous Waste (HHW) and Small Quantity Generator (SQG) wastes from entering the municipal solid and liquid waste streams. Many innovative programs for managing small sources of hazardous waste have been developed in response to the Plan. With the assistance of Urban Consortium grants, the City of Seattle has researched and developed a series of reports describing the planning, operation and evaluation of the plan's HHW collection programs. Three of the Plan's programs of particular interest to other jurisdictions are the fixed site and mobile HHW Collection Facilities, and the Business Waste Consultations provided to SQG's. In 1991, Seattle received an Urban Consortium grant to produce two videos showing how the HHW Collection Facilities and Business Consultations programs work. This report provides an overviews of the video development and production process and a discussion of the lessons learned by the staff directing the production.

  7. Developing EFL Learners' Speaking Skills through Dynamic Assessment: A Case of A Beginner and an Advanced Learner

    Science.gov (United States)

    Ebadi, Saman; Asakereh, Ahmad

    2017-01-01

    Dynamic assessment (DA), having its theoretical base in Vygotskyan Sociocultural theory of mind, is a newly developed classroom assessment through which learners are helped to perform beyond their current ability. Drawing upon the theoretical aspect of DA, the present study explored the impact of DA on the development of speaking skills. To this…

  8. Child-Computer Interaction at the Beginner Stage of Music Learning: Effects of Reflexive Interaction on Children's Musical Improvisation.

    Science.gov (United States)

    Addessi, Anna Rita; Anelli, Filomena; Benghi, Diber; Friberg, Anders

    2017-01-01

    In this article children's musical improvisation is investigated through the "reflexive interaction" paradigm. We used a particular system, the MIROR-Impro, implemented in the framework of the MIROR project (EC-FP7), which is able to reply to the child playing a keyboard by a "reflexive" output, mirroring (with repetitions and variations) her/his inputs. The study was conducted in a public primary school, with 47 children, aged 6-7. The experimental design used the convergence procedure, based on three sample groups allowing us to verify if the reflexive interaction using the MIROR-Impro is necessary and/or sufficient to improve the children's abilities to improvise. The following conditions were used as independent variables: to play only the keyboard, the keyboard with the MIROR-Impro but with not-reflexive reply, the keyboard with the MIROR-Impro with reflexive reply. As dependent variables we estimated the children's ability to improvise in solos, and in duets. Each child carried out a training program consisting of 5 weekly individual 12 min sessions. The control group played the complete package of independent variables; Experimental Group 1 played the keyboard and the keyboard with the MIROR-Impro with not-reflexive reply; Experimental Group 2 played only the keyboard with the reflexive system. One week after, the children were asked to improvise a musical piece on the keyboard alone (Solo task), and in pairs with a friend (Duet task). Three independent judges assessed the Solo and the Duet tasks by means of a grid based on the TAI-Test for Ability to Improvise rating scale. The EG2, which trained only with the reflexive system, reached the highest average results and the difference with EG1, which did not used the reflexive system, is statistically significant when the children improvise in a duet. The results indicate that in the sample of participants the reflexive interaction alone could be sufficient to increase the improvisational skills, and necessary when they improvise in duets. However, these results are in general not statistically significant. The correlation between Reflexive Interaction and the ability to improvise is statistically significant. The results are discussed on the light of the recent literature in neuroscience and music education.

  9. Trunk Muscle EMG During Intermediate Pilates Mat Exercises in Beginner Healthy and Chronic Low Back Pain Individuals.

    Science.gov (United States)

    Pereira, Ivye L R; Queiroz, Bergson; Loss, Jefferson; Amorim, César; Sacco, Isabel C N

    2017-06-01

    The purpose of this study was to compare the electromyographic pattern of core muscles during intermediate Pilates mat exercises between healthy people and those with low back pain. We evaluated healthy participants (n = 19; mean ± standard deviation [SD]: age 28 ± 8 years, body mass 65 ± 10 kg, height 160.0 ± 9.1 cm) and a low back pain group (n = 13; mean ± SD: age 30 ± 9 years, body mass 67 ± 12 kg, height 170.0 ± 6.6 cm). Electromyographic analysis assessed the multifidus, external oblique, internal oblique, and rectus abdominis muscles during classical Pilates exercises (single leg stretch, criss-cross, and dead bug). We calculated the root mean square normalized by maximum voluntary contraction, and the time of peak activation was provided by a linear envelope and normalized by the total movement cycle. The criss-cross exercise presented the highest values of root mean square for trunk flexors (rectus abdominis and oblique) compared with the other exercises, followed by the single leg stretch and the dead bug, which had similar muscle activation. The single leg stretch presented more activation of the rectus abdominis and oblique, whereas the criss-cross and dead bug created more activation of the oblique compared with the multifidus and rectus. The Pilates exercises presented different muscle recruitment patterns, and allowed the activation of the lumbopelvic stabilizing muscles even in the first session for healthy individuals and those with chronic low back pain. Copyright © 2017. Published by Elsevier Inc.

  10. Practical guidelines for ultrasound-guided core needle biopsy of soft-tissue lesions: Transformation from beginner to specialist

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Sang Yoon; Chung, Hye Won; Oh, Tack Sun; Lee, Jong Seok [University of Ulsan College of Medicine, Asan Medical Center, Seoul (Korea, Republic of)

    2017-04-15

    Ultrasound-guided core needle biopsy (US-CNB) is an important step in the diagnosis of musculoskeletal soft-tissue lesions. To maximize efficacy and minimize the complications of US-CNB, it is critical to collaborate with a multidisciplinary team and to understand the particular considerations of US-CNB for these lesions. The purpose of this article is to provide a systematic review and step-by-step tips for using US-CNB to diagnose musculoskeletal soft-tissue lesions.

  11. Longitudinal transactions between personality and occupational roles : A large and heterogeneous study of job beginners, stayers, and changers

    NARCIS (Netherlands)

    Denissen, J.J.A.; Ulferts, H.; Lüdtke, O.; Muck, P.M.; Gerstorf, D.

    2014-01-01

    Social norms are central to theoretical accounts of longitudinal person-environment transactions. On the one hand, individuals are thought to select themselves into social roles that fit their personality. On the other hand, it is assumed that individuals' personality is transformed by the

  12. Die russische baltische Historiographie in der zweiten Hälfte des 19. und zu Beginn des 20. Jahrhunderts / Tiit Rosenberg

    Index Scriptorium Estoniae

    Rosenberg, Tiit, 1946-

    2005-01-01

    Vene balti historiograafiast 19. sajandi teisel poolel ja 20. saj. algul. Evgraf Tsheshihhin, Joann Jürgens, Georgi Forsten, Vassili Blagoveshtshenski, Stepan Sivitski, Vassili Ivanov, Aleksandr Nevzorov, Aleksandr Brückner, Anton Budilovitsh, Aleksandr Tshumikov, Ivan Lutshitski, Konstantin Vojenski jt.

  13. Effect of peripheral vision training on the attack of beginner indoor soccer players: a study during competition

    OpenAIRE

    Nelson Kautzner Marques Junior

    2009-01-01

    http://dx.doi.org/10.5007/1980-0037.2009v11n1p119   In the area of Biophysical Dimension and following the research line of the Study of Learning Mechanisms and Processes and of Motor Conduct within the epistemological construct of phenomenological explanation. The objective of this study was to investigate peripheral vision training (PVT) and its effect on attack runs during indoor soccer, taking into account dominant laterality (brain hemisphere function) in both learning speed and ...

  14. Effect of peripheral vision training on the attack of beginner indoor soccer players: a study during competition

    OpenAIRE

    Nelson Kautzner Marques Junior

    2009-01-01

    This study was conducted within the context of Human Motor Skill Science, in the area of Biophysical Dimension and following the research line of the Study of Learning Mechanisms and Processes and of Motor Conduct within the epistemological construct of phenomenological explanation. The objective of this study was to investigate peripheral vision training (PVT) and its effect on attack runs during indoor soccer, taking into account dominant laterality (brain hemisphere function) in both learn...

  15. Hegemony for Beginners: Egyptian Activity in the Southern Levant during the Second Half of the Fourth Millennium B.C

    Directory of Open Access Journals (Sweden)

    Branislav Anđelković

    2016-03-01

    Full Text Available After a modest start in the mid-20th century, thousands of Protodynastic Egyptian objects have been unearthed and identified as such in the Southern Levant, including serekh-signs of several Dynasty 0 (Narmer, "Double Falcon", Ny-Hor, IryHor, Ka, and 1st Dynasty (Hor Aha pharaohs. The explanatory models presented so far fail to integrate the totality of the archaeologically manifested parameters, especially considering the impact of the last fifteen years of finds and their contextual and other analysis, into the proper semiotic matrix. The conundrum of Egyptian activity in the Southern Levant displays, at the same time, features of a small-scale trading partner, a colonizer, and a suzerain. Egyptian pottery of local origin provides an indication of a south-north flow of the Egyptian daily-life repertoire of pottery types, or rather their contents, between the Egyptian-related sites, that clearly demonstrates an Egyptian distribution system operating on an intra-regional level in the Early Bronze IB Southern Levant. The ‘Egyptian phenomenon’ is far from being unique since reestablishment of a similar geopolitical pattern, only on a considerably greater scale, can be recognized during the New Kingdom – the Egyptian province in Asia.

  16. Child–Computer Interaction at the Beginner Stage of Music Learning: Effects of Reflexive Interaction on Children’s Musical Improvisation

    Science.gov (United States)

    Addessi, Anna Rita; Anelli, Filomena; Benghi, Diber; Friberg, Anders

    2017-01-01

    In this article children’s musical improvisation is investigated through the “reflexive interaction” paradigm. We used a particular system, the MIROR-Impro, implemented in the framework of the MIROR project (EC-FP7), which is able to reply to the child playing a keyboard by a “reflexive” output, mirroring (with repetitions and variations) her/his inputs. The study was conducted in a public primary school, with 47 children, aged 6–7. The experimental design used the convergence procedure, based on three sample groups allowing us to verify if the reflexive interaction using the MIROR-Impro is necessary and/or sufficient to improve the children’s abilities to improvise. The following conditions were used as independent variables: to play only the keyboard, the keyboard with the MIROR-Impro but with not-reflexive reply, the keyboard with the MIROR-Impro with reflexive reply. As dependent variables we estimated the children’s ability to improvise in solos, and in duets. Each child carried out a training program consisting of 5 weekly individual 12 min sessions. The control group played the complete package of independent variables; Experimental Group 1 played the keyboard and the keyboard with the MIROR-Impro with not-reflexive reply; Experimental Group 2 played only the keyboard with the reflexive system. One week after, the children were asked to improvise a musical piece on the keyboard alone (Solo task), and in pairs with a friend (Duet task). Three independent judges assessed the Solo and the Duet tasks by means of a grid based on the TAI-Test for Ability to Improvise rating scale. The EG2, which trained only with the reflexive system, reached the highest average results and the difference with EG1, which did not used the reflexive system, is statistically significant when the children improvise in a duet. The results indicate that in the sample of participants the reflexive interaction alone could be sufficient to increase the improvisational skills, and necessary when they improvise in duets. However, these results are in general not statistically significant. The correlation between Reflexive Interaction and the ability to improvise is statistically significant. The results are discussed on the light of the recent literature in neuroscience and music education. PMID:28184205

  17. The Effect of Dual N-Back Task Training on Phonological Memory Expansion in Adult EFL Learners at the Beginner Level

    Science.gov (United States)

    Farvardin, Mohammad Taghi; Afghari, Akbar; Koosha, Mansour

    2014-01-01

    One of the most influential models of working memory (WM) is the one developed by Baddeley (1986, 2000, 2003) which views WM comprising several components--a central executive, an episodic buffer, the visuo-spatial sketchpad, and the phonological loop. The phonological loop or phonological memory (PM) deals with the temporary storage of verbal and…

  18. Regulation of distribution grid prices at the beginning of market liberalisation - Experience in Norway and Sweden; Regulierung der Verteilnetzpreise zu Beginn der Marktoeffnung. Erfahrung in Norwegen und Schweden

    Energy Technology Data Exchange (ETDEWEB)

    Filippini, M.; Wind, J.; Luchsinger, C.

    2001-07-01

    This report for the Swiss Federal Office of Energy (SFOE) reviews the experience gained in the deregulation of electricity distribution grids in Norway and Sweden and compares it with the possible options for Switzerland. The report looks at the requirements placed on the future Swiss regulation of electricity distribution grids and the various regulation models such as Rate-of-Return, Price-Cap, Revenue-Cap and Benchmarking that could be used in the short and long term. The choice of Sweden and Norway from the list of countries with liberalised electricity markets is discussed. The results of the study of the two countries are discussed individually, including the structure of the sector, the various stages of deregulation, the main characteristics encountered at the start of deregulation, regulation of grid prices at the beginning of liberalisation and experience gained in each case. The report is supplemented by a comprehensive list of the sources used.

  19. Radiation protection and environmental radioactivity. A voyage to the World Wide Web for beginners; Strahlenschutz und Umweltradioaktivitaet im Internet. Eine Reise in das World Wide Web fuer Anfaenger

    Energy Technology Data Exchange (ETDEWEB)

    Weimer, S [Landesanstalt fuer Umweltschutz Baden-Wuerttemberg, Referat ' ' Umweltradioaktivitaet, Strahlenschutz' ' (Germany)

    1998-07-01

    According to the enormous growth of the Internet service 'World Wide Web' there is also a big growth in the number of web sites in connection with radiation protection. An introduction is given of some practical basis of the WWW. The structure of WWW addresses and navigating through the web with hyperlinks is explained. Further some search engines are presented. The paper lists a number of WWW addresses of interesting sites with radiological protection informations. (orig.) [German] Mit dem rasanten Wachstum des Internet-Dienstes 'World Wide Web' ist auch das Angebot von Web-Seiten im Bereich Strahlenschutz stark gewachsen. Es wird eine Einfuehrung in die wichtigsten praktischen Grundlagen des WWW gegeben. Es wird der Aufbau der WWW-Adressen erklaert und das Navigieren mit Hyperlinks. Ausserdem werden einige Suchmaschinen vorgestellt. Der Beitrag stellt eine groessere Zahl an WWW-Adressen zu interessanten Seiten mit Strahlenschutzinformationen zur Verfuegung. (orig.)

  20. EFL SPEAKING AND INDIVIDUAL DIFFERENCES IN WORKING MEMORY CAPACITY: GRAMMATICAL COMPLEXITY AND WEIGHTED LEXICAL DENSITY IN THE ORAL PRODUCTION OF BEGINNERS

    Directory of Open Access Journals (Sweden)

    GICELE VERGINE e RAQUEL D’ELY

    2008-04-01

    Full Text Available O presente estudo expande a investigação de Fontanini, Weissheimer, Bergsleithner, Perucci and D’Ely (2005 utilizando parte dos dados dessa pesquisa para examinar a relação entre capacidade de memória de trabalho, medida pelo teste de amplitude oral e pelo teste de amplitude geral, e o uso de fala gramaticalmente complexa e lexicalmente densa de doze alunos iniciantes ao elaborarem uma descrição de gravura em Inglês como L2. Adicionando aos resultados obtidos por Fontanini et al (2005, não houve correlação estatisticamente significativa entres as medidas de memória de trabalho e a fala complexa e lexicalmente densa dos aprendizes. Portanto, os resultados corroboram a existência de efeito de troca de recursos atencionais (trade-off effects entre variáveis da produção oral como uma função de diferenças individuais na capacidade de memória de trabalho.PALAVRAS-CHAVE: produção oral, complexidade, densidade lexical, capacidade de memória de trabalho, efeito de troca de recursos atencionais.

  1. Error estimation and parameter dependence of the calculation of the fast ion distribution function, temperature, and density using data from the KF1 high energy neutral particle analyzer on Joint European Torus

    International Nuclear Information System (INIS)

    Schlatter, Christian; Testa, Duccio; Cecconello, Marco; Murari, Andrea; Santala, Marko

    2004-01-01

    Joint European Torus high energy neutral particle analyzer measures the flux of fast neutrals originating from the plasma core. From this data, the fast ion distribution function f i fast , temperature T i,perpendicular fast , and density n i fast are derived using knowledge of various plasma parameters and of the cross section for the required atomic processes. In this article, a systematic sensitivity study of the effect of uncertainties in these quantities on the evaluation of the neutral particle analyzer f i fast , T i,perpendicular fast , and n i fast is reported. The dominant parameter affecting n i fast is the impurity confinement time and therefore a reasonable estimate of this quantity is necessary to reduce the uncertainties in n i fast below 50%. On the other hand, T i,perpendicular fast is much less sensitive and can certainly be provided with an accuracy of better than 10%

  2. Anodic behavior of mechanically alloyed Cu–Ni–Fe and Cu–Ni–Fe–O electrodes for aluminum electrolysis in low-temperature KF-AlF3 electrolyte

    International Nuclear Information System (INIS)

    Goupil, G.; Helle, S.; Davis, B.; Guay, D.; Roué, L.

    2013-01-01

    A comparative study on the anodic behavior of Cu 65 Ni 20 Fe 15 and (Cu 65 Ni 20 Fe 15 ) 98.6 O 1.4 materials during the electrolysis of aluminum was conducted. Both materials were prepared in powder form by ball milling and subsequently consolidated to form dense pellets that were used as anodes. The electrochemical characterization was performed at 700 °C in a potassium cryolite-based electrolyte, and the composition-morphology of the oxide scales formed on both anodes were determined by scanning electron microscopy, energy dispersive X-ray spectroscopy and X-ray diffraction measurements. On Cu 65 Ni 20 Fe 15 , a thick (170 μm) and porous oxide scale is formed after 15 min of electrolysis that readily dissolves (or spalls) before a denser oxide layer is formed after a longer electrolysis time (1 and 5 h). In comparison, a thin (2 μm) and dense oxide layer mainly composed of NiFe 2 O 4 is observed on a (Cu 65 Ni 20 Fe 15 ) 98.6 O 1.4 electrode after 15 min of electrolysis. The thickness of this oxide layer increases to 10 and 30 μm after 1 h and 5 h of electrolysis. However, the outward diffusion of Cu to form CuO x at the surface of the electrode is not totally hampered by the presence of NiFe 2 O 4 and a porous Cu-depleted region is formed at the oxide/alloy interface. As a result, electrolyte penetration occurs in the scale, which favors the progressive formation of an iron fluoride layer at the oxide/alloy interface

  3. On the efficiency of the hybrid and the exact second-order sampling formulations of the EnKF: a reality-inspired 3-D test case for estimating biodegradation rates of chlorinated hydrocarbons at the port of Rotterdam

    KAUST Repository

    El Gharamti, Mohamad; Valstar, Johan; Janssen, Gijs; Marsman, Annemieke; Hoteit, Ibrahim

    2016-01-01

    This study considers the assimilation problem of subsurface contaminants at the port of Rotterdam in the Netherlands. It involves the estimation of solute concentrations and biodegradation rates of four different chlorinated solvents. We focus

  4. Karlsruhe Research Center, Nuclear Safety Research Project (PSF). Annual report 1994; Forschungszentrum Karlsruhe, Projekt Nukleare Sicherheitsforschung. Jahrsbericht 1994

    Energy Technology Data Exchange (ETDEWEB)

    Hueper, R. [ed.

    1995-08-01

    The reactor safety R and D work of the Karlsruhe Research Centre (FZKA) has been part of the Nuclear Safety Research Projet (PSF) since 1990. The present annual report 1994 summarizes the R and D results. The research tasks are coordinated in agreement with internal and external working groups. The contributions to this report correspond to the status of early 1995. An abstract in English precedes each of them, whenever the respective article is written in German. (orig.) [Deutsch] Seit Beginn 1990 sind die F+E-Arbeiten des Forschungszentrum Karlsruhe (FZKA) zur Reaktorsicherheit im Projekt Nukleare Sicherheitsforschung (PSF) zusammengefasst. Der vorliegende Jahresbericht 1994 enthaelt Beitraege zu aktuellen Fragen der Sicherheit von Leichtwasserreaktoren und innovativen Systemen sowie der Umwandlung von minoren Aktiniden. Die konkreten Forschungsthemen und -vorhaben werden mit internen und externen Fachgremien laufend abgestimmt. An den beschriebenen Arbeiten sind die folgenden Institute und Abteilungen des FZKA beteiligt: Institut fuer Materialforschung IMF I, II, III; Institut fuer Neutronenphysik und Reaktortechnik INR; Institut fuer Angewandte Thermo- und Fluiddynamik IATF; Institut fuer Reaktorsicherheit IRS; Hauptabteilung Ingenieurtechnik HIT; Hauptabteilung Versuchstechnik HVT sowie vom KfK beauftragte externe Institutionen. Die einzelnen Beitraege stellen den Stand der Arbeiten zum Fruehjahr 1995 dar und sind entsprechend dem F+E-Programm 1994 numeriert. Den in deutscher Sprache verfassten Beitraege sind Kurzfassungen in englischer Sprache vorangestellt. (orig.)

  5. Influence of Polyaniline Coated Kenaf Fiber on Kenaf Paper Sheet

    OpenAIRE

    Abdullah Hisham Nur Syafiqah; Abd Razak Saiful Izwan; Mat Nayan Nadirul Hasraf; Wan Abdul Rahman Wan Aizan

    2015-01-01

    This paper reports the properties of newly developed electrically conductive natural fiber paper sheet made up of kenaf fiber (KF) incorporated with polyaniline coated kenaf fiber (KF-PANI). This study proposed on dispersion of conductive filler in different amount (wt %) into kenaf pulp for developing different electrical conductivity. The conductive sheet (KF/KF-PANI) revealed a percolation concentration at 25 wt% of KF-PANI. Its scanning electron micrograph showed good paper formation with...

  6. Influence of Polyaniline Coated Kenaf Fiber on Kenaf Paper Sheet

    Directory of Open Access Journals (Sweden)

    Abdullah Hisham Nur Syafiqah

    2015-01-01

    Full Text Available This paper reports the properties of newly developed electrically conductive natural fiber paper sheet made up of kenaf fiber (KF incorporated with polyaniline coated kenaf fiber (KF-PANI. This study proposed on dispersion of conductive filler in different amount (wt % into kenaf pulp for developing different electrical conductivity. The conductive sheet (KF/KF-PANI revealed a percolation concentration at 25 wt% of KF-PANI. Its scanning electron micrograph showed good paper formation with no significant damages.

  7. Human Estimation of Slope, Distance, and Height of Terrain in Simulated Lunar Conditions

    Science.gov (United States)

    2009-02-01

    9643 APPENDIX J DEVON ISLAND DISTANCE REFERENCE 259 Distance References NBA Basketball Court Width 15 meters 50 feet...Cockpit Hours: Simulator Airframe: Hours: Sports Baseball Years: Beginner Intermediate Advanced Basketball Years: Beginner

  8. Früher Beginn: Aggression bei jugendlichen Paaren und ihr Bezug zu Partnerschaftsqualität und Bewältigung von Konflikten [Early start: Aggression in adolescent couples and its link to relationship quality and coping with conflicts

    NARCIS (Netherlands)

    Seiffge-Krenke, I.; Burk, W.J.

    2016-01-01

    Aggressive behavior in adult couples is a problem which must be taken seriously and is a frequent reason for psychotherapy and counseling. Less is known about an early start of aggression, e.g. in adolescent romantic relationships. In a sample of 194 romantic partner dyads (age 16-18 years)

  9. Atomic physics for cave-men and other beginners. The universe from within. Molecules, atoms, and elementary particles; Atomphysik fuer Hoehlenmenschen und andere Anfaenger. Das Universum von innen. Molekuele, Atome und Elementarteilchen

    Energy Technology Data Exchange (ETDEWEB)

    Beetz, Juergen

    2016-07-01

    In this essential can be found the structure and the general properties of atoms, the precise interior of atoms and the special behaviour resulting from it, and the mysterious world of ''quanta'' and their behaviour.

  10. Dicty_cDB: AFM177 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ESFGGATTFNFTS SILPIPFKSIIECNGLEEVNQSSKSYKFNDTIKINPFEIKTFRFISN*klkiklinkykn kf Translated Amino Acid sequence...ISETPFSLASTTHIDKTFISTNKEAIIVDTIKKAEDGTSFVVRVYESFGGATTFNFTS SILPIPFKSIIECNGLEEVNQSSKSYKFNDTIKINPFEIKTFRFISN*klkiklinky

  11. Data driven computing by the morphing fast Fourier transform ensemble Kalman filter in epidemic spread simulations

    Science.gov (United States)

    Mandel, Jan; Beezley, Jonathan D.; Cobb, Loren; Krishnamurthy, Ashok

    2010-01-01

    The FFT EnKF data assimilation method is proposed and applied to a stochastic cell simulation of an epidemic, based on the S-I-R spread model. The FFT EnKF combines spatial statistics and ensemble filtering methodologies into a localized and computationally inexpensive version of EnKF with a very small ensemble, and it is further combined with the morphing EnKF to assimilate changes in the position of the epidemic. PMID:21031155

  12. Multilevel ensemble Kalman filter

    KAUST Repository

    Chernov, Alexey; Hoel, Haakon; Law, Kody; Nobile, Fabio; Tempone, Raul

    2016-01-01

    This work embeds a multilevel Monte Carlo (MLMC) sampling strategy into the Monte Carlo step of the ensemble Kalman filter (EnKF). In terms of computational cost vs. approximation error the asymptotic performance of the multilevel ensemble Kalman filter (MLEnKF) is superior to the EnKF s.

  13. Mean-field Ensemble Kalman Filter

    KAUST Repository

    Law, Kody; Tembine, Hamidou; Tempone, Raul

    2015-01-01

    A proof of convergence of the standard EnKF generalized to non-Gaussian state space models is provided. A density-based deterministic approximation of the mean-field limiting EnKF (MFEnKF) is proposed, consisting of a PDE solver and a quadrature

  14. Predicting Breeding Values in Animals by Kalman Filter

    DEFF Research Database (Denmark)

    Karacaoren, B; Janss, L L G; Kadarmideen, H N

    2012-01-01

    The aim of this study was to investigate usefulness of Kalman Filter (KF) Random Walk methodology (KF-RW) for prediction of breeding values in animals. We used body condition score (BCS) from dairy cattle for illustrating use of KF-RW. BCS was measured by Swiss Holstein Breeding Association during...

  15. Multilevel ensemble Kalman filter

    KAUST Repository

    Chernov, Alexey

    2016-01-06

    This work embeds a multilevel Monte Carlo (MLMC) sampling strategy into the Monte Carlo step of the ensemble Kalman filter (EnKF). In terms of computational cost vs. approximation error the asymptotic performance of the multilevel ensemble Kalman filter (MLEnKF) is superior to the EnKF s.

  16. Dissolved inorganic carbon, total alkalinity, pH, and other variables collected from surface discrete observations using flow through pump and other instruments from Explorer of the Seas (ID: 33KF) in the Caribbean Sea and North Atlantic ocean during the Ocean Acidification Cruise EX1507 from 2015-02-14 to 2015-02-15 (NCEI Accession 0154385)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This archival package contains surface discrete measurements of dissolved inorganic carbon, total alkalinity, pH in the Caribbean Sea. Increasing amounts of...

  17. Kiwifruit Non-Sugar Components Reduce Glycaemic Response to Co-Ingested Cereal in Humans

    Directory of Open Access Journals (Sweden)

    Suman Mishra

    2017-10-01

    Full Text Available Kiwifruit (KF effects on the human glycaemic response to co-ingested wheat cereal were determined. Participants (n = 20 consumed four meals in random order, all being made to 40 g of the same available carbohydrate, by adding kiwifruit sugars (KF sug; glucose, fructose, sucrose 2:2:1 to meals not containing KF. The meals were flaked wheat biscuit (WB+KFsug, WB+KF, WB+guar gum+KFsug, WB+guar gum+KF, that was ingested after fasting overnight. Blood glucose was monitored 3 h and hunger measured at 180 min post-meal using a visual analogue scale. KF and guar reduced postprandial blood glucose response amplitude, and prevented subsequent hypoglycaemia that occurred with WB+KFsug. The area between the blood glucose response curve and baseline from 0 to 180 min was not significantly different between meals, 0–120 min areas were significantly reduced by KF and/or guar. Area from 120 to 180 min was positive for KF, guar, and KF+guar, while the area for the WB meal was negative. Hunger at 180 min was significantly reduced by KF and/or guar when compared with WB. We conclude that KF components other than available carbohydrate may improve the glycaemic response profile to co-ingested cereal food.

  18. A Ketogenic Formula Prevents Tumor Progression and Cancer Cachexia by Attenuating Systemic Inflammation in Colon 26 Tumor-Bearing Mice

    Directory of Open Access Journals (Sweden)

    Kentaro Nakamura

    2018-02-01

    Full Text Available Low-carbohydrate, high-fat diets (ketogenic diets might prevent tumor progression and could be used as supportive therapy; however, few studies have addressed the effect of such diets on colorectal cancer. An infant formula with a ketogenic composition (ketogenic formula; KF is used to treat patients with refractory epilepsy. We investigated the effect of KF on cancer and cancer cachexia in colon tumor-bearing mice. Mice were randomized into normal (NR, tumor-bearing (TB, and ketogenic formula (KF groups. Colon 26 cells were inoculated subcutaneously into TB and KF mice. The NR and TB groups received a standard diet, and the KF mice received KF ad libitum. KF mice preserved their body, muscle, and carcass weights. Tumor weight and plasma IL-6 levels were significantly lower in KF mice than in TB mice. In the KF group, energy intake was significantly higher than that in the other two groups. Blood ketone body concentrations in KF mice were significantly elevated, and there was a significant negative correlation between blood ketone body concentration and tumor weight. Therefore, KF may suppress the progression of cancer and the accompanying systemic inflammation without adverse effects on weight gain, or muscle mass, which might help to prevent cancer cachexia.

  19. Study on Java Programming Education

    OpenAIRE

    太田, 信宏

    2009-01-01

    The purpose of this study is to consider the content and key points for inclusion in a Java programming course for beginners. The Java programming language has a variety of functions and has the largest application field of all such languages, containing many themes that are appropriate for any such programming course. The multifunctional and wide-ranging functions of Java, however, may actually act as a barrier to study for beginners. The core content of a programming class for beginners sho...

  20. Věční začátečníci v kurzech anglického jazyka pro dospělé

    OpenAIRE

    Mihulková, Šárka

    2014-01-01

    This thesis deals with the issue of teaching continuing beginners in adult EFL classes. It focuses on the description of factors that may influence the learning stagnation among these learners, and it attempts to ascertain the extent to which these factors take effect. Consequently, the thesis aims to characterize Czech continuing beginners as an independent group of learners and to provide scientific evidence which could clarify the assumptions, underlying the continuing-beginner concept. La...

  1. An Efficient State–Parameter Filtering Scheme Combining Ensemble Kalman and Particle Filters

    KAUST Repository

    Ait-El-Fquih, Boujemaa

    2017-12-11

    This work addresses the state-parameter filtering problem for dynamical systems with relatively large-dimensional state and low-dimensional parameters\\' vector. A Bayesian filtering algorithm combining the strengths of the particle filter (PF) and the ensemble Kalman filter (EnKF) is proposed. At each assimilation cycle of the proposed EnKF-PF, the PF is first used to sample the parameters\\' ensemble followed by the EnKF to compute the state ensemble conditional on the resulting parameters\\' ensemble. The proposed scheme is expected to be more efficient than the traditional state augmentation techniques, which suffer from the curse of dimensionality and inconsistency that is particularly pronounced when the state is a strongly nonlinear function of the parameters. In the new scheme, the EnKF and PF interact via their ensembles\\' members, in contrast with the recently introduced two-stage EnKF-PF (TS-EnKF-PF), which exchanges point estimates between EnKF and PF while requiring almost double the computational load. Numerical experiments are conducted with the Lorenz-96 model to assess the behavior of the proposed filter and to evaluate its performances against the joint PF, joint EnKF, and TS-EnKF-PF. Numerical results suggest that the EnKF-PF performs best in all tested scenarios. It was further found to be more robust, successfully estimating both state and parameters in different sensitivity experiments.

  2. An Efficient State–Parameter Filtering Scheme Combining Ensemble Kalman and Particle Filters

    KAUST Repository

    Ait-El-Fquih, Boujemaa; Hoteit, Ibrahim

    2017-01-01

    This work addresses the state-parameter filtering problem for dynamical systems with relatively large-dimensional state and low-dimensional parameters' vector. A Bayesian filtering algorithm combining the strengths of the particle filter (PF) and the ensemble Kalman filter (EnKF) is proposed. At each assimilation cycle of the proposed EnKF-PF, the PF is first used to sample the parameters' ensemble followed by the EnKF to compute the state ensemble conditional on the resulting parameters' ensemble. The proposed scheme is expected to be more efficient than the traditional state augmentation techniques, which suffer from the curse of dimensionality and inconsistency that is particularly pronounced when the state is a strongly nonlinear function of the parameters. In the new scheme, the EnKF and PF interact via their ensembles' members, in contrast with the recently introduced two-stage EnKF-PF (TS-EnKF-PF), which exchanges point estimates between EnKF and PF while requiring almost double the computational load. Numerical experiments are conducted with the Lorenz-96 model to assess the behavior of the proposed filter and to evaluate its performances against the joint PF, joint EnKF, and TS-EnKF-PF. Numerical results suggest that the EnKF-PF performs best in all tested scenarios. It was further found to be more robust, successfully estimating both state and parameters in different sensitivity experiments.

  3. Assessing performance of Bayesian state-space models fit to Argos satellite telemetry locations processed with Kalman filtering.

    Directory of Open Access Journals (Sweden)

    Mónica A Silva

    Full Text Available Argos recently implemented a new algorithm to calculate locations of satellite-tracked animals that uses a Kalman filter (KF. The KF algorithm is reported to increase the number and accuracy of estimated positions over the traditional Least Squares (LS algorithm, with potential advantages to the application of state-space methods to model animal movement data. We tested the performance of two Bayesian state-space models (SSMs fitted to satellite tracking data processed with KF algorithm. Tracks from 7 harbour seals (Phoca vitulina tagged with ARGOS satellite transmitters equipped with Fastloc GPS loggers were used to calculate the error of locations estimated from SSMs fitted to KF and LS data, by comparing those to "true" GPS locations. Data on 6 fin whales (Balaenoptera physalus were used to investigate consistency in movement parameters, location and behavioural states estimated by switching state-space models (SSSM fitted to data derived from KF and LS methods. The model fit to KF locations improved the accuracy of seal trips by 27% over the LS model. 82% of locations predicted from the KF model and 73% of locations from the LS model were <5 km from the corresponding interpolated GPS position. Uncertainty in KF model estimates (5.6 ± 5.6 km was nearly half that of LS estimates (11.6 ± 8.4 km. Accuracy of KF and LS modelled locations was sensitive to precision but not to observation frequency or temporal resolution of raw Argos data. On average, 88% of whale locations estimated by KF models fell within the 95% probability ellipse of paired locations from LS models. Precision of KF locations for whales was generally higher. Whales' behavioural mode inferred by KF models matched the classification from LS models in 94% of the cases. State-space models fit to KF data can improve spatial accuracy of location estimates over LS models and produce equally reliable behavioural estimates.

  4. Dicty_cDB: VSD553 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3.22 Translated Amino Acid sequence dkciffvpinrddaftlryqdntwdpveydvlidylgqnqdkwfsgglp*k********l yklhkgftig...kf*k*kikny Translated Amino Acid sequence (All Frames) Frame A: dkciffvpinrddaftl

  5. Export financing of nuclear power plants - banks experience

    International Nuclear Information System (INIS)

    Loeber

    1976-01-01

    Export financing of a nuclear power plant to be exported from Germany, is, in principle, provided by German commercial banks and KfW (Kreditanstalt fuer Wiederaufbau). As a rule, 50 per cent of the financing of maturities falling due under the export portion of the loan will be taken over by a banking syndicate of approximately 25 member banks, and the remaining 50 per cent would be provided by KfW. KfW and the commercial banks must grant their loans at the respective money market conditions. The banks' and KfW's loans will normally be disbursed pro rata delivery. (HP) [de

  6. PA6 and Kevlar fiber reinforced isotactic polypropylene: Structure, mechanical properties and crystallization and melting behavior

    International Nuclear Information System (INIS)

    Zhao, Songfang; Cheng, Lei; Guo, Yong; Zheng, Yuying; Li, Baoming

    2012-01-01

    Highlights: ► KF was modified with caprolactam using toluenediisocyanate (TDI) as bridge. ► Modified KF improves interfacial interaction of iPP/KF/PA6 composites. ► Fiber and nylon 6 inhibited the crystallization of PP continuous phase. -- Abstract: To improve the thermal and mechanical properties of isotactic polypropylene (iPP), iPP/Kevlar fiber (KF)/polyamide 6 (PA6) composites were prepared via the melt-extrusion method on twin-screw extruder. Kevlar fiber was modified with caprolactam using toluenediisocyanate (TDI) as bridge. The microstructure of modified KF was successfully characterized by Fourier transform infrared (FT-IR), X-ray photoelectron spectrometer (XPS) and scanning electron microscopy (SEM), the results showed that KF was bonded with caprolactam and became coarser. Then the modified KF was introduced into iPP, the composites have better mechanical and thermal properties, implying that modification of KF was helpful to improve the interfacial interaction of iPP/KF/PA6 composites. Besides, the crystallization curves indicated that crystallization behavior of PA6 in the composites was homogeneous and fractional. Furthermore, compatibilizer content played an important role in the mechanical and thermal properties of composites.

  7. A hybrid nudging-ensemble Kalman filter approach to data assimilation. Part I: application in the Lorenz system

    Directory of Open Access Journals (Sweden)

    Lili Lei

    2012-05-01

    Full Text Available A hybrid data assimilation approach combining nudging and the ensemble Kalman filter (EnKF for dynamic analysis and numerical weather prediction is explored here using the non-linear Lorenz three-variable model system with the goal of a smooth, continuous and accurate data assimilation. The hybrid nudging-EnKF (HNEnKF computes the hybrid nudging coefficients from the flow-dependent, time-varying error covariance matrix from the EnKF's ensemble forecasts. It extends the standard diagonal nudging terms to additional off-diagonal statistical correlation terms for greater inter-variable influence of the innovations in the model's predictive equations to assist in the data assimilation process. The HNEnKF promotes a better fit of an analysis to data compared to that achieved by either nudging or incremental analysis update (IAU. When model error is introduced, it produces similar or better root mean square errors compared to the EnKF while minimising the error spikes/discontinuities created by the intermittent EnKF. It provides a continuous data assimilation with better inter-variable consistency and improved temporal smoothness than that of the EnKF. Data assimilation experiments are also compared to the ensemble Kalman smoother (EnKS. The HNEnKF has similar or better temporal smoothness than that of the EnKS, and with much smaller central processing unit (CPU time and data storage requirements.

  8. A One-Step-Ahead Smoothing-Based Joint Ensemble Kalman Filter for State-Parameter Estimation of Hydrological Models

    KAUST Repository

    El Gharamti, Mohamad

    2015-11-26

    The ensemble Kalman filter (EnKF) recursively integrates field data into simulation models to obtain a better characterization of the model’s state and parameters. These are generally estimated following a state-parameters joint augmentation strategy. In this study, we introduce a new smoothing-based joint EnKF scheme, in which we introduce a one-step-ahead smoothing of the state before updating the parameters. Numerical experiments are performed with a two-dimensional synthetic subsurface contaminant transport model. The improved performance of the proposed joint EnKF scheme compared to the standard joint EnKF compensates for the modest increase in the computational cost.

  9. Dicty_cDB: CHE515 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hvpkkxv*lilqsilmitmhvplipvhhqlvfptlqltvmi vnpctidscnnstglxxhsnqw****slvp*ih--- --...FGLXGGFXGGGTXGKXDCXTCKN*xtxfi*lxfkk ixkkfxkkfxkkkklfvflsniynf*k*kf Frame C: nkctvdscsnstgcvntpincddsnpctvdscnns

  10. Grappling with Grammar on a Virtual Learning Platform: The Case of First Year French Students at the University of Wollongong

    Science.gov (United States)

    Bissoonauth-Bedford, A.; Stace, Ray

    2012-01-01

    This paper reports on an online discussion forum that was created on the University of Wollongong's Virtual Learning Environment (VLE) to aid and support the learning of French grammar at beginner/false beginner level. The aim was to provide a blended learning situation which combines face to face teaching with online learning using multimedia…

  11. Young Learners and Lexical Awareness: Children's Engagement with Wordlists and Concordances

    Science.gov (United States)

    MacGregor, Alex

    2014-01-01

    Sinclair (1991) found that lexical analysis can be overcomplicated, yet Johns (1994) called for investigation into whether corpus analysis can motivate beginners and near-beginners. The findings of this research suggest that young EFL learners can enjoy using corpus analysis tools (wordlists and concordances) to identify, classify, and generalize…

  12. Mobile-Based Chatting for Meaning Negotiation in Foreign Language Learning

    Science.gov (United States)

    Castrillo, María Dolores; Martín-Monje, Elena; Bárcena, Elena

    2014-01-01

    This paper analyzes the adequacy of mobile chatting via Whatsapp for the enhancement of a type of spontaneous and colloquial written interaction which has a strong connection with oral discourse. This is part of a research project undertaken with Spanish students of German as a foreign language with a beginner's or quasi-beginner's level. The…

  13. Jenkins essentials

    CERN Document Server

    Soni, Mitesh

    2015-01-01

    If you are a Jenkins novice or beginner with a basic understanding of continuous integration, then this is the book for you. Beginners in Jenkins will get quick hands-on experience and gain the confidence to go ahead and explore the use of Jenkins further.

  14. Analysis of Learning Behavior in a Flipped Programing Classroom Adopting Problem-Solving Strategies

    Science.gov (United States)

    Chiang, Tosti Hsu-Cheng

    2017-01-01

    Programing is difficult for beginners because they need to learn the new language of computers. Developing software, especially complex software, is bound to result in problems, frustration, and the need to think in new ways. Identifying the learning behavior behind programing by way of empirical studies can help beginners learn more easily. In…

  15. Streamlined Archaeo-geophysical Data Processing and Integration for DoD Field Use

    Science.gov (United States)

    2012-04-01

    6 Figure 2-3. Flowchart illustrating the old, ad-hoc approach of processing...Figure 2-3. Flowchart illustrating the old, ad-hoc approach of processing and integrating multiple geophysical datasets. Each color represents a... beginner , intermediate, and expert user. Most users agreed that the software is very effective for beginners because: (1) it provides a geophysics

  16. Sustainment of Individual and Collective Future Combat Skills: Modeling and Research Methods

    Science.gov (United States)

    2010-01-01

    expertise: Novice, Advanced Beginner , Competent, Proficient, and Expert. According to this conceptualization, tactical leaders develop cognitively...to equipment or containers. • Checklists, flowcharts , worksheets, decision tables, and system-fault tables. • Written instructions (e.g., on...novice; (2) advanced beginner ; (3) competent; (4) proficient; and (5) expert. Going from novice to expert, each level of skill development reflects

  17. Issues to be Considered in the Evaluation of Technical Proposals from the Ada (Trademark) Language Perspective.

    Science.gov (United States)

    1985-06-10

    flowcharts - hierarchical charts - data flow diagrams - finite state diagrams - control flow diagrams - decision tables/trees - entity-relationship...and beginners ; for example, is prompting via menus provided for beginners and single keystroke capability provided for experienced users? 2-13 - input

  18. Assessment of PDMS-water partition coefficients: implications for passive environmental sampling of hydrophobic organic compounds

    Science.gov (United States)

    DiFilippo, Erica L.; Eganhouse, Robert P.

    2010-01-01

    Solid-phase microextraction (SPME) has shown potential as an in situ passive-sampling technique in aquatic environments. The reliability of this method depends upon accurate determination of the partition coefficient between the fiber coating and water (Kf). For some hydrophobic organic compounds (HOCs), Kf values spanning 4 orders of magnitude have been reported for polydimethylsiloxane (PDMS) and water. However, 24% of the published data examined in this review did not pass the criterion for negligible depletion, resulting in questionable Kf values. The range in reported Kf is reduced to just over 2 orders of magnitude for some polychlorinated biphenyls (PCBs) when these questionable values are removed. Other factors that could account for the range in reported Kf, such as fiber-coating thickness and fiber manufacturer, were evaluated and found to be insignificant. In addition to accurate measurement of Kf, an understanding of the impact of environmental variables, such as temperature and ionic strength, on partitioning is essential for application of laboratory-measured Kf values to field samples. To date, few studies have measured Kf for HOCs at conditions other than at 20 degrees or 25 degrees C in distilled water. The available data indicate measurable variations in Kf at different temperatures and different ionic strengths. Therefore, if the appropriate environmental variables are not taken into account, significant error will be introduced into calculated aqueous concentrations using this passive sampling technique. A multiparameter linear solvation energy relationship (LSER) was developed to estimate log Kf in distilled water at 25 degrees C based on published physicochemical parameters. This method provided a good correlation (R2 = 0.94) between measured and predicted log Kf values for several compound classes. Thus, an LSER approach may offer a reliable means of predicting log Kf for HOCs whose experimental log Kf values are presently unavailable. Future

  19. Investigation of the effect of potassium on Cu(In,Ga)Se{sub 2} layers and solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Laemmle, A., E-mail: anke.laemmle@zsw-bw.de; Wuerz, R.; Powalla, M.

    2015-05-01

    We investigate the influence of potassium (K) on the Cu(In,Ga)Se{sub 2} (CIGS) growth kinetics on alkali-free alumina substrates and the electrical parameters of the CIGS solar cell by intentional K doping of the CIGS layer by a KF-precursor layer and KF-post deposition treatment (PDT). Secondary ion mass spectroscopy measurements revealed that K can be incorporated into the CIGS layer by both processes. The CIGS composition of the KF-precursor sample shows a stronger [Ga]/([Ga] + [In]) (GGI) profile. By analysing the samples with scanning electron microscopy we observed smaller CIGS grains for the KF-precursor sample compared to the K-free reference and KF-PDT sample. jV-measurements of the KF-PDT and the KF-precursor sample show an increase in the cell efficiency η from 10.7% to 13.6% and 13.7%, respectively, compared to the K-free reference sample. The external quantum efficiency measurements of the KF-precursor sample show an increased absorption in the infrared region. Capacitance-voltage measurements reveal an increase in the net doping concentration of both samples treated with K. We assume that the enhancement is caused by passivation of grain boundaries and donor-like defects by K, as previously demonstrated for Na. - Highlights: • K-doped Cu(In,Ga)Se{sub 2} (CIGS) layers from KF-precursor and KF-post deposition treatment • Separation of the K-effect from the Na-effect by using alkali-free substrates • Interdiffusion of CIGS elements during CIGS growth is hindered by K • KF-precursor leads to smaller CIGS grains and a stronger Cu depletion at the CIGS surface. • K leads to an increase in the conversion efficiency.

  20. An Adjoint-Based Adaptive Ensemble Kalman Filter

    KAUST Repository

    Song, Hajoon

    2013-10-01

    A new hybrid ensemble Kalman filter/four-dimensional variational data assimilation (EnKF/4D-VAR) approach is introduced to mitigate background covariance limitations in the EnKF. The work is based on the adaptive EnKF (AEnKF) method, which bears a strong resemblance to the hybrid EnKF/three-dimensional variational data assimilation (3D-VAR) method. In the AEnKF, the representativeness of the EnKF ensemble is regularly enhanced with new members generated after back projection of the EnKF analysis residuals to state space using a 3D-VAR [or optimal interpolation (OI)] scheme with a preselected background covariance matrix. The idea here is to reformulate the transformation of the residuals as a 4D-VAR problem, constraining the new member with model dynamics and the previous observations. This should provide more information for the estimation of the new member and reduce dependence of the AEnKF on the assumed stationary background covariance matrix. This is done by integrating the analysis residuals backward in time with the adjoint model. Numerical experiments are performed with the Lorenz-96 model under different scenarios to test the new approach and to evaluate its performance with respect to the EnKF and the hybrid EnKF/3D-VAR. The new method leads to the least root-mean-square estimation errors as long as the linear assumption guaranteeing the stability of the adjoint model holds. It is also found to be less sensitive to choices of the assimilation system inputs and parameters.

  1. Global Kalman filter approaches to estimate absolute angles of lower limb segments.

    Science.gov (United States)

    Nogueira, Samuel L; Lambrecht, Stefan; Inoue, Roberto S; Bortole, Magdo; Montagnoli, Arlindo N; Moreno, Juan C; Rocon, Eduardo; Terra, Marco H; Siqueira, Adriano A G; Pons, Jose L

    2017-05-16

    In this paper we propose the use of global Kalman filters (KFs) to estimate absolute angles of lower limb segments. Standard approaches adopt KFs to improve the performance of inertial sensors based on individual link configurations. In consequence, for a multi-body system like a lower limb exoskeleton, the inertial measurements of one link (e.g., the shank) are not taken into account in other link angle estimations (e.g., foot). Global KF approaches, on the other hand, correlate the collective contribution of all signals from lower limb segments observed in the state-space model through the filtering process. We present a novel global KF (matricial global KF) relying only on inertial sensor data, and validate both this KF and a previously presented global KF (Markov Jump Linear Systems, MJLS-based KF), which fuses data from inertial sensors and encoders from an exoskeleton. We furthermore compare both methods to the commonly used local KF. The results indicate that the global KFs performed significantly better than the local KF, with an average root mean square error (RMSE) of respectively 0.942° for the MJLS-based KF, 1.167° for the matrical global KF, and 1.202° for the local KFs. Including the data from the exoskeleton encoders also resulted in a significant increase in performance. The results indicate that the current practice of using KFs based on local models is suboptimal. Both the presented KF based on inertial sensor data, as well our previously presented global approach fusing inertial sensor data with data from exoskeleton encoders, were superior to local KFs. We therefore recommend to use global KFs for gait analysis and exoskeleton control.

  2. Molecular Characterization of Yeast Strains Isolated from Different Sources by Restriction Fragment Length Polymorphism

    International Nuclear Information System (INIS)

    Ali, M. S.; Latif, Z.

    2016-01-01

    Various molecular techniques like analysis of the amplified rDNA internal transcribed spacers (ITS), intragenic spacers and total ITS region analysis by restriction fragment length polymorphism (RFLP) has been introduced for yeast identification but there are limited databases to identify yeast species on the basis of 5.8S rDNA. In this study, twenty nine yeast strains from various sources including spoiled fruits, vegetables, foodstuffs, and concentrated juices were characterized by PCR-RFLP. PCR-RFLP has been used to characterize yeasts present in different spoiled food samples after isolation of the yeasts. By using this technique, the isolated yeast strains were characterized by direct 5.8S-ITS rDNA region amplification. RFLP analysis was applied to each of the amplification products (varied from 400bp to 800bp) detected, and the corresponding yeast identifications were made according to each specific restriction patterns obtained after treatment with two endonucleases TaqI and HaeIII which yielded a specific banding pattern for each species. For further confirmation amplified products of eleven selected isolates were sequenced and blast on NCBI. Both RFLP and sequence analyses of the strains with accession nos. KF472163, KF472164, KF472165, KF472166, KF472167, KF472168, KF472169, KF472170, KF472171, KF472172, KF472173 gave significantly similar results. The isolates were found to belong five different yeast species including; Candida spp., Pichia spp., Kluyveromyces spp., Clavispora spp. and Hanseniaspora spp. This method provides a fast, easy, reliable and authentic way for determining yeast population present in different type of samples, as compared to traditional characterization technique. (author)

  3. An Adjoint-Based Adaptive Ensemble Kalman Filter

    KAUST Repository

    Song, Hajoon; Hoteit, Ibrahim; Cornuelle, Bruce D.; Luo, Xiaodong; Subramanian, Aneesh C.

    2013-01-01

    A new hybrid ensemble Kalman filter/four-dimensional variational data assimilation (EnKF/4D-VAR) approach is introduced to mitigate background covariance limitations in the EnKF. The work is based on the adaptive EnKF (AEnKF) method, which bears a strong resemblance to the hybrid EnKF/three-dimensional variational data assimilation (3D-VAR) method. In the AEnKF, the representativeness of the EnKF ensemble is regularly enhanced with new members generated after back projection of the EnKF analysis residuals to state space using a 3D-VAR [or optimal interpolation (OI)] scheme with a preselected background covariance matrix. The idea here is to reformulate the transformation of the residuals as a 4D-VAR problem, constraining the new member with model dynamics and the previous observations. This should provide more information for the estimation of the new member and reduce dependence of the AEnKF on the assumed stationary background covariance matrix. This is done by integrating the analysis residuals backward in time with the adjoint model. Numerical experiments are performed with the Lorenz-96 model under different scenarios to test the new approach and to evaluate its performance with respect to the EnKF and the hybrid EnKF/3D-VAR. The new method leads to the least root-mean-square estimation errors as long as the linear assumption guaranteeing the stability of the adjoint model holds. It is also found to be less sensitive to choices of the assimilation system inputs and parameters.

  4. Real-time muscle state estimation from EMG signals during isometric contractions using Kalman filters.

    Science.gov (United States)

    Menegaldo, Luciano L

    2017-12-01

    State-space control of myoelectric devices and real-time visualization of muscle forces in virtual rehabilitation require measuring or estimating muscle dynamic states: neuromuscular activation, tendon force and muscle length. This paper investigates whether regular (KF) and extended Kalman filters (eKF), derived directly from Hill-type muscle mechanics equations, can be used as real-time muscle state estimators for isometric contractions using raw electromyography signals (EMG) as the only available measurement. The estimators' amplitude error, computational cost, filtering lags and smoothness are compared with usual EMG-driven analysis, performed offline, by integrating the nonlinear Hill-type muscle model differential equations (offline simulations-OS). EMG activity of the three triceps surae components (soleus, gastrocnemius medialis and gastrocnemius lateralis), in three torque levels, was collected for ten subjects. The actualization interval (AI) between two updates of the KF and eKF was also varied. The results show that computational costs are significantly reduced (70x for KF and 17[Formula: see text] for eKF). The filtering lags presented sharp linear relationships with the AI (0-300 ms), depending on the state and activation level. Under maximum excitation, amplitude errors varied in the range 10-24% for activation, 5-8% for tendon force and 1.4-1.8% for muscle length, reducing linearly with the excitation level. Smoothness, measured by the ratio between the average standard variations of KF/eKF and OS estimations, was greatly reduced for activation but converged exponentially to 1 for the other states by increasing AI. Compared to regular KF, extended KF does not seem to improve estimation accuracy significantly. Depending on the particular application requirements, the most appropriate KF actualization interval can be selected.

  5. Pour une nouvelle approche de l'hispanité grâce aux TICE - La formation d'enseignants d'espagnol langue étrangère Towards a new approach of Hispanic culture thanks to ICT - Beginners training for Spanish language teachers

    Directory of Open Access Journals (Sweden)

    Veronique Pugibet

    2006-04-01

    Full Text Available Si désormais les divers pays et cultures du monde hispanique figurent dans les programmes officiels de l'apprentissage de l'espagnol langue étrangère en France, l'approche qui en est proposée demeure encore souvent traditionnelle, une certaine vision de l'histoire et les "beaux" textes dominant largement. Comment amener les jeunes enseignants en formation initiale à porter un regard différent sur l'autre, à atteindre une véritable compétence culturelle dépassant la culture académique ? Nous rendrons compte dans notre étude de la spécificité de la formation initiale des professeurs d'espagnol qui, dorénavant, sont de plus en plus nombreux à être d'origine hispanophone. Nous exposerons leur parcours de formation sur et grâce aux TICE afin de dépasser les clichés réducteurs initiaux comme en témoignent leur approche première sur Internet, et en vue d'atteindre un regard plus ouvert sur l'hispanité et des pratiques pédagogiques différentes.Despite the ongoing presence of several Hispanic countries and cultures in state programs concerning Spanish as a foreign language in French education, the suggested methodology remains very often traditional with a predominantly biased vision of history as well as texts that are considered "beautiful". How can we help young teachers in their initial training to have a different perception of the other, to reach a true cultural competence that surpasses academic culture? We will show in our study the details involved in a Spanish teacher's initial training since, as it appears, they tend to be more and more of Hispanic origin. We will describe their training history through and thanks to the TICE in order to overcome the reductive and stereotyping clichés as they move initially towards the use of Internet, and in order to reach out for a more open perception of the Hispanic World and of different pedagogical practices.

  6. Fast Kalman-like filtering for large-dimensional linear and Gaussian state-space models

    KAUST Repository

    Ait-El-Fquih, Boujemaa; Hoteit, Ibrahim

    2015-01-01

    This paper considers the filtering problem for linear and Gaussian state-space models with large dimensions, a setup in which the optimal Kalman Filter (KF) might not be applicable owing to the excessive cost of manipulating huge covariance matrices. Among the most popular alternatives that enable cheaper and reasonable computation is the Ensemble KF (EnKF), a Monte Carlo-based approximation. In this paper, we consider a class of a posteriori distributions with diagonal covariance matrices and propose fast approximate deterministic-based algorithms based on the Variational Bayesian (VB) approach. More specifically, we derive two iterative KF-like algorithms that differ in the way they operate between two successive filtering estimates; one involves a smoothing estimate and the other involves a prediction estimate. Despite its iterative nature, the prediction-based algorithm provides a computational cost that is, on the one hand, independent of the number of iterations in the limit of very large state dimensions, and on the other hand, always much smaller than the cost of the EnKF. The cost of the smoothing-based algorithm depends on the number of iterations that may, in some situations, make this algorithm slower than the EnKF. The performances of the proposed filters are studied and compared to those of the KF and EnKF through a numerical example.

  7. Novel Kalman filter algorithm for statistical monitoring of extensive landscapes with synoptic sensor data

    Science.gov (United States)

    Raymond L. Czaplewski

    2015-01-01

    Wall-to-wall remotely sensed data are increasingly available to monitor landscape dynamics over large geographic areas. However, statistical monitoring programs that use post-stratification cannot fully utilize those sensor data. The Kalman filter (KF) is an alternative statistical estimator. I develop a new KF algorithm that is numerically robust with large numbers of...

  8. Kahalalide F analogues from the mucous secretion of Indian sacoglossan mollusc Elysia ornata

    Digital Repository Service at National Institute of Oceanography (India)

    Ciavatta, M.L.; PrabhaDevi; Carbone, M.; Mathieu, V.; Kiss, R.; Casapullo, A.; Gavagnin, M.

    , better delivery, or longer half-life. More than 150 analogues were obtained by solid phase peptide synthesis8,9 and more recently a semi-synthetic approach to produce KF analogues starting from natural KF has been also performed.10In parallel...

  9. An iterative ensemble Kalman filter for reservoir engineering applications

    NARCIS (Netherlands)

    Krymskaya, M.V.; Hanea, R.G.; Verlaan, M.

    2009-01-01

    The study has been focused on examining the usage and the applicability of ensemble Kalman filtering techniques to the history matching procedures. The ensemble Kalman filter (EnKF) is often applied nowadays to solving such a problem. Meanwhile, traditional EnKF requires assumption of the

  10. Application of an Ensemble Kalman filter to a 1-D coupled hydrodynamic-ecosystem model of the Ligurian Sea

    NARCIS (Netherlands)

    Lenartz, F.; Raick, C.; Soetaert, K.E.R.; Grégoire, M.

    2007-01-01

    The Ensemble Kalman filter (EnKF) has been applied to a 1-D complex ecosystem model coupled with a hydrodynamic model of the Ligurian Sea. In order to improve the performance of the EnKF, an ensemble subsampling strategy has been used to better represent the covariance matrices and a pre-analysis

  11. Fast Kalman-like filtering for large-dimensional linear and Gaussian state-space models

    KAUST Repository

    Ait-El-Fquih, Boujemaa

    2015-08-13

    This paper considers the filtering problem for linear and Gaussian state-space models with large dimensions, a setup in which the optimal Kalman Filter (KF) might not be applicable owing to the excessive cost of manipulating huge covariance matrices. Among the most popular alternatives that enable cheaper and reasonable computation is the Ensemble KF (EnKF), a Monte Carlo-based approximation. In this paper, we consider a class of a posteriori distributions with diagonal covariance matrices and propose fast approximate deterministic-based algorithms based on the Variational Bayesian (VB) approach. More specifically, we derive two iterative KF-like algorithms that differ in the way they operate between two successive filtering estimates; one involves a smoothing estimate and the other involves a prediction estimate. Despite its iterative nature, the prediction-based algorithm provides a computational cost that is, on the one hand, independent of the number of iterations in the limit of very large state dimensions, and on the other hand, always much smaller than the cost of the EnKF. The cost of the smoothing-based algorithm depends on the number of iterations that may, in some situations, make this algorithm slower than the EnKF. The performances of the proposed filters are studied and compared to those of the KF and EnKF through a numerical example.

  12. Mean-field Ensemble Kalman Filter

    KAUST Repository

    Law, Kody

    2015-01-07

    A proof of convergence of the standard EnKF generalized to non-Gaussian state space models is provided. A density-based deterministic approximation of the mean-field limiting EnKF (MFEnKF) is proposed, consisting of a PDE solver and a quadrature rule. Given a certain minimal order of convergence between the two, this extends to the deterministic filter approximation, which is therefore asymptotically superior to standard EnKF for d < 2 . The fidelity of approximation of the true distribution is also established using an extension of total variation metric to random measures. This is limited by a Gaussian bias term arising from non-linearity/non-Gaussianity of the model, which arises in both deterministic and standard EnKF. Numerical results support and extend the theory.

  13. Multilevel ensemble Kalman filtering

    KAUST Repository

    Hoel, Haakon

    2016-01-08

    The ensemble Kalman filter (EnKF) is a sequential filtering method that uses an ensemble of particle paths to estimate the means and covariances required by the Kalman filter by the use of sample moments, i.e., the Monte Carlo method. EnKF is often both robust and efficient, but its performance may suffer in settings where the computational cost of accurate simulations of particles is high. The multilevel Monte Carlo method (MLMC) is an extension of classical Monte Carlo methods which by sampling stochastic realizations on a hierarchy of resolutions may reduce the computational cost of moment approximations by orders of magnitude. In this work we have combined the ideas of MLMC and EnKF to construct the multilevel ensemble Kalman filter (MLEnKF) for the setting of finite dimensional state and observation spaces. The main ideas of this method is to compute particle paths on a hierarchy of resolutions and to apply multilevel estimators on the ensemble hierarchy of particles to compute Kalman filter means and covariances. Theoretical results and a numerical study of the performance gains of MLEnKF over EnKF will be presented. Some ideas on the extension of MLEnKF to settings with infinite dimensional state spaces will also be presented.

  14. A Stationary North-Finding Scheme for an Azimuth Rotational IMU Utilizing a Linear State Equality Constraint

    Directory of Open Access Journals (Sweden)

    Huapeng Yu

    2015-02-01

    Full Text Available The Kalman filter (KF has always been used to improve north-finding performance under practical conditions. By analyzing the characteristics of the azimuth rotational inertial measurement unit (ARIMU on a stationary base, a linear state equality constraint for the conventional KF used in the fine north-finding filtering phase is derived. Then, a constrained KF using the state equality constraint is proposed and studied in depth. Estimation behaviors of the concerned navigation errors when implementing the conventional KF scheme and the constrained KF scheme during stationary north-finding are investigated analytically by the stochastic observability approach, which can provide explicit formulations of the navigation errors with influencing variables. Finally, multiple practical experimental tests at a fixed position are done on a postulate system to compare the stationary north-finding performance of the two filtering schemes. In conclusion, this study has successfully extended the utilization of the stochastic observability approach for analytic descriptions of estimation behaviors of the concerned navigation errors, and the constrained KF scheme has demonstrated its superiority over the conventional KF scheme for ARIMU stationary north-finding both theoretically and practically.

  15. The Ensemble Kalman Filter for Groundwater Plume Characterization: A Case Study.

    Science.gov (United States)

    Ross, James L; Andersen, Peter F

    2018-04-17

    The Kalman filter is an efficient data assimilation tool to refine an estimate of a state variable using measured data and the variable's correlations in space and/or time. The ensemble Kalman filter (EnKF) (Evensen, 2004, 2009) is a Kalman filter variant that employs Monte Carlo analysis to define the correlations that help to refine the updated state. While use of EnKF in hydrology is somewhat limited, it has been successfully applied in other fields of engineering (e.g. oil reservoir modeling, weather forecasting). Here, EnKF is used to refine a simulated groundwater TCE plume that underlies the Tooele Army Depot-North (TEAD-N) in Utah, based on observations of TCE in the aquifer. The resulting EnKF-based assimilated plume is simulated forward in time to predict future plume migration. The correlations that underpin EnKF updating implicitly contain information about how the plume developed over time under the influence of complex site hydrology and variable source history, as they are predicated on multiple realizations of a well-calibrated numerical groundwater flow and transport model. The EnKF methodology is compared to an ordinary kriging-based assimilation method with respect to the accurate representation of plume concentrations in order to determine the relative efficacy of EnKF for water quality data assimilation. This article is protected by copyright. All rights reserved.

  16. Multilevel ensemble Kalman filtering

    KAUST Repository

    Hoel, Haakon; Chernov, Alexey; Law, Kody; Nobile, Fabio; Tempone, Raul

    2016-01-01

    The ensemble Kalman filter (EnKF) is a sequential filtering method that uses an ensemble of particle paths to estimate the means and covariances required by the Kalman filter by the use of sample moments, i.e., the Monte Carlo method. EnKF is often both robust and efficient, but its performance may suffer in settings where the computational cost of accurate simulations of particles is high. The multilevel Monte Carlo method (MLMC) is an extension of classical Monte Carlo methods which by sampling stochastic realizations on a hierarchy of resolutions may reduce the computational cost of moment approximations by orders of magnitude. In this work we have combined the ideas of MLMC and EnKF to construct the multilevel ensemble Kalman filter (MLEnKF) for the setting of finite dimensional state and observation spaces. The main ideas of this method is to compute particle paths on a hierarchy of resolutions and to apply multilevel estimators on the ensemble hierarchy of particles to compute Kalman filter means and covariances. Theoretical results and a numerical study of the performance gains of MLEnKF over EnKF will be presented. Some ideas on the extension of MLEnKF to settings with infinite dimensional state spaces will also be presented.

  17. 1986 progress report on R and D work of the Nuclear Fusion Project (PKF)

    International Nuclear Information System (INIS)

    Kast, G.

    1987-03-01

    The Kernforschungszentrum Karlsruhe (KfK) and the Max-Planck-Institute for Plasma Physics, Garching, have joined to form the Entwicklungsgemeinschaft Kernfusion, and under this roof perform research work on the physical and technical conditions and requirements of using the energy from nuclear fusion, and to plan the design and the construction of the necessary equipment for future large-scale experiments. The activities of the KfK for the development of fusion devices with magnetic confinement have been concentrated in the Nuclear Fusion Project, which cooperates in the European Fusion Technology Programme, on the basis of an association agreement between KfK and Euratom, supported by the European Commission. Supplementary KfK contributions, studies in most cases, create a connection between various fields of work, and prepare the road for new tasks, which in the years to come will be found in the extension of the Fusion Technology Programme and the planning work for NET. The reports collected in this annual survey are contributions from KfK Institutes of the year 1986. An annex presents the Easks taken over by KfK within the Fusion Technology Programme of the EC, and notes on the KfK Institutes taking part in the particular activities facilitate reference to the individual, full-text reports. (orig.) [de

  18. The calcium fluoride effect on properties of cryolite melts feasible for low-temperature production of aluminum and its alloys

    Science.gov (United States)

    Tkacheva, O.; Dedyukhin, A.; Redkin, A.; Zaikov, Yu.

    2017-07-01

    The CaF2 effect on the liquidus temperature, electrical conductivity and alumina solubility in the potassium-sodium and potassium-lithium cryolite melts with cryolite ratio (CR = (nKF+nMF)/nAlF3, M = Li, Na) 1.3 was studied. The liquidus temperature in the quisi-binary system [KF-LiF-AlF3]-CaF2 changes with the same manner as in the [KF-NaF-AlF3]-CaF2. The electrical conductivity in the KF-NaF-AlF3-CaF2 melt decreases with increasing the CaF2 content, but it slightly raises with the first small addition of CaF2 into the KF-LiF-AlF3-CaF2 melts, enriched with KF, which was explained by the increased K+ ions mobility due to their relatively low ionic potential. The contribution of the Li+ cations in conductivity of the KF-LiF-AlF3-CaF2 electrolyte is not noteworthy. The Al2O3 solubility in the KF-NaF-AlF3 electrolyte rises with the increasing KF content, but the opposite tendency is observed in the cryolite mixtures containing CaF2. The insoluble compounds - KCaAl2F9 or KCaF3 - formed in the molten mixtures containing potassium and calcium ions endorse the increase of the liquidus temperature. The calcium fluoride effect on the side ledge formation in the electrolytic cell during low-temperature aluminum electrolysis is discussed.

  19. Notices about using elementary statistics in psychology

    OpenAIRE

    松田, 文子; 三宅, 幹子; 橋本, 優花里; 山崎, 理央; 森田, 愛子; 小嶋, 佳子

    2003-01-01

    Improper uses of elementary statistics that were often observed in beginners' manuscripts and papers were collected and better ways were suggested. This paper consists of three parts: About descriptive statistics, multivariate analyses, and statistical tests.

  20. Primer and barcode gap identification and DNA barcode generation for species discrimination in plants

    OpenAIRE

    Deepu Mathew

    2015-01-01

    This book chapter details the protocols for DNA barcoding in plants, starting from DNA isolation, sequencing, sequence annotation using MEGA, till identification of barcode gaps. A good chapter for beginners in plant taxonomy

  1. Python for secret agents

    CERN Document Server

    Lott, Steven F

    2014-01-01

    If you are a Python beginner who is looking to learn the language through interesting projects, this book is for you. A basic knowledge of programming and statistics is beneficial to get the most out of the book.

  2. Using maps in genealogy

    Science.gov (United States)

    ,

    2002-01-01

    In genealogical research, maps can provide clues to where our ancestors may have lived and where to look for written records about them. Beginners should master basic genealogical research techniques before starting to use topographic maps.

  3. "Kohtume Eestis!" algtaseme keelefunktsioonidest lähtudes / Elle Sõrmus

    Index Scriptorium Estoniae

    Sõrmus, Elle

    2002-01-01

    Rets. rmt.: Sander, Klarika. Kohtume Eestis! : eestin kielen alkeisoppikirja = Estonian for beginners. Helsinki : Finn Lectura, 1999. 202 lk. + 1 helikassett. Õpik on mõeldud täiskasvanud õppijale, kes alustab eesti keele õppimist algtasemel

  4. Scipy Lecture Notes : One document to learn numerics, science, and data with Python

    OpenAIRE

    Varoquaux , Gaël; Gouillart , Emmanuelle; Vahtras , Olav; Haenel , Valentin; Rougier , Nicolas P.; Gommers , Ralf; Pedregosa , Fabian; Jędrzejewski-Szmek , Zbigniew; Virtanen , Pauli; Combelles , Christophe; Pinte , Didrik; Cimrman , Robert; Espaze , André; Chauve , Adrien; Burns , Christopher

    2015-01-01

    International audience; Tutorials on the scientific Python ecosystem: a quick introduction to central tools and techniques. The different chapters each correspond to a 1 to 2 hours course with increasing level of expertise, from beginner to expert.

  5. Soome ja ameerika koreograafide tööd Eesti tantsulaval / Maria Goltsman

    Index Scriptorium Estoniae

    Goltsman, Maria

    2010-01-01

    Tantsulavastustest "Ballroom for Beginners" ("Algajate tantsusaal"), koreograaf Jenni Kivelä, esietendus 7. mail Kumu auditooriumis ja Cid Pearlmani "This is what we do in the winter" ("See, mida me talvel teeme"), esietendus 25. mail Kanuti gildi saalis

  6. Ghana Mining Journal - Vol 15, No 1 (2015)

    African Journals Online (AJOL)

    ... on Post Processed Differential Global Positioning System (DGPS) Data – A Case ... Application of Surpac and Whittle Software in Open Pit Optimisation and ... What's on the Minds of Beginner Mining and Related Engineering Students?

  7. Data Science and Some Instruments

    Directory of Open Access Journals (Sweden)

    Corina SBUGHEA

    2017-12-01

    Full Text Available This paper is addressed to beginners, who want to form an overview on the field of Data Science, on the skills needed to access available IT tools, for obtaining meaningful and valuable analyzes in developing new strategies.

  8. A simple application of the Newman-Penrose spin coefficient formalism

    International Nuclear Information System (INIS)

    Davis, T.M.

    1976-01-01

    As a simple application of the Newman-Penrose spin coefficient formalism, useful for beginners, the vacuum symmetry (Schwarzschild) solution is found. The calculations also show that all spherically symmetric metrics are Petrov type D. (author)

  9. Validation of meter-scale surface faulting offset measurements from high-resolution topographic data

    KAUST Repository

    Salisbury, J. Barrett; Haddad, D.E.; Rockwell, T.; Arrowsmith, J R.; Madugo, C.; Zielke, Olaf; Scharer, K.

    2015-01-01

    trends from which we formulate best-practice and reporting recommendations for remote studies. In addition, a series of public and beginner-level studies validate the remote methodology for a number of tools and emphasize considerations to enhance

  10. Raspberry Pi mechatronics projects hotshot

    CERN Document Server

    Yamanoor, Sai

    2015-01-01

    This book is targeted towards beginners and intermediate designers of mechatronic systems and embedded system design. Some familiarity with the Raspberry Pi and Python programming is preferred but not required.

  11. Express.js blueprints

    CERN Document Server

    Augarten, Ben; Lin, Eric; Shaikh, Aidha; Soriani, Fabiano Pereira; Tisserand, Geoffrey; Zhang, Chiqing; Zhang, Kan

    2015-01-01

    This book is for beginners to Node.js and also for those who are technically advanced. By the end of this book, every competent developer will have achieved expertise in building web applications with Express.js.

  12. Practical web development

    CERN Document Server

    Wellens, Paul

    2015-01-01

    This book is perfect for beginners who want to get started and learn the web development basics, but also offers experienced developers a web development roadmap that will help them to extend their capabilities.

  13. Design and fabrication of diffractive optical elements with MATLAB

    National Research Council Canada - National Science Library

    Bhattacharya, Shanti (Professor in Optics); Vijayakumar, Anand

    2017-01-01

    ... their diffraction patterns using MATLAB. The fundamentals of fabrication techniques such as photolithography, electron beam lithography, and focused ion beam lithography with basic instructions for the beginner are presented...

  14. Software development on the SAP HANA platform

    CERN Document Server

    Walker, Mark

    2013-01-01

    Software Development on the SAP HANA Platform is a general tutorial guide to SAP HANA.This book is written for beginners to the SAP HANA platform. No knowledge of SAP HANA is necessary to start using this book.

  15. Nature Study Tips. Spiders.

    Science.gov (United States)

    Mulaik, Stanley B.

    1990-01-01

    Different types of spiders, their ranges and habits are discussed. Activities associated with the study of spiders are suggested. Four references are listed which may be of interest to beginners. (CW)

  16. Surev luik, ärkavad mälestused ja radioaktiivsus / Kairi Prints

    Index Scriptorium Estoniae

    Prints, Kairi, 1977-

    2010-01-01

    Koreograaf-lavastaja Dmitri Hartšenko loodud Tallinna Tantsuteatri tantsuetendus "Vestlus luigega", koreograaf Jenni Kivelä "Ballroom for Beginners" tantsuteater ZICK, Jo Strømgreni "The Experiment" Jo Strømgren Kompanii esituses

  17. Clean data

    CERN Document Server

    Squire, Megan

    2015-01-01

    If you are a data scientist of any level, beginners included, and interested in cleaning up your data, this is the book for you! Experience with Python or PHP is assumed, but no previous knowledge of data cleaning is needed.

  18. Mailing list italiana sul logo

    Directory of Open Access Journals (Sweden)

    Leda Alice Lombardo

    1995-01-01

    Full Text Available Information and contacts related to Logo, a programming language created to be accessible to beginners and can also be used by children and at the same time, provide ample opportunity to expert.

  19. Mastering Lumion 3D

    CERN Document Server

    Cardoso, Ciro

    2014-01-01

    This book is designed for all levels of Lumion users; from beginner to advanced, you will find useful insights and professional techniques to improve and develop your skills in order to fully control and master Lumion.

  20. Calculation of neutron streaming through complicated pathes with the MORSE code

    International Nuclear Information System (INIS)

    Fang Bangcheng.

    1987-01-01

    A procedure to solve a concrete engineering problem of neutron leakage with MORSE program is presented. The methodology used in treating some difficult problems and the biasing techniques are useful to the beginners of the MORSE program