French courses for Beginners

CERN Multimedia

HR Department

2009-01-01

French courses for beginners (level 0) will take place from 13 July to 27 August 2009. •\tTimetable: Mondays, Tuesdays, Wednesdays, Thursdays (11.00 to 13.00 or 13.30 to 15.30) •\tDuration: 56 hours (8 hours a week) •\tPrice: 728 CHF For registration and further information on the courses, please consult our Web pages: http://cern.ch/Training or contact Mrs. Dumeaux : Tel. 78144.

TestNG beginner's guide

CERN Document Server

Menon, Varun

2013-01-01

This book is written in a friendly, beginner's guide style with plenty of step-by-step instructions with appropriate examples.This book is great for developers and testers who are new to TestNg and want to learn how to use TestNG for writing their application as well as functional tests. This book assumes that you have experience in Java and OOPs concepts and have worked with certain IDE.

PhoneGap 3 beginner's guide

CERN Document Server

Natili, Giorgio

2013-01-01

Written in a friendly, example-driven Beginner's Guide format, there are plenty of step-by-step instructions to help you get started with PhoneGap.If you are a web developer or mobile application developer interested in an examples-based approach to learning mobile application development basics with PhoneGap, then this book is for you.

Transforming beginner teacher mentoring interventions for social ...

African Journals Online (AJOL)

Transforming beginner teacher mentoring interventions for social reform. ... for developing scholarship of teaching, as it is aligned with the role of scholar and ... Keywords: Action research; learning styles; mentoring practice; professional ...

Reduction of Used Memory Ensemble Kalman Filtering (RumEnKF): A data assimilation scheme for memory intensive, high performance computing

Science.gov (United States)

Hut, Rolf; Amisigo, Barnabas A.; Steele-Dunne, Susan; van de Giesen, Nick

2015-12-01

Reduction of Used Memory Ensemble Kalman Filtering (RumEnKF) is introduced as a variant on the Ensemble Kalman Filter (EnKF). RumEnKF differs from EnKF in that it does not store the entire ensemble, but rather only saves the first two moments of the ensemble distribution. In this way, the number of ensemble members that can be calculated is less dependent on available memory, and mainly on available computing power (CPU). RumEnKF is developed to make optimal use of current generation super computer architecture, where the number of available floating point operations (flops) increases more rapidly than the available memory and where inter-node communication can quickly become a bottleneck. RumEnKF reduces the used memory compared to the EnKF when the number of ensemble members is greater than half the number of state variables. In this paper, three simple models are used (auto-regressive, low dimensional Lorenz and high dimensional Lorenz) to show that RumEnKF performs similarly to the EnKF. Furthermore, it is also shown that increasing the ensemble size has a similar impact on the estimation error from the three algorithms.

Electric conductivity of salt melts containing KCL, KF and K2TaF7

International Nuclear Information System (INIS)

Agulyanskij, A.I.; Stangrit, P.T.; Konstantinov, V.I.

1978-01-01

Given are electric conductivity measurement results depending on the temperature and composition of the molten KF-K 2 TaF 7 , KCl-K 2 TaF 7 systems and also melts close in their composition to industrial electrolytes, KCl-KF (in mass ratio of 2:1) with addition of K 2 TaF 7 up to 25 mass%. Presented are electric conductivity molecular isotherms of the KF-K 2 TaF 7 , KCl-K 2 TaF 7 systems at 800 deg C and specific electric conductivity dependence of KCl-KF-K 2 TaF 7 melts on K 2 TaF 7 composition at 800 deg C and 900 deg C. Proceeding from the shape of molecular and specific electric conductivity isotherms a conclusion is made about existence of the following tantalum-containing ions: TaF 7 2- , TaF 6 - and TaF 6 Cl 2- in the investigated melts

Joomla! 3 beginner's guide

CERN Document Server

Tiggeler, Eric

2014-01-01

An easy to use, step-by-step guide to creating professional, mobile-friendly websites with the free Joomla CMS. The Joomla! 3 Beginner's Guide Second Edition is the ultimate guide for web developers who wish to build upon their skills and knowledge on creating websites. Even if you're new to this subject, you won't have any difficulty understanding the clear and friendly instructions and explanations. No prior knowledge of HTML and CSS is required.

What are the important manoeuvres for beginners to minimize surgical time in primary total knee arthroplasty?

Science.gov (United States)

Harato, Kengo; Maeno, Shinichi; Tanikawa, Hidenori; Kaneda, Kazuya; Morishige, Yutaro; Nomoto, So; Niki, Yasuo

2016-08-01

It was hypothesized that surgical time of beginners would be much longer than that of experts. Our purpose was to investigate and clarify the important manoeuvres for beginners to minimize surgical time in primary total knee arthroplasty (TKA) as a multicentre study. A total of 300 knees in 248 patients (averaged 74.6 years) were enrolled. All TKAs were done using the same instruments and the same measured resection technique at 14 facilities by 25 orthopaedic surgeons. Surgeons were divided into three surgeon groups (four experts, nine medium-volume surgeons and 12 beginners). The surgical technique was divided into five phases. Detailed surgical time and ratio of the time in each phase to overall surgical time were recorded and compared among the groups in each phase. A total of 62, 119, and 119 TKAs were done by beginners, medium-volume surgeons, and experts, respectively. Significant differences in surgical time among the groups were seen in each phase. Concerning the ratio of the time, experts and medium-volume surgeons seemed cautious in fixation of the permanent component compared to other phases. Interestingly, even in ratio, beginners and medium-volume surgeons took more time in exposure of soft tissue compared to experts. (0.14 in beginners, 0.13 in medium-volume surgeons, 0.11 in experts, P time in exposure and closure of soft tissue compared to experts. Improvement in basic technique is essential to minimize surgical time among beginners. First of all, surgical instructors should teach basic techniques in primary TKA for beginners. Therapeutic studies, Level IV.

PILOT: A Programming Language for Beginners.

Science.gov (United States)

Schnorr, Janice M.

The presentation describes PILOT (Programmed Inquiry, Learning or Teaching), a special programing language easy for beginners to learn and available for several brands of microcomputers. PILOT is explained to contain substantially fewer commands than most other languages and to be written in an easy to understand manner. Edit commands and their…

Velocity of sound in, and adiabatic compressibility of, Molten LiF-NaF, LiF-KF, NaF-KF mixtures

International Nuclear Information System (INIS)

Minchenko, V.I.; Konovalov, Y.V.; Smirnov, M.V.

1986-01-01

The authors measured the velocity of sound as a function of temperature at 1.5 zHM frequency in LiF-NaF, NaF-KF, LiF-KF melts over the entire range of their compositions. The measurements were made by comparison of the phases of a reference pulse signal and a signal reflected from the bottom of the crucible. The specified temperatures were maintained constant within plus or minus 1 degree. The sound conductor consisted of a cylindrical rod of sintered beryllium oxide, which does not interact with test melts. The study shows that the velocity of sound decreases linearly with increase of the temperature. The values of the constants of the empirical equations are presented in a table, with indication of the temperature range. The dependence of the velocity of sound on composition of the melts is shown, where isotherms for 1250 K are given as an example. Variation of the composition by 1-2 mole % leads to increase or decrease of the velocity of sound by 5-10 m

qooxdoo Beginner's Guide

CERN Document Server

Raffi, Mohamed

2011-01-01

This is a Packt beginner's guide. The unique style of the book is to set the requirements for an application, Team Twitter, in the first chapter and apply the concepts in the application as you learn in the following chapters. When you complete this book, you would have developed a complete application. Although the scope of this book is only on the Qooxdoo framework, which is a client side framework, we have explained how to set up one of the RPC servers and demonstrated the end to end application in the Team Twitter. This book is intended for the client side developers who design and develop

Stochastic cooling for beginners

International Nuclear Information System (INIS)

Moehl, D.

1984-01-01

These two lectures have been prepared to give a simple introduction to the principles. In Part I we try to explain stochastic cooling using the time-domain picture which starts from the pulse response of the system. In Part II the discussion is repeated, looking more closely at the frequency-domain response. An attempt is made to familiarize the beginners with some of the elementary cooling equations, from the 'single particle case' up to equations which describe the evolution of the particle distribution. (orig.)

NumPy 1.5 Beginner's Guide

CERN Document Server

Idris, Ivan

2011-01-01

The book is written in beginner's guide style with each aspect of NumPy demonstrated by real world examples. There is appropriate explained code with the required screenshots thrown in for the novice. This book is for the programmer, scientist or engineer, who has basic Python knowledge and would like to be able to do numerical computations with Python.

Shifting ontologies of a serious game and its relationships with English education for beginners

DEFF Research Database (Denmark)

Hansbøl, Mikala; Meyer, Bente

2011-01-01

  This paper takes its point of departure in a language project, which is a subproject under the larger ongoing (2007-2011) research project Serious Games on a Global Market Place. The language project follows how the virtual universe known as Mingoville ( http://www.mingoville.com/ ) becomes an ...... and learning situations of English for beginners. Keywords: Entanglement approach, relational ontology, serious games, teaching and learning English for beginners, educational technology research...... an actor in English education for beginners. The virtual universe provides an online environment for students beginning to learn English in schools and at home. This paper will focus on the shifting ontologies of Mingoville and teaching and learning situations in beginners' English. This paper takes its......  This paper takes its point of departure in a language project, which is a subproject under the larger ongoing (2007-2011) research project Serious Games on a Global Market Place. The language project follows how the virtual universe known as Mingoville ( http://www.mingoville.com/ ) becomes...

Oracle Data Guard 11gR2 administration beginner's guide

CERN Document Server

Baransel, Emre

2013-01-01

Using real-world examples and hands-on tasks, Oracle Data Guard 11gR2 Administration Beginner's Guide will give you a solid foundation in Oracle Data Guard. It has been designed to teach you everything you need to know to successfully create and operate Data Guard environments with maximum flexibility, compatibility, and effectiveness.If you are an Oracle database administrator who wants to configure and administer Data Guard configurations, then ""Oracle Data Guard 11gR2 Administration Beginner's Guide"" is for you. With a basic understanding of Oracle database administration, you'll be able

Influence of KF substitution on the ferroelectric phase transition of lead titanate single crystals studied by Brillouin light scattering

Directory of Open Access Journals (Sweden)

Seonhyeop Shin

2015-06-01

Full Text Available The elastic properties of KF-substituted perovskite lead titanate (PbTiO3 were investigated by dielectric measurements and Brillouin light scattering. The ferroelectric phase transition occurred at substantially lower temperature due to KF substitution, which was attributed to the modification of the covalency in Pb–O and Ti–O bonds. The longitudinal acoustic (LA mode of KF-substituted PbTiO3 showed a frequency softening in the paraelectric phase, which was accompanied by increasing acoustic damping. This indicated that polarization fluctuations responsible for the acoustic anomalies were enhanced by KF substitution.

Astronomy for beginners

CERN Document Server

Becan, Jeff

2008-01-01

Astronomy For Beginners is a friendly and accessible guide to our universe, our galaxy, our solar system and the planet we call home. Each year as we cruise through space on this tiny blue-green wonder, a number of amazing and remarkable events occur. For example, like clockwork, we'll run head-on into asteroid and cometary debris that spreads shooting stars across our skies. On occasion, we'll get to watch the disk of the Moon passing the Sun, casting its shadow on the face of the Earth, and sometimes we'll get to watch our own shadow as it glides across the face of the Moon. The Sun's path w

Density of salt melts containing KF, KCl, K2TaF7 and Ta2O5

International Nuclear Information System (INIS)

Agulyanskij, A.I.; Stangrit, P.T.; Konstantinov, V.I.

1978-01-01

The results of density measurements by hydrostatic weighing are given for molten K 2 TaF 7 - KF, K 2 TaF 7 -KCL, K 2 TaF 7 - KF - KCl and K 2 TaF 7 - KF - KCl - Ta 2 O 5 mixtures depending on their temperature and composition. The density of the last two systems was measured at compositions close to those of commercial electrolytes. The obtained specific volume - composition dependencies show that no interaction is taking place in the mixtures studied. It is, therefore, believed that, in the K 2 TaF 7 - KF melt, tantalum is mainly present as a complex TaF 7 2- ion, and, in the K 2 TaF 7 - KCl mlt, a certain amount of TaF 6 - ions may be formed along with TaF 7 2-

Irrlicht 17 Realtime 3D Engine Beginner's Guide

CERN Document Server

Stein, Johannes

2011-01-01

A beginner's guide with plenty of screenshots and explained code. If you have C++ skills and are interested in learning Irrlicht, this book is for you. Absolutely no knowledge of Irrlicht is necessary for you to follow this book!

GeoServer beginner's guide

CERN Document Server

Youngblood, Brian

2013-01-01

Step-by-step instructions are included and the needs of a beginner are totally satisfied by the book. The book consists of plenty of examples with accompanying screenshots and code for an easy learning curve. You are a web developer with knowledge of server side scripting, and have experience with installing applications on the server. You have a desire to want more than Google maps, by offering dynamically built maps on your site with your latest geospatial data stored in MySQL, PostGIS, MsSQL or Oracle. If this is the case, this book is meant for you.

CFEngine 3 Beginner's Guide

CERN Document Server

Rajneesh

2011-01-01

Part of Packt's Beginner's Guide series, this book guides you through setting up Cfengine to maximizing its potential. This book focuses on getting you through all the major learning points in a smooth, logical order. You'll also learn how to avoid some common pitfalls. If you are a System Administrator or Configuration manager with a growing infrastructure and if you are looking for a dependable tool to manage your infrastructure, then this book is for you. If your infrastructure is already big with hundreds and thousands of nodes and you are looking for a secure, versatile and stable configu

Beginner teacher professional development: An action research and ...

African Journals Online (AJOL)

Tanya

beginner teacher taking part in an 'education sink or swim gala' be empowered to help transform society? Society in the .... greatest challenges that were perceived then and are still present ..... mentees 1, 4 and 5 have a triple dominant profile,.

Ensemble singular vectors and their use as additive inflation in EnKF

Directory of Open Access Journals (Sweden)

Shu-Chih Yang

2015-07-01

Full Text Available Given an ensemble of forecasts, it is possible to determine the leading ensemble singular vector (ESV, that is, the linear combination of the forecasts that, given the choice of the perturbation norm and forecast interval, will maximise the growth of the perturbations. Because the ESV indicates the directions of the fastest growing forecast errors, we explore the potential of applying the leading ESVs in ensemble Kalman filter (EnKF for correcting fast-growing errors. The ESVs are derived based on a quasi-geostrophic multi-level channel model, and data assimilation experiments are carried out under framework of the local ensemble transform Kalman filter. We confirm that even during the early spin-up starting with random initial conditions, the final ESVs of the first analysis with a 12-h window are strongly related to the background errors. Since initial ensemble singular vectors (IESVs grow much faster than Lyapunov Vectors (LVs, and the final ensemble singular vectors (FESVs are close to convergence to leading LVs, perturbations based on leading IESVs grow faster than those based on FESVs, and are therefore preferable as additive inflation. The IESVs are applied in the EnKF framework for constructing flow-dependent additive perturbations to inflate the analysis ensemble. Compared with using random perturbations as additive inflation, a positive impact from using ESVs is found especially in areas with large growing errors. When an EnKF is ‘cold-started’ from random perturbations and poor initial condition, results indicate that using the ESVs as additive inflation has the advantage of correcting large errors so that the spin-up of the EnKF can be accelerated.

Review: Ways of teaching struggling reading students, and beginners

African Journals Online (AJOL)

Review: Ways of teaching struggling reading students, and beginners. ... International Journal of Pedagogy, Policy and ICT in Education. Journal Home · ABOUT THIS JOURNAL ... AJOL African Journals Online. HOW TO USE AJOL.

RavenDB 2.x beginner's guide

CERN Document Server

Tannir, Khaled

2013-01-01

Written in a friendly, example-driven Beginner's Guide format, there are plenty of step-by-step instructions and examples that are designed to help you get started with RavenDB. If you are a .NET developer, new to document-oriented databases, and you wish to learn how to build applications using NoSQL databases, then this book is for you. Experience with relational database systems will be helpful, but not necessary.

iAd Production Beginner's Guide

CERN Document Server

Collier, Ben

2012-01-01

This beginner's guide focuses on getting you through all the major learning points in a smooth, logical order. You'll also see how to avoid some common pitfalls. This book is for brands, advertisers and developers who want to create compelling, emotive, iAd advertisements that generate revenue and increase brand awareness. You don't need previous experience of creating adverts or apps for iPhone and iPad, as you'll be taken through the entire process to make motion-rich, beautiful ads.

Electric conductivity of low-temperature molten electrolyte KF-AlF3 with additions of LiF and Al2O3

International Nuclear Information System (INIS)

Apisarov, A.P.; Kryukovskij, V.A.; Zajkov, Yu.P.; Red'kin, A.A.; Tkacheva, O.Yu.; Khokhlov, V.A.

2007-01-01

Electric conductivity of LiF, Al 2 O 3 doped KF-AlF 3 (Cryolite Ratio CR=1.3) molten electrolytes was estimated on the basis of empiric equations. Specific electric conductivity of KF-AlF 3 , KF-AIF 3 -AI 2 O 3 , KF-AlF 3 -LiF, KF-AlF 3 -LiF-Al 2 0 3 molten mixtures was measured in the range 687-797 Deg C. Cells with the pyrolytic boron nitride capillary and parallel molybdena electrodes were applied for the determination of electric conductivity. Comparison of calculated and experimental data of the specific electric conductivity of cryolite-alumina melts confirms that the offered model of the calculation adequate represents temperature and concentration dependencies, and it permits forecasting its change under the introduction of different additives in electrolyte [ru

A Proposal of a Color Music Notation System on a Single Melody for Music Beginners

Science.gov (United States)

Kuo, Yi-Ting; Chuang, Ming-Chuen

2013-01-01

Music teachers often encounter obstructions in teaching beginners in music reading. Conventional notational symbols require beginners to spend significant amount of time in memorizing, which discourages learning at early stage. This article proposes a newly-developed color music notation system that may improve the recognition of the staff and the…

Android NDK Beginner's Guide

CERN Document Server

Ratabouil, Sylvain

2012-01-01

This beginner's guide focuses on getting you through all the major learning points in a smooth, logical order. You'll also see how to avoid some common pitfalls. Are you an Android Java programmer who needs more performance? Are you a C/C++ developer who doesn't want to bother with Java stuff and its out-of-control garbage collector? Do you want to create fast intensive multimedia applications or games? Answer yes to any of the above and this book is for you. With some general knowledge of C/C++ development, you will be able to dive head first into native Android development.

Efficient KF loaded on MgCaAl hydrotalcite-like compounds in the transesterification of Jatropha curcas oil

International Nuclear Information System (INIS)

Guzmán-Vargas, Ariel; Santos-Gutiérrez, Teresa; Lima, Enrique; Flores-Moreno, Jorge L.; Oliver-Tolentino, Miguel A.; Martínez-Ortiz, María de J.

2015-01-01

Highlights: • MgCaAl hydrotalcite-like compounds were synthetized. • After KF impregnation and calcination fluorinated species were detected. • Fluorinated species were stables and actives. • LDH composition and KF load effect were evaluated in biodiesel production. - Abstract: In this work a series of MgCaAl hydrotalcite-like compounds were synthetized by coprecipitation method at constant pH. In order to obtain the catalysts, the samples were modified with KF by incipient wetness impregnation at different wt%, after that, they were dried and calcined to obtain the mixed oxides. The effect of divalent cations ratio and KF load were studied in the transesterification reaction of Jatropha curcas oil to obtain biodiesel employing an inedible oil. XRD analysis showed typical diffraction patterns of LDH, by nitrogen physisorption the LDH mesoporous structure was also confirmed, 27 Al NMR spectra showed bands at 10 and 88 ppm attributed to the Al coordination before and after thermal treatment. While for the impregnated samples after calcination the profiles exhibited the mixed oxide formation, in addition, another peaks appeared associated to the formation of various fluorinated species as shown by XRD, additionally, 19 F NMR showed a main signal at −180 ppm indicating the presence of active tetrahedral aluminum fluoride species. The reaction evolution was monitoring calculating the oil conversion to biodiesel by integration of the signal spectra using 1 H NMR spectroscopy. The results of catalytic tests in transesterification reaction showed a direct correlation between Mg/Ca ratio and KF content in the oil conversion to biodiesel, the higher conversion was achieved (90%) when Mg/Ca = 1 and KF load was 30 wt%

Efficient KF loaded on MgCaAl hydrotalcite-like compounds in the transesterification of Jatropha curcas oil

Energy Technology Data Exchange (ETDEWEB)

Guzmán-Vargas, Ariel, E-mail: aguzmanv@ipn.mx [ESIQIE-IPN, Departamento de Ingeniería Química, Laboratorio de Investigación en Materiales Porosos, Catálisis Ambiental y Química Fina, UPALM Edif.7 P.B. Zacatenco, México D.F. 07738 (Mexico); Santos-Gutiérrez, Teresa [ESIQIE-IPN, Departamento de Ingeniería Química, Laboratorio de Investigación en Materiales Porosos, Catálisis Ambiental y Química Fina, UPALM Edif.7 P.B. Zacatenco, México D.F. 07738 (Mexico); Lima, Enrique [IIM-Universidad Nacional Autónoma de México, Circuito exterior s/n, Cd. Universitaria, 04510 México DF (Mexico); Flores-Moreno, Jorge L. [UAM-Azcapotzalco, Área de Química de Materiales, Av. San Pablo 180, Col. Reynosa Tamaulipas, 02200 México DF (Mexico); Oliver-Tolentino, Miguel A.; Martínez-Ortiz, María de J. [ESIQIE-IPN, Departamento de Ingeniería Química, Laboratorio de Investigación en Materiales Porosos, Catálisis Ambiental y Química Fina, UPALM Edif.7 P.B. Zacatenco, México D.F. 07738 (Mexico)

2015-09-15

Highlights: • MgCaAl hydrotalcite-like compounds were synthetized. • After KF impregnation and calcination fluorinated species were detected. • Fluorinated species were stables and actives. • LDH composition and KF load effect were evaluated in biodiesel production. - Abstract: In this work a series of MgCaAl hydrotalcite-like compounds were synthetized by coprecipitation method at constant pH. In order to obtain the catalysts, the samples were modified with KF by incipient wetness impregnation at different wt%, after that, they were dried and calcined to obtain the mixed oxides. The effect of divalent cations ratio and KF load were studied in the transesterification reaction of Jatropha curcas oil to obtain biodiesel employing an inedible oil. XRD analysis showed typical diffraction patterns of LDH, by nitrogen physisorption the LDH mesoporous structure was also confirmed, {sup 27}Al NMR spectra showed bands at 10 and 88 ppm attributed to the Al coordination before and after thermal treatment. While for the impregnated samples after calcination the profiles exhibited the mixed oxide formation, in addition, another peaks appeared associated to the formation of various fluorinated species as shown by XRD, additionally, {sup 19}F NMR showed a main signal at −180 ppm indicating the presence of active tetrahedral aluminum fluoride species. The reaction evolution was monitoring calculating the oil conversion to biodiesel by integration of the signal spectra using {sup 1}H NMR spectroscopy. The results of catalytic tests in transesterification reaction showed a direct correlation between Mg/Ca ratio and KF content in the oil conversion to biodiesel, the higher conversion was achieved (90%) when Mg/Ca = 1 and KF load was 30 wt%.

Python 3 Web Development Beginner's Guide

CERN Document Server

Anders, Michel

2011-01-01

Part of Packt's Beginner's Guide Series, this book follows a sample application, with lots of screenshots, to help you get to grips with the techniques as quickly as possible. Moderately experienced Python programmers who want to learn how to create fairly complex, database-driven, cross browser compatible web apps that are maintainable and look good will find this book of most use. All key technologies except for Python 3 are explained in detail.

Android Apps for Absolute Beginners

CERN Document Server

Jackson, Wallace

2011-01-01

Anybody can start building simple apps for the Android platform, and this book will show you how! Android Apps for Absolute Beginners takes you through the process of getting your first Android applications up and running using plain English and practical examples. It cuts through the fog of jargon and mystery that surrounds Android application development, and gives you simple, step-by-step instructions to get you started.* Teaches Android application development in language anyone can understand, giving you the best possible start in Android development * Provides simple, step-by-step exampl

Reasoning process characteristics in the diagnostic skills of beginner, competent, and expert dentists.

Science.gov (United States)

Crespo, Kathleen E; Torres, José E; Recio, María E

2004-12-01

The purpose of this study was to evaluate qualitative differences in the diagnostic reasoning process at different developmental stages of expertise. A qualitative design was used to study cognitive processes that characterize the diagnosis of oral disease at the stages of beginner (five junior students who had passed the NBDE I), competent (five GPR first-year residents), and expert dentists (five general dentists with ten or more years of experience). Individually, each participant was asked to determine the diagnosis of an oral condition based on a written clinical case, using the think aloud technique and retrospective reports. A subsequent interview was conducted to obtain the participants' diagnostic process model and pathophysiology of the case. The analysis of the verbal protocols indicated that experts referred to the patient's sociomedical context more frequently, demonstrated better organization of ideas, could determine key clinical findings, and had an ability to plan for the search of pertinent information. Fewer diagnostic hypotheses were formulated by participants who used forward reasoning, independent of the stage of development. Beginners requested additional diagnostic aids (radiographs, laboratory tests) more frequently than the competent/expert dentists. Experts recalled typical experiences with patients, while competent/beginner dentists recalled information from didactic courses. Experts evidenced cognitive diagnostic schemas that integrate pathophysiology of disease, while competent and beginner participants had not achieved this integration. We conclude that expert performance is a combination of a knowledge base, reasoning skills, and an accumulation of experiences with patients that is qualitatively different from that of competent and beginner dentists. It is important for dental education to emphasize the teaching of cognitive processes and to incorporate a wide variety of clinical experiences in addition to the teaching of

Facile preparation of highly pure KF-ZrF4 molten salt

Science.gov (United States)

Zong, Guoqiang; Cui, Zhen-Hua; Zhang, Zhi-Bing; Zhang, Long; Xiao, Ji-Chang

2018-03-01

The preparation of highly pure KF-ZrF4 (FKZr) molten salt, a potential secondary coolant in molten salt reactors, was realized simply by heating a mixture of (NH4)2ZrF6 and KF. X-ray diffraction analysis indicated that the FKZr molten salt was mainly composed of KZrF5 and K2ZrF6. The melting point of the prepared FKZr molten salt was 420-422 °C under these conditions. The contents of all metal impurities were lower than 20 ppm, and the content of oxygen was lower than 400 ppm. This one-step protocol avoids the need for a tedious procedure to prepare ZrF4 and for an additional purification process to remove oxide impurities, and is therefore a convenient, efficient and economic preparation method for high-purity FKZr molten salt.

Android 30 Animations Beginner's Guide

CERN Document Server

Shaw, Alex

2011-01-01

Written in Packt's Beginner's Guide series, this book takes a step-by-step approach with each chapter made up of three to five tutorials that introduce and explain different animation concepts. All concepts are explained with real-world examples that are fun to read and work with. If you are familiar with developing Android applications and want to bring your apps to life by adding smashing animations, then this book is for you. The book assumes that you are comfortable with Java development and have familiarity with creating Android Views in XML and Java. The tutorials assume that you will wa

Draft Genome Sequence of Cupriavidus pauculus Strain KF709, a Biphenyl-Utilizing Bacterium Isolated from Biphenyl-Contaminated Soil

OpenAIRE

Watanabe, Takahito; Yamazoe, Atsushi; Hosoyama, Akira; Fujihara, Hidehiko; Suenaga, Hikaru; Hirose, Jun; Futagami, Taiki; Goto, Masatoshi; Kimura, Nobutada; Furukawa, Kensuke

2015-01-01

We report the draft genome sequence of Cupriavidus pauculus strain KF709, which comprises 6,826,799 bp with 6,272 coding sequences. The strain KF709 utilizes biphenyl and degrades low-chlorinated biphenyls; however, it possesses fewer coding sequences involved in the degradation of aromatic compounds than other strains belonging to the Betaproteobacteria.

The Solubility of Aluminum in Cryolite-Based Electrolyte-Containing KF

Science.gov (United States)

Zhang, Yu; Yu, Jiangyu; Gao, Bingliang; Liu, Yibai; Hu, Xianwei; Shi, Zhongning; Wang, Zhaowen

2016-04-01

The solubility of aluminum in NaF-AlF3-CaF2-KF-A12O3 electrolyte system at 1253 K (980 °C) has been measured by the analysis of quenched samples saturated with aluminum. The content of the dissolved metal in the quenched melt was determined by collecting the volume of hydrogen gas when a finely crushed sample is treated with HCl. Addition of 0 to 5 pct KF has no obvious effect on the solubility of aluminum in cryolite-based melts with molar ratio of NaF/AlF3 (cryolite ratio) ranging from 2.2 to 3.0. The solubility of aluminum increases from 0.015 to 0.026 wt pct with cryolite ratio increases from 2.2 to 4.0 in the NaF-AlF3-5 wt pct CaF2-3 wt pct A12O3 electrolyte at 1253 K (980 °C). Aluminum solubility was affected by both chemical replacement reaction of Al + 3NaF = AlF3 + 3Na and physical dissolution.

French courses for beginners

CERN Multimedia

Françoise Benz

2006-01-01

If you wish to participate in one of the following courses, please tell to your supervisor and apply electronically from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an 'application for training'form available from your Departmental Secretariat or from your DTO (Departmental Training Officer). Applications will be accepted in the order in which they are received. French courses for beginners (level 0) From 17 July to 31 August 2006. Mondays, Tuesdays, Wednesdays and Thursdays(8 hours a week / between 11.00 and 15.30) Duration: 56 hours Price: 728 CHF For registration and further information on the courses, please consult our Web pages: http://cern.ch/Training or contact Mrs. Benz: Tel. 73127.

Joint Parametric Fault Diagnosis and State Estimation Using KF-ML Method

DEFF Research Database (Denmark)

Sun, Zhen; Yang, Zhenyu

2014-01-01

The paper proposes a new method for a kind of parametric fault online diagnosis with state estimation jointly. The considered fault affects not only the deterministic part of the system but also the random circumstance. The proposed method first applies Kalman Filter (KF) and Maximum Likelihood (...

NET 40 Generics Beginner's Guide

CERN Document Server

Mukherjee, Sudipta

2012-01-01

This is a concise, practical guide that will help you learn Generics in .NET, with lots of real world and fun-to-build examples and clear explanations. It is packed with screenshots to aid your understanding of the process. This book is aimed at beginners in Generics. It assumes some working knowledge of C# , but it isn't mandatory. The following would get the most use out of the book: Newbie C# developers struggling with Generics. Experienced C++ and Java Programmers who are migrating to C# and looking for an alternative to other generic frameworks like STL and JCF would find this book handy.

Draft Genome Sequence of Cupriavidus pauculus Strain KF709, a Biphenyl-Utilizing Bacterium Isolated from Biphenyl-Contaminated Soil.

Science.gov (United States)

Watanabe, Takahito; Yamazoe, Atsushi; Hosoyama, Akira; Fujihara, Hidehiko; Suenaga, Hikaru; Hirose, Jun; Futagami, Taiki; Goto, Masatoshi; Kimura, Nobutada; Furukawa, Kensuke

2015-03-26

We report the draft genome sequence of Cupriavidus pauculus strain KF709, which comprises 6,826,799 bp with 6,272 coding sequences. The strain KF709 utilizes biphenyl and degrades low-chlorinated biphenyls; however, it possesses fewer coding sequences involved in the degradation of aromatic compounds than other strains belonging to the Betaproteobacteria. Copyright © 2015 Watanabe et al.

User manual for the KfK code PCROSS

International Nuclear Information System (INIS)

Ravndal, S.; Oblozinsky, P.; Kelzenberg, S.; Cierjacks, S.

1991-08-01

The PCROSS code calculates the so-called 'pseudo' cross sections for sequential (x,n) reactions and merges them together with 'collapsed' cross sections for neutron induced reactions into one file of cross sections. The file is tailored to provide an input for the FISPACT inventory code that calculates the activation and related radiological quantities of material irradiated in a neutron flux. The present report describes the structure of the KfK code PCROSS, outlines the role of subroutines, and provides necessary information for a practical user of the code. (orig.) [de

Visual media processing using Matlab beginner's guide

CERN Document Server

Siogkas, George

2013-01-01

Written in a friendly, Beginner's Guide format, showing the user how to use the digital media aspects of Matlab (image, video, sound) in a practical, tutorial-based style.This is great for novice programmers in any language who would like to use Matlab as a tool for their image and video processing needs, and also comes in handy for photographers or video editors with even less programming experience wanting to find an all-in-one tool for their tasks.

R statistical application development by example : beginner's guide

CERN Document Server

Tattar, Narayanachart Prabhanjan

2013-01-01

Full of screenshots and examples, this Beginner's Guide by Example will teach you practically everything you need to know about R statistical application development from scratch. You will begin learning the first concepts of statistics in R which is vital in this fast paced era and it is also a bargain as you do not need to do a preliminary course on the subject.

Electrochemical behavior of boron in LiF-NaF-KF- melts

DEFF Research Database (Denmark)

Polyakova, L.P.; Bukatova, G.A.; Polyakova, E.G.

1996-01-01

The electrochemical reduction of B(III) to B(0) in KBF4-LiF-NaF-KF melts has been studied by voltammetric and chronopotentiometric methods, Glassy carbon, Pt, and Ag were used as working electrode materials. Only in the case of Ag was the reduction not complicated by interaction between boron...

An adaptive hybrid EnKF-OI scheme for efficient state-parameter estimation of reactive contaminant transport models

KAUST Repository

El Gharamti, Mohamad; Valstar, Johan R.; Hoteit, Ibrahim

2014-01-01

Reactive contaminant transport models are used by hydrologists to simulate and study the migration and fate of industrial waste in subsurface aquifers. Accurate transport modeling of such waste requires clear understanding of the system's parameters, such as sorption and biodegradation. In this study, we present an efficient sequential data assimilation scheme that computes accurate estimates of aquifer contamination and spatially variable sorption coefficients. This assimilation scheme is based on a hybrid formulation of the ensemble Kalman filter (EnKF) and optimal interpolation (OI) in which solute concentration measurements are assimilated via a recursive dual estimation of sorption coefficients and contaminant state variables. This hybrid EnKF-OI scheme is used to mitigate background covariance limitations due to ensemble under-sampling and neglected model errors. Numerical experiments are conducted with a two-dimensional synthetic aquifer in which cobalt-60, a radioactive contaminant, is leached in a saturated heterogeneous clayey sandstone zone. Assimilation experiments are investigated under different settings and sources of model and observational errors. Simulation results demonstrate that the proposed hybrid EnKF-OI scheme successfully recovers both the contaminant and the sorption rate and reduces their uncertainties. Sensitivity analyses also suggest that the adaptive hybrid scheme remains effective with small ensembles, allowing to reduce the ensemble size by up to 80% with respect to the standard EnKF scheme. © 2014 Elsevier Ltd.

Synthesis of biodiesel using potassium fluoride (KF) supported by hydrotalcite and process optimization by Box-Behnken design

Energy Technology Data Exchange (ETDEWEB)

Singh, Bhaskar; Sharma, Yogesh C. [Banaras Hindu University, Department of Applied Chemistry, Institute of Technology, Varanasi (India); Birla, Ashish; Upadhyay, S.N. [Banaras Hindu University, Department of Chemical Engineering and Technology, Institute of Technology, Varanasi (India); Yaakob, Zahira [Universiti Kebangsaan Malaysia, Department of Chemical and Process Engineering, Selangor (Malaysia)

2012-12-15

Biodiesel has been developed using a heterogeneous catalyst potassium fluoride (KF) supported on hydrotalcite (HT) and waste frying oil (WFO) as feedstock. Hydrotalcite was synthesized by co-precipitation method using mixture of Mg(NO{sub 3}){sub 2}.6H{sub 2}O and Al(NO{sub 3}){sub 2}.9H{sub 2}O slowly added to a solution containing NaOH and Na{sub 2}CO{sub 3} and calcined at 500 C. KF was impregnated on hydrotalcite at KF/HT load ratio of 80:100 by addition of a small amount of water. Biodiesel was developed using KF/HT as heterogeneous catalyst by transesterification. Box-Behnken Design using Minitab 15.1 Statistical Software and Design-Expert (Demo version 8.0.6.1) software were used as statistical tool for design of experiments and optimization of fatty acid methyl ester yield. A high yield and conversion of biodiesel was obtained by optimization of variables affecting the reaction. The variables affected the reaction in the priority order of: catalyst amount >> molar ratio (methanol to oil) > reaction time. A 12:1 methanol to WFO molar ratio, 2.5 wt.% of catalyst at 60 C in 1 h reaction time gave a high fatty acid methyl ester yield of >98 %. The quantitative analysis of the product (i.e., biodiesel) was done on a Fourier-transform-nuclear magnetic resonance spectrometer. (orig.)

An adaptive hybrid EnKF-OI scheme for efficient state-parameter estimation of reactive contaminant transport models

KAUST Repository

El Gharamti, Mohamad

2014-09-01

Reactive contaminant transport models are used by hydrologists to simulate and study the migration and fate of industrial waste in subsurface aquifers. Accurate transport modeling of such waste requires clear understanding of the system\\'s parameters, such as sorption and biodegradation. In this study, we present an efficient sequential data assimilation scheme that computes accurate estimates of aquifer contamination and spatially variable sorption coefficients. This assimilation scheme is based on a hybrid formulation of the ensemble Kalman filter (EnKF) and optimal interpolation (OI) in which solute concentration measurements are assimilated via a recursive dual estimation of sorption coefficients and contaminant state variables. This hybrid EnKF-OI scheme is used to mitigate background covariance limitations due to ensemble under-sampling and neglected model errors. Numerical experiments are conducted with a two-dimensional synthetic aquifer in which cobalt-60, a radioactive contaminant, is leached in a saturated heterogeneous clayey sandstone zone. Assimilation experiments are investigated under different settings and sources of model and observational errors. Simulation results demonstrate that the proposed hybrid EnKF-OI scheme successfully recovers both the contaminant and the sorption rate and reduces their uncertainties. Sensitivity analyses also suggest that the adaptive hybrid scheme remains effective with small ensembles, allowing to reduce the ensemble size by up to 80% with respect to the standard EnKF scheme. © 2014 Elsevier Ltd.

Eclipse plugin development by example beginner's guide

CERN Document Server

Blewitt, Alex

2013-01-01

A Beginner's Guide following the ""by Example"" approach. There will be 5-8 major examples that will be used in the book to develop advanced plugins with the Eclipse IDE.This book is for Java developers who are familiar with Eclipse as a Java IDE and are interested in learning how to develop plug-ins for Eclipse. No prior knowledge of Eclipse plug-in development or OSGi is necessary, although you are expected to know how to create, run, and debug Java programs in Eclipse.

A beginner's guide to the literature search in medical education.

Science.gov (United States)

Martin, S; Hussain, Z; Boyle, J G

2017-05-01

Conducting a literature search can be a daunting prospect if you have not done it before. This article aims to provide a beginner's guide to searching the medical education literature, by describing how to construct an effective search strategy, the resources that are available and the basics of how searching works.

Zend framework 2.0 by example beginner's guide

CERN Document Server

Shasankar, Krishna

2013-01-01

Zend Framework 2.0 by Example: Beginner's Guide is a step-by-step guide that aims to empower you to build web applications packed with some really exciting features using Zend Framework 2.0.If you are a PHP Developer who is new to Zend Framework, but you want to get hands-on with the product quickly, this book is for you. Basic knowledge of object oriented programming with PHP is expected.

Metabolic characterization and transformation of the non-dairy Lactococcus lactis strain KF147, for production of ethanol from xylose

DEFF Research Database (Denmark)

Petersen, Kia Vest; Liu, Jianming; Chen, Jun

2017-01-01

producing ethanol as the sole fermentation product with a high yield corresponding to 83% of the theoretical maximum. The results clearly indicate the great potential of using the more metabolically diverse non-dairy L. lactis strains for bio-production based on xylose containing feedstocks.......The non-dairy lactic acid bacterium Lactococcus lactis KF147 can utilize xylose as the sole energy source. To assess whether KF147 could serve as a platform organism for converting second generation sugars into useful chemicals, we characterized growth and product formation for KF147 when grown...... the arcA gene encoding the arginine deiminase. The fermentation product profile suggested two routes for xylose degradation, the phosphoketolase pathway and the pentose phosphate pathway. Inactivation of the phosphoketolase pathway redirected the entire flux through the pentose phosphate pathway whereas...

[Beginners' operations and medical specialist standards : Avoidance of criminal liability and civil liability].

Science.gov (United States)

Schneider, H

2018-05-16

In all phases, patients are entitled to receive medical treatment according to medical specialist standards. This does not mean that patients necessarily have to be treated by a medical specialist. Operations performed by "beginners", e. g. assistant physicians, are permitted. However, there are increased liability risks, both for the specialist and the assistant physician. Furthermore, there are risks of criminal responsibility for causing bodily harm by negligence or negligent manslaughter. This article portrays the requirements of civil liability and criminal responsibility concerning beginners' operations on the basis of cases and judgments of the Federal Court and the Higher Regional Courts in Germany. Additionally, the reception of the jurisprudence by the relevant legal literature will be discussed. Jurisprudence and legal literature categorize breaches of duty of care. Assistant physicians can be subject to contributory negligence liabilities, while specialists can bear liabilities for negligent selection, organization or supervision. Responsible specialist and assistant physicians can protect themselves (and the patient) and avoid legal risks by only performing operations adequate to their educational level or by delegating operations to beginners and ensuring intervention by a specialist by supervision of the operation which is suitable to the assistant physician's level of education.

jQuery for designers beginner's guide

CERN Document Server

MacLees, Natalie

2014-01-01

A step-by-step guide that spices up your web pages and designs them in the way you want using the most widely used JavaScript library, jQuery. The beginner-friendly and easy-to-understand approach of the book will help get to grips with jQuery in no time. If you know the fundamentals of HTML and CSS, and want to extend your knowledge by learning to use JavaScript, then this is just the book for you. jQuery makes JavaScript straightforward and approachable - you'll be surprised at how easy it can be to add animations and special effects to your beautifully designed pages.

Colloquial French the complete course for beginners

CERN Document Server

Demouy, Valérie

2015-01-01

Colloquial French: The Complete Course for Beginners has been carefully developed by an experienced teacher to provide a step-by-step course to French as it is written and spoken today. Combining a clear, practical and accessible style with a methodical and thorough treatment of the language, it equips learners with the essential skills needed to communicate confidently and effectively in French in a broad range of situations. No prior knowledge of the language is required. Colloquial French is exceptional; each unit presents a wealth of grammatical points that are reinforced with a wide range

Biphenyl Modulates the Expression and Function of Respiratory Oxidases in the Polychlorinated-Biphenyls Degrader Pseudomonas pseudoalcaligenes KF707

Directory of Open Access Journals (Sweden)

Federica Sandri

2017-06-01

Full Text Available Pseudomonas pseudoalcaligenes KF707 is a soil bacterium which is known for its capacity to aerobically degrade harmful organic compounds such as polychlorinated biphenyls (PCBs using biphenyl as co-metabolite. Here we provide the first genetic and functional analysis of the KF707 respiratory terminal oxidases in cells grown with two different carbon sources: glucose and biphenyl. We identified five terminal oxidases in KF707: two c(caa3 type oxidases (Caa3 and Ccaa3, two cbb3 type oxidases (Cbb31 and Cbb32, and one bd type cyanide-insensitive quinol oxidase (CIO. While the activity and expression of both Cbb31 and Cbb32 oxidases was prevalent in glucose grown cells as compared to the other oxidases, the activity and expression of the Caa3 oxidase increased considerably only when biphenyl was used as carbon source in contrast to the Cbb32 oxidase which was repressed. Further, the respiratory activity and expression of CIO was up-regulated in a Cbb31 deletion strain as compared to W.T. whereas the CIO up-regulation was not present in Cbb32 and C(caa3 deletion mutants. These results, together, reveal that both function and expression of cbb3 and caa3 type oxidases in KF707 are modulated by biphenyl which is the co-metabolite needed for the activation of the PCBs-degradation pathway.

Production of a Biofuel that Keeps the Glycerol as a Monoglyceride by Using Supported KF as Heterogeneous Catalyst

Directory of Open Access Journals (Sweden)

Juan Calero

2014-06-01

Full Text Available This study describes the results obtained in the synthesis of a biofuel that avoids the production of glycerol by applying supported KF as alkaline heterogeneous catalyst, to generate two moles of fatty acid methyl esters and one mole of monoglyceride from one mol of triglyceride. In this respect, the selective transesterification process of sunflower oil with methanol was carried out with KF (10 wt% supported on three different solids, Al2O3, ZnO and MgO. The standard experimental conditions employed in the heterogeneous selective methanolysis reaction were: 12 mL of sunflower oil, 2.7 mL of methanol, 0.8 g of catalyst, at 65 °C temperature and one hour of reaction time. In all cases 100% conversion was obtained, with high selectivity values, greater than 90%, and quite suitable viscosity values, 4.5–8.5 cSt. In this way, the best catalytic behavior in the first use was obtained by using Al2O3 as support. However, although in the five consecutive reuses all catalysts exhibited a continuous decrease in their catalytic activities; the lower one was for KF catalyst using MgO as support. In summary, these three KF supported catalysts are very suitable to obtain a new biofuel, similar to conventional biodiesel, applicable to diesel engines.

Electric conductivity of molten mixtures of ternary mutual KF-KCl-ZrF4 system

International Nuclear Information System (INIS)

Darienko, S.E.; Raspopin, S.P.; Chervinskij, Yu.F.

1988-01-01

Using the relative capillary method at the frequency of 50 kHz the specific electric conductivity of molten mixtures of the KF-KCl-ZnF 4 system is measured. All the measurements were made in the atmosphere of purified argon. Temperature dependence of electric conductivity of the mixtures studied (800-1260 K) is described by the equations of exponential type with sufficient accuracy. Curves of identical specific electric conductivity of the three-component system are presented. With an increase in zirconium tetrachloride concentration in the mixtures electric conductivity of the melts decreases. On the basis of the measurement results of KF-ZrF 4 and KCl-ZrF 4 molten mixture specific electric conductivity and data on the melt density the values of molar electric conductivity at 1200 K are calculated

Report on research and development work 1985 on the nuclear fusion project. Annual report of the Association KfK-Euratom

International Nuclear Information System (INIS)

Finken, D.

1986-05-01

The Nuclear Research Centre Karlsruhe and the Max Planck Institute for Plasma Physics together form the Nuclear Fusion Development Association. The partners collaborate with the aim of creating the physical and technical preconditions for the use of the energy released by nuclear fusion and to plan and carry out future large-scale experiments. The work of the Nuclear Research Centre Karlsruhe on fusion with magnetic containment is included in the nuclear fusion project and is part of the European fusion technology programme. The work is supported by an association contract between KfK and Euratom by the European Commission. Connections are built up between areas of work and new projects are prepared by supplementary KfK contributions, mostly studies. This is done with regard to the expansion of the technology programme to be expected for future years and the planning activities for NET. The reports collected here are contributions of the KfK institutes in 1985. The appendix contains a list of the tasks which KfK has taken over from the fusion technology programme of the EEC. References to the institutes' contributions make the assignment of textual contributions easier. (orig.) [de

A beginner's guide to 3D printing 14 simple toy designs to get you started

CERN Document Server

Rigsby, Mike

2014-01-01

A Beginner''s Guide to 3D Printing is the perfect resource for those who would like to experiment with 3D design and manufacturing, but have little or no technical experience with the standard software. Author Mike Rigsby leads readers step-by-step through 15 simple toy projects, each illustrated with screen caps of Autodesk 123D Design, the most common free 3D software available. The projects are later described using Sketchup, another free popular software package. Beginning with basics projects that will take longer to print than design, readers are then given instruction on more advanced t

Nuclear fusion project. Semi-annual report of the Association KfK/EURATOM

International Nuclear Information System (INIS)

Kast, G.

1988-07-01

Short communications give a survey of 38 technology tasks, the development of ECRH power sources at 150 GHz, and 9 NET study are listed in the appendices I and II, respectively, while the KfK departments contributing to the Fusion Project and the Fusion Project Management Staff are listed in appendices III and IV, respectively. (GG)

Relativity and quantum physics for beginners

CERN Document Server

Manly, Steven L

2009-01-01

As we humans have expanded our horizons to see things vastly smaller, faster, larger, and farther than ever before, we have been forced to confront preconceptions born of the human experience and create wholly new ways of looking at the world around us. The theories of relativity and quantum physics were developed out of this need and have provided us with phenomenal, mind-twisting insights into the strange and exciting reality show of our universe.Relativity and Quantum Physics For Beginners is an entertaining and accessible introduction to the bizarre concepts that fueled the scientific revolution of the 20th century and led to amazing advances in our understanding of the universe.

Enhancing Beginners' Second Language Learning through an Informal Online Environment

Science.gov (United States)

Chakowa, Jessica

2018-01-01

Web 2.0 tools are used increasingly to support second language learning, but there have been limited studies involving beginner learners, multiple technologies, and informal settings. This current study addresses this gap and investigates the factors affecting students' interest in a nongraded online learning environment and what kinds of tools,…

Collection Development for the School Library Media Program: A Beginner's Guide

Science.gov (United States)

Kerby, Mona

2006-01-01

A valuable resource for new or experienced school librarians, "Collection Development for the School Library Media Program: A Beginner's Guide" is an easy-to-use guide to collection development. It provides practical and relevant information about collection development issues such as: the school users, policies, selection criteria and sources,…

Nuclear fusion project. Semi-annual report of the Association KfK/EURATOM

International Nuclear Information System (INIS)

Kast, G.

1987-05-01

This semi-annual report gives 36 short descriptions of the work done in the framework of the Nuclear Fusion Project and outlines studies for NET/INTOR and for ECRH power sources at 150 GHz. Tables of fusion technology contracts, of NET contracts, of KfK departments contributing to the Fusion Project, and of the Fusion Project management staff complete this report. (GG)

Semiokapitalismus und imperiale Kontrollgesellschaft Zur Digitalisierung der Produktion am Beginn des 21. Jahrhunderts

Directory of Open Access Journals (Sweden)

Wolfgang Neurath

2014-12-01

Full Text Available Wolfgang Neurath analysiert angesichts des kybernetischen Semiokapitalismus und des durch ihn entstandenen "Kognitariats" in welcher Art und Weise digitale Produktions- und Wertschöpfungsprozesse am Beginn des 21. Jahrhunderts zur Kontrolle eingesetzt werden ...

Specific problems of beginners at study of programming and possibilities of their solution

OpenAIRE

Procházková, Petra

2017-01-01

This thesis deals with the problems of beginners in the study of programming at University of Economics in Prague, Faculty of Informatics and Statistics. This applies particularly to students who are studying the subject Programming in Java.

Language Training: French course for beginners

CERN Multimedia

Françoise Benz

2004-01-01

If you wish to participate in one of the following courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. A French course for beginners (level 0) will take place from 12 July to 27 August. Timetable: not yet fixed Duration: 54 hours / 2 hours a day Price: CHF 702 Please enrol as soon as possible through the Web: http://cern.ch/Training FORMATION EN LANGUES LANGUAGE TRAINING Françoise Benz 73127 language.training@cern.ch

Language Training: French course for beginners

CERN Multimedia

Françoise Benz

2004-01-01

If you wish to participate in one of the following courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. A French course for beginners (level 0) will take place from 12 July to 27 August. Timetable: not yet fixed Duration: 54 hours / 2 hours a day Price: 702 SF Please enrol as soon as possible through the Web: http://cern.ch/Training FORMATION EN LANGUES LANGUAGE TRAINING Françoise Benz 73127 language.training@cern.ch

Vaadin 7 UI design by example beginner's guide

CERN Document Server

Duarte, Alejandro

2013-01-01

This book is a hands-on Beginner's Guide for developers who are new to Vaadin and/or Vaadin UI components. The book will teach readers through examples to use each of the exciting components to build and add various aspects of the user interface to their web apps.If you have experience with the Java language and want to create web applications that look good without having to deal with HTML, XML, and JavaScript, this book is for you. Basic Java programming skills are required, but no web development knowledge is needed at all.

Nuclear Fusion Project. Semi-annual report of the Association KfK/EURATOM

International Nuclear Information System (INIS)

Kast, G.

1987-12-01

Short communications give a survey of 38 technology tasks, the development of ECRH power sources at 150 GHz, and 8 NET study contracts. The fusion technology contracts and the NET contracts are listed in the appendices I and II, respectively, while the KfK departments contributing to the Fusion Project and the Fusion Project Management Staff are listed in appendices III and IV, respectively. (GG)

Programming Languages or Generic Software Tools, for Beginners' Courses in Computer Literacy?

Science.gov (United States)

Neuwirth, Erich

1987-01-01

Discussion of methods that can be used to teach beginner courses in computer literacy focuses on students aged 10-12. The value of using a programing language versus using a generic software package is highlighted; Logo and Prolog are reviewed; and the use of databases is discussed. (LRW)

Interfacial phenomena in the reactions of Al-B, Al-Ti-B, and Al-Zr-B alloys with KF-AlF3 and NaF-AlF3 melts

International Nuclear Information System (INIS)

Lee, M.S.; Terry, B.S.; Grieveson, P.

1993-01-01

The interfacial phenomena occurring during the contacting of liquid Al-B, Al-Ti-B, and Al-Zr-B melts with KF-AlF 3 liquid fluxes have been investigated by optical examination of quenched metal drops previously immersed in the liquid fluxes. Reactions in the Al-B/KF-AlF 3 system involve the formation of metastable AlB 12 at the metal/flux interface. At high KBF 4 levels in the flux, the AlB 12 is dispersed in the flux and also at low KBF 4 levels in the metal. Reactions in the Al-Ti-B/KF-AlF 3 system involve the formation of TiB 2 , which may be dispersed in either the metal or the flux depending upon the composition of the flux. The results obtained for the Al-Ti-B/NaF-AlF 3 and Al-Zr-B/KF-AlF 3 systems were similar to those observed for the Al-Ti-B/KF-AlF 3 system

CS Circles: An In-Browser Python Course for Beginners

OpenAIRE

Pritchard, David; Vasiga, Troy

2012-01-01

Computer Science Circles is a free programming website for beginners that is designed to be fun, easy to use, and accessible to the broadest possible audience. We teach Python since it is simple yet powerful, and the course content is well-structured but written in plain language. The website has over one hundred exercises in thirty lesson pages, plus special features to help teachers support their students. It is available in both English and French. We discuss the philosophy behind the cour...

OXIDATION OF POLYCHLORINATED BIPHENYLS BY PSEUDOMONAS SP. STRAIN LB400 AND PSEUDOMONAS PSEUDOALCALIGENES KF707

Science.gov (United States)

Biphenyl-grown cells and cell extracts prepared from biphenyl-grown cells of Pseudomonas sp. strain LB400 oxidize a much wider range of chlorinated biphenyls than do analogous preparations from Pseudomonas pseudoalcaligenes KF707. These results are attributed to differences in th...

KfK-seminar series on supercomputing und visualization from May till September 1992

International Nuclear Information System (INIS)

Hohenhinnebusch, W.

1993-05-01

During the period of may 1992 to september 1992 a series of seminars was held at KfK on several topics of supercomputing in different fields of application. The aim was to demonstrate the importance of supercomputing and visualization in numerical simulations of complex physical and technical phenomena. This report contains the collection of all submitted seminar papers. (orig./HP) [de

Discovering SQL A Hands-On Guide for Beginners

CERN Document Server

Kriegel, Alex

2011-01-01

Teaching the SQL skills that businesses demand when hiring programmers If you're a SQL beginner, you don't just want to learn SQL basics, you also want to get some practical SQL skills you can use in the job market. This book gives you both. Covering the basics through intermediate topics with clear explanations, hands-on exercises, and helpful solutions, this book is the perfect introduction to SQL. Topics include both the current SQL:2008 standards, the upcoming SQL:2011 standards, and also how to use SQL against current releases of the most popular commercial SQL databases, such as Oracle,

Extended software for the KfK K-edge densitometer

International Nuclear Information System (INIS)

Eberle, H.

1985-04-01

In order to further exploit the possibilities of the KfK K-edge densitometer, and to enlarge the range of its application, we have extended and modified the instrument's software. With the new software packages the instrument can now be used for analysis of the actinide elemments Th, U, Np, Pu and Am in single element solutions, and for the simultaneous assay of U and Pu in mixed U/Pu solutions. Provisions have been made for later extensions, allowing the analysis of additional elements combinations, if necessary. The report gives a short description of the new programs, and of the modifications to the previous programs. The listings and the corresponding programs are given in the Appendix. (orig./HP)

­Genomic data mining of the marine actinobacteria Streptomyces sp. H-KF8 unveils insights into multi-stress related genes and metabolic pathways involved in antimicrobial synthesis

Directory of Open Access Journals (Sweden)

Agustina Undabarrena

2017-02-01

Full Text Available Streptomyces sp. H-KF8 is an actinobacterial strain isolated from marine sediments of a Chilean Patagonian fjord. Morphological characterization together with antibacterial activity was assessed in various culture media, revealing a carbon-source dependent activity mainly against Gram-positive bacteria (S. aureus and L. monocytogenes. Genome mining of this antibacterial-producing bacterium revealed the presence of 26 biosynthetic gene clusters (BGCs for secondary metabolites, where among them, 81% have low similarities with known BGCs. In addition, a genomic search in Streptomyces sp. H-KF8 unveiled the presence of a wide variety of genetic determinants related to heavy metal resistance (49 genes, oxidative stress (69 genes and antibiotic resistance (97 genes. This study revealed that the marine-derived Streptomyces sp. H-KF8 bacterium has the capability to tolerate a diverse set of heavy metals such as copper, cobalt, mercury, chromate and nickel; as well as the highly toxic tellurite, a feature first time described for Streptomyces. In addition, Streptomyces sp. H-KF8 possesses a major resistance towards oxidative stress, in comparison to the soil reference strain Streptomyces violaceoruber A3(2. Moreover, Streptomyces sp. H-KF8 showed resistance to 88% of the antibiotics tested, indicating overall, a strong response to several abiotic stressors. The combination of these biological traits confirms the metabolic versatility of Streptomyces sp. H-KF8, a genetically well-prepared microorganism with the ability to confront the dynamics of the fjord-unique marine environment.

Is Contrast Enhanced Ultrasonography a useful tool in a beginner's hand? How much can a Computer Assisted Diagnosis prototype help in characterizing the malignancy of focal liver lesions?

Science.gov (United States)

Moga, Tudor Voicu; Popescu, Alina; Sporea, Ioan; Danila, Mirela; David, Ciprian; Gui, Vasile; Iacob, Nicoleta; Miclaus, Gratian; Sirli, Roxana

2017-08-23

Contrast enhanced ultrasound (CEUS) improved the characterization of focal liver lesions (FLLs), but is an operatordependent method. The goal of this paper was to test a computer assisted diagnosis (CAD) prototype and to see its benefit in assisting a beginner in the evaluation of FLLs. Our cohort included 97 good quality CEUS videos[34% hepatocellular carcinomas (HCC), 12.3% hypervascular metastases (HiperM), 11.3% hypovascular metastases (HipoM), 24.7% hemangiomas (HMG), 17.5% focal nodular hyperplasia (FNH)] that were used to develop a CAD prototype based on an algorithm that tested a binary decision based classifier. Two young medical doctors (1 year CEUS experience), two experts and the CAD prototype, reevaluated 50 FLLs CEUS videos (diagnosis of benign vs. malignant) first blinded to clinical data, in order to evaluate the diagnostic gap beginner vs. expert. The CAD classifier managed a 75.2% overall (benign vs. malignant) correct classification rate. The overall classification rates for the evaluators, before and after clinical data were: first beginner-78%; 94%; second beginner-82%; 96%; first expert-94%; 100%; second expert-96%; 98%. For both beginners, the malignant vs. benign diagnosis significantly improved after knowing the clinical data (p=0.005; p=0,008). The expert was better than the beginner (p=0.04) and better than the CAD (p=0.001). CAD in addition to the beginner can reach the expert diagnosis. The most frequent lesions misdiagnosed at CEUS were FNH and HCC. The CAD prototype is a good comparing tool for a beginner operator that can be developed to assist the diagnosis. In order to increase the classification rate, the CAD system for FLL in CEUS must integrate the clinical data.

iClone 431 3D Animation Beginner's Guide

CERN Document Server

McCallum, MD

2011-01-01

This book is a part of the Beginner's guide series, wherein you will quickly start doing tasks with precise instructions. Then the tasks will be followed by explanation and then a challenging task or a multiple choice question about the topic just covered. Do you have a story to tell or an idea to illustrate? This book is aimed at film makers, video producers/compositors, vxf artists or 3D artists/designers like you who have no previous experience with iClone. If you have that drive inside you to entertain people via the internet on sites like YouTube or Vimeo, create a superb presentation vid

Predictability over the North Atlantic ocean in hindcast ensembles of MPI-ESM initialized by EnKF and three nudging systems

Science.gov (United States)

Brune, Sebastian; Pohlmann, Holger; Düsterhus, Andre; Kröger, Jürgen; Müller, Wolfgang; Baehr, Johanna

2016-04-01

We investigate hindcast skill for surface air temperature and upper ocean heat content (0-700m) in the North Atlantic for yearly mean values from 1960 to 2014 in four prediction systems based on the global coupled Max Planck Institute for Meteorology Earth System Model (MPI-ESM). We find that in the North Atlantic and within the four prediction systems under consideration only the EnKF initialized hindcasts reproduce the variability of the reference data well both in terms of anomaly correlation and representation of the probability density function. The systems under consideration only differ in the method how they incorporate surface and sub-surface oceanic temperatures and salinities during assimilation: ensemble Kalman Filter (EnKF), anomaly nudging of ORA reanalysis (BS-1), full field nudging of ORA and GECCO reanalysis, respectively (PT-ORA, PT-GEC). We assess the hindcast skill of each prediction system with reference to HadCRUT4 near surface air temperature data (Morice et al. 2012) and NOAA OC5 upper ocean heat content data (Levitus et al. 2012) using anomaly correlation (ACC) and by analysing the interquartile range (IQR) of the probability density function (PDF). Firstly, we calculate hindcast skill in terms of ACC and IQR against reference data over the whole time period. Here, the hindcast skills of EnKF and BS-1 are better for both ACC and IQR in lead years 2 to 5 when compared to PT-ORA and PT-GEC, their hindcast skill drops off after lead year 1. Secondly, the PDF of the reference data is not uniformly distributed over time. We therefore calculate ACC and IQR for a 20 year moving window. We find hindcast skill in terms of ACC for EnKF and BS-1 in the 1960s and from the 1990s onwards, up to eight lead years in advance, with almost no skill for the time period inbetween. In contrast, there is no skill for PT-ORA and PT-GEC in any period after lead year one. The IQR of reference data is best captured by the EnKF, in the 1960s and 1990s up to lead year

Utilization of balance equipment in windsurf beginners off water training.

OpenAIRE

Frič, Čestmír

2013-01-01

Work name: Utilization of balance equipment in windsurf beginners off water training. Aim of work: To determin and evaluate significance of balance equipment in off water training. Method: The method of comparative experiment have been used in this thesis. Than the obtained data were evaluated. It was nessesary to create and compare two groups of people, compound of young healthy individuals in the age 20 - 30 both male and female. The only condition for the research was their zero experience...

Characterization of the Second LysR-Type Regulator in the Biphenyl-Catabolic Gene Cluster of Pseudomonas pseudoalcaligenes KF707

OpenAIRE

Watanabe, Takahito; Fujihara, Hidehiko; Furukawa, Kensuke

2003-01-01

Pseudomonas pseudoalcaligenes KF707 possesses a biphenyl-catabolic (bph) gene cluster consisting of bphR1A1A2-(orf3)-bphA3A4BCX0X1X2X3D. The bphR1 (formerly orf0) gene product, which belongs to the GntR family, is a positive regulator for itself and bphX0X1X2X3D. Further analysis in this study revealed that a second regulator belonging to the LysR family (designated bphR2) is involved in the regulation of the bph genes in KF707. The bphR2 gene was not located near the bph gene cluster, and it...

English Idioms and Iranian Beginner Learners: A Focus on Short Stories and Pictures

Science.gov (United States)

Mehrpour, Saeed; Mansourzadeh, Nurullah

2017-01-01

Idiomatic expressions are among the most difficult and challenging aspects in the realm of lexicon. The focus of the present study was on investigating the effect of short stories and pictures on learning idiomatic expressions by beginner EFL learners. For this aim, 52 Iranian EFL learners were chosen and assigned to three groups randomly: two…

Adenosine A{sub 2A} receptor imaging with [{sup 11}C]KF18446 PET in the rat brain after quinolinic acid lesion. Comparison with the dopamine receptor imaging

Energy Technology Data Exchange (ETDEWEB)

Ishiwata, Kiichi; Ogi, Nobuo; Hayakawa, Nobutaka [Tokyo Metropolitan Inst. of Gerontology, Tokyo (Japan). Positron Medical Center] [and others

2002-11-01

We proposed [{sup 11}C]KF18446 as a selective radioligand for mapping the adenosine A{sub 2A} receptors being highly enriched in the striatum by positron emission tomography (PET). In the present study, we investigated whether [{sup 11}C]KF18446 PET can detect the change in the striatal adenosine A{sub 2A} receptors in the rat after unilateral injection of an excitotoxin quinolinic acid into the striatum, a Huntington's disease model, to demonstrate the usefulness of [{sup 11}C]KF18446. The extent of the striatal lesion was identified based on MRI, to which the PET was co-registered. The binding potential of [{sup 11}C]KF18446 significantly decreased in the quinolinic acid-lesioned striatum. The decrease was comparable to the decrease in the potential of [{sup 11}C] raclopride binding to dopamine D{sub 2} receptors in the lesioned striatum, but seemed to be larger than the decrease in the potential of [{sup 11}C]SCH23390 binding to dopamine D{sub 1} receptors. Ex vivo and in vitro autoradiography validated the PET signals. We concluded that [{sup 11}C]KF18446 PET can detect change in the adenosine A{sub 2A} receptors in the rat model, and will provide a new diagnostic tool for characterizing post-synaptic striatopallidal neurons in the stratum. (author)

Separating DDTs in edible animal fats using matrix solid-phase dispersion extraction with activated carbon filter, Toyobo-KF.

Science.gov (United States)

Furusawa, Naoto

2006-09-01

A technique is presented for the economical, routine, and quantitative analysis of contamination by dichloro-diphenyl-trichloroethanes (DDTs) [pp'-DDT, pp'-dichlorodiphenyl dichloroethylene, and pp'-dichlorodiphenyl dichloreothane in beef tallow and chicken fat samples, based on their separation using matrix solid-phase dispersion (MSPD) extraction with Toyobo-KF, an activated carbon fiber. Toyobo-KF is a newly applied MSPD sorbent, and it is followed by reversed-phase high-performance liquid chromatography (HPLC) with a photodiode array detector. The resulting analytical performance parameters [recoveries of spiked DDTs (0.1, 0.2, and 0.4 microg/g) > or = 81%, with relative standard deviations of < or = 8% (n = 5), and quantitation limits < or = 0.03 microg/g], with minimal handling and cost-efficiency, indicate that the present MSPD-HPLC method may be a useful tool for routine monitoring of DDT contamination in meat.

KF/Al2O3 as a Recyclable Basic Catalyst for 1,3-Dipolar Cycloaddition Reaction: Synthesis of Indolizine-1-Carbonitrile Derivatives

Directory of Open Access Journals (Sweden)

Abaszadeh Mehdi

2017-07-01

Full Text Available KF/Al2O3 as a green and efficient catalyst has been used for synthesis of indolizine-1-carbonitrile derivatives. It can be proceeded by using 1,3-dipolar cycloaddition reaction of 1-alkyl-2-chloropyridinium bromides, malononitrile and benzaldehyde in ethanol, at reflux. The great advantage of this catalyst is the ease of handling. KF/Al2O3 can be used and removed by filtration, avoiding cumbersome aqueous workups and decreasing solvent waste handling issues. High conversions, short reaction times and a cleaner reaction profiles are some of the outstanding advantages of this method.

Estimation of water level and steam temperature using ensemble Kalman filter square root (EnKF-SR)

Science.gov (United States)

Herlambang, T.; Mufarrikoh, Z.; Karya, D. F.; Rahmalia, D.

2018-04-01

The equipment unit which has the most vital role in the steam-powered electric power plant is boiler. Steam drum boiler is a tank functioning to separate fluida into has phase and liquid phase. The existence in boiler system has a vital role. The controlled variables in the steam drum boiler are water level and the steam temperature. If the water level is higher than the determined level, then the gas phase resulted will contain steam endangering the following process and making the resulted steam going to turbine get less, and the by causing damages to pipes in the boiler. On the contrary, if less than the height of determined water level, the resulted height will result in dry steam likely to endanger steam drum. Thus an error was observed between the determined. This paper studied the implementation of the Ensemble Kalman Filter Square Root (EnKF-SR) method in nonlinear model of the steam drum boiler equation. The computation to estimate the height of water level and the temperature of steam was by simulation using Matlab software. Thus an error was observed between the determined water level and the steam temperature, and that of estimated water level and steam temperature. The result of simulation by Ensemble Kalman Filter Square Root (EnKF-SR) on the nonlinear model of steam drum boiler showed that the error was less than 2%. The implementation of EnKF-SR on the steam drum boiler r model comprises of three simulations, each of which generates 200, 300 and 400 ensembles. The best simulation exhibited the error between the real condition and the estimated result, by generating 400 ensemble. The simulation in water level in order of 0.00002145 m, whereas in the steam temperature was some 0.00002121 kelvin.

A Case Study: Writing a Spanish Dictionary as a Collaborative Task among Beginner Students

Science.gov (United States)

Lopez, Nuria

2016-01-01

This article reports a small-scale study carried out in a beginners' Spanish class of second year undergraduate students. The purpose of the study was to investigate the effectiveness of a vocabulary task in terms of its impact on vocabulary acquisition, the learners' approach to vocabulary learning and their motivation and engagement. The task…

KfK analysis of the SUPER-PHENIX-1 control rod experiments. Pt. 1

International Nuclear Information System (INIS)

Giese, H.

1991-03-01

As proposed by the SPX-1 analysis task force, MSM (modified source multiplication) correction factors have been produced for a series of control rod configurations established in the first critical core C1D with minimum fissile loading and in the fully loaded core CMP. The report gives a complete description of the method used at KfK to produce these correction factors and summarises the evaluated experimental results obtained. The KfK method is characterized by a 'two-step-adjustment': A basic reactivity scale adjustment and a subsequent rod worth adjustment. The first adjustment was achieved by 'tuning' either the axialbuckling in the leakage term D B 2 or the average number of neutrons per fission in the production term so that the excess reactivity of the so-called 'Follower-core' with all control rods fully raised was properly reproduced. As this excess reactivity could not be directly determined by an experiment, it had to be assessed from the shut-down worth of the main control system in combination with measured fractions of the S-curve of this system. In the second adjustment, the absorber cross sections were tuned to reproduce experimental rod worths. While for the analysis of the C1D experiments, MSM correction factor calculations were performed in 2D centre-plane geometry only, the analysis of the CMP measurements employed both 2D and 3D calculations. (orig./HP)

Consideration of a Learning Programming Process based on Software Design for Beginners

OpenAIRE

大村, 基将; 紅林, 秀治

2016-01-01

We considered a learning programming process based on software design for technology education. Lessons of computer program-aided measurement and control are for beginners to learn programming. These lessons are efficient to learn the step of programming, but the main of the lessons are works of typing the sample programming and debugging. Therefore, these lessons have a fundamental lack of the concept of design. Then we considered learning processes of programming and applied the process of ...

Maxwell–Stefan diffusion and dynamical correlation in molten LiF-KF: A molecular dynamics study

Energy Technology Data Exchange (ETDEWEB)

Jain, Richa Naja, E-mail: ltprichanaja@gmail.com; Chakraborty, Brahmananda; Ramaniah, Lavanya M. [High Pressure & Synchrotron Radiation Physics Division, Bhabha Atomic Research Centre, Trombay, Mumbai-85 (India)

2016-05-23

In this work our main objective is to compute Dynamical correlations, Onsager coefficients and Maxwell-Stefan (MS) diffusivities for molten salt LiF-KF mixture at various thermodynamic states through Green–Kubo formalism for the first time. The equilibrium molecular dynamics (MD) simulations were performed using BHM potential for LiF–KF mixture. The velocity autocorrelations functions involving Li ions reflect the endurance of cage dynamics or backscattering with temperature. The magnitude of Onsager coefficients for all pairs increases with increase in temperature. Interestingly most of the Onsager coefficients has almost maximum magnitude at the eutectic composition indicating the most dynamic character of the eutectic mixture. MS diffusivity hence diffusion for all ion pairs increases in the system with increasing temperature. Smooth variation of the diffusivity values denies any network formation in the mixture. Also, the striking feature is the noticeable concentration dependence of MS diffusivity between cation-cation pair, Đ{sub Li-K} which remains negative for most of the concentration range but changes sign to become positive for higher LiF concentration. The negative MS diffusivity is acceptable as it satisfies the non-negative entropy constraint governed by 2{sup nd} law of thermodynamics. This high diffusivity also vouches the candidature of molten salt as a coolant.

Task-Based Language Teaching for Beginner-Level Learners of L2 French: An Exploratory Study

Science.gov (United States)

Erlam, Rosemary; Ellis, Rod

2018-01-01

This study investigated the effect of input-based tasks on the acquisition of vocabulary and grammar by beginner-level learners of L2 French and reported the introduction of task-based teaching as an innovation in a state secondary school. The experimental group (n = 19) completed a series of focused input-based language tasks, taught by their…

Grundwassermodellbildung – Hydrostratigraphische Bewertungen mittels GCI-PetroKf, Datenbank- und Geoinformationssystemen

DEFF Research Database (Denmark)

Koch, Alexander; Fuchs, Sven; Göbel, Patricia

reimportiert und für die Verwendung in Geoinformationssystemen (i.e. ArcGIS) weiter aufbereitet. Über Interpolationsverfahren konnte innerhalb des Programmes ArcGIS ein lateraler Bezug zwischen den verschiedenen Mächtigkeiten hergestellt werden, um so auf weitere Inhomogenitäten im Aufbau des Grundwasserleiter......-Systems schließen zu können. Anschließend wurden mittels ArcGIS die Quartärbasis des Modellraums konstruiert, sowie Grundwasserisolinien- und Grundwasserdifferenzenkarten berechnet. Die Grundwasserdifferenzenkarten reproduzieren gut die Grundwasserabsenkungen im Bereich von lokalen Tagebauen. Insgesamt zeigen sich...... gute Übereinstimmungen mit früheren hydrogeologischen Untersuchungen im Projektgebiet. Die Kombination des PetroKf-Algorithmus mit der Aufbereitung in einer Datenbank, sowie der Weiterverarbeitung in ArcGIS, zeigt einen praktikablen Weg zur Entwicklung und Parametrisierung eines hydrogeologischen...

Plutonium isotopic assay of reprocessing product solutions in the KfK K-edge densitometer

International Nuclear Information System (INIS)

Eberle, H.; Ottmar, H.; Matussek, P.

1985-04-01

The KfK K-edge densiometer, designed for accurate element concentration measurements using the technique of X-ray absorptiometry at the K absorption edge, provides as an additional option the possibility to determine the isotopic composition of freshly separated plutonium from an gamma-spectrometric analysis of its self-radiation. This report describes the underlying methodology and experimental procedures for the isotopic analysis in the K-edge densitometer. The paper also presents and discusses the experimental results so far obtained from routine measurements on reprocessing product solutions. (orig.)

Electrochemical investigation on the redox chemistry of niobium in LiCl-KCl-KF-Na2O melts

DEFF Research Database (Denmark)

Gillesberg, Bo; Bjerrum, Niels; Barner, Jens H. Von

1997-01-01

The system LiCl-KCl-KF-1 mole percent K2NbF7 (molar ration F-/Nb = 8) has been investigated in-the temperature range 370 to 725 degrees C by cyclic and square wave voltammetry. In the temperature range from 370 to 520 degrees C Nb(V) was reduced to Nb(III) in two reversible steps: Nb(V) --> Nb(IV...

Development of a Portable Training Tool for Simulating Visceral Angiographic Procedures for Beginners

International Nuclear Information System (INIS)

Yamagami, Takuji; Osuga, Keigo; Yoshimatsu, Rika; Matsumoto, Tomohiro; Miura, Hiroshi; Terayama, Koshi; Anai, Hiroshi; Takahashi, Masahide; Hasebe, Terumitsu; Nishimura, Tsunehiko

2009-01-01

The purpose of this study was to evaluate the usefulness of a tool that we developed to simulate performance of visceral angiography to train beginners in the field of splanchnic angiography. Seven residents and two fellows who were rotating within the Division of Interventional Radiology at our institution between June and August 2008 participated in the evaluation of this tool. They had no experience in performing visceral angiography as an operator. Time for selection of arterial branches arising from the celiac axis on the model was measured before and after training. After such training, the participants performed actual visceral angiography as an operator with instructors beside them. Success of the trainees in selecting visceral arterial branches was evaluated in these real-life cases. In the first test using the model, seven of nine trainees (77.8%) succeeded in selecting all required arteries, while the remaining two failed to select all required arteries. After training using the model, all trainees succeeded in selecting all required arteries just before the actual angiographic study. In the actual angiography, the catheter was successfully inserted from the femoral artery and advanced to the superior mesenteric, celiac, splenic, common hepatic, gastroduodenal, and right and left hepatic arteries by all trainees with only two exceptions. In conclusion, this tool is helpful for training beginners in visceral angiographic procedures.

Operating software for plutonium measurements in the KfK K-edge densitometer. A user's guide

International Nuclear Information System (INIS)

Eberle, H.

1983-09-01

A set of computer programs has been developed for the execution of plutonium concentration measurements in the KfK K-edge photon absorptiometer for performance evaluation. The programs are implemented on a ND-6620 data acquisition and processing system. A short description of the programs and commands for data accumulation and analysis is given. Nevertheless, the user should be familiar with the ND-6620 data acquisition and processing system, its system software, and with the FORTRAN programming language. (orig./HP)

Peculiarities of mathematics instruction for beginners for children with disabilities in regular primary schools

Directory of Open Access Journals (Sweden)

Jablan Branka

2010-01-01

Full Text Available The paper studies the issue of education of visually impaired children, hearing impaired children and children with intellectual disabilities in regular primary schools in the context of mathematics instruction for beginners. The authors state the basic characteristics of mathematics instruction for beginners with respect to the contents studied in the first four grades of primary school, as well as the key problems and educational needs of visually impaired children, hearing impaired children and children with intellectual disabilities. The basic characteristics of inclusive education and the key role of teacher in this process are pointed out. Starting from the developmental peculiarities of children with disabilities, the authors emphasize the importance of applying an individualized approach in teaching mathematics. Possible didactic and methodical solutions are discussed, as well as different approaches in teaching this subject that can facilitate learning of mathematical contents to visually impaired children, hearing impaired children and children with intellectual disabilities. Bearing in mind the peculiarities of inclusive education, i.e. the need for the children with disabilities to participate in common activities with the other children in the class, the authors emphasize the importance of encouraging interaction and communication among children in the process of learning mathematical contents.

Language Learning Shifts and Attitudes towards Language Learning in an Online Tandem Program for Beginner Writers

Science.gov (United States)

Tolosa, Constanza; Ordóñez, Claudia Lucía; Guevara, Diana Carolina

2017-01-01

We present findings of a project that investigated the potential of an online tandem program to enhance the foreign language learning of two groups of school-aged beginner learners, one learning English in Colombia and the other learning Spanish in New Zealand. We assessed the impact of the project on students' learning with a free writing…

Status report. KfK contribution to the development of DEMO-relevant test blankets for NET/ITER. Pt. 2: BOT helium cooled solid breeder blanket. Vol. 1

International Nuclear Information System (INIS)

Dalle Donne, M.; Boccaccini, L.V.; Bojarsky, E.; Deckers, H.; Dienst, W.; Doerr, L.; Fischer, U.; Giese, H.; Guenther, E.; Haefner, H.E.; Hofmann, P.; Kappler, F.; Knitter, R.; Kuechle, M.; Moellendorf, U. von; Norajitra, P.; Penzhorn, R.D.; Reimann, G.; Reiser, H.; Schulz, B.; Schumacher, G.; Schwenk-Ferrero, A.; Sordon, G.; Tsukiyama, T.; Wedemeyer, H.; Weimar, P.; Werle, H.; Wiegner, E.; Zimmermann, H.

1991-10-01

The BOT (Breeder Outside Tube) Helium Cooled Breeder Blanket for a fusion Demo reactor and the status of the R and D program is presented. This is the KfK contribution to the European Program for the Demo relevant test plankets to be irradiated in NET/ITER. Volume 1 (KfK 4928) contains the summary, volume 2 (KfK 4929) a more detailed version of the report. In both volumes are described the reasons for the selected design, the reference blanket design for the Demo reactor, the design of test blanket including the ancillary systems together with the present status of the relative R and D program in the fields of neutronic and thermohydraulic calculations, of the electromagnetic forces caused by disruptions, of the development and irradiation of the ceramic breeder material, of the tritium release and recovery, and of the technological investigations. An outlook is given on the required R and D program for the BOT Helium Cooled Solid Breeder Blanket prior to tests in NET/ITER and the proposed test program in NET/ITER. (orig.) [de

Status report. KfK contribution to the development of DEMO-relevant test blankets for NET/ITER. Pt. 2: BOT helium cooled solid breeder blanket. Vol. 2

International Nuclear Information System (INIS)

Dalle Donne, M.; Boccaccini, L.V.; Bojarsky, E.; Deckers, H.; Dienst, W.; Doerr, L.; Fischer, U.; Giese, H.; Guenther, E.; Haefner, H.E.; Hofmann, P.; Kappler, F.; Knitter, R.; Kuechle, M.; Moellendorf, U. von; Norajitra, P.; Penzhorn, R.D.; Reimann, G.; Reiser, H.; Schulz, B.; Schumacher, G.; Schwenk-Ferrero, A.; Sordon, G.; Tsukiyama, T.; Wedemeyer, H.; Weimar, P.; Werle, H.; Wiegner, E.; Zimmermann, H.

1991-10-01

The BOT (Breeder Outside Tube) Helium Cooled Solid Breeder Blanket for a fusion Demo reactor and the status of the R and D program is presented. This is the KfK contribution to the European Program for the Demo relevant test blankets to be irradiated in NET/ITER. Volume 1 (KfK 4928) contains the summary, volume 2 (KfK 4929) a more detailed version of the report. In both volumes are described the reasons for the selected design, the reference blanket design for the Demo reactor, the design of the test blanket including the ancillary systems together with the present status of the relative R and D program in the fields of neutronic and thermohydraulic calculations, of the electromagnetic forces caused by disruptions, of the development and irradiation of the ceramic breeder material, of the tritium release and recovery, and of the technological investigations. An outlook is given on the required R and D program for the BOT Helium Cooled Solid Breeder Blanket prior to tests in NET/ITER and the proposed test program in NET/ITER. (orig.) [de

From Theory to Practice: Beginner Teachers' Experiences of the Rigour of the Postgraduate Certificate in Education Programme

Science.gov (United States)

Nomlomo, Vuyokazi; Sosibo, Zilungile

2016-01-01

This article focuses on how recent graduates perceive the rigour of the Postgraduate Certificate in Education (PGCE) initial teacher education (ITE) programme. The article is based on qualitative data collected from a purposely selected sample of 19 beginner teachers who graduated from two higher education institutions that offer PGCE programmes…

Practice for beginners programming lesson using App Lab: Introduction of programming learning for undergraduate students

OpenAIRE

榊原, 直樹

2017-01-01

App Lab is an online programming education environment. It was designed classes of programming for beginners using the App Lab. Through 15 lessons of the class, it was to understand the basic structure of the programming of the sequential-repetition-branch. Students were allowed to complete the game as a final project. The effectiveness of App the Lab has been confirmed from these results.

FusionCharts Beginner's Guide The Official Guide for FusionCharts Suite

CERN Document Server

Nadhani, Sanket; Bhattacharya, Shamasis

2012-01-01

The book is written as a practical, step-by-step guide to using FusionCharts Suite. The book not only teaches you the fundamentals and implementation of FusionCharts Suite, but also makes you the data visualization guru among your friends and colleagues by teaching how to select the right chart type and usability tips. Filled with examples, code samples and practical tips in a no-nonsense way, the book is a breeze to read.This book is both for beginners and advanced web developers who need to create interactive charts for their web applications. No previous knowledge of FusionCharts Suite is a

Adobe Flash 11 Stage3D (Molehill) Game Programming Beginner's Guide

CERN Document Server

Kaitila, Christer

2011-01-01

Written in an informal and friendly manner, the style and approach of this book will take you on an exciting adventure. Piece by piece, detailed examples help you along the way by providing real-world game code required to make a complete 3D video game. Each chapter builds upon the experience and achievements earned in the last, culminating in the ultimate prize - your game! If you ever wanted to make your own 3D game in Flash, then this book is for you. This book is a perfect introduction to 3D game programming in Adobe Molehill for complete beginners. You do not need to know anything about S

A beginner's guide to writing the nursing conceptual model-based theoretical rationale.

Science.gov (United States)

Gigliotti, Eileen; Manister, Nancy N

2012-10-01

Writing the theoretical rationale for a study can be a daunting prospect for novice researchers. Nursing's conceptual models provide excellent frameworks for placement of study variables, but moving from the very abstract concepts of the nursing model to the less abstract concepts of the study variables is difficult. Similar to the five-paragraph essay used by writing teachers to assist beginning writers to construct a logical thesis, the authors of this column present guidelines that beginners can follow to construct their theoretical rationale. This guide can be used with any nursing conceptual model but Neuman's model was chosen here as the exemplar.

Using Reciprocal Peer Teaching to Develop Learner Autonomy: An Action Research Project with a Beginners' Chinese Class

Science.gov (United States)

Liu, Weiming; Devitt, Ann

2014-01-01

Peer teaching has been used as a mechanism for promoting learner autonomy in a range of language learning contexts. This article explores how absolute beginners in a Chinese class can engage in reciprocal peer teaching (RPT) from the start of their language learning experience and how this contributes to the development of their autonomy as…

Factors That Contribute to Transfer and Bachelor's Degree Attainment of Low-Income Community College Beginners

Science.gov (United States)

Felder, Andrea Darlene

2016-01-01

Transfer and bachelor's degree attainment rates of low-income community college beginners lag behind their middle- and high-income peers. As community college continues to be an affordable and accessible route to higher education, consideration should be given to how to close the gap in transfer and bachelor's degree attainment rates of low-income…

Catalytic effect of KF-846 on the reforming of the primary intermediates from the co-pyrolysis of pubescens and LDPE

International Nuclear Information System (INIS)

Liu, Wen-wu; Hu, Chang-wei; Tong, Dong-mei; Yang, Yu; Li, Gui-ying; Zhu, Liang-fang; Tang, Jin-Qiang

2014-01-01

Highlights: • Reforming reactions were inhibited by H 2 , decrease of acidity and low temperature. • There was a synergistic effect on producing hydrogen between Ni and Mo. • The lattice oxygen over catalyst employed might transfer into the intermediates. • Co-pyrolysis, low temperature and N 2 could restrain oxygen transfer to some extent. - Abstract: Co-pyrolysis is regarded as an effective approach to upgrade the quality of pyrolysis products. In this work the activity of KF-846 was evaluated by co-pyrolysis of pubescens and low density polyethylene under different experimental conditions including catalytic mode, pyrolytic atmosphere and temperature, etc. The results showed that the fresh KF-846 exerted strong effects of cyclization, aromatization, hydrogen transfer and vapor-catalytic reforming reactions on the primary intermediates from the co-pyrolysis. The hydrogen-rich gases indicated a synergistic effect between Ni and Mo over KF-846 on producing hydrogen. More importantly, the reforming reactions might be inhibited to some extent by H 2 atmosphere, the low temperature and the decrease of acidity over catalyst. Furthermore, it was deduced that the oxygen over the lattice of catalyst or some intermediates might transfer into other intermediates, possibly resulting in more products with high oxygen content, but it was presumed that the low temperature, co-pyrolysis process and N 2 atmosphere could repress the trend to a certain degree. The mass and energy balance of co-pyrolysis were analyzed, and the main reaction pathways were also proposed. The interference in pyrolysis by regulating the catalytic mode, pyrolytic atmosphere and temperature, acidity over catalyst might posses a certain guiding significance for the pyrolytic technology and the design/selection of catalysts employed

Wheelchair propulsion kinematics in beginners and expert users: influence of wheelchair settings.

Science.gov (United States)

Gorce, P; Louis, N

2012-01-01

Biomechanical studies have linked the handrim wheelchair propulsion with a prevalence of upper limb musculoskeletal disorders. The purpose of this study was to examine the influence of the wheelchair settings on upper limb kinematics during wheelchair propulsion. Recordings were made under various wheelchair configuration conditions to understand the effect of wheelchair settings on kinematics parameters such shoulder, elbow and wrist angles. Ten experts and ten beginners' subjects propelled an experimental wheelchair on a roller ergometer system at a comfortable speed. Twelve wheelchair configurations were tested. Kinematics were recorded for each configuration. Based on the hand position relatively to the handrim, the main kinematic parameters of wheelchair propulsion were investigated on the whole propulsion cycle and a key event such as handrim contact and release. Compared to the beginner subjects, all the experts' subjects generally present higher joint amplitude and propulsion speeds. Seat height and antero-posterior axle position influence usage of the hand-rim, timing parameters and configurations of upper limb joints. Results seem to confirm that low and backward seat position allow a greater efficiency. Nevertheless, according that proximity of joint limit is a well known factor of musculoskeletal disorders, our results let us think that too low and backward seat position, increasing joints positions and amplitudes, could increase the risk of upper limb injuries in relation with manual wheelchair propulsion. Kinematic differences highlight that future studies on wheelchair propulsion should only be done with impaired experienced subjects. Furthermore, this study provides indications on how wheelchair settings can be used for upper limb injury prevention. Copyright © 2011 Elsevier Ltd. All rights reserved.

ESTUDO DA ESTABILIDADE TÉRMICA DE FIBRA QUERATINA (KF DE PENAS DE FRANGO PARA OBTENÇÃO DE CARBONO (CF

Directory of Open Access Journals (Sweden)

Débora Damasceno Belarmino

2012-07-01

Full Text Available A fibra de queratina de penas de frango foi submetida à análise térmica (TG em sua forma natural e carbonizada, aumentando assim a expansão do reaproveitamento de materiais desperdiçados no Brasil. A partir das curvas obtidas por TG/DTG da pena natural (KF e tratadas (KFNaOH, SCFC e SCFD buscou-se um melhor ciclo de carbonização (pirólise para esse tipo de precursor. O trabalho também trata como um dos focos, o estudo comparativo do comportamento térmico desses materiais. Uma parte da KF foi tratada com hidróxido de sódio (NaOH, e observou-se pelo o resultado TG/DTG que a resistência térmica do material não foi influenciada. Outra parte de KF foi semicarbonizada (220°C sem controle do ambiente térmico e taxas de aquecimento e resfriamento, apresentando colorações diferentes, mais clara (SCFC e mais escura (SCFD. Foi constatado nas curvas de TG/DTG, que esse tratamento de carbonização não é ideal para a obtenção de carbono. Também foi verificado nas curvas de TG/DTG que na CF houve um aumento da estabilidade térmica comparada a todas as outras amostras. Essa pesquisa é uma inovação no que diz respeito à preparação e avaliação de fibras de penas de frango na obtenção de fibras sintetizadas, que atualmente são, em larga escala, derivados do petróleo, lembrando-se da diminuição das reservas de petróleo e da poluição que os mesmos geram ao meio ambiente.

The impact of covariance localization on the performance of an ocean EnKF system assimilating glider data in the Ligurian Sea

Science.gov (United States)

Falchetti, Silvia; Alvarez, Alberto

2018-04-01

Data assimilation through an ensemble Kalman filter (EnKF) is not exempt from deficiencies, including the generation of long-range unphysical correlations that degrade its performance. The covariance localization technique has been proposed and used in previous research to mitigate this effect. However, an evaluation of its performance is usually hindered by the sparseness and unsustained collection of independent observations. This article assesses the performance of an ocean prediction system composed of a multivariate EnKF coupled with a regional configuration of the Regional Ocean Model System (ROMS) with a covariance localization solution and data assimilation from an ocean glider that operated over a limited region of the Ligurian Sea. Simultaneous with the operation of the forecast system, a high-quality data set was repeatedly collected with a CTD sensor, i.e., every day during the period from 5 to 20 August 2013 (approximately 4 to 5 times the synoptic time scale of the area), located on board the NR/V Alliance for model validation. Comparisons between the validation data set and the forecasts provide evidence that the performance of the prediction system with covariance localization is superior to that observed using only EnKF assimilation without localization or using a free run ensemble. Furthermore, it is shown that covariance localization also increases the robustness of the model to the location of the assimilated data. Our analysis reveals that improvements are detected with regard to not only preventing the occurrence of spurious correlations but also preserving the spatial coherence in the updated covariance matrix. Covariance localization has been shown to be relevant in operational frameworks where short-term forecasts (on the order of days) are required.

Resistance to pyridine-based inhibitor KF116 reveals an unexpected role of integrase in HIV-1 Gag-Pol polyprotein proteolytic processing.

Science.gov (United States)

Hoyte, Ashley C; Jamin, Augusta V; Koneru, Pratibha C; Kobe, Matthew J; Larue, Ross C; Fuchs, James R; Engelman, Alan N; Kvaratskhelia, Mamuka

2017-12-01

The pyridine-based multimerization selective HIV-1 integrase (IN) inhibitors (MINIs) are a distinct subclass of allosteric IN inhibitors. MINIs potently inhibit HIV-1 replication during virion maturation by inducing hyper- or aberrant IN multimerization but are largely ineffective during the early steps of viral replication. Here, we investigated the mechanism for the evolution of a triple IN substitution (T124N/V165I/T174I) that emerges in cell culture with a representative MINI, KF116. We show that HIV-1 NL4-3(IN T124N/V165I/T174I) confers marked (>2000-fold) resistance to KF116. Two IN substitutions (T124N/T174I) directly weaken inhibitor binding at the dimer interface of the catalytic core domain but at the same time markedly impair HIV-1 replication capacity. Unexpectedly, T124N/T174I IN substitutions inhibited proteolytic processing of HIV-1 polyproteins Gag and Gag-Pol, resulting in immature virions. Strikingly, the addition of the third IN substitution (V165I) restored polyprotein processing, virus particle maturation, and significant levels of replication capacity. These results reveal an unanticipated role of IN for polyprotein proteolytic processing during virion morphogenesis. The complex evolutionary pathway for the emergence of resistant viruses, which includes the need for the compensatory V165I IN substitution, highlights a relatively high genetic barrier exerted by MINI KF116. Additionally, we have solved the X-ray structure of the drug-resistant catalytic core domain protein, which provides means for rational development of second-generation MINIs. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

Food Ration and Mental Training for the Improvement of the Free Throw Performance in Congolese Beginners Basketball Players

Science.gov (United States)

Bouhika, Eddie Janvier; Moussouami, Simplice Innocent; Tsiama Portejoie, Jean Aimé; Bazaba Kayilou, Jean Michel; Moyen, Rachel; Mizere Moungondo, Martin; Maouene, Michel; Mbemba, François

2016-01-01

Objective: Through an experimental study, the present work aims at testing the effectiveness of diet and mental imagery on the success of free throw in Congolese beginners Basketball Players. Method: 45 players participated in this experimental study in Brazzaville (Congo). These subjects were divided into 3 groups. Group I (n = 15), made up of…

Enhanced Recognition of Written Words and Enjoyment of Reading in Struggling Beginner Readers through Whole-Word Multimedia Software

Science.gov (United States)

Karemaker, Arjette; Pitchford, Nicola J.; O'Malley, Claire

2010-01-01

The effectiveness of a reading intervention using the whole-word multimedia software "Oxford Reading Tree (ORT) for Clicker" was compared to a reading intervention using traditional ORT Big Books. Developing literacy skills and attitudes towards learning to read were assessed in a group of 17 struggling beginner readers aged 5-6 years. Each child…

On the efficiency of the hybrid and the exact second-order sampling formulations of the EnKF: a reality-inspired 3-D test case for estimating biodegradation rates of chlorinated hydrocarbons at the port of Rotterdam

KAUST Repository

El Gharamti, Mohamad

2016-11-15

This study considers the assimilation problem of subsurface contaminants at the port of Rotterdam in the Netherlands. It involves the estimation of solute concentrations and biodegradation rates of four different chlorinated solvents. We focus on assessing the efficiency of an adaptive hybrid ensemble Kalman filter and optimal interpolation (EnKF-OI) and the exact second-order sampling formulation (EnKFESOS) for mitigating the undersampling of the estimation and observation errors covariances, respectively. A multi-dimensional and multi-species reactive transport model is coupled to simulate the migration of contaminants within a Pleistocene aquifer layer located around 25 m below mean sea level. The biodegradation chain of chlorinated hydrocarbons starting from tetrachloroethene and ending with vinyl chloride is modeled under anaerobic environmental conditions for 5 decades. Yearly pseudo-concentration data are used to condition the forecast concentration and degradation rates in the presence of model and observational errors. Assimilation results demonstrate the robustness of the hybrid EnKF-OI, for accurately calibrating the uncertain biodegradation rates. When implemented serially, the adaptive hybrid EnKF-OI scheme efficiently adjusts the weights of the involved covariances for each individual measurement. The EnKFESOS is shown to maintain the parameter ensemble spread much better leading to more robust estimates of the states and parameters. On average, a well tuned hybrid EnKF-OI and the EnKFESOS respectively suggest around 48 and 21 % improved concentration estimates, as well as around 70 and 23 % improved anaerobic degradation rates, over the standard EnKF. Incorporating large uncertainties in the flow model degrades the accuracy of the estimates of all schemes. Given that the performance of the hybrid EnKF-OI depends on the quality of the background statistics, satisfactory results were obtained only when the uncertainty imposed on the background

A New Approach to Programming Language Education for Beginners with Top-Down Learning

Directory of Open Access Journals (Sweden)

Daisuke Saito

2013-12-01

Full Text Available There are two basic approaches in learning new programming language: a bottom-up approach and a top-down approach. It has been said that if a learner has already acquired one language, the top-down approach is more efficient to learn another while, for a person who has absolutely no knowledge of any programming languages; the bottom-up approach is preferable. The major problem of the bottom-up approach is that it requires longer period to acquire the language. For quicker learning, this paper applies a top-down approach for a beginners who has not yet acquired any programming languages.

A Drawing and Multi-Representational Computer Environment for Beginners' Learning of Programming Using C: Design and Pilot Formative Evaluation

Science.gov (United States)

Kordaki, Maria

2010-01-01

This paper presents both the design and the pilot formative evaluation study of a computer-based problem-solving environment (named LECGO: Learning Environment for programming using C using Geometrical Objects) for the learning of computer programming using C by beginners. In its design, constructivist and social learning theories were taken into…

A guide to MATLAB for beginners and experienced users

CERN Document Server

Hunt, Brian R; Rosenberg, Jonathan M

2014-01-01

Now in its third edition, this outstanding textbook explains everything you need to get started using MATLAB®. It contains concise explanations of essential MATLAB commands, as well as easily understood instructions for using MATLAB's programming features, graphical capabilities, simulation models, and rich desktop interface. MATLAB 8 and its new user interface is treated extensively in the book. New features in this edition include: a complete treatment of MATLAB's publish feature; new material on MATLAB graphics, enabling the user to master quickly the various symbolic and numerical plotting routines; and a robust presentation of MuPAD® and how to use it as a stand-alone platform. The authors have also updated the text throughout, reworking examples and exploring new applications. The book is essential reading for beginners, occasional users and experienced users wishing to brush up their skills. Further resources are available from the authors' website at www-math.umd.edu/schol/a-guide-to-matlab.html.

Review of The Atheist’s Primer and Atheism for Beginners

Directory of Open Access Journals (Sweden)

Andrew J Bissette

2014-05-01

Full Text Available The New Atheists are occasionally accused of lacking nuance and sophistication, or of existing in an intellectual vacuum. To some it may seem that Dawkins 'et al'. are naïve logical positivists; this perspective may be reinforced by recent authors’ explicit rejection of the value of philosophy and other non-scientific approaches to knowledge (cf. Lawrence Krauss, Stephen Hawking. Into the fray steps Michael Palmer, offering his attempt to popularise a version of atheism that is underpinned by a long tradition of philosophical inquiry. 'The Atheist’s Primer', a condensed version of Palmer’s previous work, is aptly named: it is a crash course on the history and major arguments of atheism from a firmly philosophical angle. Its companion text, 'Atheism For Beginners', is a coursebook aimed at tutors seeking to teach this material.

Shifting ontologies of a serious game and its relationships with English education for beginners

DEFF Research Database (Denmark)

Hansbøl, Mikala; Meyer, Bente

2011-01-01

  This paper takes its point of departure in a language project, which is a subproject under the larger ongoing (2007-2011) research project Serious Games on a Global Market Place. The language project follows how the virtual universe known as Mingoville ( http://www.mingoville.com/ ) becomes...... point of departure in neither Mingoville as part of the media ecologies of the classroom, nor in the epistemological ramifications of Mingoville. Instead, it suggests that opening up the shifting ontologies of Mingoville (i.e. what mediates Mingoville and its relationships with doing beginners English...

Teaching of reading to school beginners : a study of reading programmes in primary one in Uganda

OpenAIRE

Kemizano, Rosert

2007-01-01

Abstract The study examines reading programmes with the reference to the teaching/learning of reading to school beginners. The teaching of reading at the early stages is important because it is the quality of the experiences that children get that affect or lay the foundation for reading development (Chall, 1996).Therefore, the phenomenon, “teaching of reading to school beginners” studied is of great importance. The theoretical background used includes reading and its importance, Languag...

A Prototype Regional GSI-based EnKF-Variational Hybrid Data Assimilation System for the Rapid Refresh Forecasting System: Dual-Resolution Implementation and Testing Results

Science.gov (United States)

Pan, Yujie; Xue, Ming; Zhu, Kefeng; Wang, Mingjun

2018-05-01

A dual-resolution (DR) version of a regional ensemble Kalman filter (EnKF)-3D ensemble variational (3DEnVar) coupled hybrid data assimilation system is implemented as a prototype for the operational Rapid Refresh forecasting system. The DR 3DEnVar system combines a high-resolution (HR) deterministic background forecast with lower-resolution (LR) EnKF ensemble perturbations used for flow-dependent background error covariance to produce a HR analysis. The computational cost is substantially reduced by running the ensemble forecasts and EnKF analyses at LR. The DR 3DEnVar system is tested with 3-h cycles over a 9-day period using a 40/˜13-km grid spacing combination. The HR forecasts from the DR hybrid analyses are compared with forecasts launched from HR Gridpoint Statistical Interpolation (GSI) 3D variational (3DVar) analyses, and single LR hybrid analyses interpolated to the HR grid. With the DR 3DEnVar system, a 90% weight for the ensemble covariance yields the lowest forecast errors and the DR hybrid system clearly outperforms the HR GSI 3DVar. Humidity and wind forecasts are also better than those launched from interpolated LR hybrid analyses, but the temperature forecasts are slightly worse. The humidity forecasts are improved most. For precipitation forecasts, the DR 3DEnVar always outperforms HR GSI 3DVar. It also outperforms the LR 3DEnVar, except for the initial forecast period and lower thresholds.

Objective-C for Absolute Beginners iPhone and Mac Programming Made Easy

CERN Document Server

Bennett, Gary; Fisher, Mitchell

2010-01-01

It seems as if everyone is writing applications for Apple's iPhone and iPad, but how do they all do it? It's best to learn Objective-C, the native language of both the iOS and Mac OS X, but where to begin? Right here, even if you've never programmed before! Objective-C for Absolute Beginners will teach you how to write software for your Mac, iPhone,or iPad using Objective-C, an elegant and powerful language with a rich set of developer tools. Using a hands-on approach, you'll learn to think in programming terms, how to use Objective-C to build program logic, and how to write your own applicati

Assessing Verbal Functioning in South African School Beginners from Diverse Socioeconomic Backgrounds: A Comparison between Verbal Working Memory and Vocabulary Measures

Science.gov (United States)

Cockcroft, Kate; Bloch, Lauren; Moolla, Azra

2016-01-01

This study investigated whether measures of verbal working memory are less sensitive to children's socioeconomic background than traditional vocabulary measures. Participants were 120 school beginners, divided into high and low socioeconomic groups. The groups contained equal numbers of English first-language and second-language speakers. All were…

Deuteriation of an asymmetric short hydrogen bond. X-ray crystal structure of KF.(CH2CO2D)2

International Nuclear Information System (INIS)

Emsley, J.; Jones, D.J.; Kuroda, R.

1981-01-01

Deuteriation of the strong hydrogen bonds of KF.(CH 2 CO 2 H) 2 shows no isotope effect on the bond lengths. The only significant change is in the bond angle at the fluoride ion which widens to 128.5 from 116 0 . The i.r. spectrum shows very little change. Since the O-H ... F - hydrogen bonds are highly asymmetric, these observations challenge previous predictions about the effects of deuteriation on such bonds. (author)

Data analysis using SPSS for Windows, versions 8 - 10 a beginner's guide

CERN Document Server

Foster, Jeremy J, Dr

2001-01-01

A new edition of this best-selling introductory book to cover the latest SPSS versions 8.0 - 10.0 This book is designed to teach beginners how to use SPSS for Windows, the most widely used computer package for analysing quantitative data. Written in a clear, readable and non-technical style the author explains the basics of SPSS including the input of data, data manipulation, descriptive analyses and inferential techniques, including; - creating using and merging data files - creating and printing graphs and charts - parametric tests including t-tests, ANOVA, GLM - correlation, regression and factor analysis - non parametric tests and chi square reliability - obtaining neat print outs and tables - includes a CD-Rom containing example data files, syntax files, output files and Excel spreadsheets.

The Beginner's Guide to Wind Tunnels with TunnelSim and TunnelSys

Science.gov (United States)

Benson, Thomas J.; Galica, Carol A.; Vila, Anthony J.

2010-01-01

The Beginner's Guide to Wind Tunnels is a Web-based, on-line textbook that explains and demonstrates the history, physics, and mathematics involved with wind tunnels and wind tunnel testing. The Web site contains several interactive computer programs to demonstrate scientific principles. TunnelSim is an interactive, educational computer program that demonstrates basic wind tunnel design and operation. TunnelSim is a Java (Sun Microsystems Inc.) applet that solves the continuity and Bernoulli equations to determine the velocity and pressure throughout a tunnel design. TunnelSys is a group of Java applications that mimic wind tunnel testing techniques. Using TunnelSys, a team of students designs, tests, and post-processes the data for a virtual, low speed, and aircraft wing.

EnKF OSSE Experiments Assessing the Impact of HIRAD Wind Speed and HIWRAP Radial Velocity Data on Analysis of Hurricane Karl (2010)

Science.gov (United States)

Albers, Cerese; Sippel, Jason A.; Braun, Scott A.; Miller, Timothy

2012-01-01

Previous studies (e.g., Zhang et al. 2009, Weng et al. 2011) have shown that radial velocity data from airborne and ground-based radars can be assimilated into ensemble Kalman filter (EnKF) systems to produce accurate analyses of tropical cyclone vortices, which can reduce forecast intensity error. Recently, wind speed data from SFMR technology has also been assimilated into the same types of systems and has been shown to improve the forecast intensity of mature tropical cyclones. Two instruments that measure these properties were present during the NASA Genesis and Rapid Intensification Processes (GRIP) field experiment in 2010 which sampled Hurricane Karl, and will next be co-located on the same aircraft for the subsequent NASA HS3 experiment. The High Altitude Wind and Rain Profiling Radar (HIWRAP) is a conically scanning Doppler radar mounted upon NASAs Global Hawk unmanned aerial vehicle, and the usefulness of its radial velocity data for assimilation has not been previously examined. Since the radar scans from above with a fairly large fixed elevation angle, it observes a large component of the vertical wind, which could degrade EnKF analyses compared to analyses with data taken from lesser elevation angles. The NASA Hurricane Imaging Radiometer (HIRAD) is a passive microwave radiometer similar to SFMR, and measures emissivity and retrieves hurricane surface wind speeds and rain rates over a much wider swath. Thus, this study examines the impact of assimilating simulated HIWRAP radial velocity data into an EnKF system, simulated HIRAD wind speed, and HIWRAP+HIRAD with the Weather Research and Forecasting (WRF) model and compares the results to no data assimilation and also to the Truth from which the data was simulated for both instruments.

A stargazing program for beginners a pocket field guide

CERN Document Server

Carter, Jamie

2015-01-01

 By investing just an hour a week and $50 in binoculars, it’s possible to learn a few simple techniques and quickly gain a real insight into the night sky's ever-changing patterns – and what they tell us about Earth, the seasons and ourselves. Searching more for a learned appreciation of nature and our exact place within the cosmos than academic scientific knowledge, science and travel writer Jamie Carter takes the reader on a 12 month tour of the night sky's incredible annual rhythms that say so much about Earth. During the journey he learns about the celestial mechanics at work in the skies above that are – to the beginner – almost beyond belief. As well as the vital constellations and clusters, and the weird and wonderful nebulas, he searches out “dark sky destinations” across the globe that help increase knowledge and give a new perspective on familiar night sky sights. On the journey he witnesses a solar eclipse and grapples with star-charts, binoculars, smartphone apps, telescopes, spots sa...

Gaussian anamorphosis in the analysis step of the EnKF: a joint state-variable/observation approach

Directory of Open Access Journals (Sweden)

Javier Amezcua

2014-09-01

Full Text Available The analysis step of the (ensemble Kalman filter is optimal when (1 the distribution of the background is Gaussian, (2 state variables and observations are related via a linear operator, and (3 the observational error is of additive nature and has Gaussian distribution. When these conditions are largely violated, a pre-processing step known as Gaussian anamorphosis (GA can be applied. The objective of this procedure is to obtain state variables and observations that better fulfil the Gaussianity conditions in some sense. In this work we analyse GA from a joint perspective, paying attention to the effects of transformations in the joint state-variable/observation space. First, we study transformations for state variables and observations that are independent from each other. Then, we introduce a targeted joint transformation with the objective to obtain joint Gaussianity in the transformed space. We focus primarily in the univariate case, and briefly comment on the multivariate one. A key point of this paper is that, when (1–(3 are violated, using the analysis step of the EnKF will not recover the exact posterior density in spite of any transformations one may perform. These transformations, however, provide approximations of different quality to the Bayesian solution of the problem. Using an example in which the Bayesian posterior can be analytically computed, we assess the quality of the analysis distributions generated after applying the EnKF analysis step in conjunction with different GA options. The value of the targeted joint transformation is particularly clear for the case when the prior is Gaussian, the marginal density for the observations is close to Gaussian, and the likelihood is a Gaussian mixture.

A Comparison between Verbal Working Memory and Vocabulary in Bilingual and Monolingual South African School Beginners: Implications for Bilingual Language Assessment

Science.gov (United States)

Cockcroft, Kate

2016-01-01

This study compared bilingual and monolingual school beginners on measures of simple and complex verbal working memory and receptive and expressive vocabulary. The aim was to determine whether the tests of working memory are fairer measures of language ability than the vocabulary tests for bilingual children when tested in their second language.…

Raman spectroscopic study of the minerals apophyllite-(KF) KCa4Si8O20F·8H2O and apophyllite-(KOH) KCa4Si8O20(F,OH)·8H2O

Science.gov (United States)

Frost, Ray L.; Xi, Yunfei

2012-11-01

Raman spectroscopy complimented with infrared spectroscopy has been used to study the variation in molecular structure of two minerals of the apophyllite mineral group, namely apophyllite-(KF) KCa4Si8O20F·8H2O and apophyllite-(KOH) KCa4Si8O20(F,OH)·8H2O. apophyllite-(KF) and apophyllite-(KOH) are different minerals only because of the difference in the percentage of fluorine to hydroxyl ions. The Raman spectra are dominated by a very intense sharp peak at 1059 cm-1. A band at around 846 cm-1 is assigned to the water librational mode. It is proposed that the difference between apophyllite-(KF) and apophyllite-(KOH) is the observation of two Raman bands in the OH stretching region at around 3563 and 3625 cm-1. Multiple water stretching and bending modes are observed showing that there is much variation in hydrogen bonding between water and the silicate surfaces.

Moving forward: Revisiting the Spanish for High Beginners course

Directory of Open Access Journals (Sweden)

Flavia Belpoliti

2015-08-01

Full Text Available This paper presents a case study on the redesign of a Spanish for High Beginners (SHB course at a large metropolitan university in Texas, USA. The first section presents a discussion on the diverse nature of students who can benefit from an intensive first-year Spanish course and the challenges that these learners’ mixed abilities pose for instruction. The second section describes the redesign process of the SHB course, including placement procedures, the Spanish Language Program sequence, and changes in the syllabus to integrate communicative and transcultural competences by implementing a combination of focused instruction, collaborative learning and task-based approaches. The last section introduces a short presentation of four activities implemented in the redesigned course, which provide paths for future development of advanced beginners’ integrative tasks. The final section focuses on the results of an exit survey measuring students’ perceptions of the course. The successful implementation of changes and its outcomes demonstrate that this course could be a relevant solution for Spanish programs at tertiary institutions with diverse populations, helping to solve challenges of placement, articulation, and time-to-graduation effectiveness.

Quantitative Analysis of KF-LiF-ZrF4 Molten Salt by Probe Assisted in-situ LIBS Systems

International Nuclear Information System (INIS)

Kim, S.H.; Moon, J.H.; Kim, D.H.; Hwang, I.S.; Lee, J.H.

2015-01-01

Full text of publication follows: Pyro-processing draws attention as a recycling process of spent nuclear fuel for future nuclear reactor. In the aspect of process control and safeguards of the pyro-processing, it requires a technology to measure the concentration of molten salt in real-time. The existing technologies measure the concentration by chemical analysis of sampled molten salt in the hot cell but it is disadvantageous in the aspects of cost, safety and time. The LIBS (Laser-Induced Breakdown Spectroscopy) is a form of atomic emission spectroscopy in which a pulsed laser is used as the excitation source. LIBS technology is appropriate to measure sensitive nuclear materials in hot cell because it is capable of measuring specimen quantitatively and qualitatively by exited atom by laser. Spectrum obtained from plasma is largely influenced by laser operation conditions and physical properties of specimens. Also, plasma induction is limited on the surface of specimen, so analysis of composition inside of the molten salt is extremely difficult. Thus, several restrictions should be overcome in order to apply LIBS for the measurement of molten salt (KF-LiF-ZrF 4 ) composition in real-time. In this study probe assisted LIBS system will be introduced with KF-LiF-ZrF 4 to quantitatively measure molten salt composition. Echelle spectrometer was used and the measurable wavelength area was 250-400 nm, the range of UV ray. NIST atomic spectra database measured the wavelength for molten salt composition, and each element was selected high signal intensity and wavelength range that is not overlapped by other elements. (authors)

Optical spectra of phthalocyanines and related compounds a guide for beginners

CERN Document Server

Isago, Hiroaki

2015-01-01

This book displays how optical (absorption, emission, and magnetic circular dichroism) spectra of phthalocyanines and related macrocyclic dyes can be varied from their prototypical ones depending on conditions. As these compounds can be involved in colorful chemistry (which might be driven by impurities in solvents), their spectra behave like the sea-god Proteus in their mutability. Therefore, those who have been engaged with phthalocyanines for the first time, including even educated professional researchers and engineers, may have been embarrassed by the deceptive behavior of their compounds and could have, in the worst cases, given up their projects. This book is aimed not merely at reviewing the optical spectra, but also at helping such people, particularly beginners, to figure them out by showing some examples of their prototypical spectra and their variations in several situations. For the purpose of better understanding, the book also provides an introduction to their theoretical backgrounds as graphic...

Status report. KfK contribution to the development of DEMO-relevant test blankets for NET/ITER. Pt. 1: Self-cooled liquid metal breeder blanket. Vol. 1

International Nuclear Information System (INIS)

Malang, S.; Reimann, J.; Sebening, H.; Barleon, L.; Bogusch, E.; Bojarsky, E.; Borgstedt, H.U.; Buehler, L.; Casal, V.; Deckers, H.; Feuerstein, H.; Fischer, U.; Frees, G.; Graebner, H.; John, H.; Jordan, T.; Kramer, W.; Krieg, R.; Lenhart, L.; Malang, S.; Meyder, R.; Norajitra, P.; Reimann, J.; Schwenk-Ferrero, A.; Schnauder, H.; Stieglitz, R.; Oschinski, J.; Wiegner, E.

1991-12-01

A self-cooled liquid metal breeder blanket for a fusion DEMO-reactor and the status of the development programme is described as a part of the European development programme of DEMO relevant test blankets for NET/ITER. Volume 1 (KfK 4907) contains a summary, Volume 2 (KfK 4908) a more detailed version of the report. Both volumes contain sections on previous studies on self-cooled liquid metal breeder blankets, the reference blanket design for a DEMO-reactor, a typical test blanket design including the ancillary loop system and the building requirements for NET/ITER together with the present status of the associated R and D-programme in the fields of neutronics, magnetohydrodynamics, tritium removal and recovery, liquid metal compatibility and purification, ancillary loop system, safety and reliability. An outlook is given regarding the required R and D-programme for the self-cooled liquid metal breeder blanket prior to tests in NET/ITER and the relevant test programme to be performed in NET/ITER. (orig.) [de

Short-Range prediction of a Mediterranean Severe weather event using EnKF: Configuration tests

Science.gov (United States)

Carrio Carrio, Diego Saul; Homar Santaner, Víctor

2014-05-01

The afternoon of 4th October 2007, severe damaging winds and torrential rainfall affected the Island of Mallorca. This storm produced F2-F3 tornadoes in the vicinity of Palma, with one person killed and estimated damages to property exceeding 10 M€. Several studies have analysed the meteorological context in which this episode unfolded, describing the formation of a train of multiple thunderstorms along a warm front and the evolution of a squall line organized from convective activity initiated offshore Murcia during that morning. Couhet et al. (2011) attributed the correct simulation of the convective system and particularly its organization as a squall line to the correct representation of a convergence line at low-levels over the Alboran Sea during the first hours of the day. The numerical prediction of mesoscale phenomena which initiates, organizes and evolves over the sea is an extremely demanding challenge of great importance for coastal regions. In this study, we investigate the skill of a mesoscale ensemble data assimilation system to predict the severe phenomena occurred on 4th October 2007. We use an Ensemble Kalman Filter which assimilates conventional (surface, radiosonde and AMDAR) data using the DART implementation from (NCAR). On the one hand, we analyse the potential of the assimilation cycle to advect critical observational data towards decisive data-void areas over the sea. Furthermore, we assess the sensitivity of the ensemble products to the ensemble size, grid resolution, assimilation period and physics diversity in the mesoscale model. In particular, we focus on the effect of these numerical configurations on the representation of the convective activity and the precipitation field, as valuable predictands of high impact weather. Results show that the 6-h EnKF assimilation period produces initial fields that successfully represent the environment in which initiation occurred and thus the derived numerical predictions render improved

Multiscale KF Algorithm for Strong Fractional Noise Interference Suppression in Discrete-Time UWB Systems

Directory of Open Access Journals (Sweden)

Liyun Su

2011-01-01

Full Text Available In order to suppress the interference of the strong fractional noise signal in discrete-time ultrawideband (UWB systems, this paper presents a new UWB multi-scale Kalman filter (KF algorithm for the interference suppression. This approach solves the problem of the narrowband interference (NBI as nonstationary fractional signal in UWB communication, which does not need to estimate any channel parameter. In this paper, the received sampled signal is transformed through multiscale wavelet to obtain a state transition equation and an observation equation based on the stationarity theory of wavelet coefficients in time domain. Then through the Kalman filter method, fractional signal of arbitrary scale is easily figured out. Finally, fractional noise interference is subtracted from the received signal. Performance analysis and computer simulations reveal that this algorithm is effective to reduce the strong fractional noise when the sampling rate is low.

Corrosion of superalloy Incoloy 800H/HT in eutectic mixture LiF-NaF-KF with different addition of chromium fluoride; Korozia superzliatiny Incoloy 800H/HT v eutektickej zmesi LiF-NaF-KF s ruznym pridavkom fluoridu chromiteho

Energy Technology Data Exchange (ETDEWEB)

Kontrik, M.; Pavlik, V.; Simko, F. [Slovenska Akademia Vied, Ustav Anorganickej Chemie, Oddelenie Taveninovych Sustav, 84636 Bratislava (Slovakia)

2013-04-16

Thesis deals with investigating the addition of chromium trifluoride to eutectic mixture of LiF-NaF-KF (46.5 - 11.5 - 42 mol %) on the corrosion of superalloy Incoloy 800H/HT with static tests. The corrosion losses of the alloy and type of corrosion attack was observed. It was found that the addition of chromium fluoride into the mixture generally increases of corrosion of the material. Several types of corrosion attacks were observed. On the surface of the samples the spotted, pitting and transgranular corrosions were found. On the cross-sections of the samples the subsurface and lamellar corrosions were detected. (authors)

EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA); Scientific Opinion on the substantiation of a health claim related to KF2BL20 and maintenance of normal hair pursuant to Article 13(5) of Regulation (EC) No 1924/2006

DEFF Research Database (Denmark)

Tetens, Inge

and contributes to reduce hair loss”. The target population proposed by the applicant is healthy adults in the general population. The Panel considers that maintenance of normal hair is a beneficial physiological effect. The applicant identified one single arm study as being pertinent to the health claim...... related to KF2BL20, which is a combination of keratin, copper, zinc, niacin, pantothenic acid, pyridoxine and D-biotin, and maintenance of normal hair. The Panel considers that KF2BL20 is sufficiently characterised. The claimed effect is “helps to reinforce hair strength and normal hair function....... The Panel notes that this study was uncontrolled and considers that no conclusions can be drawn from this study for the scientific substantiation of the claim. The Panel concludes that a cause and effect relationship has not been established between the consumption of KF2BL20 and maintenance of normal hair....

Language Learning Shifts and Attitudes Towards Language Learning in an Online Tandem Program for Beginner Writers

Directory of Open Access Journals (Sweden)

Constanza Tolosa

2017-01-01

Full Text Available We present findings of a project that investigated the potential of an online tandem program to enhance the foreign language learning of two groups of school-aged beginner learners, one learning English in Colombia and the other learning Spanish in New Zealand. We assessed the impact of the project on students’ learning with a free writing activity done as pretest and posttest and used a semi-structured interview to explore their attitudes towards language learning and their perceived development of their native language. Data analysis indicated statistically significant gains in foreign language writing and positive attitudinal changes toward foreign and native language learning.

101 amazing sights of the night sky a guided tour for beginners

CERN Document Server

Moromisato, George

2017-01-01

Is there anything more wondrous and alluring than the night sky? You've seen the stars, and you know about the constellations--but there's so much more to discover! George Moromisato's magnificent full-color guide introduces you to 101 amazing sights, from Saturn's famous rings to the Andromeda Galaxy. Learn what to look for and when and where to find it! This astronomy book is perfect for beginners, so many objects can be seen with the unaided eye or binoculars, while others simply require a small telescope. Book Features: Guide to 101 phenomena and objects of the night sky, ranked by beauty, accessibility and historical importance Information about equipment needed, from binoculars to small telescopes Full-color photographs, including many from NASA Astrophotography tips on taking pictures of the night sky, such as snapping shots with a phone through a telescope Charts to know when to look for solar eclipses, meteor showers and other notable events.

Status report. KfK contribution to the development of DEMO-relevant test blankets for NET/ITER. Pt. 1: Self-cooled liquid metal breeder blanket. Vol. 2. Detailed version

International Nuclear Information System (INIS)

John, H.; Malang, S.; Sebening, H.

1991-12-01

A self-cooled liquid metal breeder blanket for a fusion DEMO-reactor and the status of the development programme is described as a part of the European development programme of DEMO relevant test blankets for NET/ITER. Volume 1 (KfK 4907) contains a summary. Volume 2 (KfK 4908) a more detailed version of the report. Both volumes contain sections on previous studies on self-cooled liquid metal breeder blankets, the reference blanket design for a DEMO-reactor, a typical test blanket design including the ancillary loop system and the building requirements for NET/ITER together with the present status of the associated RandD-programme in the fields of neutronics, magnetohydrodynamics, tritium removal and recovery, liquid metal compatibility and purification, ancillary loop system, safety and reliability. An outlook is given regarding the required RandD-programme for the self-cooled liquid metal breeder blanket prior to tests in NET/ITER and the relevant test programme to be performed in NET/ITER. (orig.) [de

Review of applications of TLBO algorithm and a tutorial for beginners to solve the unconstrained and constrained optimization problems

Directory of Open Access Journals (Sweden)

R. Venkata Rao

2016-01-01

Full Text Available The teaching-learning-based optimization (TLBO algorithm is finding a large number of applications in different fields of engineering and science since its introduction in 2011. The major applications are found in electrical engineering, mechanical design, thermal engineering, manufacturing engineering, civil engineering, structural engineering, computer engineering, electronics engineering, physics, chemistry, biotechnology and economics. This paper presents a review of applications of TLBO algorithm and a tutorial for solving the unconstrained and constrained optimization problems. The tutorial is expected to be useful to the beginners.

Electrochemical behaviours of lanthanide fluorides in the electrolysis system with LiF-NaF-Kf salt

International Nuclear Information System (INIS)

Joon-Bo, Shim; Sung-Chan, Hwang; Eung-Ho, Kim; Young-Ho, Kang; Byung-Jik, Lee; Jae-Hyung, Yoo

2003-01-01

As a part of partitioning studies, the experiments of cyclic voltammetry and electrolytic reduction with the liquid bismuth cathode were conducted to investigate electrochemical behaviours of lanthanide elements in the electrorefining system employing LiF-NaF-KF eutectic salt as the electrolyte. The cyclic voltammograms for NdF 3 and GdF 3 were obtained at various potential scan rates, respectively. The cathodic and anodic peak currents of the elements increased in proportion to the square root of the potential scan rate. According to changes of the potential difference between the coupled cathodic and anodic peaks, reversibilities of the reduction-oxidation reactions in this system were evaluated. In addition, further behaviours of electrochemical reaction of the elements were examined through electrolytic tests of the system using liquid bismuth as the cathode at fixed current densities. (author)

Three stitch hernioplasty: A novel technique for beginners

Science.gov (United States)

Patchayappan, Manikandan; Narayanasamy, Sangara Narayanan; Duraisamy, Nagarajan

2015-01-01

Objective: To analyze mesh fixation with minimum sutures and postoperative complications. Study Design: Prospective study. Place and Duration of Study: Department of General Surgery, Thanjavur Medical College and Hospital, Tamil Nadu, from July 2010 to June 2012. Materials and Methods: All inguinal hernia patients, who fulfilled the sample selection criteria, were admitted and planned for surgery. The prolene mesh is fashioned as in Lichtenstein's repair, placed and fixed only by three prolene stitches. The first stitch is made in the periosteum of pubic tubercle. The second stitch is taken in the inguinal ligament (1.5 cm lateral to the pubic tubercle) and the third stitch is from the medial most part of the conjoint tendon, that is, the mesh is fixed in the medial aspect alone. Results: Majority of the patients fall between the age group of 40 and 60 (72%) years and all are male patients. Of the total cases, 50% were right sided, 25% were left sided, and 25% were bilateral. Of the postoperative complications, 12% had seroma, 4% had hematoma, 2% developed surgical site infection, 2% developed chronic groin pain, 1% presented with recurrence, and none developed foreign body sinus. Conclusion: The incidence of long-term complications of three stitch hernioplasty are comparable to that of the other standard, tension-free open hernia repair as well as other laparoscopic procedures. Moreover, the three stitch hernioplasty method is a simple method, easy for the beginners to adopt, has less foreign body reaction, less time consuming, causes less tissue trauma, and lesser chance for vascular injury. PMID:26629464

Thermodynamic Assessment of Hot Corrosion Mechanisms of Superalloys Hastelloy N and Haynes 242 in Eutectic Mixture of Molten Salts KF and ZrF4

Energy Technology Data Exchange (ETDEWEB)

Michael V. Glazoff

2012-02-01

The KF - ZrF4 system was considered for the application as a heat exchange agent in molten salt nuclear reactors (MSRs) beginning with the work carried out at ORNL in early fifties. Based on a combination of excellent properties such as thermal conductivity, viscosity in the molten state, and other thermo-physical and rheological properties, it was selected as one of possible candidates for the nuclear reactor secondary heat exchanger loop.

Character Learning Strategies Among Danish and Swedish Beginners of Chinese as a Foreign Language (CFL)

DEFF Research Database (Denmark)

Zhang, Chun; Chen, Yi-ting

Inventory for Language Learning (SILL) by Oxford (1990), we adapted Shen’ (2005) questionnaire into two online surveys. The first survey was done in February 2016 aiming to discover some Chinese character learning strategies employed by Danish and Swedish learners. Based on the 1st survey, the second survey......This study was conducted at three universities (i.e., Aarhus University, Copenhagen University, and Stockholm University) at two Nordic countries (i.e., Denmark and Sweden). 39 beginner Danish and Swedish of Chinese (L2) university students participated in the study. Drawing from the strategy...... was developed and thereafter conducted in March 2016. A preliminary analysis revealed that the students used primarily three types of strategies (1) compensation strategies (i.e., application-assisted tools), (2) cognitive strategies (i.e., orthographic knowledge) and (3) memory strategies (i.e., repeated...

Green Michael addition of thiols to electron deficient alkenes using KF/alumina and recyclable solvent or solvent-free conditions

Energy Technology Data Exchange (ETDEWEB)

Lenardao, Eder J.; Trecha, Danusia O.; Ferreira, Patricia da C.; Jacob, Raquel G.; Perin, Gelson [Universidade Federal de Pelotas (UFPEL), Pelotas, RS (Brazil). Inst. de Quimica e Geociencias. Lab. de Sintese Organica Limpa (LASOL)]. E-mail: lenardao@ufpel.edu.br

2009-07-01

A general, clean and easy method for the conjugated addition of thiols to citral promoted by KF/Al{sub 2}O{sub 3} under solvent-free or using glycerin as recyclable solvent at room temperature is described. It was found that the solvent-free protocol is applicable to the direct reaction of thiophenol with the essential oil of lemon grass (Cymbopogon citratus) to afford directly 3,7-dimethyl-3-(phenylthio)oct-6-enal, a potential bactericide agent. The method was extended to other electron-poor alkenes with excellent results. For the solvent-free protocol, the use of microwave irradiation facilitated the procedure and accelerates the reaction. The catalytic system and glycerin can be reused up to three times without previous treatment with comparable activity. (author)

Nuclear Fusion Project. Semi-annual report of the Association KfK/EURATOM

International Nuclear Information System (INIS)

Kast, G.

1989-04-01

Report on technology tasks: Blanket design studies; development of computational tools for neutronics; corrosion and fatigue of structural materials in flowing Pb-17Li; tritium extraction from liquid Pb-17Li by the use of solid getters; ceramic breeder materials; high field composite conductors; superconducting poloidal field coil development; design and construction of a poloidal field coil for TORE SUPRA as NET-prototype coil; structural materials fatigue characterization at 4 K; low electrical conductivity structural development; MANET 1; pre- and post-irradiation fatigue properties of 1.4914 martensitic steel; in-pile creep-fatigue testing of type 316 and 1.4914 steel; ceramics for first-wall protection and for RF windows; fatigue under dual beam irradiation; low activation ferritic-martensitic steels; plasma facing components; procedures and tools for structural design evaluation; remote maintenance; mechanical component assembly; handling equipment for in-vessel components; safety aspects of the cryosystem and of superconducting magnets; safety guidelines for the design of NET; generic environmental impact assessment for a fusion facility; large components for plasma exhaust pumping; optimization of cryogenic vacuum pumping of He; solid particle separators for plasma exhaust; plasma exhaust purification; adsorption of DT on heated metal beds other than U; catalyst development for the exhaust purification process; ECRH power sources; vacuum and exhaust performance of NET; NET TF pancake tests; CAD DATA exchange between NET and KfK; catalytic plasma exhaust gas clean-up facility for NET; NET blanket handling device; electrical connectors for remote handling. (orig./HP)

Electrochemical separation of uranium in the molten system LiF-NaF-KF-UF4

Science.gov (United States)

Korenko, M.; Straka, M.; Szatmáry, L.; Ambrová, M.; Uhlíř, J.

2013-09-01

This article is focused on the electrochemical investigation (cyclic voltammetry and related studies) of possible reduction of U4+ ions to metal uranium in the molten system LiF-NaF-KF(eut.)-UF4 that can provide basis for the electrochemical extraction of uranium from molten salts. Two-step reduction mechanism for U4+ ions involving one electron exchange in soluble/soluble U4+/U3+ system and three electrons exchange in the second step were found on the nickel working electrode. Both steps were found to be reversible and diffusion controlled. Based on cyclic voltammetry, the diffusion coefficients of uranium ions at 530 °C were found to be D(U4+) = 1.64 × 10-5 cm2 s-1 and D(U3+) 1.76 × 10-5 cm2 s-1. Usage of the nickel spiral electrode for electrorefining of uranium showed fairly good feasibility of its extraction. However some oxidant present during the process of electrorefining caused that the solid deposits contained different uranium species such as UF3, UO2 and K3UO2F5.

USABILITY TESTING OF JAPANESE CAPTIONS SEGMENTATION SYSTEM TO SCAFFOLD BEGINNERS TO COMPREHEND JAPANESE VIDEOS

Directory of Open Access Journals (Sweden)

Ya-Fei Yang

2013-06-01

Full Text Available A major learning difficulty of Japanese foreign language (JFL learners is the complex composition of two syllabaries, hiragana and katakana, and kanji characters adopted from logographic Chinese ones. As the number of Japanese language learners increases, computer-assisted Japanese language education gradually gains more attention. This study aimed to adopt a Japanese word segmentation system to help JFL learners overcome literacy problems. This study adopted MeCab, a Japanese morphological analyzer and part-of-speech (POS tagger, to segment Japanese texts into separate morphemes by adding spaces and to attach POS tags to each morpheme for beginners. The participants were asked to participate in three experimental activities involvingwatching two Japanese videos with general or segmented Japanese captions and complete the Nielsen’s Attributes of Usability (NAU survey and the After Scenario Questionnaire (ASQ to evaluate the usability of the learning activities. The results of the system evaluation showed that the videos with the segmented captions could increase the participants’ learning motivation and willingness to adopt the word segmentation system to learn Japanese.

Advanced Beginner to Competent Practitioner: New Graduate Nurses' Perceptions of Strategies That Facilitate or Hinder Development.

Science.gov (United States)

St-Martin, Lyne; Harripaul, Anastasia; Antonacci, Rosetta; Laframboise, Devon; Purden, Margaret

2015-09-01

New graduate nurses (NGNs) are a precious resource, but their development from advanced beginners to competent nurses is challenging. This qualitative descriptive study explored NGNs' perceptions of strategies that influenced their development in the first 2 years of employment. Semistructured interviews were conducted with a sample of 13 nurses. The study revealed that NGNs learn to master aspects of the nursing role as they construct a professional identity. They identified organizational, educational, and personal strategies as being important to their development, including tailored orientation, opportunities for skill acquisition, and personal support. Few strategies supported the development of professional identity. Mastering the nursing role and constructing a professional identity is central to NGNs' development. Further attention from nursing leaders is needed to promote concurrent development in both dimensions. Nurses with a strong professional identity are more likely to remain in the profession. Copyright 2015, SLACK Incorporated.

KfK-analysis of the SUPER-PHENIX-1 control rod experiments. Pt. 2

International Nuclear Information System (INIS)

Giese, H.

1992-10-01

Using standard data and codes, this first analysis campaign led to results that drastically overestimated measured control rod worths with C/E ratios ranging from 1.17 to 1.28. These findings were in sharp contrast to the results of the majority of earlier control rod experiments in zero-power facilities, where C/E ratios were usually comprised between 1.0 and 1.1. Investigations were then launched to identify the origin of this discrepancy. By comparison with the calculation methods employed by the other working groups engaging in the analysis of the SPX-1 experiments it was found that the principal problem arose from the KfK/BN-procedure used for the homogenization of control rod absorber cross sections. The specific failure of this standard procedure in the case of the SPX-1 analysis is ascribed to the extremely heterogeneous structure of the SPX-1 control rods. In an attempt to improve on this point, a new method for the production of homogenized absorber cross sections was developed and applied to the SPX-1 analysis. The report concludes with a description of this method and a survey of the results obtained for SPX-1. It is found that this revised analysis leads to a significantly improved agreement of measured and calculated control rod worths and to a better consistency with the results of earlier control rod experiments in zero-power facilities. (orig.)

Ethanol production from kitchen waste using the flocculating yeast Saccharomyces cerevisiae strain KF-7

International Nuclear Information System (INIS)

Tang, Y.-Q.; Koike, Yoji; Liu Kai; An, M.-Z.; Morimura, Shigeru; Wu Xiaolei; Kida, Kenji

2008-01-01

A process for producing ethanol from kitchen waste was developed in this study. The process consists of freshness preservation of the waste, saccharification of the sugars in the waste, continuous ethanol fermentation of the saccharified liquid, and anaerobic treatment of the saccharification residue and the stillage. Spraying lactic acid bacteria (LCB) on the kitchen waste kept the waste fresh for over 1 week. High glucose recovery (85.5%) from LCB-sprayed waste was achieved after saccharification using Nagase N-40 glucoamylase. The resulting saccharified liquid was used directly for ethanol fermentation, without the addition of any nutrients. High ethanol productivity (24.0 g l -1 h -1 ) was obtained when the flocculating yeast strain KF-7 was used in a continuous ethanol fermentation process at a dilution rate of 0.8 h -1 . The saccharification residue was mixed with stillage and treated in a thermophilic anaerobic continuous stirred tank reactor (CSTR); a VTS loading rate of 6 g l -1 d -1 with 72% VTS digestion efficiency was achieved. Using this process, 30.9 g ethanol, and 65.2 l biogas with 50% methane, was produced from 1 kg of kitchen waste containing 118.0 g total sugar. Thus, energy in kitchen waste can be converted to ethanol and methane, which can then be used as fuels, while simultaneously treating kitchen waste

Ethanol production from kitchen waste using the flocculating yeast Saccharomyces cerevisiae strain KF-7

Energy Technology Data Exchange (ETDEWEB)

Tang, Yue-Qin; Liu, Kai; An, Ming-Zhe; Morimura, Shigeru; Kida, Kenji [Graduate School of Science and Technology, Kumamoto University, 2-39-1 Kurokami, Kumamoto 860-8555 (Japan); Koike, Yoji [Tokyo Gas Co., Ltd., 1-7-7 Suehiro-cho, Tsurumi-ku, Yokohama City, Kanagawa 230-0045 (Japan); Wu, Xiao-Lei [Department of Energy and Resources Engineering, College of Engineering, Peking University, Beijing 100871 (China)

2008-11-15

A process for producing ethanol from kitchen waste was developed in this study. The process consists of freshness preservation of the waste, saccharification of the sugars in the waste, continuous ethanol fermentation of the saccharified liquid, and anaerobic treatment of the saccharification residue and the stillage. Spraying lactic acid bacteria (LCB) on the kitchen waste kept the waste fresh for over 1 week. High glucose recovery (85.5%) from LCB-sprayed waste was achieved after saccharification using Nagase N-40 glucoamylase. The resulting saccharified liquid was used directly for ethanol fermentation, without the addition of any nutrients. High ethanol productivity (24.0 g l{sup -1} h{sup -1}) was obtained when the flocculating yeast strain KF-7 was used in a continuous ethanol fermentation process at a dilution rate of 0.8 h{sup -1}. The saccharification residue was mixed with stillage and treated in a thermophilic anaerobic continuous stirred tank reactor (CSTR); a VTS loading rate of 6 g l{sup -1} d{sup -1} with 72% VTS digestion efficiency was achieved. Using this process, 30.9 g ethanol, and 65.2 l biogas with 50% methane, was produced from 1 kg of kitchen waste containing 118.0 g total sugar. Thus, energy in kitchen waste can be converted to ethanol and methane, which can then be used as fuels, while simultaneously treating kitchen waste. (author)

User's guide for the portable microprocessor equipment: 'KfK K-edge densitometer' for quantitative determination of Th, U, Np, Pu, Am in solutions

International Nuclear Information System (INIS)

Michel-Piper, I.; Matussek, P.

1985-06-01

This report describes the hardware and software features, and the use of the microprocessor-controlled multichannel analyzer system SILENA + IRIS. The self-contained portable system, which permits independent accumulation and evaluation of spectral data from the KfK K-edge densitometer, provides one of the possible means for the authentication of resident instruments by safeguards inspectors. The 'K-Edge' program, written in PL/M language for compatibility with the system's firmware, allows fully automated assays of heavy element concentrations in solutions by means of X-ray absorption edge spectrometry. It is primarily intended for highly accurate determinations of the U and Pu content in process- and product solutions of a reprocessing plant. (orig.)

A Web-Based, Social Networking Beginners' Running Intervention for Adults Aged 18 to 50 Years Delivered via a Facebook Group: Randomized Controlled Trial.

Science.gov (United States)

Looyestyn, Jemma; Kernot, Jocelyn; Boshoff, Kobie; Maher, Carol

2018-02-26

Online social networks continue to grow in popularity, with 1.7 billion users worldwide accessing Facebook each month. The use of social networking sites such as Facebook for the delivery of health behavior programs is relatively new. The primary aim of this study was to determine the effectiveness of a Web-based beginners' running program for adults aged 18 to 50 years, delivered via a Facebook group, in increasing physical activity (PA) and cardiorespiratory fitness. A total of 89 adults with a mean age of 35.2 years (SD 10.9) were recruited online and via print media. Participants were randomly allocated to receive the UniSA Run Free program, an 8-week Web-based beginners' running intervention, delivered via a closed Facebook group (n=41) that included daily interactive posts (information with links, motivational quotes, opinion polls, or questions) and details of the running sessions; or to the control group who received a hard copy of the running program (n=48). Assessments were completed online at baseline, 2 months, and 5 months. The primary outcome measures were self-reported weekly moderate to vigorous physical activity (MVPA) and objectively measured cardiorespiratory fitness. Secondary outcomes were social support, exercise attitudes, and self-efficacy. Analyses were undertaken using random effects mixed modeling. Compliance with the running program and engagement with the Facebook group were analyzed descriptively. Both groups significantly increased MVPA across the study period (P=.004); however, this was significantly higher in the Facebook group (P=.04). The Facebook group increased their MVPA from baseline by 140 min/week versus 91 min for the control at 2 months. MVPA remained elevated for the Facebook group (from baseline) by 129 min/week versus a 50 min/week decrease for the control at 5 months. Both groups had significant increases in social support scores at 2 months (P=.02); however, there were no group by time differences (P=.16). There were

Structuring scientific works in the “Introduction, Methods, Results and Discussion” format – what a beginner ought to know

Directory of Open Access Journals (Sweden)

N. V. Avdeeva

2016-01-01

Full Text Available Reference materials about the “Introduction, Methods, Results and Discussion”, which is a commonly used international format for scientific works, have become available for Russian authors nowadays, still lack of knowledge about the format would pop up here or there, especially when we speak about beginners. The faults which would appear regularly in work structuring prompted the present research, the aim of which is to compare the information about the IMRAD format with the specific difficulties beginning authors would often face when preparing their works for publication.The main materials to be studied were sources in Russian and in English published mostly in 2010s and devoted to the problems of structuring works according to the meant above format. Besides, the present research considered the results of plagiarism tests (such tests used to be carried out at the Russia State Library within the period of 2013 – 2015 with the help of software “Automated system of specialized processing of textual documents”. The main methods of our research would remain structural and comparative analysis of texts.As a result, our research revealed the fact of inconsistency of the available information on the IMRAD structure. It would often demand deep thinking and explanations. Different authors of reference editions would as a rule differ one from another in their interpretation of the degree of necessity of this or that composition element, of the amount of details in descriptions, etc. Moreover, the very structure of scientific work looks differently for different authors. More often the structure supposes the integrity of the contents and its form, still sometimes its description would be replaced by outer elements, such as, for example, language clichés. The analysis of the most common faults in text structuring points that authors do not often have a clear idea of how to understand the different demands which are so obscurely described

Rainfall Simulations of Typhoon Morakot with Controlled Translation Speed Based on EnKF Data Assimilation

Directory of Open Access Journals (Sweden)

Tzu-Hsiung Yen

2011-01-01

Full Text Available Typhoon Morakot produced record-breaking accumulated rainfall over southern Taiwan in August 2009. The combination of several factors resulted in this extreme weather event: the steep terrain in Taiwan, the prevailing south-westerly flow in the monsoon trough, Typhoon Goni over the northern South China Sea, and the slow translation speed of Morakot itself over Taiwan. In this study, the influence of the translation speed is particularly emphasized. Based on the EnKF data assimilation, an innovative method is applied to perform ensemble simulations with several designated translation speeds of Morakot using the WRF model. Thus the influence of the translation speed on the amount of accumulated rainfall over Taiwan can be quantitatively evaluated. In the control simulation with observed translation speed, the maximum amount and geographic pattern of accumulated rainfall during the landfall period of Morakot are generally consistent with the observations, though the detailed overall distributions of accumulated rainfall is mostly underestimated, resulting in the low bias of the frequency distribution of the accumulated rainfall. In a simulation with nearly-doubled translation speed of Morakot, the maximum accumulated rainfall is decreased by 33% than that in the control simulation, while the rainfall distribution over Taiwan remains similar. In addition, the 28 ensemble members can further provide additional information in terms of their spread and other statistics. The results from ensemble members reveal the usefulness of ensemble simulations for the quantitative precipitation forecast.

Using a task-based approach to teaching and learning Chinese as a Foreign Language in a university beginner's level class

DEFF Research Database (Denmark)

Ruan, Youjin; Duan, Xiaoju; Wang, Li

2015-01-01

to learning Chinese as a foreign language. Chinese culture elements were also integrated into the tasks and the learning process. By analysing seven items of a post-course survey, this paper investigates the learners’ opinions toward the task-based language teaching and learning method, as well as the methods......The task-based method is regarded as an effective approach for promoting interaction and collaboration in language learning. In a beginner Chinese language course offered as an elective at Aalborg University, Denmark, a selection of tasks was designed and used to attract the students’ interests...... used in integrating culture with the language learning in this course. The results indicated that course participants were generally positive about their learning experiences and processes during the course. They appreciated not only the task-based method, but also the ways in which culture...

Elaboration and experimental study of the Borosilicate glass GP 98/12 for the vitrification of the radioactive wastes of KfKarlsruhe Centre (R.F.A.)

International Nuclear Information System (INIS)

Ghezal, A.

1987-09-01

The transformation into a vitrified block of highly radioactive liquid wastes is actually the best solution for the storage in long run. In West Germany, the research institute in the field of nuclear energy (KfK) has been oriented in this way by developing industrial processes of vitrification and by following studies on the behaviour of the final products. For the fission products, the chosen glasses present good stability characteristics and are used as a first barrier during confinement. Our work, which is part of the research program on radioactive waste vitrification, consists of preparing borosilicate glass GP 98/12 and studying physical and chemical characteristics. We have also contributed to the development and the realization of glass blocks sampling system prepared at pilot scale

What on earth is a mainframe ? an introduction to IBM zSeries mainframes and z/OS operating systems for total beginners

CERN Document Server

Stephens, David

2008-01-01

Looking for a "Mainframes for Beginners" book? Need to learn about z/OS fast? Then this is the book you need. This is the perfect introduction to IBM System z Mainframes and z/OS. Avoiding technical jargon, it gives you the basic facts in clear, light-hearted, entertaining English. You'll quickly learn what Mainframes are, what they do, what runs on them, and terms and terminology you need to speak Mainframe-ese. But it's not all technical. There's also invaluable information about the people that work on Mainframes, Mainframe management issues, new Mainframe trends, and other facts that don't seem to be written down anywhere else. What On Earth is a Mainframe is the closest you'll get to a "Mainframes for Dummies" book. Programmers, managers, recruitment consultants, and industry commentators will all find this book their new best friend when trying to understand the Mainframe world.

Purification of Biotransformation Products of Cis-Isoflavan-4-ol by Biphenyl Dioxygenase of Pseudomonas pseudoalcaligenes KF707 Strain Expressed in Escherichia coli

Directory of Open Access Journals (Sweden)

Tri Ratna Sulistiyani

2013-04-01

Full Text Available Isoflavone has multiple beneficial effects on human health, especially through its antioxidant and anticancer activities. The biotransformation of isoflavone using byphenyl dioxygenase could be performed to extend the diversity of flavonoids and to improve their biological and physiological properties. Biotransformation of two enantiomers (3R, 4R-cis-isoflavan-4-ol and (3S, 4S-cis-isoflavan-4-ol by E. coli JM109 (pJHF108 carrying a biphenyl dioxygenase gene from P. pseudoalcaligenesKF707 produced two products, designated as CM1 andCM2. The products had a retention time of 11.9 and 14.6 min, respectively, and the same absorption peaks at 204, 220, and 275 nm. CM1 and CM2 had [M-H2O+H]+ at m/z 225. Based on the molecular mass and hydrolysis products, we proposed that epoxidation occurred on cis-isoflavan-4-ol. Chloroform extraction instead of ethyl acetate extraction was performed to improve the stability of cismetabolites, CM1 and CM2.

EIR, KfK joint heat transfer experiment on a single rod, roughened with trapezoidal rounded ribs and cooled by various gases

International Nuclear Information System (INIS)

Hudina, M.; Huggenberger, M.; Dalle Donne, M.; Meyer, L.; Rehme, K.

1978-10-01

Heat transfer and pressure drop experiments with an identical fuel rod simulator have been performed at the two Research Establishments in Wuerenlingen and in Karlsruhe. The rod was artificially roughened with 'two-dimensional' ribs of trapezoidal shape and with rounded edges. The experiments at EIR were performed with CO 2 and the rough rod was contained in a smooth tube and centered by special spacers. The experiments at KfK were performed using helium and nitrogen in the same test section (rod and outer smooth tube with spacers) and air with the rod mounted in another outer smooth tube and with spacers located farther away from the measuring positions. The global measured friction factors and Stanton numbers for different gases agree reasonably well. The differences between the roughness parameters R and G are larger. The possible reasons for the uncertainties in the reduction of these parameters are discussed. It is recommended to perform further experiments with helium in a test section with spacers far apart, to investigate the effect of the temperature ratio on heat transfer and to check if the unfavourable data obtained by the experiment with air are too pessimistic for GCFR application. (orig.) [de

Teaching Norwegian to Beginners: Six Principles to Guide Lesson Planning

Directory of Open Access Journals (Sweden)

Anna Krulatz

2014-01-01

Full Text Available Teaching a foreign language is no simple task. There are several factors to consider, from curriculum design, to material selection and lesson implementation, to assessment. The challenge, however, is even greater, if you are teaching a less commonly taught language such as Norwegian – a language spoken by fewer than six million native speakers, used almost exclusively in one country, and with a limited number of available pedagogical materials. Under such circumstances, the task of preparing high quality communicative lessons is immense, even for an experienced language instructor. The goal of this article is to present how a successful language lesson can be developed even if one is using a textbook that does not foster communicative competence. As an example, I am using a unit from a Norwegian textbook for beginners: På vei, often used in Norwegian as a second language course for adults in Norway. The lesson focuses on routines and times of the day, and it concludes with the students comparing and contrasting their daily routines with a partner. Prior to this lesson, students have learned to provide basic information about themselves (where they come from, what languages they speak, what they do for work, expressions for greetings and goodbyes, basic verbs relating to daily activities such as ‘snakker’ (to speak, ‘kjører’ (to drive, ‘kjøpper’ (to buy, ‘jobber’ (to work, ‘leser’ (to read, ‘scriver’ (to write, ordinal numerals, meals, some food items, some basic prepositions and locations, words for family members, and subject and object pronouns for all persons. If you were to closely follow the textbook in teaching this unit, you would begin by teaching the students how to tell time, then briefly go over some verbs to express daily routines, listen to and read a text titled ‘Jeg står opp klokka seks,’ a narrative about Monica’s day (Monica is one of the characters in the book, and finally ask the students

Using a Blog to Guide Beginner Students to Use Adjectives Appropriately When Writing Descriptions in English (El uso de una bitácora o "blog" para guiar a estudiantes principiantes en el uso apropiado de los adjetivos cuando escriben descripciones en inglés)

Science.gov (United States)

Lizarazo Jara, Omar Yesid

2012-01-01

Beginner students often have difficulties using adjectives when they write descriptions in English. This article focuses on the procedures used to help my sixth grade students understand and use adjectives in the correct order by using a blog. To achieve the objective of the project I decided to implement an innovation in and out of class…

A Facile and Efficient Synthesis of Diaryl Amines or Ethers under Microwave Irradiation at Presence of KF/Al2O3 without Solvent and Their Anti-Fungal Biological Activities against Six Phytopathogens

Directory of Open Access Journals (Sweden)

Tao Zhang

2013-09-01

Full Text Available A series of diaryl amines, ethers and thioethers were synthesized under microwave irradiation efficiently at presence of KF/Al2O3 in 83%–96% yields without any solvent. The salient characters of this method lie in short reaction time, high yields, general applicability to substrates and simple workup procedure. At the same time, their antifungal biological activities against six phytopathogen were evaluated. Most of the compounds (3b, 3c, 3g–o are more potent than thiophannate-methyl against to Magnaporthe oryzae. This implies that diaryl amine or ether moiety may be helpful in finding a fungicide against Magnaporthe oryzae.

Oracle Application Express 5 for beginners a practical guide to rapidly develop data-centric web applications accessible from desktop, laptops, tablets, and smartphones

CERN Document Server

2015-01-01

Oracle Application Express has taken another big leap towards becoming a true next generation RAD tool. It has entered into its fifth version to build robust web applications. One of the most significant feature in this release is a new page designer that helps developers create and edit page elements within a single page design view, which enormously maximizes developer productivity. Without involving the audience too much into the boring bits, this full colored edition adopts an inspiring approach that helps beginners practically evaluate almost every feature of Oracle Application Express, including all features new to version 5. The most convincing way to explore a technology is to apply it to a real world problem. In this book, you’ll develop a sales application that demonstrates almost every feature to practically expose the anatomy of Oracle Application Express 5. The short list below presents some main topics of Oracle APEX covered in this book: Rapid web application development for desktops, la...

Storing Hydrogen, by Enhancing Diamond Powder Properties under Hydrogen Plasma with CaF2 and KF for Use in Fuel Cells

International Nuclear Information System (INIS)

Ochoa, Franklyn E. Colmenares

2006-01-01

A fuel cell is like a battery that instead of using electricity to recharge itself, it uses hydrogen. In the fuel cell industry, one of the main problems is storing hydrogen in a safe way and extracting it economically. Gaseous hydrogen requires high pressures which could be very dangerous in case of a collision. The success of hydrogen use depends largely on the development of an efficient storage and release method. In an effort to develop a better hydrogen storage system for fuel cells technology this research investigates the use of 99% pure diamond powder for storing hydrogen. Mixing this powder with a calcium fluoride and potassium fluoride compound in its solid form and treating the surface of the powder with hydrogen plasma, modifies the surface of the diamond. After some filtration through distilled water and drying, the modified diamond is treated with hydrogen. We expect hydrogen to be attracted to the diamond powder surface in higher quantities due to the CaF2 and KF treatment. Due to the large surface area of diamond nanopowder and the electronegative terminal bonds of the fluorine particles on the structure's surface, to the method shows promise in storing high densities of hydrogen

Kiwifruit Non-Sugar Components Reduce Glycaemic Response to Co-Ingested Cereal in Humans

Directory of Open Access Journals (Sweden)

Suman Mishra

2017-10-01

Full Text Available Kiwifruit (KF effects on the human glycaemic response to co-ingested wheat cereal were determined. Participants (n = 20 consumed four meals in random order, all being made to 40 g of the same available carbohydrate, by adding kiwifruit sugars (KF sug; glucose, fructose, sucrose 2:2:1 to meals not containing KF. The meals were flaked wheat biscuit (WB+KFsug, WB+KF, WB+guar gum+KFsug, WB+guar gum+KF, that was ingested after fasting overnight. Blood glucose was monitored 3 h and hunger measured at 180 min post-meal using a visual analogue scale. KF and guar reduced postprandial blood glucose response amplitude, and prevented subsequent hypoglycaemia that occurred with WB+KFsug. The area between the blood glucose response curve and baseline from 0 to 180 min was not significantly different between meals, 0–120 min areas were significantly reduced by KF and/or guar. Area from 120 to 180 min was positive for KF, guar, and KF+guar, while the area for the WB meal was negative. Hunger at 180 min was significantly reduced by KF and/or guar when compared with WB. We conclude that KF components other than available carbohydrate may improve the glycaemic response profile to co-ingested cereal food.

A Ketogenic Formula Prevents Tumor Progression and Cancer Cachexia by Attenuating Systemic Inflammation in Colon 26 Tumor-Bearing Mice

Directory of Open Access Journals (Sweden)

Kentaro Nakamura

2018-02-01

Full Text Available Low-carbohydrate, high-fat diets (ketogenic diets might prevent tumor progression and could be used as supportive therapy; however, few studies have addressed the effect of such diets on colorectal cancer. An infant formula with a ketogenic composition (ketogenic formula; KF is used to treat patients with refractory epilepsy. We investigated the effect of KF on cancer and cancer cachexia in colon tumor-bearing mice. Mice were randomized into normal (NR, tumor-bearing (TB, and ketogenic formula (KF groups. Colon 26 cells were inoculated subcutaneously into TB and KF mice. The NR and TB groups received a standard diet, and the KF mice received KF ad libitum. KF mice preserved their body, muscle, and carcass weights. Tumor weight and plasma IL-6 levels were significantly lower in KF mice than in TB mice. In the KF group, energy intake was significantly higher than that in the other two groups. Blood ketone body concentrations in KF mice were significantly elevated, and there was a significant negative correlation between blood ketone body concentration and tumor weight. Therefore, KF may suppress the progression of cancer and the accompanying systemic inflammation without adverse effects on weight gain, or muscle mass, which might help to prevent cancer cachexia.

Effect of pre-entry instruction as an additional part of radiation training beginner's course on reduction of radioactive contamination in two independent unsealed radioisotope facilities

International Nuclear Information System (INIS)

Matsuda, Naoki; Yoshida, Masahiro; Takao, Hideaki; Kaneko, Mamoru; Okumura, Yutaka; Shimasaki, Tatsuya; Kojima, Akihiro; Shiraishi, Yoshioki; Horiuchi, Seikoh

2005-01-01

The education for radiation workers is essential for the safety of radiation facility that stands on radiation protection practice by each worker. Japanese laws concerning radiation safety requires each radiation worker attending the 6 hours beginner's training course before entering the control area. However, in unsealed radioisotope facilities, radioactive contaminations in the control area may still take place because practical procedures for radiation safety vary depending on the type of experiments and the characteristics of radioisotopes. Therefore, an additional and practical training for each radiation worker is needed. In an attempt to give the workers an additional training of this kind, the pre-entry instruction was performed independently in Center for Frontier Life Sciences, Nagasaki University and in Institute of Resource Development and Analysis Kumamoto University. In this study, the efficacy of the instruction in each facility was assessed quantitatively on the basis of the incidence of contamination in the control area. The instruction covered laboratory rules, radioisotope ordering information, description of sign-up sheets, radioactive waste management, use of survey meters, and lab tour with an appropriate modification to meet with a specificity of each experiment. The instruction was given to beginners and to refreshers who have not handled radioisotopes for a long period, in a face-to-face manner for 1 hour before they start working radioisotopes. To examine the education effect on the reduction of contamination in a typical and frequently used laboratory, the contamination in molecular biology room of Nagasaki University was surveyed directly by a GM survey meter on a daily basis. In Kumamoto University, contamination on the surface of the entire floor in the control area was surveyed monthly by the smear method to know the education effect on general reduction of contamination. The results revealed that the number of contamination decreased

KF46 METAR

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

Assessment of PDMS-water partition coefficients: implications for passive environmental sampling of hydrophobic organic compounds

Science.gov (United States)

DiFilippo, Erica L.; Eganhouse, Robert P.

2010-01-01

Solid-phase microextraction (SPME) has shown potential as an in situ passive-sampling technique in aquatic environments. The reliability of this method depends upon accurate determination of the partition coefficient between the fiber coating and water (Kf). For some hydrophobic organic compounds (HOCs), Kf values spanning 4 orders of magnitude have been reported for polydimethylsiloxane (PDMS) and water. However, 24% of the published data examined in this review did not pass the criterion for negligible depletion, resulting in questionable Kf values. The range in reported Kf is reduced to just over 2 orders of magnitude for some polychlorinated biphenyls (PCBs) when these questionable values are removed. Other factors that could account for the range in reported Kf, such as fiber-coating thickness and fiber manufacturer, were evaluated and found to be insignificant. In addition to accurate measurement of Kf, an understanding of the impact of environmental variables, such as temperature and ionic strength, on partitioning is essential for application of laboratory-measured Kf values to field samples. To date, few studies have measured Kf for HOCs at conditions other than at 20 degrees or 25 degrees C in distilled water. The available data indicate measurable variations in Kf at different temperatures and different ionic strengths. Therefore, if the appropriate environmental variables are not taken into account, significant error will be introduced into calculated aqueous concentrations using this passive sampling technique. A multiparameter linear solvation energy relationship (LSER) was developed to estimate log Kf in distilled water at 25 degrees C based on published physicochemical parameters. This method provided a good correlation (R2 = 0.94) between measured and predicted log Kf values for several compound classes. Thus, an LSER approach may offer a reliable means of predicting log Kf for HOCs whose experimental log Kf values are presently unavailable. Future

Influence of Polyaniline Coated Kenaf Fiber on Kenaf Paper Sheet

OpenAIRE

Abdullah Hisham Nur Syafiqah; Abd Razak Saiful Izwan; Mat Nayan Nadirul Hasraf; Wan Abdul Rahman Wan Aizan

2015-01-01

This paper reports the properties of newly developed electrically conductive natural fiber paper sheet made up of kenaf fiber (KF) incorporated with polyaniline coated kenaf fiber (KF-PANI). This study proposed on dispersion of conductive filler in different amount (wt %) into kenaf pulp for developing different electrical conductivity. The conductive sheet (KF/KF-PANI) revealed a percolation concentration at 25 wt% of KF-PANI. Its scanning electron micrograph showed good paper formation with...

PA6 and Kevlar fiber reinforced isotactic polypropylene: Structure, mechanical properties and crystallization and melting behavior

International Nuclear Information System (INIS)

Zhao, Songfang; Cheng, Lei; Guo, Yong; Zheng, Yuying; Li, Baoming

2012-01-01

Highlights: ► KF was modified with caprolactam using toluenediisocyanate (TDI) as bridge. ► Modified KF improves interfacial interaction of iPP/KF/PA6 composites. ► Fiber and nylon 6 inhibited the crystallization of PP continuous phase. -- Abstract: To improve the thermal and mechanical properties of isotactic polypropylene (iPP), iPP/Kevlar fiber (KF)/polyamide 6 (PA6) composites were prepared via the melt-extrusion method on twin-screw extruder. Kevlar fiber was modified with caprolactam using toluenediisocyanate (TDI) as bridge. The microstructure of modified KF was successfully characterized by Fourier transform infrared (FT-IR), X-ray photoelectron spectrometer (XPS) and scanning electron microscopy (SEM), the results showed that KF was bonded with caprolactam and became coarser. Then the modified KF was introduced into iPP, the composites have better mechanical and thermal properties, implying that modification of KF was helpful to improve the interfacial interaction of iPP/KF/PA6 composites. Besides, the crystallization curves indicated that crystallization behavior of PA6 in the composites was homogeneous and fractional. Furthermore, compatibilizer content played an important role in the mechanical and thermal properties of composites.

Influence of Polyaniline Coated Kenaf Fiber on Kenaf Paper Sheet

Directory of Open Access Journals (Sweden)

Abdullah Hisham Nur Syafiqah

2015-01-01

Full Text Available This paper reports the properties of newly developed electrically conductive natural fiber paper sheet made up of kenaf fiber (KF incorporated with polyaniline coated kenaf fiber (KF-PANI. This study proposed on dispersion of conductive filler in different amount (wt % into kenaf pulp for developing different electrical conductivity. The conductive sheet (KF/KF-PANI revealed a percolation concentration at 25 wt% of KF-PANI. Its scanning electron micrograph showed good paper formation with no significant damages.

An Efficient State–Parameter Filtering Scheme Combining Ensemble Kalman and Particle Filters

KAUST Repository

Ait-El-Fquih, Boujemaa

2017-12-11

This work addresses the state-parameter filtering problem for dynamical systems with relatively large-dimensional state and low-dimensional parameters\\' vector. A Bayesian filtering algorithm combining the strengths of the particle filter (PF) and the ensemble Kalman filter (EnKF) is proposed. At each assimilation cycle of the proposed EnKF-PF, the PF is first used to sample the parameters\\' ensemble followed by the EnKF to compute the state ensemble conditional on the resulting parameters\\' ensemble. The proposed scheme is expected to be more efficient than the traditional state augmentation techniques, which suffer from the curse of dimensionality and inconsistency that is particularly pronounced when the state is a strongly nonlinear function of the parameters. In the new scheme, the EnKF and PF interact via their ensembles\\' members, in contrast with the recently introduced two-stage EnKF-PF (TS-EnKF-PF), which exchanges point estimates between EnKF and PF while requiring almost double the computational load. Numerical experiments are conducted with the Lorenz-96 model to assess the behavior of the proposed filter and to evaluate its performances against the joint PF, joint EnKF, and TS-EnKF-PF. Numerical results suggest that the EnKF-PF performs best in all tested scenarios. It was further found to be more robust, successfully estimating both state and parameters in different sensitivity experiments.

An Efficient State–Parameter Filtering Scheme Combining Ensemble Kalman and Particle Filters

KAUST Repository

Ait-El-Fquih, Boujemaa; Hoteit, Ibrahim

2017-01-01

This work addresses the state-parameter filtering problem for dynamical systems with relatively large-dimensional state and low-dimensional parameters' vector. A Bayesian filtering algorithm combining the strengths of the particle filter (PF) and the ensemble Kalman filter (EnKF) is proposed. At each assimilation cycle of the proposed EnKF-PF, the PF is first used to sample the parameters' ensemble followed by the EnKF to compute the state ensemble conditional on the resulting parameters' ensemble. The proposed scheme is expected to be more efficient than the traditional state augmentation techniques, which suffer from the curse of dimensionality and inconsistency that is particularly pronounced when the state is a strongly nonlinear function of the parameters. In the new scheme, the EnKF and PF interact via their ensembles' members, in contrast with the recently introduced two-stage EnKF-PF (TS-EnKF-PF), which exchanges point estimates between EnKF and PF while requiring almost double the computational load. Numerical experiments are conducted with the Lorenz-96 model to assess the behavior of the proposed filter and to evaluate its performances against the joint PF, joint EnKF, and TS-EnKF-PF. Numerical results suggest that the EnKF-PF performs best in all tested scenarios. It was further found to be more robust, successfully estimating both state and parameters in different sensitivity experiments.

An Adjoint-Based Adaptive Ensemble Kalman Filter

KAUST Repository

Song, Hajoon

2013-10-01

A new hybrid ensemble Kalman filter/four-dimensional variational data assimilation (EnKF/4D-VAR) approach is introduced to mitigate background covariance limitations in the EnKF. The work is based on the adaptive EnKF (AEnKF) method, which bears a strong resemblance to the hybrid EnKF/three-dimensional variational data assimilation (3D-VAR) method. In the AEnKF, the representativeness of the EnKF ensemble is regularly enhanced with new members generated after back projection of the EnKF analysis residuals to state space using a 3D-VAR [or optimal interpolation (OI)] scheme with a preselected background covariance matrix. The idea here is to reformulate the transformation of the residuals as a 4D-VAR problem, constraining the new member with model dynamics and the previous observations. This should provide more information for the estimation of the new member and reduce dependence of the AEnKF on the assumed stationary background covariance matrix. This is done by integrating the analysis residuals backward in time with the adjoint model. Numerical experiments are performed with the Lorenz-96 model under different scenarios to test the new approach and to evaluate its performance with respect to the EnKF and the hybrid EnKF/3D-VAR. The new method leads to the least root-mean-square estimation errors as long as the linear assumption guaranteeing the stability of the adjoint model holds. It is also found to be less sensitive to choices of the assimilation system inputs and parameters.

An Adjoint-Based Adaptive Ensemble Kalman Filter

KAUST Repository

Song, Hajoon; Hoteit, Ibrahim; Cornuelle, Bruce D.; Luo, Xiaodong; Subramanian, Aneesh C.

2013-01-01

A new hybrid ensemble Kalman filter/four-dimensional variational data assimilation (EnKF/4D-VAR) approach is introduced to mitigate background covariance limitations in the EnKF. The work is based on the adaptive EnKF (AEnKF) method, which bears a strong resemblance to the hybrid EnKF/three-dimensional variational data assimilation (3D-VAR) method. In the AEnKF, the representativeness of the EnKF ensemble is regularly enhanced with new members generated after back projection of the EnKF analysis residuals to state space using a 3D-VAR [or optimal interpolation (OI)] scheme with a preselected background covariance matrix. The idea here is to reformulate the transformation of the residuals as a 4D-VAR problem, constraining the new member with model dynamics and the previous observations. This should provide more information for the estimation of the new member and reduce dependence of the AEnKF on the assumed stationary background covariance matrix. This is done by integrating the analysis residuals backward in time with the adjoint model. Numerical experiments are performed with the Lorenz-96 model under different scenarios to test the new approach and to evaluate its performance with respect to the EnKF and the hybrid EnKF/3D-VAR. The new method leads to the least root-mean-square estimation errors as long as the linear assumption guaranteeing the stability of the adjoint model holds. It is also found to be less sensitive to choices of the assimilation system inputs and parameters.

Assessing performance of Bayesian state-space models fit to Argos satellite telemetry locations processed with Kalman filtering.

Directory of Open Access Journals (Sweden)

Mónica A Silva

Full Text Available Argos recently implemented a new algorithm to calculate locations of satellite-tracked animals that uses a Kalman filter (KF. The KF algorithm is reported to increase the number and accuracy of estimated positions over the traditional Least Squares (LS algorithm, with potential advantages to the application of state-space methods to model animal movement data. We tested the performance of two Bayesian state-space models (SSMs fitted to satellite tracking data processed with KF algorithm. Tracks from 7 harbour seals (Phoca vitulina tagged with ARGOS satellite transmitters equipped with Fastloc GPS loggers were used to calculate the error of locations estimated from SSMs fitted to KF and LS data, by comparing those to "true" GPS locations. Data on 6 fin whales (Balaenoptera physalus were used to investigate consistency in movement parameters, location and behavioural states estimated by switching state-space models (SSSM fitted to data derived from KF and LS methods. The model fit to KF locations improved the accuracy of seal trips by 27% over the LS model. 82% of locations predicted from the KF model and 73% of locations from the LS model were <5 km from the corresponding interpolated GPS position. Uncertainty in KF model estimates (5.6 ± 5.6 km was nearly half that of LS estimates (11.6 ± 8.4 km. Accuracy of KF and LS modelled locations was sensitive to precision but not to observation frequency or temporal resolution of raw Argos data. On average, 88% of whale locations estimated by KF models fell within the 95% probability ellipse of paired locations from LS models. Precision of KF locations for whales was generally higher. Whales' behavioural mode inferred by KF models matched the classification from LS models in 94% of the cases. State-space models fit to KF data can improve spatial accuracy of location estimates over LS models and produce equally reliable behavioural estimates.

Global Kalman filter approaches to estimate absolute angles of lower limb segments.

Science.gov (United States)

Nogueira, Samuel L; Lambrecht, Stefan; Inoue, Roberto S; Bortole, Magdo; Montagnoli, Arlindo N; Moreno, Juan C; Rocon, Eduardo; Terra, Marco H; Siqueira, Adriano A G; Pons, Jose L

2017-05-16

In this paper we propose the use of global Kalman filters (KFs) to estimate absolute angles of lower limb segments. Standard approaches adopt KFs to improve the performance of inertial sensors based on individual link configurations. In consequence, for a multi-body system like a lower limb exoskeleton, the inertial measurements of one link (e.g., the shank) are not taken into account in other link angle estimations (e.g., foot). Global KF approaches, on the other hand, correlate the collective contribution of all signals from lower limb segments observed in the state-space model through the filtering process. We present a novel global KF (matricial global KF) relying only on inertial sensor data, and validate both this KF and a previously presented global KF (Markov Jump Linear Systems, MJLS-based KF), which fuses data from inertial sensors and encoders from an exoskeleton. We furthermore compare both methods to the commonly used local KF. The results indicate that the global KFs performed significantly better than the local KF, with an average root mean square error (RMSE) of respectively 0.942° for the MJLS-based KF, 1.167° for the matrical global KF, and 1.202° for the local KFs. Including the data from the exoskeleton encoders also resulted in a significant increase in performance. The results indicate that the current practice of using KFs based on local models is suboptimal. Both the presented KF based on inertial sensor data, as well our previously presented global approach fusing inertial sensor data with data from exoskeleton encoders, were superior to local KFs. We therefore recommend to use global KFs for gait analysis and exoskeleton control.

Molecular Characterization of Yeast Strains Isolated from Different Sources by Restriction Fragment Length Polymorphism

International Nuclear Information System (INIS)

Ali, M. S.; Latif, Z.

2016-01-01

Various molecular techniques like analysis of the amplified rDNA internal transcribed spacers (ITS), intragenic spacers and total ITS region analysis by restriction fragment length polymorphism (RFLP) has been introduced for yeast identification but there are limited databases to identify yeast species on the basis of 5.8S rDNA. In this study, twenty nine yeast strains from various sources including spoiled fruits, vegetables, foodstuffs, and concentrated juices were characterized by PCR-RFLP. PCR-RFLP has been used to characterize yeasts present in different spoiled food samples after isolation of the yeasts. By using this technique, the isolated yeast strains were characterized by direct 5.8S-ITS rDNA region amplification. RFLP analysis was applied to each of the amplification products (varied from 400bp to 800bp) detected, and the corresponding yeast identifications were made according to each specific restriction patterns obtained after treatment with two endonucleases TaqI and HaeIII which yielded a specific banding pattern for each species. For further confirmation amplified products of eleven selected isolates were sequenced and blast on NCBI. Both RFLP and sequence analyses of the strains with accession nos. KF472163, KF472164, KF472165, KF472166, KF472167, KF472168, KF472169, KF472170, KF472171, KF472172, KF472173 gave significantly similar results. The isolates were found to belong five different yeast species including; Candida spp., Pichia spp., Kluyveromyces spp., Clavispora spp. and Hanseniaspora spp. This method provides a fast, easy, reliable and authentic way for determining yeast population present in different type of samples, as compared to traditional characterization technique. (author)

Effect of peripheral vision training on the attack of beginner indoor soccer players: a study during competition

Directory of Open Access Journals (Sweden)

Nelson Kautzner Marques Junior

2009-01-01

Full Text Available This study was conducted within the context of Human Motor Skill Science, in the area of Biophysical Dimension and following the research line of the Study of Learning Mechanisms and Processes and of Motor Conduct within the epistemological construct of phenomenological explanation. The objective of this study was to investigate peripheral vision training (PVT and its effect on attack runs during indoor soccer, taking into account dominant laterality (brain hemisphere function in both learning speed andoffensive skills. Ten beginner indoor soccer players aged 10.4 ± 2.31 years, from Lar da Criança Padre Franz Neumair, Ititioca, Niterói, Rio de Janeiro, Brazil, participated in the study. The boys were divided into an experimental group (EG, n = 5 and a controlgroup (CG, n = 5 with similar dominant laterality (brain hemisphere function (H (EG: 80% left H and 20% right H, CG: 60% left H and 40% right H. The players underwent nine training sessions, followed by a championship, and then six additional sessions, followed by a second championship. Each championship was filmed for scoutvideo analysis. Two-way ANOVA revealed a significant difference in peripheral vision during offensive runs between CG and EG, with marked acquisition of peripheral vision in EG. The quality of the attack runs was significant (two-way ANOVA. EG was the better team at the beginning of the attack runs and during attack development, whereas CG was better at attack finalization during the first championship. EG showed more competence in attack run finalization during the second championship. No significant difference in the number of goals scored was observed between the two groups (two-wayANOVA, p>0.05. The frequency of participation in the training sessions was significant (t-test for independent samples, p≤0.05, with EG attending more sessions. In conclusion, EG acquired peripheral vision, a finding suggesting that PVT improves the attack capacity of indoor soccer

Effect of peripheral vision training on the attack of beginner indoor soccer players: a study during competition

Directory of Open Access Journals (Sweden)

Nelson Kautzner Marques Junior

2009-01-01

Full Text Available http://dx.doi.org/10.5007/1980-0037.2009v11n1p119   In the area of Biophysical Dimension and following the research line of the Study of Learning Mechanisms and Processes and of Motor Conduct within the epistemological construct of phenomenological explanation. The objective of this study was to investigate peripheral vision training (PVT and its effect on attack runs during indoor soccer, taking into account dominant laterality (brain hemisphere function in both learning speed and offensive skills. Ten beginner indoor soccer players aged 10.4 ± 2.31 years, from Lar da Criança Padre Franz Neumair, Ititioca, Niterói, Rio de Janeiro, Brazil, participated in the study. The boys were divided into an experimental group (EG, n = 5 and a control group (CG, n = 5 with similar dominant laterality (brain hemisphere function (H (EG: 80% left H and 20% right H, CG: 60% left H and 40% right H. The players underwent nine training sessions, followed by a championship, and then six additional sessions, followed by a second championship. Each championship was filmed for scout video analysis. Two-way ANOVA revealed a significant difference in peripheral vision during offensive runs between CG and EG, with marked acquisition of peripheral vision in EG. The quality of the attack runs was significant (two-way ANOVA. EG was the better team at the beginning of the attack runs and during attack development, whereas CG was better at attack finalization during the first championship. EG showed more competence in attack run finalization during the second championship. No significant difference in the number of goals scored was observed between the two groups (two-way ANOVA, p>0.05. The frequency of participation in the training sessions was significant (t-test for independent samples, p≤0.05, with EG attending more sessions. In conclusion, EG acquired peripheral vision, a finding suggesting that PVT improves the attack capacity of indoor soccer players.

A hybrid nudging-ensemble Kalman filter approach to data assimilation. Part I: application in the Lorenz system

Directory of Open Access Journals (Sweden)

Lili Lei

2012-05-01

Full Text Available A hybrid data assimilation approach combining nudging and the ensemble Kalman filter (EnKF for dynamic analysis and numerical weather prediction is explored here using the non-linear Lorenz three-variable model system with the goal of a smooth, continuous and accurate data assimilation. The hybrid nudging-EnKF (HNEnKF computes the hybrid nudging coefficients from the flow-dependent, time-varying error covariance matrix from the EnKF's ensemble forecasts. It extends the standard diagonal nudging terms to additional off-diagonal statistical correlation terms for greater inter-variable influence of the innovations in the model's predictive equations to assist in the data assimilation process. The HNEnKF promotes a better fit of an analysis to data compared to that achieved by either nudging or incremental analysis update (IAU. When model error is introduced, it produces similar or better root mean square errors compared to the EnKF while minimising the error spikes/discontinuities created by the intermittent EnKF. It provides a continuous data assimilation with better inter-variable consistency and improved temporal smoothness than that of the EnKF. Data assimilation experiments are also compared to the ensemble Kalman smoother (EnKS. The HNEnKF has similar or better temporal smoothness than that of the EnKS, and with much smaller central processing unit (CPU time and data storage requirements.

Investigation of the effect of potassium on Cu(In,Ga)Se{sub 2} layers and solar cells

Energy Technology Data Exchange (ETDEWEB)

Laemmle, A., E-mail: anke.laemmle@zsw-bw.de; Wuerz, R.; Powalla, M.

2015-05-01

We investigate the influence of potassium (K) on the Cu(In,Ga)Se{sub 2} (CIGS) growth kinetics on alkali-free alumina substrates and the electrical parameters of the CIGS solar cell by intentional K doping of the CIGS layer by a KF-precursor layer and KF-post deposition treatment (PDT). Secondary ion mass spectroscopy measurements revealed that K can be incorporated into the CIGS layer by both processes. The CIGS composition of the KF-precursor sample shows a stronger [Ga]/([Ga] + [In]) (GGI) profile. By analysing the samples with scanning electron microscopy we observed smaller CIGS grains for the KF-precursor sample compared to the K-free reference and KF-PDT sample. jV-measurements of the KF-PDT and the KF-precursor sample show an increase in the cell efficiency η from 10.7% to 13.6% and 13.7%, respectively, compared to the K-free reference sample. The external quantum efficiency measurements of the KF-precursor sample show an increased absorption in the infrared region. Capacitance-voltage measurements reveal an increase in the net doping concentration of both samples treated with K. We assume that the enhancement is caused by passivation of grain boundaries and donor-like defects by K, as previously demonstrated for Na. - Highlights: • K-doped Cu(In,Ga)Se{sub 2} (CIGS) layers from KF-precursor and KF-post deposition treatment • Separation of the K-effect from the Na-effect by using alkali-free substrates • Interdiffusion of CIGS elements during CIGS growth is hindered by K • KF-precursor leads to smaller CIGS grains and a stronger Cu depletion at the CIGS surface. • K leads to an increase in the conversion efficiency.

Real-time muscle state estimation from EMG signals during isometric contractions using Kalman filters.

Science.gov (United States)

Menegaldo, Luciano L

2017-12-01

State-space control of myoelectric devices and real-time visualization of muscle forces in virtual rehabilitation require measuring or estimating muscle dynamic states: neuromuscular activation, tendon force and muscle length. This paper investigates whether regular (KF) and extended Kalman filters (eKF), derived directly from Hill-type muscle mechanics equations, can be used as real-time muscle state estimators for isometric contractions using raw electromyography signals (EMG) as the only available measurement. The estimators' amplitude error, computational cost, filtering lags and smoothness are compared with usual EMG-driven analysis, performed offline, by integrating the nonlinear Hill-type muscle model differential equations (offline simulations-OS). EMG activity of the three triceps surae components (soleus, gastrocnemius medialis and gastrocnemius lateralis), in three torque levels, was collected for ten subjects. The actualization interval (AI) between two updates of the KF and eKF was also varied. The results show that computational costs are significantly reduced (70x for KF and 17[Formula: see text] for eKF). The filtering lags presented sharp linear relationships with the AI (0-300 ms), depending on the state and activation level. Under maximum excitation, amplitude errors varied in the range 10-24% for activation, 5-8% for tendon force and 1.4-1.8% for muscle length, reducing linearly with the excitation level. Smoothness, measured by the ratio between the average standard variations of KF/eKF and OS estimations, was greatly reduced for activation but converged exponentially to 1 for the other states by increasing AI. Compared to regular KF, extended KF does not seem to improve estimation accuracy significantly. Depending on the particular application requirements, the most appropriate KF actualization interval can be selected.

Metabolically active tumour volume segmentation from dynamic [(18)F]FLT PET studies in non-small cell lung cancer.

Science.gov (United States)

Hoyng, Lieke L; Frings, Virginie; Hoekstra, Otto S; Kenny, Laura M; Aboagye, Eric O; Boellaard, Ronald

2015-01-01

Positron emission tomography (PET) with (18)F-3'-deoxy-3'-fluorothymidine ([(18)F]FLT) can be used to assess tumour proliferation. A kinetic-filtering (KF) classification algorithm has been suggested for segmentation of tumours in dynamic [(18)F]FLT PET data. The aim of the present study was to evaluate KF segmentation and its test-retest performance in [(18)F]FLT PET in non-small cell lung cancer (NSCLC) patients. Nine NSCLC patients underwent two 60-min dynamic [(18)F]FLT PET scans within 7 days prior to treatment. Dynamic scans were reconstructed with filtered back projection (FBP) as well as with ordered subsets expectation maximisation (OSEM). Twenty-eight lesions were identified by an experienced physician. Segmentation was performed using KF applied to the dynamic data set and a source-to-background corrected 50% threshold (A50%) was applied to the sum image of the last three frames (45- to 60-min p.i.). Furthermore, several adaptations of KF were tested. Both for KF and A50% test-retest (TRT) variability of metabolically active tumour volume and standard uptake value (SUV) were evaluated. KF performed better on OSEM- than on FBP-reconstructed PET images. The original KF implementation segmented 15 out of 28 lesions, whereas A50% segmented each lesion. Adapted KF versions, however, were able to segment 26 out of 28 lesions. In the best performing adapted versions, metabolically active tumour volume and SUV TRT variability was similar to those of A50%. KF misclassified certain tumour areas as vertebrae or liver tissue, which was shown to be related to heterogeneous [(18)F]FLT uptake areas within the tumour. For [(18)F]FLT PET studies in NSCLC patients, KF and A50% show comparable tumour volume segmentation performance. The KF method needs, however, a site-specific optimisation. The A50% is therefore a good alternative for tumour segmentation in NSCLC [(18)F]FLT PET studies in multicentre studies. Yet, it was observed that KF has the potential to subsegment

Data driven computing by the morphing fast Fourier transform ensemble Kalman filter in epidemic spread simulations

Science.gov (United States)

Mandel, Jan; Beezley, Jonathan D.; Cobb, Loren; Krishnamurthy, Ashok

2010-01-01

The FFT EnKF data assimilation method is proposed and applied to a stochastic cell simulation of an epidemic, based on the S-I-R spread model. The FFT EnKF combines spatial statistics and ensemble filtering methodologies into a localized and computationally inexpensive version of EnKF with a very small ensemble, and it is further combined with the morphing EnKF to assimilate changes in the position of the epidemic. PMID:21031155

Mean-field Ensemble Kalman Filter

KAUST Repository

Law, Kody; Tembine, Hamidou; Tempone, Raul

2015-01-01

A proof of convergence of the standard EnKF generalized to non-Gaussian state space models is provided. A density-based deterministic approximation of the mean-field limiting EnKF (MFEnKF) is proposed, consisting of a PDE solver and a quadrature

The calcium fluoride effect on properties of cryolite melts feasible for low-temperature production of aluminum and its alloys

Science.gov (United States)

Tkacheva, O.; Dedyukhin, A.; Redkin, A.; Zaikov, Yu.

2017-07-01

The CaF2 effect on the liquidus temperature, electrical conductivity and alumina solubility in the potassium-sodium and potassium-lithium cryolite melts with cryolite ratio (CR = (nKF+nMF)/nAlF3, M = Li, Na) 1.3 was studied. The liquidus temperature in the quisi-binary system [KF-LiF-AlF3]-CaF2 changes with the same manner as in the [KF-NaF-AlF3]-CaF2. The electrical conductivity in the KF-NaF-AlF3-CaF2 melt decreases with increasing the CaF2 content, but it slightly raises with the first small addition of CaF2 into the KF-LiF-AlF3-CaF2 melts, enriched with KF, which was explained by the increased K+ ions mobility due to their relatively low ionic potential. The contribution of the Li+ cations in conductivity of the KF-LiF-AlF3-CaF2 electrolyte is not noteworthy. The Al2O3 solubility in the KF-NaF-AlF3 electrolyte rises with the increasing KF content, but the opposite tendency is observed in the cryolite mixtures containing CaF2. The insoluble compounds - KCaAl2F9 or KCaF3 - formed in the molten mixtures containing potassium and calcium ions endorse the increase of the liquidus temperature. The calcium fluoride effect on the side ledge formation in the electrolytic cell during low-temperature aluminum electrolysis is discussed.

Fast Kalman-like filtering for large-dimensional linear and Gaussian state-space models

KAUST Repository

Ait-El-Fquih, Boujemaa; Hoteit, Ibrahim

2015-01-01

This paper considers the filtering problem for linear and Gaussian state-space models with large dimensions, a setup in which the optimal Kalman Filter (KF) might not be applicable owing to the excessive cost of manipulating huge covariance matrices. Among the most popular alternatives that enable cheaper and reasonable computation is the Ensemble KF (EnKF), a Monte Carlo-based approximation. In this paper, we consider a class of a posteriori distributions with diagonal covariance matrices and propose fast approximate deterministic-based algorithms based on the Variational Bayesian (VB) approach. More specifically, we derive two iterative KF-like algorithms that differ in the way they operate between two successive filtering estimates; one involves a smoothing estimate and the other involves a prediction estimate. Despite its iterative nature, the prediction-based algorithm provides a computational cost that is, on the one hand, independent of the number of iterations in the limit of very large state dimensions, and on the other hand, always much smaller than the cost of the EnKF. The cost of the smoothing-based algorithm depends on the number of iterations that may, in some situations, make this algorithm slower than the EnKF. The performances of the proposed filters are studied and compared to those of the KF and EnKF through a numerical example.

Fast Kalman-like filtering for large-dimensional linear and Gaussian state-space models

KAUST Repository

Ait-El-Fquih, Boujemaa

2015-08-13

This paper considers the filtering problem for linear and Gaussian state-space models with large dimensions, a setup in which the optimal Kalman Filter (KF) might not be applicable owing to the excessive cost of manipulating huge covariance matrices. Among the most popular alternatives that enable cheaper and reasonable computation is the Ensemble KF (EnKF), a Monte Carlo-based approximation. In this paper, we consider a class of a posteriori distributions with diagonal covariance matrices and propose fast approximate deterministic-based algorithms based on the Variational Bayesian (VB) approach. More specifically, we derive two iterative KF-like algorithms that differ in the way they operate between two successive filtering estimates; one involves a smoothing estimate and the other involves a prediction estimate. Despite its iterative nature, the prediction-based algorithm provides a computational cost that is, on the one hand, independent of the number of iterations in the limit of very large state dimensions, and on the other hand, always much smaller than the cost of the EnKF. The cost of the smoothing-based algorithm depends on the number of iterations that may, in some situations, make this algorithm slower than the EnKF. The performances of the proposed filters are studied and compared to those of the KF and EnKF through a numerical example.

A Stationary North-Finding Scheme for an Azimuth Rotational IMU Utilizing a Linear State Equality Constraint

Directory of Open Access Journals (Sweden)

Huapeng Yu

2015-02-01

Full Text Available The Kalman filter (KF has always been used to improve north-finding performance under practical conditions. By analyzing the characteristics of the azimuth rotational inertial measurement unit (ARIMU on a stationary base, a linear state equality constraint for the conventional KF used in the fine north-finding filtering phase is derived. Then, a constrained KF using the state equality constraint is proposed and studied in depth. Estimation behaviors of the concerned navigation errors when implementing the conventional KF scheme and the constrained KF scheme during stationary north-finding are investigated analytically by the stochastic observability approach, which can provide explicit formulations of the navigation errors with influencing variables. Finally, multiple practical experimental tests at a fixed position are done on a postulate system to compare the stationary north-finding performance of the two filtering schemes. In conclusion, this study has successfully extended the utilization of the stochastic observability approach for analytic descriptions of estimation behaviors of the concerned navigation errors, and the constrained KF scheme has demonstrated its superiority over the conventional KF scheme for ARIMU stationary north-finding both theoretically and practically.

The integration of Mathematics, Science and Technology in early childhood education and the foundation phase: The role of the formation of the professional identities of beginner teachers

Directory of Open Access Journals (Sweden)

Marie Botha

2015-02-01

Full Text Available This article focuses on the professional identity formation of six beginner teachers (three in early childhood education and three in the foundation phase, involved in the teaching of Mathematics, Science and Technology (MST. Attention is in particular being paid to the role of professional identity in how they applied innovative teaching methods such as enquiry-based teaching. The study is based on the personal narratives of the six teachers, regarding their own learning experiences in MST, the impact of their professional training at an institution of higher education, as well as their first experiences as MST teachers in the workplace. A qualitative research design was applied and data was obtained through visual (photo collages and written stories, observation and interviews. Whilst all the teachers held negative attitudes towards Mathematics, this situation was turned around during their university training. The three teachers in early childhood education experienced their entrance to the profession as positive, due mainly to the support of colleagues in their application of innovative teaching methods. Two teachers in the foundation phase, however, experienced the opposite. The findings emphasise the complex processes in the moulding of a professional teacher identity and how teaching practices are influenced by these processes.

Karlsruhe Research Center, Nuclear Safety Research Project (PSF). Annual report 1994; Forschungszentrum Karlsruhe, Projekt Nukleare Sicherheitsforschung. Jahrsbericht 1994

Energy Technology Data Exchange (ETDEWEB)

Hueper, R. [ed.

1995-08-01

The reactor safety R and D work of the Karlsruhe Research Centre (FZKA) has been part of the Nuclear Safety Research Projet (PSF) since 1990. The present annual report 1994 summarizes the R and D results. The research tasks are coordinated in agreement with internal and external working groups. The contributions to this report correspond to the status of early 1995. An abstract in English precedes each of them, whenever the respective article is written in German. (orig.) [Deutsch] Seit Beginn 1990 sind die F+E-Arbeiten des Forschungszentrum Karlsruhe (FZKA) zur Reaktorsicherheit im Projekt Nukleare Sicherheitsforschung (PSF) zusammengefasst. Der vorliegende Jahresbericht 1994 enthaelt Beitraege zu aktuellen Fragen der Sicherheit von Leichtwasserreaktoren und innovativen Systemen sowie der Umwandlung von minoren Aktiniden. Die konkreten Forschungsthemen und -vorhaben werden mit internen und externen Fachgremien laufend abgestimmt. An den beschriebenen Arbeiten sind die folgenden Institute und Abteilungen des FZKA beteiligt: Institut fuer Materialforschung IMF I, II, III; Institut fuer Neutronenphysik und Reaktortechnik INR; Institut fuer Angewandte Thermo- und Fluiddynamik IATF; Institut fuer Reaktorsicherheit IRS; Hauptabteilung Ingenieurtechnik HIT; Hauptabteilung Versuchstechnik HVT sowie vom KfK beauftragte externe Institutionen. Die einzelnen Beitraege stellen den Stand der Arbeiten zum Fruehjahr 1995 dar und sind entsprechend dem F+E-Programm 1994 numeriert. Den in deutscher Sprache verfassten Beitraege sind Kurzfassungen in englischer Sprache vorangestellt. (orig.)

Predicting Breeding Values in Animals by Kalman Filter

DEFF Research Database (Denmark)

Karacaoren, B; Janss, L L G; Kadarmideen, H N

2012-01-01

The aim of this study was to investigate usefulness of Kalman Filter (KF) Random Walk methodology (KF-RW) for prediction of breeding values in animals. We used body condition score (BCS) from dairy cattle for illustrating use of KF-RW. BCS was measured by Swiss Holstein Breeding Association during...

Multilevel ensemble Kalman filter

KAUST Repository

Chernov, Alexey; Hoel, Haakon; Law, Kody; Nobile, Fabio; Tempone, Raul

2016-01-01

This work embeds a multilevel Monte Carlo (MLMC) sampling strategy into the Monte Carlo step of the ensemble Kalman filter (EnKF). In terms of computational cost vs. approximation error the asymptotic performance of the multilevel ensemble Kalman filter (MLEnKF) is superior to the EnKF s.

Multilevel ensemble Kalman filter

KAUST Repository

Chernov, Alexey

2016-01-06

This work embeds a multilevel Monte Carlo (MLMC) sampling strategy into the Monte Carlo step of the ensemble Kalman filter (EnKF). In terms of computational cost vs. approximation error the asymptotic performance of the multilevel ensemble Kalman filter (MLEnKF) is superior to the EnKF s.

Mean-field Ensemble Kalman Filter

KAUST Repository

Law, Kody

2015-01-07

A proof of convergence of the standard EnKF generalized to non-Gaussian state space models is provided. A density-based deterministic approximation of the mean-field limiting EnKF (MFEnKF) is proposed, consisting of a PDE solver and a quadrature rule. Given a certain minimal order of convergence between the two, this extends to the deterministic filter approximation, which is therefore asymptotically superior to standard EnKF for d < 2 . The fidelity of approximation of the true distribution is also established using an extension of total variation metric to random measures. This is limited by a Gaussian bias term arising from non-linearity/non-Gaussianity of the model, which arises in both deterministic and standard EnKF. Numerical results support and extend the theory.

μ opioid receptor activation hyperpolarizes respiratory-controlling Kölliker-Fuse neurons and suppresses post-inspiratory drive.

Science.gov (United States)

Levitt, Erica S; Abdala, Ana P; Paton, Julian F R; Bissonnette, John M; Williams, John T

2015-10-01

In addition to reductions in respiratory rate, opioids also cause aspiration and difficulty swallowing, indicating impairment of the upper airways. The Kölliker-Fuse (KF) maintains upper airway patency and a normal respiratory pattern. In this study, activation of μ opioid receptors in the KF reduced respiratory frequency and tidal volume in anaesthetized rats. Nerve recordings in an in situ preparation showed that activation of μ opioid receptors in the KF eliminated the post-inspiration phase of the respiratory cycle. In brain slices, μ opioid agonists hyperpolarized a distinct population (61%) of KF neurons by activation of an inwardly rectifying potassium conductance. These results suggest that KF neurons that are hyperpolarized by opioids could contribute to opioid-induced respiratory disturbances, particularly the impairment of upper airways. Opioid-induced respiratory effects include aspiration and difficulty swallowing, suggesting impairment of the upper airways. The pontine Kölliker-Fuse nucleus (KF) controls upper airway patency and regulates respiration, in particular the inspiratory/expiratory phase transition. Given the importance of the KF in coordinating respiratory pattern, the mechanisms of μ opioid receptor activation in this nucleus were investigated at the systems and cellular level. In anaesthetized, vagi-intact rats, injection of opioid agonists DAMGO or [Met(5) ]enkephalin (ME) into the KF reduced respiratory frequency and amplitude. The μ opioid agonist DAMGO applied directly into the KF of the in situ arterially perfused working heart-brainstem preparation of rat resulted in robust apneusis (lengthened low amplitude inspiration due to loss of post-inspiratory drive) that was rapidly reversed by the opioid antagonist naloxone. In brain slice preparations, activation of μ opioid receptors on KF neurons hyperpolarized a distinct population (61%) of neurons. As expected, the opioid-induced hyperpolarization reduced the excitability of

Multilevel ensemble Kalman filtering

KAUST Repository

Hoel, Haakon

2016-01-08

The ensemble Kalman filter (EnKF) is a sequential filtering method that uses an ensemble of particle paths to estimate the means and covariances required by the Kalman filter by the use of sample moments, i.e., the Monte Carlo method. EnKF is often both robust and efficient, but its performance may suffer in settings where the computational cost of accurate simulations of particles is high. The multilevel Monte Carlo method (MLMC) is an extension of classical Monte Carlo methods which by sampling stochastic realizations on a hierarchy of resolutions may reduce the computational cost of moment approximations by orders of magnitude. In this work we have combined the ideas of MLMC and EnKF to construct the multilevel ensemble Kalman filter (MLEnKF) for the setting of finite dimensional state and observation spaces. The main ideas of this method is to compute particle paths on a hierarchy of resolutions and to apply multilevel estimators on the ensemble hierarchy of particles to compute Kalman filter means and covariances. Theoretical results and a numerical study of the performance gains of MLEnKF over EnKF will be presented. Some ideas on the extension of MLEnKF to settings with infinite dimensional state spaces will also be presented.

Multilevel ensemble Kalman filtering

KAUST Repository

Hoel, Haakon; Chernov, Alexey; Law, Kody; Nobile, Fabio; Tempone, Raul

2016-01-01

The ensemble Kalman filter (EnKF) is a sequential filtering method that uses an ensemble of particle paths to estimate the means and covariances required by the Kalman filter by the use of sample moments, i.e., the Monte Carlo method. EnKF is often both robust and efficient, but its performance may suffer in settings where the computational cost of accurate simulations of particles is high. The multilevel Monte Carlo method (MLMC) is an extension of classical Monte Carlo methods which by sampling stochastic realizations on a hierarchy of resolutions may reduce the computational cost of moment approximations by orders of magnitude. In this work we have combined the ideas of MLMC and EnKF to construct the multilevel ensemble Kalman filter (MLEnKF) for the setting of finite dimensional state and observation spaces. The main ideas of this method is to compute particle paths on a hierarchy of resolutions and to apply multilevel estimators on the ensemble hierarchy of particles to compute Kalman filter means and covariances. Theoretical results and a numerical study of the performance gains of MLEnKF over EnKF will be presented. Some ideas on the extension of MLEnKF to settings with infinite dimensional state spaces will also be presented.

1986 progress report on R and D work of the Nuclear Fusion Project (PKF)

International Nuclear Information System (INIS)

Kast, G.

1987-03-01

The Kernforschungszentrum Karlsruhe (KfK) and the Max-Planck-Institute for Plasma Physics, Garching, have joined to form the Entwicklungsgemeinschaft Kernfusion, and under this roof perform research work on the physical and technical conditions and requirements of using the energy from nuclear fusion, and to plan the design and the construction of the necessary equipment for future large-scale experiments. The activities of the KfK for the development of fusion devices with magnetic confinement have been concentrated in the Nuclear Fusion Project, which cooperates in the European Fusion Technology Programme, on the basis of an association agreement between KfK and Euratom, supported by the European Commission. Supplementary KfK contributions, studies in most cases, create a connection between various fields of work, and prepare the road for new tasks, which in the years to come will be found in the extension of the Fusion Technology Programme and the planning work for NET. The reports collected in this annual survey are contributions from KfK Institutes of the year 1986. An annex presents the Easks taken over by KfK within the Fusion Technology Programme of the EC, and notes on the KfK Institutes taking part in the particular activities facilitate reference to the individual, full-text reports. (orig.) [de

Věční začátečníci v kurzech anglického jazyka pro dospělé

OpenAIRE

Mihulková, Šárka

2014-01-01

This thesis deals with the issue of teaching continuing beginners in adult EFL classes. It focuses on the description of factors that may influence the learning stagnation among these learners, and it attempts to ascertain the extent to which these factors take effect. Consequently, the thesis aims to characterize Czech continuing beginners as an independent group of learners and to provide scientific evidence which could clarify the assumptions, underlying the continuing-beginner concept. La...

Desensitization and Tolerance of Mu Opioid Receptors on Pontine Kölliker-Fuse Neurons.

Science.gov (United States)

Levitt, Erica S; Williams, John T

2018-01-01

Acute desensitization of mu opioid receptors is thought to be an initial step in the development of tolerance to opioids. Given the resistance of the respiratory system to develop tolerance, desensitization of neurons in the Kölliker-Fuse (KF), a key area in the respiratory circuit, was examined. The activation of G protein-coupled inwardly rectifying potassium current was measured using whole-cell voltage-clamp recordings from KF and locus coeruleus (LC) neurons contained in acute rat brain slices. A saturating concentration of the opioid agonist [Met 5 ]-enkephalin (ME) caused significantly less desensitization in KF neurons compared with LC neurons. In contrast to LC, desensitization in KF neurons was not enhanced by activation of protein kinase C or in slices from morphine-treated rats. Cellular tolerance to ME and morphine was also lacking in KF neurons from morphine-treated rats. The lack of cellular tolerance in KF neurons correlates with the relative lack of tolerance to the respiratory depressant effect of opioids. Copyright © 2018 by The American Society for Pharmacology and Experimental Therapeutics.

Changes in self-reported symptoms of depression and physical well-being in healthy individuals following a Taiji beginner course - Results of a randomized controlled trial.

Science.gov (United States)

Schitter, Agnes Maria; Nedeljkovic, Marko; Ausfeld-Hafter, Brigitte; Fleckenstein, Johannes

2016-04-01

Taiji is a mind-body practice being increasingly investigated for its therapeutic benefits in a broad range of mental and physical conditions. The aim of this study was to investigate the potential preventive effects of Taiji practice in healthy individuals with regard to their depressive symptomatology and physical well-being. Seventy healthy Taiji novices were randomly assigned to a Taiji intervention group, that is, Taiji beginner course (Yang-Style Taiji, 2 h per week, 12 weeks) or a control group comprised of the waiting list for the course. Self-reported symptoms of depression (CES-D) and physical well-being (FEW-16) were assessed at baseline, at the end of the intervention, as well as 2 months later. The included participants had a mean age of 35.5 years. Physical well-being in the Taiji group significantly increased when comparing baseline to follow-up (FEW-16 sum score T(27) = 3.94, P = 0.001, 95% CI 0.17 to 0.55). Pearson's correlation coefficients displayed a strong negative relationship between self-reported symptoms of depression and physical well-being (P's healthy individuals, with improvements pronouncing over time. Physical well-being was shown to have a strong relationship with depressive symptoms. Based on these results, the consideration of Taiji as one therapeutic option in the development of multimodal approaches in the prevention of depression seems justifiable.

Export financing of nuclear power plants - banks experience

International Nuclear Information System (INIS)

Loeber

1976-01-01

Export financing of a nuclear power plant to be exported from Germany, is, in principle, provided by German commercial banks and KfW (Kreditanstalt fuer Wiederaufbau). As a rule, 50 per cent of the financing of maturities falling due under the export portion of the loan will be taken over by a banking syndicate of approximately 25 member banks, and the remaining 50 per cent would be provided by KfW. KfW and the commercial banks must grant their loans at the respective money market conditions. The banks' and KfW's loans will normally be disbursed pro rata delivery. (HP) [de

Robust Finite-Dimensional LQG (Linear Quadric Gaussian)-Based Controllers for a Class of Distributed Parameter Systems.

Science.gov (United States)

1988-06-01

loop equations can be written in terms of the extended space XE = h ., where . C 7, to get SA = + G 0w(54 ) X K C A- BK - KfC j [0 K] 7] or in terms...C where in LQG notation C, = l,(sJ - (A - BK, - AfC))-’kj C = K (sl - (A - BK, - KfC ))-1K ! 44 Uy Recall that only Kf has to be approximated in...the oper- ators A-BK, and A- KfC both generate stable semigroups [24]. If (A+AA-BK) and (A + AA - 1’fC) also generale stable semigroups, then the

Human Estimation of Slope, Distance, and Height of Terrain in Simulated Lunar Conditions

Science.gov (United States)

2009-02-01

9643 APPENDIX J DEVON ISLAND DISTANCE REFERENCE 259 Distance References NBA Basketball Court Width 15 meters 50 feet...Cockpit Hours: Simulator Airframe: Hours: Sports Baseball Years: Beginner Intermediate Advanced Basketball Years: Beginner

The Ensemble Kalman Filter for Groundwater Plume Characterization: A Case Study.

Science.gov (United States)

Ross, James L; Andersen, Peter F

2018-04-17

The Kalman filter is an efficient data assimilation tool to refine an estimate of a state variable using measured data and the variable's correlations in space and/or time. The ensemble Kalman filter (EnKF) (Evensen, 2004, 2009) is a Kalman filter variant that employs Monte Carlo analysis to define the correlations that help to refine the updated state. While use of EnKF in hydrology is somewhat limited, it has been successfully applied in other fields of engineering (e.g. oil reservoir modeling, weather forecasting). Here, EnKF is used to refine a simulated groundwater TCE plume that underlies the Tooele Army Depot-North (TEAD-N) in Utah, based on observations of TCE in the aquifer. The resulting EnKF-based assimilated plume is simulated forward in time to predict future plume migration. The correlations that underpin EnKF updating implicitly contain information about how the plume developed over time under the influence of complex site hydrology and variable source history, as they are predicated on multiple realizations of a well-calibrated numerical groundwater flow and transport model. The EnKF methodology is compared to an ordinary kriging-based assimilation method with respect to the accurate representation of plume concentrations in order to determine the relative efficacy of EnKF for water quality data assimilation. This article is protected by copyright. All rights reserved.

Study on Java Programming Education

OpenAIRE

太田, 信宏

2009-01-01

The purpose of this study is to consider the content and key points for inclusion in a Java programming course for beginners. The Java programming language has a variety of functions and has the largest application field of all such languages, containing many themes that are appropriate for any such programming course. The multifunctional and wide-ranging functions of Java, however, may actually act as a barrier to study for beginners. The core content of a programming class for beginners sho...

Processing arctic eddy-flux data using a simple carbon-exchange model embedded in the ensemble Kalman filter.

Science.gov (United States)

Rastetter, Edward B; Williams, Mathew; Griffin, Kevin L; Kwiatkowski, Bonnie L; Tomasky, Gabrielle; Potosnak, Mark J; Stoy, Paul C; Shaver, Gaius R; Stieglitz, Marc; Hobbie, John E; Kling, George W

2010-07-01

Continuous time-series estimates of net ecosystem carbon exchange (NEE) are routinely made using eddy covariance techniques. Identifying and compensating for errors in the NEE time series can be automated using a signal processing filter like the ensemble Kalman filter (EnKF). The EnKF compares each measurement in the time series to a model prediction and updates the NEE estimate by weighting the measurement and model prediction relative to a specified measurement error estimate and an estimate of the model-prediction error that is continuously updated based on model predictions of earlier measurements in the time series. Because of the covariance among model variables, the EnKF can also update estimates of variables for which there is no direct measurement. The resulting estimates evolve through time, enabling the EnKF to be used to estimate dynamic variables like changes in leaf phenology. The evolving estimates can also serve as a means to test the embedded model and reconcile persistent deviations between observations and model predictions. We embedded a simple arctic NEE model into the EnKF and filtered data from an eddy covariance tower located in tussock tundra on the northern foothills of the Brooks Range in northern Alaska, USA. The model predicts NEE based only on leaf area, irradiance, and temperature and has been well corroborated for all the major vegetation types in the Low Arctic using chamber-based data. This is the first application of the model to eddy covariance data. We modified the EnKF by adding an adaptive noise estimator that provides a feedback between persistent model data deviations and the noise added to the ensemble of Monte Carlo simulations in the EnKF. We also ran the EnKF with both a specified leaf-area trajectory and with the EnKF sequentially recalibrating leaf-area estimates to compensate for persistent model-data deviations. When used together, adaptive noise estimation and sequential recalibration substantially improved filter

Performance Analysis of Local Ensemble Kalman Filter

Science.gov (United States)

Tong, Xin T.

2018-03-01

Ensemble Kalman filter (EnKF) is an important data assimilation method for high-dimensional geophysical systems. Efficient implementation of EnKF in practice often involves the localization technique, which updates each component using only information within a local radius. This paper rigorously analyzes the local EnKF (LEnKF) for linear systems and shows that the filter error can be dominated by the ensemble covariance, as long as (1) the sample size exceeds the logarithmic of state dimension and a constant that depends only on the local radius; (2) the forecast covariance matrix admits a stable localized structure. In particular, this indicates that with small system and observation noises, the filter error will be accurate in long time even if the initialization is not. The analysis also reveals an intrinsic inconsistency caused by the localization technique, and a stable localized structure is necessary to control this inconsistency. While this structure is usually taken for granted for the operation of LEnKF, it can also be rigorously proved for linear systems with sparse local observations and weak local interactions. These theoretical results are also validated by numerical implementation of LEnKF on a simple stochastic turbulence in two dynamical regimes.

For beginners in anaesthesia, self-training with an audiovisual checklist improves safety during anaesthesia induction: A prospective, randomised, controlled two-centre study.

Science.gov (United States)

Beck, Stefanie; Reich, Christian; Krause, Dorothea; Ruhnke, Bjarne; Daubmann, Anne; Weimann, Jörg; Zöllner, Christian; Kubitz, Jens

2018-01-31

Beginners in residency programmes in anaesthesia are challenged because working environment is complex, and they cannot rely on experience to meet challenges. During this early stage, residents need rules and structures to guide their actions and ensure patient safety. We investigated whether self-training with an electronic audiovisual checklist app on a mobile phone would produce a long-term improvement in the safety-relevant actions during induction of general anaesthesia. During the first month of their anaesthesia residency, we randomised 26 residents to the intervention and control groups. The study was performed between August 2013 and December 2014 in two university hospitals in Germany. In addition to normal training, the residents of the intervention group trained themselves on well tolerated induction using the electronic checklist for at least 60 consecutive general anaesthesia inductions. After an initial learning phase, all residents were observed during one induction of general anaesthesia. The primary outcome was the number of safety items completed during this anaesthesia induction. Secondary outcomes were similar observations 4 and 8 weeks later. Immediately, and 4 weeks after the first learning phase, residents in the intervention group completed a significantly greater number of safety checks than residents in the control group 2.8 [95% confidence interval (CI) 0.4 to 5.1, P = 0.021, Cohen's d = 0.47] and 3.7 (95% CI 1.3 to 6.1, P = 0.003, Cohen's d = 0.61), respectively. The difference between the groups had disappeared by 8 weeks: mean difference in the number of safety checks at 8 weeks was 0.4, 95% CI -2.0 to 2.8, P = 0.736, Cohen's d = 0.07). The use of an audiovisual self-training checklists improves safety-relevant behaviour in the early stages of a residency training programme in anaesthesia.

A One-Step-Ahead Smoothing-Based Joint Ensemble Kalman Filter for State-Parameter Estimation of Hydrological Models

KAUST Repository

El Gharamti, Mohamad

2015-11-26

The ensemble Kalman filter (EnKF) recursively integrates field data into simulation models to obtain a better characterization of the model’s state and parameters. These are generally estimated following a state-parameters joint augmentation strategy. In this study, we introduce a new smoothing-based joint EnKF scheme, in which we introduce a one-step-ahead smoothing of the state before updating the parameters. Numerical experiments are performed with a two-dimensional synthetic subsurface contaminant transport model. The improved performance of the proposed joint EnKF scheme compared to the standard joint EnKF compensates for the modest increase in the computational cost.

Study of the effects of multimodal exercise program on physical fitness and health perception in community-living Hungarian older adults.

Science.gov (United States)

Virág, Anikó; Harkányi, Izabella; Karóczi, Csilla K; Vass, Zsolt; Kovács, Éva

2018-05-01

The aim of this study was to investigate the effects on fitness indicators and subjective health-perception of a multimodal exercise program provided by a district in Budapest among community-living seniors. Sixty community-living older adults aged over 60 years formed beginner group (who were at the beginning of the exercise program), advanced group (who had been in the programme for 3-6 months), active group (who had been participating in the exercise program for at least 6 months, in addition to Nordic walking program) and a physically inactive control group. Balance, functional mobility, lower and upper limb strength, lower and upper body flexibility, aerobic endurance and self-reported health perception were measured at baseline, and after a 12-week follow-up period. The beginner group and the advanced group improved in upper body flexibility (beginner Δ=1.2; d=0.83; advanced: Δ=1.7; d=1.39), lower body flexibility (beginner: Δ=1.7, d=0.484; advanced: Δ=1.9; d=1.55), lower limb strength (beginner: Δ=1.47; d=0.84; advanced: Δ=1.57; d=0.72), and functional mobility (beginner: Δ=-0.6; d=0.54; advanced: Δ=-0.4; d=0.90). There were also improvements in aerobic endurance (Δ=11.06; d=0.96) and balance (Δ=1.6; d=0.62) of beginner group. These indicators declined in the control group. Indicators of the active group did not change. The self-perceived health status declined (Δ=-13.9; d=0.73) in the control group but did not change in any exercising groups. This multimodal exercise program can be effective among community-living older adults, even in Hungary, a country where geriatric physical activity is not widespread. Therefore, it would be useful to extend this model program to other settlements as well.

Deterministic Mean-Field Ensemble Kalman Filtering

KAUST Repository

Law, Kody

2016-05-03

The proof of convergence of the standard ensemble Kalman filter (EnKF) from Le Gland, Monbet, and Tran [Large sample asymptotics for the ensemble Kalman filter, in The Oxford Handbook of Nonlinear Filtering, Oxford University Press, Oxford, UK, 2011, pp. 598--631] is extended to non-Gaussian state-space models. A density-based deterministic approximation of the mean-field limit EnKF (DMFEnKF) is proposed, consisting of a PDE solver and a quadrature rule. Given a certain minimal order of convergence k between the two, this extends to the deterministic filter approximation, which is therefore asymptotically superior to standard EnKF for dimension d<2k. The fidelity of approximation of the true distribution is also established using an extension of the total variation metric to random measures. This is limited by a Gaussian bias term arising from nonlinearity/non-Gaussianity of the model, which arises in both deterministic and standard EnKF. Numerical results support and extend the theory.

Deterministic Mean-Field Ensemble Kalman Filtering

KAUST Repository

Law, Kody; Tembine, Hamidou; Tempone, Raul

2016-01-01

The proof of convergence of the standard ensemble Kalman filter (EnKF) from Le Gland, Monbet, and Tran [Large sample asymptotics for the ensemble Kalman filter, in The Oxford Handbook of Nonlinear Filtering, Oxford University Press, Oxford, UK, 2011, pp. 598--631] is extended to non-Gaussian state-space models. A density-based deterministic approximation of the mean-field limit EnKF (DMFEnKF) is proposed, consisting of a PDE solver and a quadrature rule. Given a certain minimal order of convergence k between the two, this extends to the deterministic filter approximation, which is therefore asymptotically superior to standard EnKF for dimension d<2k. The fidelity of approximation of the true distribution is also established using an extension of the total variation metric to random measures. This is limited by a Gaussian bias term arising from nonlinearity/non-Gaussianity of the model, which arises in both deterministic and standard EnKF. Numerical results support and extend the theory.

Sex differences in muscle morphology of the knee flexors and knee extensors.

Directory of Open Access Journals (Sweden)

Fearghal P Behan

Full Text Available Females experience higher risk of anterior cruciate ligament (ACL injuries; males experience higher risk of hamstring strain injuries. Differences in injury may be partially due to sex differences in knee flexor (KF to knee extensor (KE muscle size ratio and the proportional size of constituent muscles.To compare the absolute and proportional size, and mass distribution, of individual KE and KF muscles, as well as overall size and balance (size ratio of these muscle groups between the sexes.T1-weighted axial plane MR images (1.5T of healthy untrained young males and females (32 vs 34 were acquired to determine thigh muscle anatomical cross-sectional area (ACSA. Maximal ACSA (ACSAmax of constituent muscles, summated for KF and KE muscle groups, and the KF:KE ratio were calculated.Females had 25.3% smaller KE ACSAmax (70.9±12.1 vs 93.6±10.3 cm2; P<0.001 and 29.6% smaller KF ACSAmax than males (38.8±7.3cm2 vs 55.1±7.3cm2; P<0.001. Consequently, females had lower KF:KE ACSA ratio (P = 0.031. There were sex differences in the proportional size of 2/4 KE and 5/6 KF. In females, vastus lateralis (VL, biceps femoris long-head (BFlh and semimembranosus (SM were a greater proportion and sartorius (SA, gracilis (GR and biceps femoris short-head (BFsh a smaller proportion of their respective muscle groups compared to males (All P<0.05.Sex differences in KF:KE ACSAmax ratio may contribute to increased risk of ACL injury in females. Sex discrepancies in absolute and proportional size of SA, GR, VL and BFlh may contribute further anatomical explanations for sex differences in injury incidence.

Production of 5-ketofructose from fructose or sucrose using genetically modified Gluconobacter oxydans strains.

Science.gov (United States)

Siemen, Anna; Kosciow, Konrad; Schweiger, Paul; Deppenmeier, Uwe

2018-02-01

The growing consumer demand for low-calorie, sugar-free foodstuff motivated us to search for alternative non-nutritive sweeteners. A promising sweet-tasting compound is 5-keto-D-fructose (5-KF), which is formed by membrane-bound fructose dehydrogenases (Fdh) in some Gluconobacter strains. The plasmid-based expression of the fdh genes in Gluconobacter (G.) oxydans resulted in a much higher Fdh activity in comparison to the native host G. japonicus. Growth experiments with G. oxydans fdh in fructose-containing media indicated that 5-KF was rapidly formed with a conversion efficiency of 90%. 5-KF production from fructose was also observed using resting cells with a yield of about 100%. In addition, a new approach was tested for the production of the sweetener 5-KF by using sucrose as a substrate. To this end, a two-strain system composed of the fdh-expressing strain and a G. oxydans strain that produced the sucrose hydrolyzing SacC was developed. The strains were co-cultured in sucrose medium and converted 92.5% of the available fructose units into 5-KF. The glucose moiety of sucrose was converted to 2-ketogluconate and acetate. With regard to the development of a sustainable and resource-saving process for the production of 5-KF, sugar beet extract was used as substrate for the two-strain system. Fructose as product from sucrose cleavage was mainly oxidized to 5-KF which was detected in a concentration of over 200 mM at the end of the fermentation process. In summary, the two-strain system was able to convert fructose units of sugar beet extract to 5-KF with an efficiency of 82 ± 5%.

Issues to be Considered in the Evaluation of Technical Proposals from the Ada (Trademark) Language Perspective.

Science.gov (United States)

1985-06-10

flowcharts - hierarchical charts - data flow diagrams - finite state diagrams - control flow diagrams - decision tables/trees - entity-relationship...and beginners ; for example, is prompting via menus provided for beginners and single keystroke capability provided for experienced users? 2-13 - input

Data assimilation strategies for volcano geodesy

Science.gov (United States)

Zhan, Yan; Gregg, Patricia M.

2017-09-01

Ground deformation observed using near-real time geodetic methods, such as InSAR and GPS, can provide critical information about the evolution of a magma chamber prior to volcanic eruption. Rapid advancement in numerical modeling capabilities has resulted in a number of finite element models targeted at better understanding the connection between surface uplift associated with magma chamber pressurization and the potential for volcanic eruption. Robust model-data fusion techniques are necessary to take full advantage of the numerical models and the volcano monitoring observations currently available. In this study, we develop a 3D data assimilation framework using the Ensemble Kalman Filter (EnKF) approach in order to combine geodetic observations of surface deformation with geodynamic models to investigate volcanic unrest. The EnKF sequential assimilation method utilizes disparate data sets as they become available to update geodynamic models of magma reservoir evolution. While the EnKF has been widely applied in hydrologic and climate modeling, the adaptation for volcano monitoring is in its initial stages. As such, our investigation focuses on conducting a series of sensitivity tests to optimize the EnKF for volcano applications and on developing specific strategies for assimilation of geodetic data. Our numerical experiments illustrate that the EnKF is able to adapt well to the spatial limitations posed by GPS data and the temporal limitations of InSAR, and that specific strategies can be adopted to enhance EnKF performance to improve model forecasts. Specifically, our numerical experiments indicate that: (1) incorporating additional iterations of the EnKF analysis step is more efficient than increasing the number of ensemble members; (2) the accuracy of the EnKF results are not affected by initial parameter assumptions; (3) GPS observations near the center of uplift improve the quality of model forecasts; (4) occasionally shifting continuous GPS stations to

Inertial Sensor Error Reduction through Calibration and Sensor Fusion

Directory of Open Access Journals (Sweden)

Stefan Lambrecht

2016-02-01

Full Text Available This paper presents the comparison between cooperative and local Kalman Filters (KF for estimating the absolute segment angle, under two calibration conditions. A simplified calibration, that can be replicated in most laboratories; and a complex calibration, similar to that applied by commercial vendors. The cooperative filters use information from either all inertial sensors attached to the body, Matricial KF; or use information from the inertial sensors and the potentiometers of an exoskeleton, Markovian KF. A one minute walking trial of a subject walking with a 6-DoF exoskeleton was used to assess the absolute segment angle of the trunk, thigh, shank, and foot. The results indicate that regardless of the segment and filter applied, the more complex calibration always results in a significantly better performance compared to the simplified calibration. The interaction between filter and calibration suggests that when the quality of the calibration is unknown the Markovian KF is recommended. Applying the complex calibration, the Matricial and Markovian KF perform similarly, with average RMSE below 1.22 degrees. Cooperative KFs perform better or at least equally good as Local KF, we therefore recommend to use cooperative KFs instead of local KFs for control or analysis of walking.

TCSA for beginners

CERN Multimedia

CERN. Geneva

2014-01-01

the basics of the approach I also give a brief overview of the recently introduced renormalization methods to deal with cut-off dependence, which led to a major improvement in precision and also widened the potential scope of applications.

Kant for beginners

CERN Document Server

Want, Christopher; Appignanesi, Richard

1996-01-01

Immanuel Kant, philosopher of the Enlightenment, laid the foundations of modern Western thought. This work focuses on the three critiques of Pure Reason, Practical Reason and Judgement. It describes Kant's main formal concepts: the relation of mind to sensory experience, the question of freedom and the law and, above all, the revaluation of metaphysics. Kant emerges as a diehard rationalist yet also a Romantic, deeply committed to the power of the sublime to transform experience.

PHENIX for beginners

International Nuclear Information System (INIS)

Zajc, W.A.; Fachini, P.

2002-01-01

An introduction to the PHENIX detector and to the PHENIX physics program is presented. The PHENIX physics results presented here are those from the the first RHIC (Relativistic Heavy Ion Collider) run with Au+Au collisions at √(S NN ) = 130 GeV. A brief overview of the PHENIX detector is provided. The systematic variation with centrality of charged particle multiplicity, transverse energy, identified particle spectra and yield ratios, production of charged hadrons and π0's at high transverse momenta are reported, together with first results on charm production at RHIC

PHENIX for Beginners

Science.gov (United States)

Zajc, W. A.; Fachini, P.

2002-10-01

An introduction to the PHENIX detector and to the PHENIX physics program is presented. The PHENIX physics results presented here are those from the the first RHIC (Relativistic Heavy Ion Collider) run with Au+Au collisions at RADICAL:[[RADICAND:[SNN

Spectrophotometric analysis of flavonoid-DNA binding interactions at physiological conditions

Science.gov (United States)

Janjua, Naveed Kausar; Siddiqa, Asima; Yaqub, Azra; Sabahat, Sana; Qureshi, Rumana; Haque, Sayed ul

2009-12-01

Mode of interactions of three flavonoids [morin (M), quercetin (Q), and rutin (R)] with chicken blood ds.DNA (ck.DNA) has been investigated spectrophotometrically at different temperatures including body temperature (310 K) and at two physiological pH values, i.e. 7.4 (human blood pH) and 4.7 (stomach pH). The binding constants, Kf, evaluated using Benesi-Hildebrand equation showed that the flavonoids bind effectively through intercalation at both pH values and body temperature. Quercetin, somehow, showed greater binding capabilities with DNA. The free energies of flavonoid-DNA complexes indicated the spontaneity of their binding. The order of binding constants of three flavonoids at both pH values were found to be Kf(Q) > Kf(R) > Kf(M) and at 310 K.

Jenkins essentials

CERN Document Server

Soni, Mitesh

2015-01-01

If you are a Jenkins novice or beginner with a basic understanding of continuous integration, then this is the book for you. Beginners in Jenkins will get quick hands-on experience and gain the confidence to go ahead and explore the use of Jenkins further.

Konjac flour improved textural and water retention properties of transglutaminase-mediated, heat-induced porcine myofibrillar protein gel: Effect of salt level and transglutaminase incubation.

Science.gov (United States)

Chin, Koo B; Go, Mi Y; Xiong, Youling L

2009-03-01

Functional properties of heat-induced gels prepared from microbial transglutaminase (TG)-treated porcine myofibrillar protein (MP) containing sodium caseinate with or without konjac flour (KF) under various salt concentrations (0.1, 0.3 and 0.6MNaCl) were evaluated. The mixed MP gels with KF exhibited improved cooking yields at all salt concentrations. TG treatment greatly enhanced gel strength and elasticity (storage modulus, G') at 0.6M NaCl, but not at lower salt concentrations. The combination of KF and TG improved the gel strength at 0.1 and 0.3M NaCl and G' at all salt concentrations, when compared with non-TG controls. Incubation of MP suspensions (sols) with TG promoted the disappearance of myosin heavy chain and the production of polymers. The TG-treated MP mixed gels had a compact structure, compared to those without TG, and the KF incorporation modified the gel matrix and increased its water-holding capacity. Results from differential scanning calorimetry suggested possible interactions of MP with KF, which may explain the changes in the microstructure of the heat-induced gels.

Stock price estimation using ensemble Kalman Filter square root method

Science.gov (United States)

Karya, D. F.; Katias, P.; Herlambang, T.

2018-04-01

Shares are securities as the possession or equity evidence of an individual or corporation over an enterprise, especially public companies whose activity is stock trading. Investment in stocks trading is most likely to be the option of investors as stocks trading offers attractive profits. In determining a choice of safe investment in the stocks, the investors require a way of assessing the stock prices to buy so as to help optimize their profits. An effective method of analysis which will reduce the risk the investors may bear is by predicting or estimating the stock price. Estimation is carried out as a problem sometimes can be solved by using previous information or data related or relevant to the problem. The contribution of this paper is that the estimates of stock prices in high, low, and close categorycan be utilized as investors’ consideration for decision making in investment. In this paper, stock price estimation was made by using the Ensemble Kalman Filter Square Root method (EnKF-SR) and Ensemble Kalman Filter method (EnKF). The simulation results showed that the resulted estimation by applying EnKF method was more accurate than that by the EnKF-SR, with an estimation error of about 0.2 % by EnKF and an estimation error of 2.6 % by EnKF-SR.

Wound closure with Karydakis flap is decreasing the perioperative costs after pilonidal sinus excision as compared to lay-open approach.

Science.gov (United States)

Borel, F; Gaudin, C; Duchalais, E; Lehur, P-A; Meurette, G

2017-12-01

To assess the impact of a simple flap closing procedure by Karydakis flap (KF) after pilonidal sinus excision on the costs and healing time as compared to routine lay-open technique. Out of 44 consecutive patients operated on for pilonidal excision (November 2013-March 2015), 17 had a Karydakis flap and 27 a lay-open procedure. For each patient, the length of stay, the operating time (OT), the time needed for complete healing and postoperative care resources were recorded. The global costs included OT, nursing care quantity, and modalities until complete scar healing. One reoperation in the lay-open group was necessary during the follow-up (8±5months). No recurrence occurred. Postoperative morbidity was similar in both groups. Results showed that KF global cost was inferior as compared to lay-open technique (941±178€ vs. 1601±399€; P=0.0001), KF healed faster (32±17 vs. 59±22days; P=0.0001), whereas OT was longer in KF group (16±7 vs. 25±4min; P=0.001). KF allows a faster healing time and a 41% lower cost than lay-open technique. Preferential use of KF rather than lay-open procedure could allow a significant health cost saving. Copyright © 2017. Published by Elsevier Masson SAS.

Linear versus Nonlinear Filtering with Scale-Selective Corrections for Balanced Dynamics in a Simple Atmospheric Model

KAUST Repository

Subramanian, Aneesh C.

2012-11-01

This paper investigates the role of the linear analysis step of the ensemble Kalman filters (EnKF) in disrupting the balanced dynamics in a simple atmospheric model and compares it to a fully nonlinear particle-based filter (PF). The filters have a very similar forecast step but the analysis step of the PF solves the full Bayesian filtering problem while the EnKF analysis only applies to Gaussian distributions. The EnKF is compared to two flavors of the particle filter with different sampling strategies, the sequential importance resampling filter (SIRF) and the sequential kernel resampling filter (SKRF). The model admits a chaotic vortical mode coupled to a comparatively fast gravity wave mode. It can also be configured either to evolve on a so-called slow manifold, where the fast motion is suppressed, or such that the fast-varying variables are diagnosed from the slow-varying variables as slaved modes. Identical twin experiments show that EnKF and PF capture the variables on the slow manifold well as the dynamics is very stable. PFs, especially the SKRF, capture slaved modes better than the EnKF, implying that a full Bayesian analysis estimates the nonlinear model variables better. The PFs perform significantly better in the fully coupled nonlinear model where fast and slow variables modulate each other. This suggests that the analysis step in the PFs maintains the balance in both variables much better than the EnKF. It is also shown that increasing the ensemble size generally improves the performance of the PFs but has less impact on the EnKF after a sufficient number of members have been used.

Linear versus Nonlinear Filtering with Scale-Selective Corrections for Balanced Dynamics in a Simple Atmospheric Model

KAUST Repository

Subramanian, Aneesh C.; Hoteit, Ibrahim; Cornuelle, Bruce; Miller, Arthur J.; Song, Hajoon

2012-01-01

This paper investigates the role of the linear analysis step of the ensemble Kalman filters (EnKF) in disrupting the balanced dynamics in a simple atmospheric model and compares it to a fully nonlinear particle-based filter (PF). The filters have a very similar forecast step but the analysis step of the PF solves the full Bayesian filtering problem while the EnKF analysis only applies to Gaussian distributions. The EnKF is compared to two flavors of the particle filter with different sampling strategies, the sequential importance resampling filter (SIRF) and the sequential kernel resampling filter (SKRF). The model admits a chaotic vortical mode coupled to a comparatively fast gravity wave mode. It can also be configured either to evolve on a so-called slow manifold, where the fast motion is suppressed, or such that the fast-varying variables are diagnosed from the slow-varying variables as slaved modes. Identical twin experiments show that EnKF and PF capture the variables on the slow manifold well as the dynamics is very stable. PFs, especially the SKRF, capture slaved modes better than the EnKF, implying that a full Bayesian analysis estimates the nonlinear model variables better. The PFs perform significantly better in the fully coupled nonlinear model where fast and slow variables modulate each other. This suggests that the analysis step in the PFs maintains the balance in both variables much better than the EnKF. It is also shown that increasing the ensemble size generally improves the performance of the PFs but has less impact on the EnKF after a sufficient number of members have been used.

A Brief Tutorial on the Ensemble Kalman Filter

OpenAIRE

Mandel, Jan

2009-01-01

The ensemble Kalman filter (EnKF) is a recursive filter suitable for problems with a large number of variables, such as discretizations of partial differential equations in geophysical models. The EnKF originated as a version of the Kalman filter for large problems (essentially, the covariance matrix is replaced by the sample covariance), and it is now an important data assimilation component of ensemble forecasting. EnKF is related to the particle filter (in this context, a particle is the s...

Silicon electrodeposition from chloride-fluoride melts containing K2SiF6 and SiO2

Directory of Open Access Journals (Sweden)

Zhuk Sergey I.

2017-01-01

Full Text Available Silicon electrodeposition on glassy carbon from the KF-KCl-K2SiF6, KF-KCl-K2SiF6-KOH and KF-KCl-K2SiF6-SiO2 melts was studied by the cyclic voltammetry. Тhe electroreduction of Si(IV to metallic Si was observed as a single 4-electron wave under all considered conditions. The reactions of cathode reduction of silicon from fluoride and oxyfluoride complexes were suggested. It was shown that the process can be controlled by the preliminary transformation of SiO44- to SiF62- and SiOxFyz-. The influence of the current density on structure and morphology of silicon deposits obtained during galvanostatic electrolysis of the KF-KCl-K2SiF6-SiO2 melt was studied.

Young Learners and Lexical Awareness: Children's Engagement with Wordlists and Concordances

Science.gov (United States)

MacGregor, Alex

2014-01-01

Sinclair (1991) found that lexical analysis can be overcomplicated, yet Johns (1994) called for investigation into whether corpus analysis can motivate beginners and near-beginners. The findings of this research suggest that young EFL learners can enjoy using corpus analysis tools (wordlists and concordances) to identify, classify, and generalize…

A Bayesian consistent dual ensemble Kalman filter for state-parameter estimation in subsurface hydrology

KAUST Repository

Ait-El-Fquih, Boujemaa; El Gharamti, Mohamad; Hoteit, Ibrahim

2016-01-01

Ensemble Kalman filtering (EnKF) is an efficient approach to addressing uncertainties in subsurface ground-water models. The EnKF sequentially integrates field data into simulation models to obtain a better characterization of the model's state and parameters. These are generally estimated following joint and dual filtering strategies, in which, at each assimilation cycle, a forecast step by the model is followed by an update step with incoming observations. The joint EnKF directly updates the augmented state-parameter vector, whereas the dual EnKF empirically employs two separate filters, first estimating the parameters and then estimating the state based on the updated parameters. To develop a Bayesian consistent dual approach and improve the state-parameter estimates and their consistency, we propose in this paper a one-step-ahead (OSA) smoothing formulation of the state-parameter Bayesian filtering problem from which we derive a new dual-type EnKF, the dual EnKF(OSA). Compared with the standard dual EnKF, it imposes a new update step to the state, which is shown to enhance the performance of the dual approach with almost no increase in the computational cost. Numerical experiments are conducted with a two-dimensional (2-D) synthetic groundwater aquifer model to investigate the performance and robustness of the proposed dual EnKFOSA, and to evaluate its results against those of the joint and dual EnKFs. The proposed scheme is able to successfully recover both the hydraulic head and the aquifer conductivity, providing further reliable estimates of their uncertainties. Furthermore, it is found to be more robust to different assimilation settings, such as the spatial and temporal distribution of the observations, and the level of noise in the data. Based on our experimental setups, it yields up to 25% more accurate state and parameter estimations than the joint and dual approaches.

Potential of an ensemble Kalman smoother for stratospheric chemical-dynamical data assimilation

Directory of Open Access Journals (Sweden)

Thomas Milewski

2013-02-01

Full Text Available A new stratospheric ensemble Kalman smoother (EnKS system is introduced, and the potential of assimilating posterior stratospheric observations to better constrain the whole model state at analysis time is investigated. A set of idealised perfect-model Observation System Simulation Experiments (OSSE assimilating synthetic limb-sounding temperature or ozone retrievals are performed with a chemistry–climate model. The impact during the analysis step is characterised in terms of the root mean square error reduction between the forecast state and the analysis state. The performances of (1 a fixed-lag EnKS assimilating observations spread over 48 hours and (2 an ensemble Kalman Filter (EnKF assimilating a denser network of observations are compared with a reference EnKF. The ozone assimilation with EnKS shows a significant additional reduction of analysis error of the order of 10% for dynamical and chemical variables in the extratropical upper troposphere lower stratosphere (UTLS and Polar Vortex regions when compared to the reference EnKF. This reduction has similar magnitude to the one achieved by the denser-network EnKF assimilation. Similarly, the temperature assimilation with EnKS significantly decreases the error in the UTLS for the wind variables like the denser-network EnKF assimilation. However, the temperature assimilation with EnKS has little or no significant impact on the temperature and ozone analyses, whereas the denser-network EnKF shows improvement with respect to the reference EnKF. The different analysis impacts from the assimilation of current and posterior ozone observations indicate the capacity of time-lagged background-error covariances to represent temporal interactions up to 48 hours between variables during the ensemble data assimilation analysis step, and the possibility to use posterior observations whenever additional current observations are unavailable. The possible application of the EnKS for reanalyses is

A Bayesian consistent dual ensemble Kalman filter for state-parameter estimation in subsurface hydrology

KAUST Repository

Ait-El-Fquih, Boujemaa

2016-08-12

Ensemble Kalman filtering (EnKF) is an efficient approach to addressing uncertainties in subsurface ground-water models. The EnKF sequentially integrates field data into simulation models to obtain a better characterization of the model\\'s state and parameters. These are generally estimated following joint and dual filtering strategies, in which, at each assimilation cycle, a forecast step by the model is followed by an update step with incoming observations. The joint EnKF directly updates the augmented state-parameter vector, whereas the dual EnKF empirically employs two separate filters, first estimating the parameters and then estimating the state based on the updated parameters. To develop a Bayesian consistent dual approach and improve the state-parameter estimates and their consistency, we propose in this paper a one-step-ahead (OSA) smoothing formulation of the state-parameter Bayesian filtering problem from which we derive a new dual-type EnKF, the dual EnKF(OSA). Compared with the standard dual EnKF, it imposes a new update step to the state, which is shown to enhance the performance of the dual approach with almost no increase in the computational cost. Numerical experiments are conducted with a two-dimensional (2-D) synthetic groundwater aquifer model to investigate the performance and robustness of the proposed dual EnKFOSA, and to evaluate its results against those of the joint and dual EnKFs. The proposed scheme is able to successfully recover both the hydraulic head and the aquifer conductivity, providing further reliable estimates of their uncertainties. Furthermore, it is found to be more robust to different assimilation settings, such as the spatial and temporal distribution of the observations, and the level of noise in the data. Based on our experimental setups, it yields up to 25% more accurate state and parameter estimations than the joint and dual approaches.

Fusion technology programme

International Nuclear Information System (INIS)

Finken, D.

1986-05-01

In 1982, KfK joined the fusion programme of EURATOM as a further association introducing its experience in nuclear technology. KfK closely cooperates with IPP Garching, the two institutions forming a research unit aiming at planning and realization of future development steps of fusion. KfK has combined its forces in the Nuclear Fusion Project (PKF) with participation of several KfK departments to the project tasks. Previous work of KfK in magnetic fusion has addressed mainly superconducting magnets, plasma heating by cluster ions and studies on structural materials. At present, emphasis of our work has concentrated increasingly on the nuclear part, i.e. the first wall and blanket structures and the elements of the tritium extraction and purification system. Associated to this component development are studies of remote maintenance and safety. Most of the actual work addresses NET, the next step to a demonstration of fusion feasibility. NET is supposed to follow JET, the operating plasma physics experiment of Euratom, on the 1990's. Detailed progress of the work in the past half year is described in this report. (orig./GG)

Knee flexor strength and balance control impairment may explain declines during prolonged walking in women with mild multiple sclerosis.

Science.gov (United States)

Ramari, Cintia; Moraes, Andréa G; Tauil, Carlos B; von Glehn, Felipe; Motl, Robert; de David, Ana C

2018-02-01

Physiological factors such as muscle weakness and balance could explain declines in walking distance by multiple sclerosis (MS) patients. The purpose of this study was to characterize levels and examine associations among decline in walking distance, balance and muscular strength in women with mild MS. Participants included 28 women with mild relapsing-remitting MS and 21 women without MS. We executed the 6-min walk test (6MWT) to verify declines in walking distance. Isokinetic knee flexion (KF) and extension (KE) muscle strength was measured using a dynamometer. Balance was quantified using a force platform, with eyes open and closed, on a rigid and foam surface. The MS patients presented declines in walking, lower KF muscle strength, and worse balance than controls. KF strength and balance correlated with walking in the MS group. The KF strength explained differences between groups in walking. The KF strength and balance presented as predictors of walking slowing down in the 6MWT, in mild MS. Women with mild MS have strength impairment of knee flexor muscles and balance control impairment that may explain walking related motor fatigability during prolonged walking. Copyright © 2018 Elsevier B.V. All rights reserved.

Low-rank Kalman filtering for efficient state estimation of subsurface advective contaminant transport models

KAUST Repository

El Gharamti, Mohamad

2012-04-01

Accurate knowledge of the movement of contaminants in porous media is essential to track their trajectory and later extract them from the aquifer. A two-dimensional flow model is implemented and then applied on a linear contaminant transport model in the same porous medium. Because of different sources of uncertainties, this coupled model might not be able to accurately track the contaminant state. Incorporating observations through the process of data assimilation can guide the model toward the true trajectory of the system. The Kalman filter (KF), or its nonlinear invariants, can be used to tackle this problem. To overcome the prohibitive computational cost of the KF, the singular evolutive Kalman filter (SEKF) and the singular fixed Kalman filter (SFKF) are used, which are variants of the KF operating with low-rank covariance matrices. Experimental results suggest that under perfect and imperfect model setups, the low-rank filters can provide estimates as accurate as the full KF but at much lower computational effort. Low-rank filters are demonstrated to significantly reduce the computational effort of the KF to almost 3%. © 2012 American Society of Civil Engineers.

Analysis of Learning Behavior in a Flipped Programing Classroom Adopting Problem-Solving Strategies

Science.gov (United States)

Chiang, Tosti Hsu-Cheng

2017-01-01

Programing is difficult for beginners because they need to learn the new language of computers. Developing software, especially complex software, is bound to result in problems, frustration, and the need to think in new ways. Identifying the learning behavior behind programing by way of empirical studies can help beginners learn more easily. In…

Output regularization of SVM seizure predictors: Kalman Filter versus the "Firing Power" method.

Science.gov (United States)

Teixeira, Cesar; Direito, Bruno; Bandarabadi, Mojtaba; Dourado, António

2012-01-01

Two methods for output regularization of support vector machines (SVMs) classifiers were applied for seizure prediction in 10 patients with long-term annotated data. The output of the classifiers were regularized by two methods: one based on the Kalman Filter (KF) and other based on a measure called the "Firing Power" (FP). The FP is a quantification of the rate of the classification in the preictal class in a past time window. In order to enable the application of the KF, the classification problem was subdivided in a two two-class problem, and the real-valued output of SVMs was considered. The results point that the FP method raise less false alarms than the KF approach. However, the KF approach presents an higher sensitivity, but the high number of false alarms turns their applicability negligible in some situations.

Proposed man-rem reference values of occupational exposure

International Nuclear Information System (INIS)

Lombard, J.

1988-04-01

This report presents a proposal of referent collective dose (man-rem) values for occupational exposure related to operation of French pressurized water reactors. These values, permitting adequate choice of protection both at design and operation level, are dependent on the level of annual individual doses. The man-rem value, originating from annual individual doses less than 0.5 rem are estimated to 1 kf. The proposed value is 20 kf for annual individual exposures between 0.5 and 3 rem, and 90 kf for annual individual exposures between 3 and 5 rem. (author) [fr

Multilevel ensemble Kalman filtering

KAUST Repository

Hoel, Hakon

2016-06-14

This work embeds a multilevel Monte Carlo sampling strategy into the Monte Carlo step of the ensemble Kalman filter (EnKF) in the setting of finite dimensional signal evolution and noisy discrete-time observations. The signal dynamics is assumed to be governed by a stochastic differential equation (SDE), and a hierarchy of time grids is introduced for multilevel numerical integration of that SDE. The resulting multilevel EnKF is proved to asymptotically outperform EnKF in terms of computational cost versus approximation accuracy. The theoretical results are illustrated numerically.

Multilevel ensemble Kalman filtering

KAUST Repository

Hoel, Hakon; Law, Kody J. H.; Tempone, Raul

2016-01-01

This work embeds a multilevel Monte Carlo sampling strategy into the Monte Carlo step of the ensemble Kalman filter (EnKF) in the setting of finite dimensional signal evolution and noisy discrete-time observations. The signal dynamics is assumed to be governed by a stochastic differential equation (SDE), and a hierarchy of time grids is introduced for multilevel numerical integration of that SDE. The resulting multilevel EnKF is proved to asymptotically outperform EnKF in terms of computational cost versus approximation accuracy. The theoretical results are illustrated numerically.

Advanced Guidance Algorithms for Homing Missiles with Bearings-Only Measurements.

Science.gov (United States)

1987-11-01

poles are no longer determined by A - BK, and A - KfC . However, the following theorem shows that the coupling H,(s) :=I+PLN(sI -A +BK,) between the...jw) given in Section H-C deter- = N(sI -A + BK,(sI- A + BK, + KC) - ’ KfC )- IM mines the robustness of the FSRO control system. However, N(sl - A + BK...by (si-A+ KfC )-’M constructing a TITO system for the state-feedback regulator.) Therefore, Theorem 3 implies that a regulator with an asymptotic =N(sl-A

Ensemble Kalman filter regularization using leave-one-out data cross-validation

KAUST Repository

Rayo Schiappacasse, Lautaro Jerónimo

2012-09-19

In this work, the classical leave-one-out cross-validation method for selecting a regularization parameter for the Tikhonov problem is implemented within the EnKF framework. Following the original concept, the regularization parameter is selected such that it minimizes the predictive error. Some ideas about the implementation, suitability and conceptual interest of the method are discussed. Finally, what will be called the data cross-validation regularized EnKF (dCVr-EnKF) is implemented in a 2D 2-phase synthetic oil reservoir experiment and the results analyzed.

The FORTRAN-77 version of the Karlsruhe program system KAPROS

International Nuclear Information System (INIS)

Moritz, N.

1985-02-01

The FORTRAN-77 KAPROS-kernel includes some major changes compared with the version, which is described in the KfK-report 2254. The changes are documented in this report from the point of view of the system-programmer. This report is meant to be a supplement to the KfK-report 2254, assuming that the reader of this report is familiar with the KfK-report 2254. He also should be familiar with the IBM operating system MVS SP1.3.2 and the usual terms of data processing. (orig.) [de

Kahalalide F analogues from the mucous secretion of Indian sacoglossan mollusc Elysia ornata

Digital Repository Service at National Institute of Oceanography (India)

Ciavatta, M.L.; PrabhaDevi; Carbone, M.; Mathieu, V.; Kiss, R.; Casapullo, A.; Gavagnin, M.

, better delivery, or longer half-life. More than 150 analogues were obtained by solid phase peptide synthesis8,9 and more recently a semi-synthetic approach to produce KF analogues starting from natural KF has been also performed.10In parallel...

Grappling with Grammar on a Virtual Learning Platform: The Case of First Year French Students at the University of Wollongong

Science.gov (United States)

Bissoonauth-Bedford, A.; Stace, Ray

2012-01-01

This paper reports on an online discussion forum that was created on the University of Wollongong's Virtual Learning Environment (VLE) to aid and support the learning of French grammar at beginner/false beginner level. The aim was to provide a blended learning situation which combines face to face teaching with online learning using multimedia…

Mobile-Based Chatting for Meaning Negotiation in Foreign Language Learning

Science.gov (United States)

Castrillo, María Dolores; Martín-Monje, Elena; Bárcena, Elena

2014-01-01

This paper analyzes the adequacy of mobile chatting via Whatsapp for the enhancement of a type of spontaneous and colloquial written interaction which has a strong connection with oral discourse. This is part of a research project undertaken with Spanish students of German as a foreign language with a beginner's or quasi-beginner's level. The…

Disease specific stress of tumor patients at the beginning of radiotherapy. Effect on psychosocial support requirement; Krankheitsspezifische Belastungen von Tumorpatienten zu Beginn einer Strahlentherapie. Auswirkungen auf den psychosozialen Betreuungsbedarf

Energy Technology Data Exchange (ETDEWEB)

Sehlen, S.; Hollenhorst, H.; Schymura, B.; Firsching, M.; Duehmke, E. [Ludwig-Maximilians-Univ., Muenchen (Germany). Klinik und Poliklinik fuer Strahlentherapie und Radioonkologie; Aydemir, U. [Inst. fuer Biometrie und Epidemiologie, Klinikum Grosshadern, Ludwig-Maximilians-Univ., Muenchen (Germany); Herschbach, P. [Technische Univ. Muenchen (Germany). Inst. und Poliklinik fuer Psychosomatische Medizin, Psychotherapie und medizinische Psychologie

2001-10-01

requirement. (orig.) [German] Hintergrund: Die Radiotherapie bringt Tumorpatienten in eine besondere Lebenssituation, in der sie eine Reihe von unterschiedlichen Faktoren ausgesetzt werden, deren Auspraegung weitgehend unbekannt ist. Intention dieser Querschnittsstudie war es, erstmals systematisch die spezifischen Belastungen von Tumorpatienten zu Beginn einer Strahlentherapie aufzuzeigen und einen belastungsabhaengigen Betreuungswunsch zu erheben mit dem Ziel einer Belastungsreduktion und Verbesserung von Lebensqualitaet und Compliance waehrend einer radioonkologischen Behandlung. Patienten und Methoden: 732 Patienten wurden zunaechst in die Studie aufgenommen, von denen 446 (60,9%) die Einschlusskriterien erfuellten (Ablehnung 21,0%, Karnofsky-Index 6,6%, organisatorische Probleme 3,4%, Sprachbarrieren 3,0%, kognitive Einschraenkung 2,6%, Tod 2,5%). Folgende Erhebungsinstrumente gingen in die Auswertung zu Beginn der Strahlentherapie ein: medizinische und soziodemographische Daten, Lebenssituation (LS), Fragebogen zur Belastung von Krebspatienten (FBK), selbst definierter Betreuungswunsch (BB). 262 Maenner und 184 Frauen (medianes Alter 60,0 Jahre) mit unterschiedlichen Diagnosen wurden untersucht. Ergebnisse: Auf Skalenebene des Fragebogens zur Belastung von Krebspatienten zeigte sich vor allem eine Belastung durch Einschraenkung der Leistungsfaehigkeit, Angst und Schmerz. Frauen hatten signifikant hoehere Belastungswerte in den Bereichen Schmerz (p=0,016) und Angst (p=0,009), Patienten unter 45 Jahren im Bereich Information (p=0,002) und Patienten zwischen 45 und 60 Jahren in den Bereichen Angst (p=0,002) und Gesamtbelastung (p=0,003). Patientinnen mit einem Mammakarzinom waren am staerksten belastet. Der Anteil von stark belasteten Patienten war in den Skalen Leistungsfaehigkeit (43%) und Angst (40%) am hoechsten. Es bestand ein signifikanter Zusammenhang zwischen hoher Belastung und hohem Betreuungswunsch (insbesondere nach Arzt-/Psychologengespraechen und Information

PENGGUNAAN SKEMA KONVEKTIF MODEL CUACA WRF (BETTS MILLER JANJIC, KAIN FRITSCH DAN GRELL 3D ENSEMBLE (Studi kasus: Surabaya dan Jakarta

Directory of Open Access Journals (Sweden)

Roni Kurniawan

2015-01-01

Full Text Available Pada kajian ini dilakukan evaluasi penggunaan beberapa skema konvektif pada model WRF (Weather Research and Forecasting untuk prediksi cuaca di wilayah Indonesia. Terdapat tiga skema konvektif yang akan dievaluasi yaitu; skema konvektif cumulus BMJ (Betts Miller Janjic, KF (Kain Fritsch, dan GD (Grell 3D ensemble. Data yang digunakan untuk evaluasi adalah data curah hujan per 3 jam dan data angin per 12 jam (level ketinggian; permukaan, 850, 500, 250 mb dari hasil pengolahan model WRF dan observasi selama periode bulan Agustus 2011 dan Februari 2012 di stasiun Juanda-Surabaya dan Cengkareng-Jakarta. Hasil verifikasi dari tiga skema konvektif pada model WRF terhadap data observasi menunjukkan bahwa untuk prakiraan curah hujan, penggunaan skema konvektif BMJ lebih baik dari skema KF dan GD, dan untuk prakiraan arah dan kecepatan angin skema BMJ dan GD relatif lebih baik dari skema KF. Berdasarkan analisis hasil verifikasi yang diperoleh, pemilihan skema konvektif cumulus BMJ cenderung lebih baik dari skema konvektif KF dan GD untuk di aplikasikan pada model WRF.   In this study, the use of some convective schemes on the model WRF (Weather Research and Forecasting for weather prediction in Indonesian region has been evaluated. There are two models evaluated; BMJ cumulus convective scheme (Betts Miller Janjic, KF (Kain Fritsch, and GD (Grell 3D ensemble. The data used in the evaluation are the 3 hourly rainfall data, and the 12 hourly wind data (level height; surface, 850, 500, 250mb from the WRF models and observation processing during August 2011 and February 2012 period at the Juanda-Surabaya and Cengkareng-Jakarta stations. The results of the verification of the three convective schemes in WRF models against observation data indicate that for precipitation forecasts, the application of the BMJ convective scheme is better than the KF and GD schemes, and for direction and wind speed forecast, BMJ and GD schemes is relatively better than the KF

A new deterministic Ensemble Kalman Filter with one-step-ahead smoothing for storm surge forecasting

KAUST Repository

Raboudi, Naila

2016-11-01

The Ensemble Kalman Filter (EnKF) is a popular data assimilation method for state-parameter estimation. Following a sequential assimilation strategy, it breaks the problem into alternating cycles of forecast and analysis steps. In the forecast step, the dynamical model is used to integrate a stochastic sample approximating the state analysis distribution (called analysis ensemble) to obtain a forecast ensemble. In the analysis step, the forecast ensemble is updated with the incoming observation using a Kalman-like correction, which is then used for the next forecast step. In realistic large-scale applications, EnKFs are implemented with limited ensembles, and often poorly known model errors statistics, leading to a crude approximation of the forecast covariance. This strongly limits the filter performance. Recently, a new EnKF was proposed in [1] following a one-step-ahead smoothing strategy (EnKF-OSA), which involves an OSA smoothing of the state between two successive analysis. At each time step, EnKF-OSA exploits the observation twice. The incoming observation is first used to smooth the ensemble at the previous time step. The resulting smoothed ensemble is then integrated forward to compute a "pseudo forecast" ensemble, which is again updated with the same observation. The idea of constraining the state with future observations is to add more information in the estimation process in order to mitigate for the sub-optimal character of EnKF-like methods. The second EnKF-OSA "forecast" is computed from the smoothed ensemble and should therefore provide an improved background. In this work, we propose a deterministic variant of the EnKF-OSA, based on the Singular Evolutive Interpolated Ensemble Kalman (SEIK) filter. The motivation behind this is to avoid the observations perturbations of the EnKF in order to improve the scheme\\'s behavior when assimilating big data sets with small ensembles. The new SEIK-OSA scheme is implemented and its efficiency is demonstrated

Streamlined Archaeo-geophysical Data Processing and Integration for DoD Field Use

Science.gov (United States)

2012-04-01

6 Figure 2-3. Flowchart illustrating the old, ad-hoc approach of processing...Figure 2-3. Flowchart illustrating the old, ad-hoc approach of processing and integrating multiple geophysical datasets. Each color represents a... beginner , intermediate, and expert user. Most users agreed that the software is very effective for beginners because: (1) it provides a geophysics

Sustainment of Individual and Collective Future Combat Skills: Modeling and Research Methods

Science.gov (United States)

2010-01-01

expertise: Novice, Advanced Beginner , Competent, Proficient, and Expert. According to this conceptualization, tactical leaders develop cognitively...to equipment or containers. • Checklists, flowcharts , worksheets, decision tables, and system-fault tables. • Written instructions (e.g., on...novice; (2) advanced beginner ; (3) competent; (4) proficient; and (5) expert. Going from novice to expert, each level of skill development reflects

Enhancement of biodiesel synthesis from soybean oil by potassium fluoride modification of a calcium magnesium oxides catalyst.

Science.gov (United States)

Fan, Mingming; Zhang, Pingbo; Ma, Qinke

2012-01-01

Transesterification of soybean oil with methanol was carried out in the presence of CaO-MgO and KF-modified CaO-MgO catalysts at atmospheric pressure. While the methyl ester yield for the CaO-MgO catalyst with a ratio of 8:2 (CaO:MgO) was 63.6%, it was 97.9% for the KF-modified catalyst at a 2% catalyst to the reactants (methanol/oil mixture) weight ratio, a temperature of 65 °C, a methanol-soybean oil ratio of 9:1 and a reaction time of 2.5 h. The KF/CaO-MgO catalyst still yielded 86.7% after four successive uses. The catalytic performance of the KF/CaO-MgO catalyst was attributed to the formation of active KCaF(3) and K(2)MgF(4) centers. Copyright © 2011 Elsevier Ltd. All rights reserved.

Reduced Incidence of Slowly Progressive Heymann Nephritis in Rats Immunized With a Modified Vaccination Technique

Directory of Open Access Journals (Sweden)

Arpad Z. Barabas

2006-01-01

Full Text Available A slowly progressive Heymann nephritis (SPHN was induced in three groups of rats by weekly injections of a chemically modified renal tubular antigen in an aqueous medium. A control group of rats received the chemically unmodified version of the antigen in an aqueous solution. One group of SPHN rats were pre- and post-treated with weekly injections of IC made up of rKF3 and rarKF3 IgM antibody at antigen excess (MIC (immune complexes [ICs] containing sonicated ultracentrifuged [u/c] rat kidney fraction 3 [rKF3] antigen and IgM antibodies specific against the antigen, at slight antigen excess. One group of SPHN rats were post-treated with MIC 3 weeks after the induction of the disease and one group of SPHN animals received no treatment. The control group of rats received pre- and post-treatment with sonicated u/c rKF3.

The biomechanical role of overall-shape transformation in a primitive multicellular organism: A case study of dimorphism in the filamentous cyanobacterium Arthrospira platensis.

Science.gov (United States)

Chaiyasitdhi, Atitheb; Miphonpanyatawichok, Wirat; Riehle, Mathis Oliver; Phatthanakun, Rungrueang; Surareungchai, Werasak; Kundhikanjana, Worasom; Kuntanawat, Panwong

2018-01-01

Morphological transformations in primitive organisms have long been observed; however, its biomechanical roles are largely unexplored. In this study, we investigate the structural advantages of dimorphism in Arthrospira platensis, a filamentous multicellular cyanobacterium. We report that helical trichomes, the default shape, have a higher persistence length (Lp), indicating a higher resistance to bending or a large value of flexural rigidity (kf), the product of the local cell stiffness (E) and the moment of inertia of the trichomes' cross-section (I). Through Atomic Force Microscopy (AFM), we determined that the E of straight and helical trichomes were the same. In contrast, our computational model shows that I is greatly dependent on helical radii, implying that trichome morphology is the major contributor to kf variation. According to our estimation, increasing the helical radii alone can increase kf by 2 orders of magnitude. We also observe that straight trichomes have improved gliding ability, due to its structure and lower kf. Our study shows that dimorphism provides mechanical adjustability to the organism and may allow it to thrive in different environmental conditions. The higher kf provides helical trichomes a better nutrient uptake through advection in aquatic environments. On the other hand, the lower kf improves the gliding ability of straight trichomes in aquatic environments, enabling it to chemotactically relocate to more favorable territories when it encounters certain environmental stresses. When more optimal conditions are encountered, straight trichomes can revert to their original helical form. Our study is one of the first to highlight the biomechanical role of an overall-shape transformation in cyanobacteria.

A generalized polynomial chaos based ensemble Kalman filter with high accuracy

International Nuclear Information System (INIS)

Li Jia; Xiu Dongbin

2009-01-01

As one of the most adopted sequential data assimilation methods in many areas, especially those involving complex nonlinear dynamics, the ensemble Kalman filter (EnKF) has been under extensive investigation regarding its properties and efficiency. Compared to other variants of the Kalman filter (KF), EnKF is straightforward to implement, as it employs random ensembles to represent solution states. This, however, introduces sampling errors that affect the accuracy of EnKF in a negative manner. Though sampling errors can be easily reduced by using a large number of samples, in practice this is undesirable as each ensemble member is a solution of the system of state equations and can be time consuming to compute for large-scale problems. In this paper we present an efficient EnKF implementation via generalized polynomial chaos (gPC) expansion. The key ingredients of the proposed approach involve (1) solving the system of stochastic state equations via the gPC methodology to gain efficiency; and (2) sampling the gPC approximation of the stochastic solution with an arbitrarily large number of samples, at virtually no additional computational cost, to drastically reduce the sampling errors. The resulting algorithm thus achieves a high accuracy at reduced computational cost, compared to the classical implementations of EnKF. Numerical examples are provided to verify the convergence property and accuracy improvement of the new algorithm. We also prove that for linear systems with Gaussian noise, the first-order gPC Kalman filter method is equivalent to the exact Kalman filter.

Impacts of using an ensemble Kalman filter on air quality simulations along the California-Mexico border region during Cal-Mex 2010 field campaign.

Science.gov (United States)

Bei, Naifang; Li, Guohui; Meng, Zhiyong; Weng, Yonghui; Zavala, Miguel; Molina, L T

2014-11-15

The purpose of this study is to investigate the impact of using an ensemble Kalman filter (EnKF) on air quality simulations in the California-Mexico border region on two days (May 30 and June 04, 2010) during Cal-Mex 2010. The uncertainties in ozone (O3) and aerosol simulations in the border area due to the meteorological initial uncertainties were examined through ensemble simulations. The ensemble spread of surface O3 averaged over the coastal region was less than 10ppb. The spreads in the nitrate and ammonium aerosols are substantial on both days, mostly caused by the large uncertainties in the surface temperature and humidity simulations. In general, the forecast initialized with the EnKF analysis (EnKF) improved the simulation of meteorological fields to some degree in the border region compared to the reference forecast initialized with NCEP analysis data (FCST) and the simulation with observation nudging (FDDA), which in turn leading to reasonable air quality simulations. The simulated surface O3 distributions by EnKF were consistently better than FCST and FDDA on both days. EnKF usually produced more reasonable simulations of nitrate and ammonium aerosols compared to the observations, but still have difficulties in improving the simulations of organic and sulfate aerosols. However, discrepancies between the EnKF simulations and the measurements were still considerably large, particularly for sulfate and organic aerosols, indicating that there are still ample rooms for improvement in the present data assimilation and/or the modeling systems. Copyright © 2014 Elsevier B.V. All rights reserved.

Injury and injury rates in Muay Thai kick boxing.

Science.gov (United States)

Gartland, S; Malik, M H; Lovell, M E

2001-10-01

To determine the type and number of injuries that occur during the training and practice of Muay Thai kick boxing and to compare the data obtained with those from previous studies of karate and taekwondo. One to one interviews using a standard questionnaire on injuries incurred during training and practice of Muay Thai kick boxing were conducted at various gyms and competitions in the United Kingdom and a Muay Thai gala in Holland. A total of 152 people were questioned, 132 men and 20 women. There were 19 beginners, 82 amateurs, and 51 professionals. Injuries to the lower extremities were the most common in all groups. Head injuries were the second most common in professionals and amateurs. Trunk injuries were the next most common in beginners. The difference in injury distribution among the three groups was significant (pinjury in the three groups. Fractures were the second most common in professionals, and in amateurs and beginners it was sprains and strains (pinjury rates were: beginners, 13.5/1000 participants; amateurs, 2.43/1000 participants; professionals, 2.79/1000 participants. For beginners, 7% of injuries resulted in seven or more days off training; for amateurs and professionals, these values were 4% and 5.8% respectively. The results are similar to those found for karate and taekwondo with regard to injury distribution, type, and rate. The percentage of injuries resulting in time off training is less.

Mapping Direct Observations From Objective Structured Clinical Examinations to the Milestones Across Specialties.

Science.gov (United States)

Baker-Genaw, Kimberly; Kokas, Maria S; Ahsan, Syed F; Darnley-Fisch, Deborah; Drake, Sean; Goyal, Nikhil; Inamdar, Kedar; Moutzouros, Vasilios; Prabhakar, Deepak; Rolland, Laurie; Sangha, Roopina; Shreve, Maria; Woodward, Ann

2016-07-01

Little is known about residents' performance on the milestones at the institutional level. Our institution formed a work group to explore this using an institutional-level curriculum and residents' evaluation of the milestones. We assessed whether beginner-level milestones for interpersonal and communication skills (ICS) related to observable behaviors in ICS-focused objective structured clinical examinations (OSCEs) for postgraduate year (PGY) 1 residents across specialties. The work group compared ICS subcompetencies across 12 programs to identify common beginner-level physician-patient communication milestones. The selected ICS milestone sets were compared for common language with the ICS-OSCE assessment tool-the Kalamazoo Essential Elements of Communication Checklist-Adapted (KEECC-A). To assess whether OSCE scores related to ICS milestone scores, all PGY-1 residents from programs that were part of Next Accreditation System Phase 1 were identified; their OSCE scores from July 2013 to June 2014 and ICS subcompetency scores from December 2014 were compared. The milestones for 10 specialties and the transitional year had at least 1 ICS subcompetency that related to physician-patient communication. The language of the ICS beginner-level milestones appears similar to behaviors outlined in the KEECC-A. All 60 residents with complete data received at least a beginner-level ICS subcompetency score and at least a satisfactory score on all 3 OSCEs. The ICS-OSCE scores for PGY-1 residents appear to relate to beginner-level milestones for physician-patient communication across multiple specialties.

An iterative ensemble Kalman filter for reservoir engineering applications

NARCIS (Netherlands)

Krymskaya, M.V.; Hanea, R.G.; Verlaan, M.

2009-01-01

The study has been focused on examining the usage and the applicability of ensemble Kalman filtering techniques to the history matching procedures. The ensemble Kalman filter (EnKF) is often applied nowadays to solving such a problem. Meanwhile, traditional EnKF requires assumption of the

Study of structure and chemical interactions in molten salt mixtures on the base of tantalum fluorides

International Nuclear Information System (INIS)

Agulyanskij, A.I.; Kirillov, S.A.; Prysyazhnyj, V.D.; AN Ukrainskoj SSR, Kiev. Inst. Obshchej i Neorganicheskoj Khimii)

1980-01-01

Using the method of IR-spectroscopy molten salt mixture containing K 2 TaF 7 , KF, KCl are investigated. It is detected that in the process of K 2 TaF 7 melting the TaF 6 - and TaF 7 2- ions are present in melt. When adding KF and KCl to the melt the equilibrium is shifted the direction of the TaF 7 2- and TaF 6 Cl 2- heptahaloid complexing respectively. In the melts with the composition close to the industrial electrolytes, containing K 2 TaF 7 , KF and KCl heptacoordinated tantalate ion is a prevailing one

Attitude Estimation Using Kalman Filtering: External Acceleration Compensation Considerations

Directory of Open Access Journals (Sweden)

Romy Budhi Widodo

2016-01-01

Full Text Available Attitude estimation is often inaccurate during highly dynamic motion due to the external acceleration. This paper proposes extended Kalman filter-based attitude estimation using a new algorithm to overcome the external acceleration. This algorithm is based on an external acceleration compensation model to be used as a modifying parameter in adjusting the measurement noise covariance matrix of the extended Kalman filter. The experiment was conducted to verify the estimation accuracy, that is, one-axis and multiple axes sensor movement. Five approaches were used to test the estimation of the attitude: (1 the KF-based model without compensating for external acceleration, (2 the proposed KF-based model which employs the external acceleration compensation model, (3 the two-step KF using weighted-based switching approach, (4 the KF-based model which uses the threshold-based approach, and (5 the KF-based model which uses the threshold-based approach combined with a softened part approach. The proposed algorithm showed high effectiveness during the one-axis test. When the testing conditions employed multiple axes, the estimation accuracy increased using the proposed approach and exhibited external acceleration rejection at the right timing. The proposed algorithm has fewer parameters that need to be set at the expense of the sharpness of signal edge transition.

Ensemble Kalman filtering with one-step-ahead smoothing

KAUST Repository

Raboudi, Naila F.

2018-01-11

The ensemble Kalman filter (EnKF) is widely used for sequential data assimilation. It operates as a succession of forecast and analysis steps. In realistic large-scale applications, EnKFs are implemented with small ensembles and poorly known model error statistics. This limits their representativeness of the background error covariances and, thus, their performance. This work explores the efficiency of the one-step-ahead (OSA) smoothing formulation of the Bayesian filtering problem to enhance the data assimilation performance of EnKFs. Filtering with OSA smoothing introduces an updated step with future observations, conditioning the ensemble sampling with more information. This should provide an improved background ensemble in the analysis step, which may help to mitigate the suboptimal character of EnKF-based methods. Here, the authors demonstrate the efficiency of a stochastic EnKF with OSA smoothing for state estimation. They then introduce a deterministic-like EnKF-OSA based on the singular evolutive interpolated ensemble Kalman (SEIK) filter. The authors show that the proposed SEIK-OSA outperforms both SEIK, as it efficiently exploits the data twice, and the stochastic EnKF-OSA, as it avoids observational error undersampling. They present extensive assimilation results from numerical experiments conducted with the Lorenz-96 model to demonstrate SEIK-OSA’s capabilities.

Molecular characterization and combined genotype association study of bovine cluster of differentiation 14 gene with clinical mastitis in crossbred dairy cattle.

Science.gov (United States)

Selvan, A Sakthivel; Gupta, I D; Verma, A; Chaudhari, M V; Magotra, A

2016-07-01

The present study was undertaken with the objectives to characterize and to analyze combined genotypes of cluster of differentiation 14 (CD14) gene to explore its association with clinical mastitis in Karan Fries (KF) cows maintained in the National Dairy Research Institute herd, Karnal. Genomic DNA was extracted using blood of randomly selected 94 KF lactating cattle by phenol-chloroform method. After checking its quality and quantity, polymerase chain reaction (PCR) was carried out using six sets of reported gene-specific primers to amplify complete KF CD14 gene. The forward and reverse sequences for each PCR fragments were assembled to form complete sequence for the respective region of KF CD14 gene. The multiple sequence alignments of the edited sequence with the corresponding reference with reported Bos taurus sequence (EU148610.1) were performed with ClustalW software to identify single nucleotide polymorphisms (SNPs). Basic Local Alignment Search Tool analysis was performed to compare the sequence identity of KF CD14 gene with other species. The restriction fragment length polymorphism (RFLP) analysis was carried out in all KF cows using Helicobacter pylori 188I (Hpy188I) (contig 2) and Haemophilus influenzae I (HinfI) (contig 4) restriction enzyme (RE). Cows were assigned genotypes obtained by PCR-RFLP analysis, and association study was done using Chi-square (χ (2)) test. The genotypes of both contigs (loci) number 2 and 4 were combined with respect to each animal to construct combined genotype patterns. Two types of sequences of KF were obtained: One with 2630 bp having one insertion at 616 nucleotide (nt) position and one deletion at 1117 nt position, and the another sequence was of 2629 bp having only one deletion at 615 nt position. ClustalW, multiple alignments of KF CD14 gene sequence with B. taurus cattle sequence (EU148610.1), revealed 24 nt changes (SNPs). Cows were also screened using PCR-RFLP with Hpy188I (contig 2) and HinfI (contig 4) RE

1948-IJBCS-Article-Akinwunmi K.F

African Journals Online (AJOL)

hp

bilirubin, creatinine, uric acid, urea levels in the liver and plasma of treated animals. Moreover, some activities ... brown fixed oil which is mainly linoleic acid. (46.9%), oleic acid ...... of rosmarinic acid extracts on porcine pancreatic amylase in ...

Implementation and Evaluation of Microcomputer Systems for the Republic of Turkey’s Naval Ships.

Science.gov (United States)

1986-03-01

important database design tool for both logical and physical database design, such as flowcharts or pseudocodes are used for program design. Logical...string manipulation in FORTRAN is difficult but not impossible. BASIC ( Beginners All-Purpose Symbolic Instruction Code): Basic is currently the most...63 APPENDIX B GLOSSARY/ACRONYM LIST AC Alternating Current AP Application Program BASIC Beginners All-purpose Symbolic Instruction Code CCP

AMA- and RWE- Based Adaptive Kalman Filter for Denoising Fiber Optic Gyroscope Drift Signal.

Science.gov (United States)

Yang, Gongliu; Liu, Yuanyuan; Li, Ming; Song, Shunguang

2015-10-23

An improved double-factor adaptive Kalman filter called AMA-RWE-DFAKF is proposed to denoise fiber optic gyroscope (FOG) drift signal in both static and dynamic conditions. The first factor is Kalman gain updated by random weighting estimation (RWE) of the covariance matrix of innovation sequence at any time to ensure the lowest noise level of output, but the inertia of KF response increases in dynamic condition. To decrease the inertia, the second factor is the covariance matrix of predicted state vector adjusted by RWE only when discontinuities are detected by adaptive moving average (AMA).The AMA-RWE-DFAKF is applied for denoising FOG static and dynamic signals, its performance is compared with conventional KF (CKF), RWE-based adaptive KF with gain correction (RWE-AKFG), AMA- and RWE- based dual mode adaptive KF (AMA-RWE-DMAKF). Results of Allan variance on static signal and root mean square error (RMSE) on dynamic signal show that this proposed algorithm outperforms all the considered methods in denoising FOG signal.

Fuzzy adaptive Kalman filter for indoor mobile target positioning with INS/WSN integrated method

Institute of Scientific and Technical Information of China (English)

杨海; 李威; 罗成名

2015-01-01

Pure inertial navigation system (INS) has divergent localization errors after a long time. In order to compensate the disadvantage, wireless sensor network (WSN) associated with the INS was applied to estimate the mobile target positioning. Taking traditional Kalman filter (KF) as the framework, the system equation of KF was established by the INS and the observation equation of position errors was built by the WSN. Meanwhile, the observation equation of velocity errors was established by the velocity difference between the INS and WSN, then the covariance matrix of Kalman filter measurement noise was adjusted with fuzzy inference system (FIS), and the fuzzy adaptive Kalman filter (FAKF) based on the INS/WSN was proposed. The simulation results show that the FAKF method has better accuracy and robustness than KF and EKF methods and shows good adaptive capacity with time-varying system noise. Finally, experimental results further prove that FAKF has the fast convergence error, in comparison with KF and EKF methods.

An Iterative Ensemble Kalman Filter with One-Step-Ahead Smoothing for State-Parameters Estimation of Contaminant Transport Models

KAUST Repository

Gharamti, M. E.

2015-05-11

The ensemble Kalman filter (EnKF) is a popular method for state-parameters estimation of subsurface flow and transport models based on field measurements. The common filtering procedure is to directly update the state and parameters as one single vector, which is known as the Joint-EnKF. In this study, we follow the one-step-ahead smoothing formulation of the filtering problem, to derive a new joint-based EnKF which involves a smoothing step of the state between two successive analysis steps. The new state-parameters estimation scheme is derived in a consistent Bayesian filtering framework and results in separate update steps for the state and the parameters. This new algorithm bears strong resemblance with the Dual-EnKF, but unlike the latter which first propagates the state with the model then updates it with the new observation, the proposed scheme starts by an update step, followed by a model integration step. We exploit this new formulation of the joint filtering problem and propose an efficient model-integration-free iterative procedure on the update step of the parameters only for further improved performances. Numerical experiments are conducted with a two-dimensional synthetic subsurface transport model simulating the migration of a contaminant plume in a heterogenous aquifer domain. Contaminant concentration data are assimilated to estimate both the contaminant state and the hydraulic conductivity field. Assimilation runs are performed under imperfect modeling conditions and various observational scenarios. Simulation results suggest that the proposed scheme efficiently recovers both the contaminant state and the aquifer conductivity, providing more accurate estimates than the standard Joint and Dual EnKFs in all tested scenarios. Iterating on the update step of the new scheme further enhances the proposed filter’s behavior. In term of computational cost, the new Joint-EnKF is almost equivalent to that of the Dual-EnKF, but requires twice more model

Variation analysis of bacterial polyhydroxyalkanoates production using saturated and unsaturated hydrocarbons

Directory of Open Access Journals (Sweden)

Saiqa Tufail

Full Text Available ABSTRACT Polyhydroxyalkanoates (PHA are efficient, renewable and environment friendly polymeric esters. These polymers are synthesized by a variety of microbes under stress conditions. This study was carried out to check the suitability of waste frying oil in comparison to other oils for economical bioplastic production. Six bacterial strains were isolated and identified as Bacillus cereus (KF270349, Klebsiella pneumoniae (KF270350, Bacillus subtilis (KF270351, Brevibacterium halotolerance (KF270352, Pseudomonas aeruginosa (KF270353, and Stenotrophomonas rhizoposid (KF270354 by ribotyping. All strains were PHA producers so were selected for PHA synthesis using four different carbon sources, i.e., waste frying oil, canola oil, diesel and glucose. Extraction of PHA was carried out using sodium hypochlorite method and maximum amount was detected after 72 h in all cases. P. aeruginosa led to maximum PHA production after 72 h at 37 °C and 100 rpm using waste frying oil that was 53.2% PHA in comparison with glucose 37.8% and cooking oil 34.4%. B. cereus produced 40% PHA using glucose as carbon source which was high when compared against other strains. A significantly lesser amount of PHA was recorded with diesel as a carbon source for all strains. Sharp Infrared peaks around 1740-1750 cm-1 were present in Fourier Transform Infrared spectra that correspond to exact position for PHA. The use of waste oils and production of poly-3hydroxybutyrate-co-3hydroxyvalerate (3HB-co-3HV by strains used in this study is a good aspect to consider for future prospects as this type of polymer has better properties as compared to PHBs.

Biomimetic Growth of Hydroxyapatite on Kenaf Fibers

Directory of Open Access Journals (Sweden)

Saiful Izwan Abd Razak

2016-01-01

Full Text Available Biomimetic hydroxyapatite (HA growth on mercerized kenaf fiber (KF was achieved by immersion in a simulated body fluid (SBF solution with the addition of a chelating agent. An electron micrograph revealed uniform HA layers on the KF within 14 days of immersion with significant vibrational peaks of HA components. The tensile tests showed no significant drops in the unit break of the modified fibers. This new bone-like apatite coating on KF can be useful in the field of bone tissue engineering. The key motivation for this new approach was that it utilizes the abundantly available kenaf plant resource as the biobased template.

Fusion technology programme

International Nuclear Information System (INIS)

Finken, D.

1985-05-01

In the current Fusion Technology Programme of the European Community the KfK association is working at present on 16 R and D contracts. Most of the work is strongly oriented towards the Next European Torus. Direct support to NET is given by three KfK delegates being member of the NET study group. In addition to the R and D contracts the association is working on 11 NET study contracts. Though KfK contributes to all areas defined in fusion technology, the main emphasis is put on superconducting magnet and breeding blanket development. Other important fields are tritium technology, materials research, and remote handling. (orig./GG)

Army Library Institute V: Product/Marketing/Service - Volume 2, Supplementary Data

Science.gov (United States)

1981-11-01

Rinctlons OCLC for Beginners Performance Standards Screening Panel Session 4, Thursday, 21 May 1981 Task Force Group Meetings ADP/Networking...for Library Functions W OCLC for Beginners X Career Programs and Position Classification Standards Y Screening Panel...is non-DLC a librarian will examine it, assign a call number, and do any other editing. For a flowchart , see Appendix 6, but remember that this is a

Usability Issues in the Design of Novice Programming Systems,

Science.gov (United States)

1996-08-01

lists this as a design principle for novice programming environments. In traditional compiled languages, beginners are also confused by the need to...programming task external knowledge that might interfere with correct under- standing of the language. Most beginner programming errors can be...language for text editing, but [Curtis 1988] found that a textual pseudocode and graphical flowcharts were both bet- ter than natural language in program

Hydrogen energy for beginners

CERN Document Server

2013-01-01

This book highlights the outstanding role of hydrogen in energy processes, where it is the most functional element due to its unique peculiarities that are highlighted and emphasized in the book. The first half of the book covers the great natural hydrogen processes in biology, chemistry, and physics, showing that hydrogen is a trend that can unite all natural sciences. The second half of the book is devoted to the technological hydrogen processes that are under research and development with the aim to create the infrastructure for hydrogen energetics. The book describes the main features of hydrogen that make it inalienable player in processes such as fusion, photosynthesis, and metabolism. It also covers the methods of hydrogen production and storage, highlighting at the same time the exclusive importance of nanotechnologies in those processes.

Jazz: A Beginner's Guide

Science.gov (United States)

Poliniak, Susan

2011-01-01

Introducing jazz music to elementary and middle school students can open a multitude of creative doors--provided that teachers know how and where to start. This article presents a sample of what Christine Nowmos teaches to her kindergarten-through-fourth-grade classrooms over the course of two months. During January and February each year, she has…

E10 for beginners

International Nuclear Information System (INIS)

Gebert, R.W.; Nicolai, H.

1995-01-01

In this contribution, we summarize a recent attempt to understand hyperbolic Kac Moody algebras in terms of the string vertex operator construction. As is well known, Kac Moody algebras fall into one of three classes corresponding to whether the associated Cartan matrices are positive definite, positive semi-definite and indefinite. Of these, the first two are well understood, leading to finite and affine Lie algebras (the latter being equivalent to current algebras in two space-time dimensions). Virtually nothing is known, however, about the last class of Kac Moody algebras, based on indefinite Cartan matrices. Nonetheless these have been repeatedly suggested as natural candidates for the still elusive fundamental symmetry of string theory (see e.g. [24], [28] for recent proposals in this direction). Being vastly larger than affine Kac Moody algebras, they are certainly ''sufficiently big'' for this purpose, but an even more compelling argument supporting such speculations is the intimate link that exists between Kac Moody algebras and the vertex operator construction of string theory which has been known for a long time. More specifically, it has been established that the elements making up a Kac Moody algebra of finite or affine type can be explicitly realized in terms of tachyon and photon emission vertex operators of a compactified open bosonic string [9], [14]. On the basis of these results, it has been conjectured that Kac Moody algebras of indefinite type might not only furnish new symmetries of string theory, but might themselves be understood in terms of string vertex operators associated with the higher excited (massive) states of a compactified bosonic string [14], [8]. (orig.)

Quantum physics for beginners

CERN Document Server

Ficek, Zbigniew

2016-01-01

The textbook introduces students to the main ideas of quantum physics and the basic mathematical methods and techniques used in the fields of advanced quantum physics, atomic physics, laser physics, nanotechnology, quantum chemistry, and theoretical mathematics. The textbook explains how microscopic objects (particles) behave in unusual ways, giving rise to what's called quantum effects. It contains a wide range of tutorial problems from simple confidence-builders to fairly challenging exercises that provide adequate understanding of the basic concepts of quantum physics.

C++ for beginners... masters

CERN Document Server

Asthana, Ankit

2007-01-01

About the Book: The purpose of this book is to provide an introductory text for understanding the C++ language and to empower the reader to write C++ programs. The book also introduces reader to the paradigm of object oriented programming. The main strength and USP of this book is that it is written by a student for students but will be equally useful for intermediate level programmers, and software development professionals. The author is in the best position to identify and address issues and areas where a student needs maximum help in understanding the C++ concepts and developing programmi

Nuclear power for beginners

International Nuclear Information System (INIS)

Croall, S.; Sempler, K.

1978-01-01

A 'comic strip' account of nuclear power, covering weapons and weapons proliferation, reactor accidents involving human errors, radiation hazards, radioactive waste management and the fuel cycle, fast breeder reactors and plutonium, security, public relations and sociological aspects, energy consumption patterns, energy conservation and alternative energy sources, environmental aspects and anti-nuclear activities. (U.K.)

Am Beginn des Hausbaus

DEFF Research Database (Denmark)

Kinzel, Moritz

Architectural developments during the Neolithic period show important innovations, e.g., the discovery and use of the right angle and the use of activity floors placed on top of each other. Although these developments influenced our building history and our understanding of architecture in genera...

Android NDK beginner's guide

CERN Document Server

Ratabouil, Sylvain

2015-01-01

Are you an Android Java programmer who needs more performance? Are you a C/C++ developer who doesn't want to bother with the complexity of Java and its out-of-control garbage collector? Do you want to create fast intensive multimedia applications or games? If you've answered yes to any of these questions then this book is for you. With some general knowledge of C/C++ development, you will be able to dive headfirst into native Android development.

Pulsars for the Beginner

Science.gov (United States)

DiLavore, Phillip; Wayland, James R.

1971-01-01

Presents the history of the discovery of pulsars, observations that have been made on pulsar radiation, and theories that have been presented for its presence and origin. Illustrations using pulsar's properties are presented in mechanics, electromagnetic radiation and thermodynamics. (DS)

Hamilton's principle for beginners

International Nuclear Information System (INIS)

Brun, J L

2007-01-01

I find that students have difficulty with Hamilton's principle, at least the first time they come into contact with it, and therefore it is worth designing some examples to help students grasp its complex meaning. This paper supplies the simplest example to consolidate the learning of the quoted principle: that of a free particle moving along a line. Next, students are challenged to add gravity to reinforce the argument and, finally, a two-dimensional motion in a vertical plane is considered. Furthermore these examples force us to be very clear about such an abstract principle

NS simulator for beginners

CERN Document Server

Altman, Eitan

2012-01-01

NS-2 is an open-source discrete event network simulator which is widely used by both the research community as well as by the people involved in the standardization protocols of IETF. The goal of this book is twofold: on one hand to learn how to use the NS-2 simulator, and on the other hand, to become acquainted with and to understand the operation of some of the simulated objects using NS-2 simulations. The book is intended to help students, engineers or researchers who need not have much background in programming or who want to learn through simple examples how to analyse some simulated obje

Openlayers 3 beginner's guide

CERN Document Server

Gratier, Thomas; Hazzard, Erik

2015-01-01

Whether you are a hobbyist or a professional web developer, if you wish to use maps on your website, then this book is for you. A basic understanding of JavaScript will be helpful, but is not necessary. If you've never worked with maps before, this book will introduce you to some common mapping topics and will guide you through the OpenLayers library. Experienced developers can also use this book as a reference to OpenLayers 3 components and to further enhance their knowledge.

RADWARE on the ANU VAX system

International Nuclear Information System (INIS)

Regan, P.H.

1994-10-01

This manual is meant to be a guide for beginners with RADWARE, it is not supposed to be a definitive work, but rather, a beginners aid. It consists of the information required to set up the programs in your own directory and examples of how to get started with the various programs. As with most graphics/analysis programs the only way to become familiar is regular usage. There are some useful screen dumps at the end of this manual which may be useful for the beginner to show they're where they should be. RADWARE is a γ-ray analysis package which includes the programs SLICE, GF2 (aka 'gelifit') and ESCL8R ('escalator'). Also included are a number spectrum plotting (PLOTSPEC) and decay scheme drawing programs

Molecular characterization and combined genotype association study of bovine cluster of differentiation 14 gene with clinical mastitis in crossbred dairy cattle

Directory of Open Access Journals (Sweden)

A. Sakthivel Selvan

2016-07-01

Full Text Available Aim: The present study was undertaken with the objectives to characterize and to analyze combined genotypes of cluster of differentiation 14 (CD14 gene to explore its association with clinical mastitis in Karan Fries (KF cows maintained in the National Dairy Research Institute herd, Karnal. Materials and Methods: Genomic DNA was extracted using blood of randomly selected 94 KF lactating cattle by phenolchloroform method. After checking its quality and quantity, polymerase chain reaction (PCR was carried out using six sets of reported gene-specific primers to amplify complete KF CD14 gene. The forward and reverse sequences for each PCR fragments were assembled to form complete sequence for the respective region of KF CD14 gene. The multiple sequence alignments of the edited sequence with the corresponding reference with reported Bos taurus sequence (EU148610.1 were performed with ClustalW software to identify single nucleotide polymorphisms (SNPs. Basic Local Alignment Search Tool analysis was performed to compare the sequence identity of KF CD14 gene with other species. The restriction fragment length polymorphism (RFLP analysis was carried out in all KF cows using Helicobacter pylori 188I (Hpy188I (contig 2 and Haemophilus influenzae I (HinfI (contig 4 restriction enzyme (RE. Cows were assigned genotypes obtained by PCRRFLP analysis, and association study was done using Chi-square (χ2 test. The genotypes of both contigs (loci number 2 and 4 were combined with respect to each animal to construct combined genotype patterns. Results: Two types of sequences of KF were obtained: One with 2630 bp having one insertion at 616 nucleotide (nt position and one deletion at 1117 nt position, and the another sequence was of 2629 bp having only one deletion at 615 nt position. ClustalW, multiple alignments of KF CD14 gene sequence with B. taurus cattle sequence (EU148610.1, revealed 24 nt changes (SNPs. Cows were also screened using PCR-RFLP with Hpy188I

Application of an Ensemble Kalman filter to a 1-D coupled hydrodynamic-ecosystem model of the Ligurian Sea

NARCIS (Netherlands)

Lenartz, F.; Raick, C.; Soetaert, K.E.R.; Grégoire, M.

2007-01-01

The Ensemble Kalman filter (EnKF) has been applied to a 1-D complex ecosystem model coupled with a hydrodynamic model of the Ligurian Sea. In order to improve the performance of the EnKF, an ensemble subsampling strategy has been used to better represent the covariance matrices and a pre-analysis

Influência da polaridade de pesticidas não-iônicos sobre sua sorção em um latossolo Influence of the polarity of non-ionic pesticides on their sorption by a latosoil

Directory of Open Access Journals (Sweden)

Lenin Piasarolo

2008-12-01

Full Text Available Investigou-se a influência da polaridade de pesticidas não-iônicos sobre sua sorção em material do horizonte A de um Latossolo Vermelho Acriférrico típico. Foram estudados treze pesticidas, abrangendo uma ampla faixa de polaridade, expressa na forma do coeficiente de partição do composto entre n-octanol e água (Kow. Foram obtidas as isotermas de sorção dos pesticidas, agitando-se subamostras do solo com soluções aquosas dos mesmos, sendo suas determinações quantitativas feitas por cromatografia líquida de alta eficiência. As isotermas de sorção dos pesticidas revelaram-se bem ajustadas ao modelo de Freundlich, com seus valores de coeficiente de sorção (Kf variando de 0,2 a 202 mL.nmol-1. Os valores de log Kf e de log Kow dos pesticidas mostraram-se linearmente correlacionados (R² = 0,87, indicando que a partição hidrofóbica na matéria orgânica foi o principal mecanismo de sorção dos compostos no solo. Para a maioria dos pesticidas, os valores de Kf obtidos foram maiores do que aqueles previstos pela equação de Briggs (1981, a qual relaciona o valor de Kf do pesticida com o seu valor de Kow e o teor de matéria orgânica do solo. Assim, os resultados mostraram que a referida equação, obtida em solos da Inglaterra, não é adequada para a previsão do valor de Kf de pesticidas no solo estudado, e que a natureza da matéria orgânica pode ser um importante fator a influenciar a sorção de pesticidas não-iônicos em solos.The sorption of thirteen non-ionic pesticides, with varying n-octanol/water partition coefficients (Kow, by soil material taken from the A horizon of an Acriferric Red Latosol was investigated. Sorption isotherms of the pesticides were determined by the shake flask method. The concentrations of the chemicals in aqueous solutions were measured by HPLC with UV detector. Sorption isotherms of all compounds fitted well the Freundlich model, with sorption coefficient (Kf values ranging from 0,2 to 202

Deletion of PDZD7 disrupts the Usher syndrome type 2 protein complex in cochlear hair cells and causes hearing loss in mice.

Science.gov (United States)

Zou, Junhuang; Zheng, Tihua; Ren, Chongyu; Askew, Charles; Liu, Xiao-Ping; Pan, Bifeng; Holt, Jeffrey R; Wang, Yong; Yang, Jun

2014-05-01

Usher syndrome type 2 (USH2) is the predominant form of USH, a leading genetic cause of combined deafness and blindness. PDZD7, a paralog of two USH causative genes, USH1C and USH2D (WHRN), was recently reported to be implicated in USH2 and non-syndromic deafness. It encodes a protein with multiple PDZ domains. To understand the biological function of PDZD7 and the pathogenic mechanism caused by PDZD7 mutations, we generated and thoroughly characterized a Pdzd7 knockout mouse model. The Pdzd7 knockout mice exhibit congenital profound deafness, as assessed by auditory brainstem response, distortion product otoacoustic emission and cochlear microphonics tests, and normal vestibular function, as assessed by their behaviors. Lack of PDZD7 leads to the disorganization of stereocilia bundles and a reduction in mechanotransduction currents and sensitivity in cochlear outer hair cells. At the molecular level, PDZD7 determines the localization of the USH2 protein complex, composed of USH2A, GPR98 and WHRN, to ankle links in developing cochlear hair cells, likely through its direct interactions with these three proteins. The localization of PDZD7 to the ankle links of cochlear hair bundles also relies on USH2 proteins. In photoreceptors of Pdzd7 knockout mice, the three USH2 proteins largely remain unchanged at the periciliary membrane complex. The electroretinogram responses of both rod and cone photoreceptors are normal in knockout mice at 1 month of age. Therefore, although the organization of the USH2 complex appears different in photoreceptors, it is clear that PDZD7 plays an essential role in organizing the USH2 complex at ankle links in developing cochlear hair cells. GenBank accession numbers: KF041446, KF041447, KF041448, KF041449, KF041450, KF041451.

Human Engineering Guidelines for Management Information Systems. Change 1,

Science.gov (United States)

1983-06-09

beginner . chapter offers guidelines concerning training. 0 A brief review available for the infrequent user. Major training factors * A program for a...the training include a program specifically designed L Li LL for the beginner or naive user? 8. Is there a brief review for the intermittent user? Ei Li...250 pages of text. Flowchart - A graphic representation, using standard symbols, which portrays logical data and process- ing requirements. Formatting

SamePage: Development of a Team Training Tool to Promote Shared Understanding

Science.gov (United States)

2007-07-01

1. Each stage of learning—from novice to advanced beginner to competent to proficient to expert—can be characterized by further acquisition of...Stage 2 Stage 3 Stage 4 Stage 5 Novice Advanced Beginner Competent Proficient Expert Engages in conscious deliberate planning Sees situation...entire scenario events in an overview story form; (2) an overview flowchart that shows the major frame events and actions required from each team member

Survey and Recommendations for the Use of Microcomputers in the Naval Audit Service.

Science.gov (United States)

1987-03-01

be completely menu driven for the beginner . The advanced user can work with command language using a callable help menu displayed by a few keystrokes...preventing beginners from becoming frustrated with a program command structure that they do not understand and cannot use correctly: and, conversely, the...hand" drawing, make flowcharts and develop complex charts using combinations of graph types superimposed onto one presentation. And others produce

Novel Kalman filter algorithm for statistical monitoring of extensive landscapes with synoptic sensor data

Science.gov (United States)

Raymond L. Czaplewski

2015-01-01

Wall-to-wall remotely sensed data are increasingly available to monitor landscape dynamics over large geographic areas. However, statistical monitoring programs that use post-stratification cannot fully utilize those sensor data. The Kalman filter (KF) is an alternative statistical estimator. I develop a new KF algorithm that is numerically robust with large numbers of...

Fault Detection and Isolation for a Supermarket Refrigeration System - Part One

DEFF Research Database (Denmark)

Yang, Zhenyu; Rasmussen, Karsten B.; Kieu, Anh T.

2011-01-01

Fault Detection and Isolation (FDI) using the Kalman Filter (KF) technique for a supermarket refrigeration system is explored. Four types of sensor fault scenarios, namely drift, offset, freeze and hard-over, are considered for two temperature sensors, and one type of parametric fault scenario, n....... The test results show that the EKF-based FDI method generally performances better and faster than the KF-based method does. However, both methods can not handle the isolation between sensor faults and parametric fault.......Fault Detection and Isolation (FDI) using the Kalman Filter (KF) technique for a supermarket refrigeration system is explored. Four types of sensor fault scenarios, namely drift, offset, freeze and hard-over, are considered for two temperature sensors, and one type of parametric fault scenario...... isolation purpose, a bank of KFs arranged by splitting measurements is constructed for sensor fault isolation, while the Multi-Model Adaptive Estimation (MMAE) method is employed to handle parametric fault isolation. All these approaches are extended and checked by using Extended KF technique afterwards...

Safety and risk assessments for the SNR 300

International Nuclear Information System (INIS)

Maschek, W.; Froehlich, R.; Jacobs, H.; Schikorr, M.; Heusener, G.; Caldarola, L.; Royl, P.; Struwe, D.

1983-01-01

Under the official inquiry ''Future Nuclear Energy Policies'', KfK have carried out a number of studies concerning the hazards arising from core-destructive accidents at the SNR-300 reactor. Among these, there was the so-called ''Upper Limit Study'' providing a critical evaluation of literature on all research done on core-destructive accidents (Bethe-Tait excursion) with a high mechanic energy release potential; the other one was the so-called ''SAI Study'' (a cooperation of KfK, Science Applications, Inc. (SAI) and Interatom (IA)) which investigated the hazards of an uncontrolled coolant flow rate disturbance occurring in the SNR-300 reactor. KfK also took part in the analysis of hazards comparing the SNR-300 reactor with an LWR-type reactor like the one at Biblis B, ordered by the Federal Ministry of Research and Technology (BMFT). These studies have already been dealt with KfK-Nachrichten, 14th annual set issue 4/1982. The article on hand summarizes and evaluates once more the most important results. (orig./RW) [de

Determination of the formation constant for the inclusion complex between Lanthanide ions and Dansyl chloride derivative by fluorescence spectroscopy: Theoretical and experimental investigation

Science.gov (United States)

Riahi, Siavash; Ganjali, Mohammad Reza; Hariri, Maryam; Abdolahzadeh, Shaghayegh; Norouzi, Parviz

2009-09-01

In this paper, a sensitive, easy, efficient, and suitable method for the calculation of Kf values of complexation between one derivative of Dansyl chloride [5-(dimethylamino) naphthalene-1-sulfonyl 4-phenylsemicarbazide] (DMNP) and Lanthanide(III) (Ln) ions is proposed, using both spectrofluorometric and spectrophotometric methods. Determination of Kf showed that DMNP was mostly selective towards the erbium (III) ion. The validity of the method was also confirmed calculating the Stern-Volmer fluorescence quenching constants ( Ksv) that resulted in the same consequence, obtained by calculating the Kf of complexation values. In addition, the UV-vis spectroscopy was applied for the determination of Kf only for the Ln ions that had interactions with DMNP. Finally, the DFT studies were done on Er 3+ and the DMNP complex for distinguishing the active sites and estimating the pair wise interaction energy. It can be concluded that this derivative of Dansyl chloride with inherent high fluorescence intensity is a suitable reagent for the selective determination of the Er 3+ ion which can be used in constructing selective Er 3+ sensors.

The application of particle filters in single trial event-related potential estimation

International Nuclear Information System (INIS)

Mohseni, Hamid R; Nazarpour, Kianoush; Sanei, Saeid; Wilding, Edward L

2009-01-01

In this paper, an approach for the estimation of single trial event-related potentials (ST-ERPs) using particle filters (PFs) is presented. The method is based on recursive Bayesian mean square estimation of ERP wavelet coefficients using their previous estimates as prior information. To enable a performance evaluation of the approach in the Gaussian and non-Gaussian distributed noise conditions, we added Gaussian white noise (GWN) and real electroencephalogram (EEG) signals recorded during rest to the simulated ERPs. The results were compared to that of the Kalman filtering (KF) approach demonstrating the robustness of the PF over the KF to the added GWN noise. The proposed method also outperforms the KF when the assumption about the Gaussianity of the noise is violated. We also applied this technique to real EEG potentials recorded in an odd-ball paradigm and investigated the correlation between the amplitude and the latency of the estimated ERP components. Unlike the KF method, for the PF there was a statistically significant negative correlation between amplitude and latency of the estimated ERPs, matching previous neurophysiological findings

Kung fu training improves physical fitness measures in overweight/obese adolescents: the "martial fitness" study.

Science.gov (United States)

Tsang, Tracey W; Kohn, Michael R; Chow, Chin Moi; Fiatarone Singh, Maria Antoinette

2010-01-01

Aim. To examine the efficacy of a six-month Kung Fu (KF) program on physical fitness in overweight/obese adolescents. Methods. Subjects were randomly assigned to the KF or sham exercise (Tai Chi, TC) control group. Physical measurements in cardiovascular fitness and muscle fitness occurred at baseline and after 6 months of training thrice weekly. Results. Twenty subjects were recruited. One subject was lost to follow-up, although overall compliance to the training sessions was 46.7 +/- 27.8%. At follow-up, the cohort improved in absolute upper (P = .002) and lower (P = .04) body strength, and upper body muscle endurance (P = .02), without group differences. KF training resulted in significantly greater improvements in submaximal cardiovascular fitness (P = .03), lower body muscle endurance (P = .28; significant 95% CI: 0.37-2.49), and upper body muscle velocity (P = .03) relative to TC training. Conclusions. This short-term KF program improved submaximal cardiovascular fitness, lower body muscle endurance, and muscle velocity, in overweight/obese adolescents with very low baseline fitness.

Kung Fu Training Improves Physical Fitness Measures in Overweight/Obese Adolescents: The “Martial Fitness” Study

Directory of Open Access Journals (Sweden)

Tracey W. Tsang

2010-01-01

Full Text Available Aim. To examine the efficacy of a six-month Kung Fu (KF program on physical fitness in overweight/obese adolescents. Methods. Subjects were randomly assigned to the KF or sham exercise (Tai Chi, TC control group. Physical measurements in cardiovascular fitness and muscle fitness occurred at baseline and after 6 months of training thrice weekly. Results. Twenty subjects were recruited. One subject was lost to follow-up, although overall compliance to the training sessions was 46.7±27.8%. At follow-up, the cohort improved in absolute upper (P=.002 and lower (P=.04 body strength, and upper body muscle endurance (P=.02, without group differences. KF training resulted in significantly greater improvements in submaximal cardiovascular fitness (P=.03, lower body muscle endurance (P=.28; significant 95% CI: 0.37–2.49, and upper body muscle velocity (P=.03 relative to TC training. Conclusions. This short-term KF program improved submaximal cardiovascular fitness, lower body muscle endurance, and muscle velocity, in overweight/obese adolescents with very low baseline fitness.

Ketamine analgesia for inflammatory pain in neonatal rats: a factorial randomized trial examining long-term effects

Directory of Open Access Journals (Sweden)

Bhutta Adnan T

2008-08-01

Full Text Available Abstract Background Neonatal rats exposed to repetitive inflammatory pain have altered behaviors in young adulthood, partly ameliorated by Ketamine analgesia. We examined the relationships between protein expression, neuronal survival and plasticity in the neonatal rat brain, and correlated these changes with adult cognitive behavior. Methods Using Western immunoblot techniques, homogenates of cortical tissue were analyzed from neonatal rats 18–20 hours following repeated exposure to 4% formalin injections (F, N = 9, Ketamine (K, 2.5 mg/kg × 2, N = 9, Ketamine prior to formalin (KF, N = 9, or undisturbed controls (C, N = 9. Brain tissues from another cohort of rat pups (F = 11, K = 12, KF = 10, C = 15 were used for cellular staining with Fos immunohistochemistry or FluoroJade-B (FJB, followed by cell counting in eleven cortical and three hippocampal areas. Long-term cognitive testing using a delayed non-match to sample (DNMS paradigm in the 8-arm radial maze was performed in adult rats receiving the same treatments (F = 20, K = 24, KF = 21, C = 27 in the neonatal period. Results Greater cell death occurred in F vs. C, K, KF in parietal and retrosplenial areas, vs. K, KF in piriform, temporal, and occipital areas, vs. C, K in frontal and hindlimb areas. In retrosplenial cortex, less Fos expression occurred in F vs. C, KF. Cell death correlated inversely with Fos expression in piriform, retrosplenial, and occipital areas, but only in F. Cortical expression of glial fibrillary acidic protein (GFAP was elevated in F, K and KF vs. C. No significant differences occurred in Caspase-3, Bax, and Bcl-2 expression between groups, but cellular changes in cortical areas were significantly correlated with protein expression patterns. Cluster analysis of the frequencies and durations of behaviors grouped them as exploratory, learning, preparatory, consumptive, and foraging behaviors. Neonatal inflammatory pain exposure reduced exploratory behaviors in adult

Ensemble Kalman filter for the reconstruction of the Earth's mantle circulation

Science.gov (United States)

Bocher, Marie; Fournier, Alexandre; Coltice, Nicolas

2018-02-01

Recent advances in mantle convection modeling led to the release of a new generation of convection codes, able to self-consistently generate plate-like tectonics at their surface. Those models physically link mantle dynamics to surface tectonics. Combined with plate tectonic reconstructions, they have the potential to produce a new generation of mantle circulation models that use data assimilation methods and where uncertainties in plate tectonic reconstructions are taken into account. We provided a proof of this concept by applying a suboptimal Kalman filter to the reconstruction of mantle circulation (Bocher et al., 2016). Here, we propose to go one step further and apply the ensemble Kalman filter (EnKF) to this problem. The EnKF is a sequential Monte Carlo method particularly adapted to solve high-dimensional data assimilation problems with nonlinear dynamics. We tested the EnKF using synthetic observations consisting of surface velocity and heat flow measurements on a 2-D-spherical annulus model and compared it with the method developed previously. The EnKF performs on average better and is more stable than the former method. Less than 300 ensemble members are sufficient to reconstruct an evolution. We use covariance adaptive inflation and localization to correct for sampling errors. We show that the EnKF results are robust over a wide range of covariance localization parameters. The reconstruction is associated with an estimation of the error, and provides valuable information on where the reconstruction is to be trusted or not.

Examining dynamic interactions among experimental factors influencing hydrologic data assimilation with the ensemble Kalman filter

Science.gov (United States)

Wang, S.; Huang, G. H.; Baetz, B. W.; Cai, X. M.; Ancell, B. C.; Fan, Y. R.

2017-11-01

The ensemble Kalman filter (EnKF) is recognized as a powerful data assimilation technique that generates an ensemble of model variables through stochastic perturbations of forcing data and observations. However, relatively little guidance exists with regard to the proper specification of the magnitude of the perturbation and the ensemble size, posing a significant challenge in optimally implementing the EnKF. This paper presents a robust data assimilation system (RDAS), in which a multi-factorial design of the EnKF experiments is first proposed for hydrologic ensemble predictions. A multi-way analysis of variance is then used to examine potential interactions among factors affecting the EnKF experiments, achieving optimality of the RDAS with maximized performance of hydrologic predictions. The RDAS is applied to the Xiangxi River watershed which is the most representative watershed in China's Three Gorges Reservoir region to demonstrate its validity and applicability. Results reveal that the pairwise interaction between perturbed precipitation and streamflow observations has the most significant impact on the performance of the EnKF system, and their interactions vary dynamically across different settings of the ensemble size and the evapotranspiration perturbation. In addition, the interactions among experimental factors vary greatly in magnitude and direction depending on different statistical metrics for model evaluation including the Nash-Sutcliffe efficiency and the Box-Cox transformed root-mean-square error. It is thus necessary to test various evaluation metrics in order to enhance the robustness of hydrologic prediction systems.

The effect of mitomycin-c in keloid fibroblast cultures

Directory of Open Access Journals (Sweden)

Ishandono Dachlan

2016-12-01

Full Text Available ABSTRACT Keloid occurs due to hyperactivity of keloid fibroblast (KF in proliferation, migration, collagen deposition, together with low rates of collagen degradation. These are under the responsibility of TGF-b. Mitomycin C (MC is used for treating keloid by a topical application during surgery at the level of 0.02% to 0.08%. Unfortunately, the lowest effective level of MC for keloid has not been determined yet. We aimed to determine the lowest effective level of MC in the suppression of KF activities. Various levels of MC diluted in growth medium were administered on KF that were isolated from six patients. After 24 hours and 72 hours of incubation, cellular proliferation, collagen deposition, cellular migration and level of TGF-b, were analyzed. Application of 120 uM MC on KF culture for 24 hours could significantly reduce TGF-b production from 1265.74 ± 274.81 pg/mL to 265.17 ± 12.20 pg/mL; proliferation index from 100% to 84.01 ± 12.91%; inhibit cellular migration to 64.38 ± 3.66%; but reduce collagen depositions from 100% to only 91.13 ± 10.19%. The lowest MC level is on 30 uM or equal with 0.001%. In conclusion, the lowest level of MC can suppress the activities of KF is 0.001%. Moreover, due to low activity in inhibiting collagen deposition, MC would be better as an adjuvant drug for keloid surgery.

An Adaptive Approach to Mitigate Background Covariance Limitations in the Ensemble Kalman Filter

KAUST Repository

Song, Hajoon

2010-07-01

A new approach is proposed to address the background covariance limitations arising from undersampled ensembles and unaccounted model errors in the ensemble Kalman filter (EnKF). The method enhances the representativeness of the EnKF ensemble by augmenting it with new members chosen adaptively to add missing information that prevents the EnKF from fully fitting the data to the ensemble. The vectors to be added are obtained by back projecting the residuals of the observation misfits from the EnKF analysis step onto the state space. The back projection is done using an optimal interpolation (OI) scheme based on an estimated covariance of the subspace missing from the ensemble. In the experiments reported here, the OI uses a preselected stationary background covariance matrix, as in the hybrid EnKF–three-dimensional variational data assimilation (3DVAR) approach, but the resulting correction is included as a new ensemble member instead of being added to all existing ensemble members. The adaptive approach is tested with the Lorenz-96 model. The hybrid EnKF–3DVAR is used as a benchmark to evaluate the performance of the adaptive approach. Assimilation experiments suggest that the new adaptive scheme significantly improves the EnKF behavior when it suffers from small size ensembles and neglected model errors. It was further found to be competitive with the hybrid EnKF–3DVAR approach, depending on ensemble size and data coverage.

Determination of the analytical performance of a headspace capillary gas chromatographic technique and karl Fischer coulometric titration by system calibration using oil samples containing known amounts of moisture.

Science.gov (United States)

Jalbert, J; Gilbert, R; Tétreault, P

1999-08-01

Over the past few years, concerns have been raised in the literature about the accuracy of the Karl Fischer (KF) method for assessing moisture in transformer mineral oils. To better understand this issue, the performance of a static headspace capillary gas chromatographic (HS-CGC) technique was compared to that of KF coulometric titration by analyzing moisture in samples containing known amounts of water and various samples obtained from the National Institute of Standards and Technology (NIST). Two modes of adding samples into the KF vessel were used:  direct injection and indirect injection via an azeotropic distillation of the moisture with toluene. Under the conditions used for direct injection, the oil matrix was totally dissolved in the anolyte, which allowed the moisture to be titrated in a single-phase solution rather than in a suspension. The results have shown that when HS-CGC and combined azeotropic distillation/KF titration are calibrated with moisture-in-oil standards, a linear relation is observed over 0-60 ppm H(2)O with a correlation coefficient better than 0.9994 (95% confidence), with the regression line crossing through zero. A similar relation can also be observed when calibration is achieved by direct KF addition of standards prepared with octanol-1, but in this case an intercept of 4-5 ppm is noted. The amount of moisture determined by curve interpolation in NIST reference materials by the three calibrated systems ranges from 13.0 to 14.8 ppm for RM 8506 and 42.5 to 46.4 ppm for RM 8507, and in any case, the results were as high as those reported in the literature with volumetric KF titration. However, titration of various dehydrated oil and solvent samples showed that direct KF titration is affected by a small bias when samples contain very little moisture. The source of error after correction for the large sample volume used for the determination (8 mL) is about 6 ppm for Voltesso naphthenic oil and 4 ppm for toluene, revealing a matrix

Proceedings of the Annual National Conference on Ada (Trademark) Technology (7th) Held in Washington, D.C. on March 13-16, 1989

Science.gov (United States)

1989-03-16

encouraged by the method. to review a tested design rather than mere paper design. DCDS The method requires the use of control-flow diagrams, flowcharts ...offered. The form of tie file is: & GET_SPARE are proccdui..s and TAKEOFFTIRE & PUTONSPARE are tasks. OPERATORS The tutorial allows the beginner to proceed...learning it on many levels. The beginners learned Program structure Ada concepts and structure without (in some casesO Discrete types (wit necessary i/O

Mudanças do esquema de convecção profunda Kain-Fritsch para a região do centro de lançamento de Alcântara Changes in the Kain-Fritsch convective parameterization deep scheme for the Alcântara launch center region

Directory of Open Access Journals (Sweden)

Antonio Vicente Pereira Neto

2011-12-01

Full Text Available Foram realizadas mudanças no esquema de parametrização convectiva de Kain-Fritsch (KF2, para melhor representar a precipitação na região do Centro de Lançamento de Alcântara (CLA em simulações com o modelo regional MM5. Simulações de 24 h em um domínio aproximadamente centrado no CLA, com espaçamento de grade de 30 km foram realizadas para o período de 2005-2006 (calibração e 2008 (validação. O KF2 foi modificado sob a seguinte configuração: passo de tempo de 60 s, uso do esquema de convecção explícita warm rain e uso conjunto dos esquemas de convecção rasa de Grell e do KF2. As mudanças no KF2 foram: aumento da profundidade de nuvem necessária para disparar a convecção profunda e ajuste de alguns parâmetros da função disparo da convecção dependentes da velocidade vertical ascendente na coluna atmosférica. Com as modificações, houve expressiva melhoria na representação do total de precipitação e da fração dos dias do mês com chuva na escala mensal. O padrão espacial de erros no domínio, no entanto, não sofreu muitas alterações sobre o continente (em geral, a precipitação foi melhor representada sobre o continente do que sobre o oceano. Todas as etapas de mudanças e ajustes realizadas no trabalho poderão ser empregadas para melhorar a representação da precipitação em outras regiões específicas.Changes in the Kain-Fritsch convective parameterization scheme (KF2 were included to better represent the precipitation in simulations using the MM5 regional model for the Alcântara Launch Center (CLA region. Daily (24 h integrations for a 30 km grid spacing domain centered in CLA were performed for 2005-2006 (calibration and 2008 (validation. KF2 scheme was modified under the following simulation settings: time step of 60 s, use of warm rain scheme and joint use of Grell and KF2 shallow convection schemes. Changes in KF2 were: increase of minimum cloud depth to initiate deep convection and

Single nucleotide polymorphism in Egyptian cattle insulin-like growth factor binding protein-3 gene

Directory of Open Access Journals (Sweden)

Othman E. Othman

2014-12-01

It is concluded that the IGFBP-3/HaeIII polymorphism may be utilized as a good marker for genetic differentiation between cattle animals for different body functions such as growth, metabolism, reproduction, immunity and energy balance. The nucleotide sequences of Egyptian cattle IGFBP-3 A and C alleles were submitted to GenBank with the accession numbers KF899893 and KF899894, respectively.

Development of a variable structure-based fault detection and diagnosis strategy applied to an electromechanical system

Science.gov (United States)

Gadsden, S. Andrew; Kirubarajan, T.

2017-05-01

Signal processing techniques are prevalent in a wide range of fields: control, target tracking, telecommunications, robotics, fault detection and diagnosis, and even stock market analysis, to name a few. Although first introduced in the 1950s, the most popular method used for signal processing and state estimation remains the Kalman filter (KF). The KF offers an optimal solution to the estimation problem under strict assumptions. Since this time, a number of other estimation strategies and filters were introduced to overcome robustness issues, such as the smooth variable structure filter (SVSF). In this paper, properties of the SVSF are explored in an effort to detect and diagnosis faults in an electromechanical system. The results are compared with the KF method, and future work is discussed.

Observation Quality Control with a Robust Ensemble Kalman Filter

KAUST Repository

Roh, Soojin

2013-12-01

Current ensemble-based Kalman filter (EnKF) algorithms are not robust to gross observation errors caused by technical or human errors during the data collection process. In this paper, the authors consider two types of gross observational errors, additive statistical outliers and innovation outliers, and introduce a method to make EnKF robust to gross observation errors. Using both a one-dimensional linear system of dynamics and a 40-variable Lorenz model, the performance of the proposed robust ensemble Kalman filter (REnKF) was tested and it was found that the new approach greatly improves the performance of the filter in the presence of gross observation errors and leads to only a modest loss of accuracy with clean, outlier-free, observations.

The meterological information system of the Karlsruhe Nuclear Research Center

International Nuclear Information System (INIS)

Holleuffer-Kypke, R. von; Huebschmann, W.G.; Thomas, P.; Suess, F.

1984-01-01

The Meteorological Information System (MIS) comprising the meteorological instruments, the computers, and the software for data processing and recording, is part of the KfK safety and control system. In 1982 is was equipped with an independent data processing system. The report explains the arrangement and the operation of the sensors and thw two process computers. For selected meteorological situations the ability of the system is demonstrated, i.e., the presentation of the vertical profiles of wind, temperature and turbulence in the lower atmospheric boundary layer as well as the calculation and graphical representation of the transport and dispersion into the KfK environment of radioactive pollutants being released by the nuclear installations of the KfK into the atmosphere. (orig.) [de

Observation Quality Control with a Robust Ensemble Kalman Filter

KAUST Repository

Roh, Soojin; Genton, Marc G.; Jun, Mikyoung; Szunyogh, Istvan; Hoteit, Ibrahim

2013-01-01

Current ensemble-based Kalman filter (EnKF) algorithms are not robust to gross observation errors caused by technical or human errors during the data collection process. In this paper, the authors consider two types of gross observational errors, additive statistical outliers and innovation outliers, and introduce a method to make EnKF robust to gross observation errors. Using both a one-dimensional linear system of dynamics and a 40-variable Lorenz model, the performance of the proposed robust ensemble Kalman filter (REnKF) was tested and it was found that the new approach greatly improves the performance of the filter in the presence of gross observation errors and leads to only a modest loss of accuracy with clean, outlier-free, observations.

Education in the Information Age, Conference Proceedings April 17-19, 1999,

Science.gov (United States)

1997-08-13

more about being a beginner. Also, our culture is hard on beginners, claiming they’re wet behind the ears, new kids on the block, and rookies... telecommuting from anywhere to anywhere. Coupled with extensive desktop computing power, collaborative planning and telepresence will be the norm. This, EC/EDI...and by extension, worth paying more for? The truth is that technical performance is only one part of what’s needed to describe how we living

Learning SAS’s Perl Regular Expression Matching the Easy Way: By Doing

Science.gov (United States)

2015-01-12

Doing 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) Paul Genovesi 5d. PROJECT NUMBER 5e. TASK NUMBER 5f...regex_learning_tool allows both beginner and expert to efficiently practice PRX matching by selecting and processing only the match records that the user is interested...perl regular expression and/or source string. The regex_learning_tool allows both beginner and expert to efficiently practice PRX matching by

Analysis of Dynamic Performance of a Kalman Filter for Combining Multiple MEMS Gyroscopes

Directory of Open Access Journals (Sweden)

Liang Xue

2014-11-01

Full Text Available In this paper, the dynamic performance of a Kalman filter (KF was analyzed, which is used to combine multiple measurements of a gyroscopes array to reduce the noise and improve the accuracy of the individual sensors. A principle for accuracy improvement by the KF was briefly presented to obtain an optimal estimate of input rate signal. In particular, the influences of some crucial factors on the KF dynamic performance were analyzed by simulations such as the factors input signal frequency, signal sampling, and KF filtering rate. Finally, a system that was comprised of a six-gyroscope array was designed and implemented to test the dynamic performance. Experimental results indicated that the 1σ error for the combined rate signal was reduced to about 0.2°/s in the constant rate test, which was a reduction by a factor of more than eight compared to the single gyroscope. The 1σ error was also reduced from 1.6°/s to 0.48°/s in the swing test. It showed that the estimated angular rate signal could well reflect the dynamic characteristic of the input signal in dynamic conditions.

Joint development effort Thermonuclear Fusion. Programme budgeting 1984

International Nuclear Information System (INIS)

1985-01-01

The joint KfK and IPP project for the development of thermonuclear fusion device is established as the centerpiece of Federal German efforts in this field. It is meant to enhance the German contribution to the European programme and thus foster the chances of a joint European large-scale experiment to be started in the Federal Republic of Germany. IPP's tasks in the project are to study the physical principles and aspects, whereas KfK is responsible for the technological aspects. Work at IPP is focused on divertor experiments with the ASDEX series in order to go deeper into the problems that could not be solved by the JET experiments, namely those of the plasma boundary and control of impurities. Stellarator experiments are made in order to study the potentials of this toroidal confinement concept for steady-state operation. The IPP which always has been working in the plasma physics field devotes all activities to the joint effort. KfK has established a special project group for this purpose, PKF. The budgeting programme presented therefore covers the IPP entire working schedule, and that of PKF of the KfK. (orig./GG) [de

Ensemble Kalman Filtering with Residual Nudging: An Extension to State Estimation Problems with Nonlinear Observation Operators

KAUST Repository

Luo, Xiaodong

2014-10-01

The ensemble Kalman filter (EnKF) is an efficient algorithm for many data assimilation problems. In certain circumstances, however, divergence of the EnKF might be spotted. In previous studies, the authors proposed an observation-space-based strategy, called residual nudging, to improve the stability of the EnKF when dealing with linear observation operators. The main idea behind residual nudging is to monitor and, if necessary, adjust the distances (misfits) between the real observations and the simulated ones of the state estimates, in the hope that by doing so one may be able to obtain better estimation accuracy. In the present study, residual nudging is extended and modified in order to handle nonlinear observation operators. Such extension and modification result in an iterative filtering framework that, under suitable conditions, is able to achieve the objective of residual nudging for data assimilation problems with nonlinear observation operators. The 40-dimensional Lorenz-96 model is used to illustrate the performance of the iterative filter. Numerical results show that, while a normal EnKF may diverge with nonlinear observation operators, the proposed iterative filter remains stable and leads to reasonable estimation accuracy under various experimental settings.

Kinetic mechanism of DNA polymerase I (Klenow)

International Nuclear Information System (INIS)

Kuchta, R.D.; Mizrahi, V.; Benkovic, P.A.; Johnson, K.A.; Benkovic, S.J.

1987-01-01

The minimal kinetic scheme for DNA polymerization catalyzed by the Klenow fragment of DNA polymerase I (KF) from Escherichia coli has been determined with short DNA oligomers of defined sequence, labeled with [ 32 P]-nucleotides. A key feature of this scheme is a minimal two-step sequence that interconverts the ternary KF-DNA/sub n/-dNTP and KF-DNA/sub n+1/-PP/sub i/ complexes. The rate is not limited by the actual polymerization but by a separate step, possibly important in ensuring fidelity. Evidence for this sequence is supplied by the observation of biphasic kinetics in single-turnover pyrophosphorolysis experiments (the microscopic reverse of polymerization). Data analysis then provides an estimate of the internal equilibrium constant. The dissociations of DNA, dNTP, and PP/sub i/ from the various binary and ternary complexes were measured by partitioning (isotope-trapping) experiments. The rate constant for DNA dissociation from KF is sequence dependent and is rate limiting during nonprocessive DNA synthesis. The combination of single-turnover (both directions) and isotope-trapping experiments provides sufficient information to permit a quantitative evaluation of the kinetic scheme for specific DNA sequences

Electromiographic and kinematic characteristics of Kung Fu Yau-Man palm strike.

Science.gov (United States)

Neto, O P; Magini, Marcio

2008-12-01

A kinematic and electromyographic analysis of Kung Fu (KF) Yau-Man palm strikes without impact is presented. An empirical model applied to data obtained by a high-speed camera describes the kinematic characteristics of the movement. The electromyographic patterns of the biceps brachii, brachioradialis and triceps brachii muscles were studied during the strike in the time (root mean square) and frequency (wavelet transform) domains. Eight KF practitioners participated in the investigation. A wooden board was placed in front of the subjects, and they were asked to perform the strike imagining a target above the board. The results show that the Yau-Man KF palm strike has very similar kinematic characteristics to a simple moderate speed elbow extension movement. All practitioners positioned themselves in relation to the wooden board in a way to achieve their highest hand speeds in the instant their hands crossed the board. The analyses of the electromyography data shows a well developed muscle coordination of the practitioners in agreement with kinematic results. The results of this paper are important not only for improving the performance of practitioners but also to demonstrate the applicability of KF in the process of motor control development.

Noise Reduction of MEMS Gyroscope Based on Direct Modeling for an Angular Rate Signal

Directory of Open Access Journals (Sweden)

Liang Xue

2015-02-01

Full Text Available In this paper, a novel approach for processing the outputs signal of the microelectromechanical systems (MEMS gyroscopes was presented to reduce the bias drift and noise. The principle for the noise reduction was presented, and an optimal Kalman filter (KF was designed by a steady-state filter gain obtained from the analysis of KF observability. In particular, the true angular rate signal was directly modeled to obtain an optimal estimate and make a self-compensation for the gyroscope without needing other sensor’s information, whether in static or dynamic condition. A linear fit equation that describes the relationship between the KF bandwidth and modeling parameter of true angular rate was derived from the analysis of KF frequency response. The test results indicated that the MEMS gyroscope having an ARW noise of 4.87°/h0.5 and a bias instability of 44.41°/h were reduced to 0.4°/h0.5 and 4.13°/h by the KF under a given bandwidth (10 Hz, respectively. The 1σ estimated error was reduced from 1.9°/s to 0.14°/s and 1.7°/s to 0.5°/s in the constant rate test and swing rate test, respectively. It also showed that the filtered angular rate signal could well reflect the dynamic characteristic of the input rate signal in dynamic conditions. The presented algorithm is proved to be effective at improving the measurement precision of the MEMS gyroscope.

Low-Rank Kalman Filtering in Subsurface Contaminant Transport Models

KAUST Repository

El Gharamti, Mohamad

2010-01-01

Understanding the geology and the hydrology of the subsurface is important to model the fluid flow and the behavior of the contaminant. It is essential to have an accurate knowledge of the movement of the contaminants in the porous media in order to track them and later extract them from the aquifer. A two-dimensional flow model is studied and then applied on a linear contaminant transport model in the same porous medium. Because of possible different sources of uncertainties, the deterministic model by itself cannot give exact estimations for the future contaminant state. Incorporating observations in the model can guide it to the true state. This is usually done using the Kalman filter (KF) when the system is linear and the extended Kalman filter (EKF) when the system is nonlinear. To overcome the high computational cost required by the KF, we use the singular evolutive Kalman filter (SEKF) and the singular evolutive extended Kalman filter (SEEKF) approximations of the KF operating with low-rank covariance matrices. The SEKF can be implemented on large dimensional contaminant problems while the usage of the KF is not possible. Experimental results show that with perfect and imperfect models, the low rank filters can provide as much accurate estimates as the full KF but at much less computational cost. Localization can help the filter analysis as long as there are enough neighborhood data to the point being analyzed. Estimating the permeabilities of the aquifer is successfully tackled using both the EKF and the SEEKF.

Low-Rank Kalman Filtering in Subsurface Contaminant Transport Models

KAUST Repository

El Gharamti, Mohamad

2010-12-01

Understanding the geology and the hydrology of the subsurface is important to model the fluid flow and the behavior of the contaminant. It is essential to have an accurate knowledge of the movement of the contaminants in the porous media in order to track them and later extract them from the aquifer. A two-dimensional flow model is studied and then applied on a linear contaminant transport model in the same porous medium. Because of possible different sources of uncertainties, the deterministic model by itself cannot give exact estimations for the future contaminant state. Incorporating observations in the model can guide it to the true state. This is usually done using the Kalman filter (KF) when the system is linear and the extended Kalman filter (EKF) when the system is nonlinear. To overcome the high computational cost required by the KF, we use the singular evolutive Kalman filter (SEKF) and the singular evolutive extended Kalman filter (SEEKF) approximations of the KF operating with low-rank covariance matrices. The SEKF can be implemented on large dimensional contaminant problems while the usage of the KF is not possible. Experimental results show that with perfect and imperfect models, the low rank filters can provide as much accurate estimates as the full KF but at much less computational cost. Localization can help the filter analysis as long as there are enough neighborhood data to the point being analyzed. Estimating the permeabilities of the aquifer is successfully tackled using both the EKF and the SEEKF.

Ensemble Kalman filter for the reconstruction of the Earth's mantle circulation

Directory of Open Access Journals (Sweden)

M. Bocher

2018-02-01

Full Text Available Recent advances in mantle convection modeling led to the release of a new generation of convection codes, able to self-consistently generate plate-like tectonics at their surface. Those models physically link mantle dynamics to surface tectonics. Combined with plate tectonic reconstructions, they have the potential to produce a new generation of mantle circulation models that use data assimilation methods and where uncertainties in plate tectonic reconstructions are taken into account. We provided a proof of this concept by applying a suboptimal Kalman filter to the reconstruction of mantle circulation (Bocher et al., 2016. Here, we propose to go one step further and apply the ensemble Kalman filter (EnKF to this problem. The EnKF is a sequential Monte Carlo method particularly adapted to solve high-dimensional data assimilation problems with nonlinear dynamics. We tested the EnKF using synthetic observations consisting of surface velocity and heat flow measurements on a 2-D-spherical annulus model and compared it with the method developed previously. The EnKF performs on average better and is more stable than the former method. Less than 300 ensemble members are sufficient to reconstruct an evolution. We use covariance adaptive inflation and localization to correct for sampling errors. We show that the EnKF results are robust over a wide range of covariance localization parameters. The reconstruction is associated with an estimation of the error, and provides valuable information on where the reconstruction is to be trusted or not.

Nuclear Safety Project - annual report 1980

International Nuclear Information System (INIS)

1981-08-01

The Annual Report 1980 is a detailed description (in German language) of work within the Nuclear Safety Project performed in 1980 in the nuclear safety field by KfK institutes and departments and by external institutes on behalf of KfK. It includes for each individual research activity short summaries in English language on work completed, essential results, plans for the near future. (orig./RW) [de

Key-Feature-Probleme zum Prüfen von prozeduralem Wissen: Ein Praxisleitfaden [Key Feature Problems for the assessment of procedural knowledge: a practical guide

Directory of Open Access Journals (Sweden)

Kopp, Veronika

2006-08-01

Full Text Available [english] After assigning the different examination formats to the diverse terms of Miller's pyramide of knowledge, this paper provides a short presentation of the key feature approach by giving the definition and an example for clarification. Afterwards, a practical guide to writing key feature problems is given consisting of the following steps: define the domain, choose a clinical situation, define the key features, develop a test case scenario, write questions, select a preferred response format, define the scoring key, and validation. Finally, we present the evaluation results of this practical guide. In sum, the participants were very pleased with it. The differences between the estimations of their knowledge before and after the workshop concerning key features were significant. The key feature approach is an innovative tool for assessing clinical decision-making skills, also for electronical examinations. Substituting the write-in format for the long-menu format allows an automatic data analysis. [german] Im vorliegenden Beitrag wird - nach der Zuordnung unterschiedlicher Prüfungsformen zu den verschiedenen Wissensarten der Wissenspyramide von Miller - der Key-Feature (KF Ansatz vorgestellt. Nachdem anhand der Definition und einem Beispiel erklärt wurde, was ein KF ist, wird im Anschluss eine Anleitung für die Erstellung eines KF-Problems gegeben. Diese besteht aus folgenden Schritten: Definition des Kontextes, Wahl der klinischen Situation, Identifikation der KFs des klinischen Problems, Schreiben des klinischen Szenarios (Fallvignette, Schreiben der einzelnen KF-Fragen, Auswahl des Antwortformates, Bewertungsverfahren und Inhaltsvalidierung. Am Ende werden die Ergebnisse einer Evaluation dieser Anleitung, die im Rahmen eines KF-Workshops gewonnen wurden, präsentiert. Die Teilnehmer waren mit dieser Workshopeinheit sehr zufrieden und gaben an, sehr viel gelernt zu haben. Die subjektive Einschätzung ihres Wissensstands vor und nach

Advanced robotics R+D at KfK

International Nuclear Information System (INIS)

Rininsland, H.; Smidt, D.; Trauboth, H.; Kernforschungszentrum Karlsruhe G.m.b.H.; Kernforschungszentrum Karlsruhe G.m.b.H.

1987-01-01

Particular considerations for teleoperated and very long reach robotic systems are given. Robotic systems involving long reach referred to, include the TFTR maintenance boom developed for the Princeton fusion reactor and future automated cranes and bridge inspection equipment. A project to develop such long reach booms currently involves Putzmeister and the NRC, who will be responsible for developing the collision avoidance algorithms as part of a 'computer aided telemanipulation' approach. Problems encountered with operating equipment of this kind remotely were addressed during the recent Chernobyl disaster at which a range of equipment developed by Putzmeister was applied to combat the disaster. (orig./HP)

KfW Water Symposium 2009 : Financing Sanitation

OpenAIRE

KfW Development Bank

2010-01-01

"The central objective of the International Year of Sanitation was to put the global community on track to achieve the Millennium Development Goals MDG sanitation target. However, one year later, it is still difficult to keep sanitation high on the agenda, while practical action is required to encourage demand driven and sustainable solutions. With the support of the German Ministry for Development and Cooperation and together with the European Investment Bank EIB and the French Developm...

Short-range ensemble predictions based on convection perturbations in the Eta Model for the Serra do Mar region in Brazil

Science.gov (United States)

Bustamante, J. F. F.; Chou, S. C.; Gomes, J. L.

2009-04-01

The Southeast Brazil, in the coastal and mountain region called Serra do Mar, between Sao Paulo and Rio de Janeiro, is subject to frequent events of landslides and floods. The Eta Model has been producing good quality forecasts over South America at about 40-km horizontal resolution. For that type of hazards, however, more detailed and probabilistic information on the risks should be provided with the forecasts. Thus, a short-range ensemble prediction system (SREPS) based on the Eta Model is being constructed. Ensemble members derived from perturbed initial and lateral boundary conditions did not provide enough spread for the forecasts. Members with model physics perturbation are being included and tested. The objective of this work is to construct more members for the Eta SREPS by adding physics perturbed members. The Eta Model is configured at 10-km resolution and 38 layers in the vertical. The domain covered is most of Southeast Brazil, centered over the Serra do Mar region. The constructed members comprise variations of the cumulus parameterization Betts-Miller-Janjic (BMJ) and Kain-Fritsch (KF) schemes. Three members were constructed from the BMJ scheme by varying the deficit of saturation pressure profile over land and sea, and 2 members of the KF scheme were included using the standard KF and a momentum flux added to KF scheme version. One of the runs with BMJ scheme is the control run as it was used for the initial condition perturbation SREPS. The forecasts were tested for 6 cases of South America Convergence Zone (SACZ) events. The SACZ is a common summer season feature of Southern Hemisphere that causes persistent rain for a few days over the Southeast Brazil and it frequently organizes over Serra do Mar region. These events are particularly interesting because of the persistent rains that can accumulate large amounts and cause generalized landslides and death. With respect to precipitation, the KF scheme versions have shown to be able to reach the

An Iterative Ensemble Kalman Filter with One-Step-Ahead Smoothing for State-Parameters Estimation of Contaminant Transport Models

KAUST Repository

Gharamti, M. E.; Ait-El-Fquih, Boujemaa; Hoteit, Ibrahim

2015-01-01

Numerical experiments are conducted with a two-dimensional synthetic subsurface transport model simulating the migration of a contaminant plume in a heterogenous aquifer domain. Contaminant concentration data are assimilated to estimate both the contaminant state and the hydraulic conductivity field. Assimilation runs are performed under imperfect modeling conditions and various observational scenarios. Simulation results suggest that the proposed scheme efficiently recovers both the contaminant state and the aquifer conductivity, providing more accurate estimates than the standard Joint and Dual EnKFs in all tested scenarios. Iterating on the update step of the new scheme further enhances the proposed filter’s behavior. In term of computational cost, the new Joint-EnKF is almost equivalent to that of the Dual-EnKF, but requires twice more model integrations than the standard Joint-EnKF.

Backbone.js cookbook

CERN Document Server

Mirgorod, Vadim

2013-01-01

Written in a friendly, example driven Beginner's Guide format, there are plenty of step-by-step instructions to get you started fast!Pentaho 4.0 By Example: Beginner's Guide is the ideal companion for a wide-variety of developers. Whether you are new to the world of Business Intelligence reporting, or an experienced BI analyst, this book will guide you through the creation of your first reports in Pentaho. We assume some knowledge of the SQL language and database systems.

Proceedings of the Symposium on the Interface of Computer Science and Statistics (17th) Held in Lexington, Kentucky on 17-19 March 1985.

Science.gov (United States)

1986-03-04

both for the beginner and the experienced user. when appropriate, on the progress of the experi- Many will experience their first use of sta- mentation...diagrammed in a flowchart in figure 3. pticaio Monte Carlo Processor Structure LOOP Generate Date Evaluate StaUsUisv Program FOTRAN Con Figure 2 Figure...coefficient. WINDOW W, I BY 1, AT 0,0 This language feature can be considered a plus, X - READ(DATA,16,2) but it also means that a beginner would have

Shared Bibliographic Input Network (SBIN) Conference Proceedings, October 1982

Science.gov (United States)

1982-10-01

records for their document collections. In the process of development of the CIRCANET requirements, we conceived a flowchart (figure 3) of the ideal system...with beginners ). b. If an error is made when taping, it can be detecteA and corrected on screen before writing onto the tape being used for input. c...It’s an easier and quicker method for beginners to become familiar with all of the fields and their entries. d. If a record is lost during the process

Nuclear Safety Project

International Nuclear Information System (INIS)

1983-12-01

The semiannual progress report 1983/1 is a description of work within the Nuclear Safety Project performed in the first six month of 1983 in the nuclear safety field by KfK institutes and departments and by external institutions on behalf of KfK. The chosen kind of this report is that of short summaries, containing the topics work performed, results obtained and plans for future work. (orig./RW) [de

Nuclear safety project

International Nuclear Information System (INIS)

Anon.

1980-11-01

The 17th semi-annual report 1980/1 is a description of work within the Nuclear Safety Project performed in the first six months of 1980 in the nuclear safety field by KfK institutes and departments and by external institutions on behalf of KfK. The chosen kind of this report is that of short summaries, containing the topics - work performed, results obtained, plans for future work. (orig.) [de

16th semi annual report

International Nuclear Information System (INIS)

1980-08-01

The 16th semi-annual report 1979/2 is a description of work within the Nuclear Safety Project performed in the second six month of 1979 in the nuclear safety field by KfK institutes and departments and by external institutions on behalf of KfK. The chosen kind of this report is that of short summaries, containing the topics: work performed, results obtained, plans for future work. (orig.) [de

スウィングのばらつきを考慮したゴルフクラブの最適設計（要旨）

OpenAIRE

王, 春暁

2010-01-01

The purpose of this study is to provide an optimal designed golf club to the golf beginners. High quality data is necessary to study the optimum design of the golf club. Therefore, the trial participants are all excellent golf players to ensure the high quality of the measurement data. The optimum design of the golf club can not be done for golf beginners, because they can not provide high quality test results. Taking into this account, it is expected this study could find out the swing patte...

Sequential assimilation of volcanic monitoring data to quantify eruption potential: Application to Kerinci volcano

Science.gov (United States)

Zhan, Yan; Gregg, Patricia M.; Chaussard, Estelle; Aoki, Yosuke

2017-12-01

Quantifying the eruption potential of a restless volcano requires the ability to model parameters such as overpressure and calculate the host rock stress state as the system evolves. A critical challenge is developing a model-data fusion framework to take advantage of observational data and provide updates of the volcanic system through time. The Ensemble Kalman Filter (EnKF) uses a Monte Carlo approach to assimilate volcanic monitoring data and update models of volcanic unrest, providing time-varying estimates of overpressure and stress. Although the EnKF has been proven effective to forecast volcanic deformation using synthetic InSAR and GPS data, until now, it has not been applied to assimilate data from an active volcanic system. In this investigation, the EnKF is used to provide a “hindcast” of the 2009 explosive eruption of Kerinci volcano, Indonesia. A two-sources analytical model is used to simulate the surface deformation of Kerinci volcano observed by InSAR time-series data and to predict the system evolution. A deep, deflating dike-like source reproduces the subsiding signal on the flanks of the volcano, and a shallow spherical McTigue source reproduces the central uplift. EnKF predicted parameters are used in finite element models to calculate the host-rock stress state prior to the 2009 eruption. Mohr-Coulomb failure models reveal that the shallow magma reservoir is trending towards tensile failure prior to 2009, which may be the catalyst for the 2009 eruption. Our results illustrate that the EnKF shows significant promise for future applications to forecasting the eruption potential of restless volcanoes and hind-cast the triggering mechanisms of observed eruptions.

Vibration Noise Modeling for Measurement While Drilling System Based on FOGs

Directory of Open Access Journals (Sweden)

Chunxi Zhang

2017-10-01

Full Text Available Aiming to improve survey accuracy of Measurement While Drilling (MWD based on Fiber Optic Gyroscopes (FOGs in the long period, the external aiding sources are fused into the inertial navigation by the Kalman filter (KF method. The KF method needs to model the inertial sensors’ noise as the system noise model. The system noise is modeled as white Gaussian noise conventionally. However, because of the vibration while drilling, the noise in gyros isn’t white Gaussian noise any more. Moreover, an incorrect noise model will degrade the accuracy of KF. This paper developed a new approach for noise modeling on the basis of dynamic Allan variance (DAVAR. In contrast to conventional white noise models, the new noise model contains both the white noise and the color noise. With this new noise model, the KF for the MWD was designed. Finally, two vibration experiments have been performed. Experimental results showed that the proposed vibration noise modeling approach significantly improved the estimated accuracies of the inertial sensor drifts. Compared the navigation results based on different noise model, with the DAVAR noise model, the position error and the toolface angle error are reduced more than 90%. The velocity error is reduced more than 65%. The azimuth error is reduced more than 50%.

Orthogonal Matching Pursuit for Enhanced Recovery of Sparse Geological Structures With the Ensemble Kalman Filter

KAUST Repository

Sana, Furrukh; Katterbauer, Klemens; Al-Naffouri, Tareq Y.; Hoteit, Ibrahim

2016-01-01

Estimating the locations and the structures of subsurface channels holds significant importance for forecasting the subsurface flow and reservoir productivity. These channels exhibit high permeability and are easily contrasted from the low-permeability rock formations in their surroundings. This enables formulating the flow channels estimation problem as a sparse field recovery problem. The ensemble Kalman filter (EnKF) is a widely used technique for the estimation and calibration of subsurface reservoir model parameters, such as permeability. However, the conventional EnKF framework does not provide an efficient mechanism to incorporate prior information on the wide varieties of subsurface geological structures, and often fails to recover and preserve flow channel structures. Recent works in the area of compressed sensing (CS) have shown that estimating in a sparse domain, using algorithms such as the orthogonal matching pursuit (OMP), may significantly improve the estimation quality when dealing with such problems. We propose two new, and computationally efficient, algorithms combining OMP with the EnKF to improve the estimation and recovery of the subsurface geological channels. Numerical experiments suggest that the proposed algorithms provide efficient mechanisms to incorporate and preserve structural information in the EnKF and result in significant improvements in recovering flow channel structures.

Vibration Noise Modeling for Measurement While Drilling System Based on FOGs.

Science.gov (United States)

Zhang, Chunxi; Wang, Lu; Gao, Shuang; Lin, Tie; Li, Xianmu

2017-10-17

Aiming to improve survey accuracy of Measurement While Drilling (MWD) based on Fiber Optic Gyroscopes (FOGs) in the long period, the external aiding sources are fused into the inertial navigation by the Kalman filter (KF) method. The KF method needs to model the inertial sensors' noise as the system noise model. The system noise is modeled as white Gaussian noise conventionally. However, because of the vibration while drilling, the noise in gyros isn't white Gaussian noise any more. Moreover, an incorrect noise model will degrade the accuracy of KF. This paper developed a new approach for noise modeling on the basis of dynamic Allan variance (DAVAR). In contrast to conventional white noise models, the new noise model contains both the white noise and the color noise. With this new noise model, the KF for the MWD was designed. Finally, two vibration experiments have been performed. Experimental results showed that the proposed vibration noise modeling approach significantly improved the estimated accuracies of the inertial sensor drifts. Compared the navigation results based on different noise model, with the DAVAR noise model, the position error and the toolface angle error are reduced more than 90%. The velocity error is reduced more than 65%. The azimuth error is reduced more than 50%.

Orthogonal Matching Pursuit for Enhanced Recovery of Sparse Geological Structures With the Ensemble Kalman Filter

KAUST Repository

Sana, Furrukh

2016-02-23

Estimating the locations and the structures of subsurface channels holds significant importance for forecasting the subsurface flow and reservoir productivity. These channels exhibit high permeability and are easily contrasted from the low-permeability rock formations in their surroundings. This enables formulating the flow channels estimation problem as a sparse field recovery problem. The ensemble Kalman filter (EnKF) is a widely used technique for the estimation and calibration of subsurface reservoir model parameters, such as permeability. However, the conventional EnKF framework does not provide an efficient mechanism to incorporate prior information on the wide varieties of subsurface geological structures, and often fails to recover and preserve flow channel structures. Recent works in the area of compressed sensing (CS) have shown that estimating in a sparse domain, using algorithms such as the orthogonal matching pursuit (OMP), may significantly improve the estimation quality when dealing with such problems. We propose two new, and computationally efficient, algorithms combining OMP with the EnKF to improve the estimation and recovery of the subsurface geological channels. Numerical experiments suggest that the proposed algorithms provide efficient mechanisms to incorporate and preserve structural information in the EnKF and result in significant improvements in recovering flow channel structures.

THERMAL CONDUCTIVITY OF SIC AND C FIBERS

Energy Technology Data Exchange (ETDEWEB)

Youngblood, Gerald E.; Senor, David J.; Kowbel, W.; Webb, J.; Kohyama, Akira

2000-09-01

Several rod-shaped specimens with uniaxially packed fibers (Hi-Nicalon, Hi-Nicalon Type S, Tyranno SA and Amoco K1100 types) and a pre-ceramic polymer matrix have been fabricated. By using appropriate analytic models, the bare fiber thermal conductivity (Kf) and the interface thermal conductance (h) will be determined as a function of temperature up to 1000?C before and after irradiation for samples cut from these rods. Initial results are: (1) for unirradiated Hi-Nicalon SiC fiber, Kf varied from 4.3 up to 5.9 W/mK for the 27-1000?C range, (2) for unirradiated K1100 graphite fiber, Kf varied from 576 down to 242 W/mK for the 27-1000?C range, and (3) h = 43 W/cm2K at 27?C as a typical fiber/matrix interface conductance.

Report on the research and development work of 1984 in the project atomic fusion

International Nuclear Information System (INIS)

Finken, D.

1985-02-01

The work done by the Nuclear Research Centre in Karlsruhe on fusion under magnetic influence is compiled in the project atomic fusion and put in the programme for European Fusion Technology. The work is supported by an association contract between KfK and Euratom via the European Commission. Some of the work exceeds the volume defined in the E.E.C's technology programme. Using these papers, mostly studies, connections are established between the various fields of work and new tasks prepared. This is taking place in the light of the expected extension of the technology programme in the coming year and the plans for NET. The reports compiled here are the 1984 papers from the KfK institute. The appendix contains a compilation of the tasks undertaken by KfK from the EEC's fusion technology programme. (orig./GG) [de

Fusion technology programme

International Nuclear Information System (INIS)

Finken, D.

1984-10-01

The KfK-Association has continued work on 17 R and D contracts of the Fusion Technology Programme. An effort of 94 manyears per year is at present contributed by 10 KfK departments, covering all aereas defined in the Fusion Technology Programme. The dominant part of the work is directed towards the need of the NET design or supporting experiments. Some additional effort addresses long term technological issues and system studies relevant to DEMO or confinement schemes alternative to tokamaks. Direct contribution to the NET team has increased by augmentation of NET study contracts and delegation of personnel, three KfK delegates being at present members of the NET team. In reverse, specifications and design guidelines worked out by NET have started to have an impact on the current R and D-work in the laboratory. (orig./GG)

[MRI changes of Achilles tendon and hindfoot in experienced runners and beginners during training and after a (half)-marathon competition].

Science.gov (United States)

Freund, W; Billich, C; Brambs, H-J; Weber, F; Schütz, U H

2011-08-01

Marathon running is gaining in popularity. Its benefits regarding the cardiovascular system as well as the metabolism are beyond doubt. However, whether or not there are detrimental side effects to the musculoskeletal system such as wear and tear is an unsolved question. We therefore prospectively looked at beginners and experienced runners at a city marathon during training and after the competition for lesions to the Achilles tendon (AT) or hindfoot. 73 healthy subjects were prospectively included in our study. They were recruited from the applicants of the city marathon or half-marathon. They underwent an initial clinical orthopaedic as well as three magnetic resonance (MRI) examinations. The MRI were conducted at the time point of study enrolment, near the end of training and directly (up to 72 hours) after the run. MRI evaluation (fat saturated T (2)-weighted sagittal STIR sequence) was performed by two independent experienced radiologists blinded to the clinical context. The results were compared for subgroups of runners, also a factorial analysis was performed. Statistical results were deemed significant for p ≤ 0.05. 32 women and 41 men were included. In the end there were 53 finishers and 20 non-finishers; 28 seasoned runners and 25 novices. 57 runners had no foot complaints, while 14 had foot pain during training and 13 during the marathon. Mean body weight was 71.6 kg, height was 173 cm, age was 40.2 years. Mean AT diameter was 7.0 mm and showed no change during training or after the marathon. There was no significant influence of gender on other variables investigated. There was a significant and positive correlation between AT diameter and weight (r = 0.37), also AT and height (r = 0.34), while there was negative correlation between height and signal intensity of calcaneus (r = -0.50). The signal intensity of the AT decreased during training. The signal intensity of the calcaneus decreased from inclusion until after the marathon

Livecode mobile development beginner's guide

CERN Document Server

Holgate, Colin

2015-01-01

The ideal reader for this book would be someone who already knows LiveCode, is interested in creating mobile apps, and wants to save the many hours it took for me to track down all of the information on how to get started! Chapter 1, LiveCode Fundamentals, will help those of you who know programming but are not familiar with LiveCode. The knowledge you've acquired should be enough for you to benefit from the remainder of the book.

Minimal Materials for ESL Beginners

Directory of Open Access Journals (Sweden)

N. S. Prabhu

2010-01-01

Full Text Available In November 2006, the government of the state of Karnataka in India announced its decision to start teaching English as a school subject from class 1 onwards in all primary schools in the state, instead of from class 5 as hitherto.

Protein blotting protocol for beginners.

Science.gov (United States)

Petrasovits, Lars A

2014-01-01

The transfer and immobilization of biological macromolecules onto solid nitrocellulose or nylon (polyvinylidene difluoride (PVDF)) membranes subsequently followed by specific detection is referred to as blotting. DNA blots are called Southerns after the inventor of the technique, Edwin Southern. By analogy, RNA blots are referred to as northerns and protein blots as westerns (Burnette, Anal Biochem 112:195-203, 1981). With few exceptions, western blotting involves five steps, namely, sample collection, preparation, separation, immobilization, and detection. In this chapter, protocols for the entire process from sample collection to detection are described.

Quantum physics a beginner's guide

CERN Document Server

Rae, Alastair I M

2005-01-01

As Alastair Rae points out in his introduction, ""quantum physics is not rocket science"". It may have gained a reputation as the theory that no one really understands, but its practical applications are all around us in everyday life. If it were not for quantum physics, computers would not function, metals would not conduct electricity, and the power stations that heat our homes would not produce energy. Assuming no prior scientific or mathematical knowledge, this clear and concise introduction provides a step-by-step guide to quantum theory, right from the very basic principles to the most c

Planet earth a beginner's guide

CERN Document Server

Gribbin, John

2012-01-01

In this incredible expedition into the origins, workings, and evolution of our home planet, John Gribbin, bestselling author of In Search of Schrödinger's Cat, The Scientists, and In Search of the Multiverse, does what he does best: taking four and a half billion years of mind-boggling science and digging out the best bits. From the physics of Newton and the geology of Wegener, to the environmentalism of Lovelock, this is a must read for Earth's scientists and residents alike. Trained as an astrophysicist at Cambridge University, John Gribbin is currently Visiting Fellow in Astronomy at the University of Sussex, England.

Kayh am Beginn der Neuzeit

OpenAIRE

Trugenberger, Volker

1990-01-01

Die Kayher Gegend barg in ihrem Boden einen besonderen Schatz: Alabaster. Herzog Ludwig von Württemberg kaufte eigens zwischen 1581 und 1586 von den Kayher Bürgern Urban Binder, Jakob Schwarz und Martin Noppel deren auf Altinger Markung uffm kreidengraben gelegene Äcker mit alapasterstein, insgesamt 2 Morgen. Der darauf gebrochene Alabaster wurde für Kunstwerke verwandt, die im Auftrag des Herzogs angefertigt wurden; er wurde nicht abgebaut, um ihn anderweitig zu verkaufen und damit Gewinne z...

Quantum error correction for beginners

International Nuclear Information System (INIS)

Devitt, Simon J; Nemoto, Kae; Munro, William J

2013-01-01

Quantum error correction (QEC) and fault-tolerant quantum computation represent one of the most vital theoretical aspects of quantum information processing. It was well known from the early developments of this exciting field that the fragility of coherent quantum systems would be a catastrophic obstacle to the development of large-scale quantum computers. The introduction of quantum error correction in 1995 showed that active techniques could be employed to mitigate this fatal problem. However, quantum error correction and fault-tolerant computation is now a much larger field and many new codes, techniques, and methodologies have been developed to implement error correction for large-scale quantum algorithms. In response, we have attempted to summarize the basic aspects of quantum error correction and fault-tolerance, not as a detailed guide, but rather as a basic introduction. The development in this area has been so pronounced that many in the field of quantum information, specifically researchers who are new to quantum information or people focused on the many other important issues in quantum computation, have found it difficult to keep up with the general formalisms and methodologies employed in this area. Rather than introducing these concepts from a rigorous mathematical and computer science framework, we instead examine error correction and fault-tolerance largely through detailed examples, which are more relevant to experimentalists today and in the near future. (review article)

Pentaho data integration beginner's guide

CERN Document Server

Roldán, María Carina

2013-01-01

This book focuses on teaching you by example. The book walks you through every aspect of Pentaho Data Integration, giving systematic instructions in a friendly style, allowing you to learn in front of your computer, playing with the tool. The extensive use of drawings and screenshots make the process of learning Pentaho Data Integration easy. Throughout the book, numerous tips and helpful hints are provided that you will not find anywhere else.This book is a must-have for software developers, database administrators, IT students, and everyone involved or interested in developing ETL solutions,

Seven Myths about Beginners' Language

DEFF Research Database (Denmark)

Lund, Karen; Kirkebæk, Mads Jakob

2015-01-01

In the article the authors have selected seven myths about beginners’ language for discussion, reflection and possible rejection. These are (1) the myth about the necessity of mastering the system before being able to speak the language, (2) the myth about limited capacity on the ‘hard disc’, (3......) the myth about ‘the only thing’ (the method), (4) the myth about “we tried that before”, (5) the myth about “one people and one teaching method, (6) the myth about easy and difficult languages, and (7) the myth about students with no competences and a worthless past. The article suggests language teachers...

Mac Programming for Absolute Beginners

CERN Document Server

Wang, Wallace

2011-01-01

Want to learn how to program on your Mac? Not sure where to begin? Best-selling author Wallace Wang will explain how to get started with Cocoa, Objective-C, and Xcode. Whether you are an experienced Windows coder moving to the Mac, or you are completely new to programming, you'll see how the basic design of a Mac OS X program works, how Objective-C differs from other languages you may have used, and how to use the Xcode development environment. Most importantly, you'll learn how to use elements of the Cocoa framework to create windows, store data, and respond to users in your own Mac programs.

JavaScript for Absolute Beginners

CERN Document Server

McNavage, T

2010-01-01

If you are new to both JavaScript and programming, this hands-on book is for you. Rather than staring blankly at gobbledygook, you'll explore JavaScript by entering and running hundreds of code samples in Firebug, a free JavaScript debugger. Then in the last two chapters, you'll leave the safety of Firebug and hand-code an uber cool JavaScript application in your preferred text editor. Written in a friendly, engaging narrative style, this innovative JavaScript tutorial covers the following essentials: * Core JavaScript syntax, such as value types, operators, expressions, and statements provide

Java 7 A Beginner's Tutorial

CERN Document Server

Kurniawan, Budi

2011-01-01

A Books24x7's TOP 10 title for 4 consecutive years! Java is an easy language to learn. However, you need to master more than the language syntax to be a professional Java programmer. For one, object-oriented programming (OOP) skill is key to developing robust and effective Java applications. In addition, knowing how to use the vast collection of libraries makes development more rapid. This book introduces you to important programming concepts and teaches how to use the Java core libraries. It is a guide to building real-world applications, both desktop and Web-based. The coverage is the

Artificial intelligence a beginner's guide

CERN Document Server

Whitby, Blay

2012-01-01

Tomorrow begins right here as we embark on an enthralling and jargon-free journey into the world of computers and the inner recesses of the human mind. Readers encounter everything from the nanotechnology used to make insect-like robots, to computers that perform surgery, in addition to discovering the biggest controversies to dog the field of AI. Blay Whitby is a Lecturer on Cognitive Science and Artificial Intelligence at the University of Sussex UK. He is the author of two books and numerous papers.

Python 3 for Absolute Beginners

CERN Document Server

Hall, Tim

2009-01-01

There are many more people who want to study programming other than aspiring computer scientists with a passing grade in advanced calculus. This guide appeals to your intelligence and ability to solve practical problems, while gently teaching the most recent revision of the programming language Python. You can learn solid software design skills and accomplish practical programming tasks, like extending applications and automating everyday processes, even if you have no programming experience at all. Authors Tim Hall and J-P Stacey use everyday language to decode programming jargon and teach Py

PIC microcomputer guide for beginner

International Nuclear Information System (INIS)

Shin, Chulho

2001-03-01

This book comprised of four parts. The first part deals with computer one chip, voltage current, resistance, electronic components, logical element, TTL and CMOS, memory and I/O and MDS. The second part is about PIC16C84 which describes its memory structure, registers and PIC16C84 command. The third part deals with LED control program, jet car LED, quiz buzzer program, LED spectrum, digital dice, two digital dices and time bomb. The last part introduces PIC16C71 and temperature controller.

Neural Networks for the Beginner.

Science.gov (United States)

Snyder, Robin M.

Motivated by the brain, neural networks are a right-brained approach to artificial intelligence that is used to recognize patterns based on previous training. In practice, one would not program an expert system to recognize a pattern and one would not train a neural network to make decisions from rules; but one could combine the best features of…

Nuclear safety project

International Nuclear Information System (INIS)

1982-06-01

The Annual Report 1981 is a detailed description (in German language) of work within the Nuclear Safety Project performed in 1981 in the nuclear safety field by KfK institutes and departments and by external institutes on behalf of KfK. It includes for each individual research activity short summaries in English language on - work completed - results obtained - plans for future work. This report was compiled by the project management. (orig.) [de

Nuclear Safety Project. Annual report 1983

International Nuclear Information System (INIS)

1984-06-01

The annual report 1983 is a detailed description (in German language) of work within the Nuclear Safety Project performed in 1983 in the nuclear safety field by KfK institutes and departments and by external institutes on behalf of KfK. It includes for each individual research activity short summaries in English language on work performed, results obtained and plans for future work. This report was compiled by the project management. (orig.) [de

List of scientific publications issued in 1991 by Karlsruhe Nuclear Research Center

International Nuclear Information System (INIS)

1992-05-01

This report KfK 5025 presents the titles of scientific publications issued in 1991. Conference papers or other papers not yet available in printed from are listed separately. Patent documents of the year 1991 are listed in two categories: patent specifications and unexamined laid-open patent applications (DE-OS). Reviews on specific subjects or training documents prepared for courses in the KfK's Center for Advanced Training are not included in this report. (orig.) [de

Nuclear safety project. Annual report 1985

International Nuclear Information System (INIS)

1986-07-01

The annual report 1985 is a detailed description (in German language) of work within the nuclear safety project performed in 1985 in the nuclear safety field by KfK institutes and departments and by external institutes on behalf of KfK. It includes for each individual research activity short summaries in English language on work performed, results obtained and plans for future work. This report was compiled by the project management. (orig./HP) [de

Multivariate localization methods for ensemble Kalman filtering

OpenAIRE

S. Roh; M. Jun; I. Szunyogh; M. G. Genton

2015-01-01

In ensemble Kalman filtering (EnKF), the small number of ensemble members that is feasible to use in a practical data assimilation application leads to sampling variability of the estimates of the background error covariances. The standard approach to reducing the effects of this sampling variability, which has also been found to be highly efficient in improving the performance of EnKF, is the localization of the estimates of the covariances. One family of ...

Microsoft Windows networking essentials

CERN Document Server

Gibson, Darril

2011-01-01

The core concepts and technologies of Windows networking Networking can be a complex topic, especially for those new to the field of IT. This focused, full-color book takes a unique approach to teaching Windows networking to beginners by stripping down a network to its bare basics, thereby making each topic clear and easy to understand. Focusing on the new Microsoft Technology Associate (MTA) program, this book pares down to just the essentials, showing beginners how to gain a solid foundation for understanding networking concepts upon which more advanced topics and technologies can be built.

Knots and links

CERN Document Server

Rolfsen, Dale

2003-01-01

Rolfsen's beautiful book on knots and links can be read by anyone, from beginner to expert, who wants to learn about knot theory. Beginners with a basic background find an inviting introduction to the elements of topology, emphasizing the tools needed for understanding knots, the fundamental group and van Kampen's theorem, for example, which are then applied to concrete problems, such as computing knot groups. For experts, Rolfsen explains advanced topics, such as the connections between knot theory and surgery and how they are useful to understanding three-manifolds. Besides providing a guide

Impact of Uncertainty Characterization of Satellite Rainfall Inputs and Model Parameters on Hydrological Data Assimilation with the Ensemble Kalman Filter for Flood Prediction

Science.gov (United States)

Vergara, H. J.; Kirstetter, P.; Hong, Y.; Gourley, J. J.; Wang, X.

2013-12-01

The Ensemble Kalman Filter (EnKF) is arguably the assimilation approach that has found the widest application in hydrologic modeling. Its relatively easy implementation and computational efficiency makes it an attractive method for research and operational purposes. However, the scientific literature featuring this approach lacks guidance on how the errors in the forecast need to be characterized so as to get the required corrections from the assimilation process. Moreover, several studies have indicated that the performance of the EnKF is 'sub-optimal' when assimilating certain hydrologic observations. Likewise, some authors have suggested that the underlying assumptions of the Kalman Filter and its dependence on linear dynamics make the EnKF unsuitable for hydrologic modeling. Such assertions are often based on ineffectiveness and poor robustness of EnKF implementations resulting from restrictive specification of error characteristics and the absence of a-priori information of error magnitudes. Therefore, understanding the capabilities and limitations of the EnKF to improve hydrologic forecasts require studying its sensitivity to the manner in which errors in the hydrologic modeling system are represented through ensembles. This study presents a methodology that explores various uncertainty representation configurations to characterize the errors in the hydrologic forecasts in a data assimilation context. The uncertainty in rainfall inputs is represented through a Generalized Additive Model for Location, Scale, and Shape (GAMLSS), which provides information about second-order statistics of quantitative precipitation estimates (QPE) error. The uncertainty in model parameters is described adding perturbations based on parameters covariance information. The method allows for the identification of rainfall and parameter perturbation combinations for which the performance of the EnKF is 'optimal' given a set of objective functions. In this process, information about

Assimilation of Deformation Data for Eruption Forecasting: Potentiality Assessment Based on Synthetic Cases

Directory of Open Access Journals (Sweden)

M. Grace Bato

2017-06-01

Full Text Available In monitoring active volcanoes, the magma overpressure is one of the key parameters used in forecasting volcanic eruptions. This parameter can be inferred from the ground displacements measured on the Earth's surface by applying inversion techniques. However, in most studies, the huge amount of information about the behavior of the volcano contained in the temporal evolution of the deformation signal is not fully exploited by inversion. Our work focuses on developing a strategy in order to better forecast the magma overpressure using data assimilation. We take advantage of the increasing amount of geodetic data [i.e., Interferometric Synthetic Aperture Radar (InSAR and Global Navigation Satellite System (GNSS] recorded on volcanoes nowadays together with the wide-range availability of dynamical models that can provide better understanding about the volcano plumbing system. Here, we particularly built our strategy on the basis of the Ensemble Kalman Filter (EnKF. We forecast the temporal behaviors of the magma overpressures and surface deformations by adopting a simple and generic two-magma chamber model and by using synthetic GNSS and/or InSAR data. We prove the ability of EnKF to both estimate the magma pressure evolution and constrain the characteristics of the deep volcanic system (i.e., reservoir size as well as basal magma inflow. High temporal frequency of observation is required to ensure the success of EnKF and the quality of assimilation is also improved by increasing the spatial density of observations in the near-field. We thus show that better results are obtained by combining a few GNSS temporal series of high temporal resolution with InSAR images characterized by a good spatial coverage. We also show that EnKF provides similar results to sophisticated Bayesian-based inversion while using the same dynamical model with the advantage of EnKF to potentially account for the temporal evolution of the uncertain model parameters. Our

An improved state-parameter analysis of ecosystem models using data assimilation

Science.gov (United States)

Chen, M.; Liu, S.; Tieszen, L.L.; Hollinger, D.Y.

2008-01-01

Much of the effort spent in developing data assimilation methods for carbon dynamics analysis has focused on estimating optimal values for either model parameters or state variables. The main weakness of estimating parameter values alone (i.e., without considering state variables) is that all errors from input, output, and model structure are attributed to model parameter uncertainties. On the other hand, the accuracy of estimating state variables may be lowered if the temporal evolution of parameter values is not incorporated. This research develops a smoothed ensemble Kalman filter (SEnKF) by combining ensemble Kalman filter with kernel smoothing technique. SEnKF has following characteristics: (1) to estimate simultaneously the model states and parameters through concatenating unknown parameters and state variables into a joint state vector; (2) to mitigate dramatic, sudden changes of parameter values in parameter sampling and parameter evolution process, and control narrowing of parameter variance which results in filter divergence through adjusting smoothing factor in kernel smoothing algorithm; (3) to assimilate recursively data into the model and thus detect possible time variation of parameters; and (4) to address properly various sources of uncertainties stemming from input, output and parameter uncertainties. The SEnKF is tested by assimilating observed fluxes of carbon dioxide and environmental driving factor data from an AmeriFlux forest station located near Howland, Maine, USA, into a partition eddy flux model. Our analysis demonstrates that model parameters, such as light use efficiency, respiration coefficients, minimum and optimum temperatures for photosynthetic activity, and others, are highly constrained by eddy flux data at daily-to-seasonal time scales. The SEnKF stabilizes parameter values quickly regardless of the initial values of the parameters. Potential ecosystem light use efficiency demonstrates a strong seasonality. Results show that the

Impact of uncertainty description on assimilating hydraulic head in the MIKE SHE distributed hydrological model

DEFF Research Database (Denmark)

Zhang, Donghua; Madsen, Henrik; Ridler, Marc E.

2015-01-01

The ensemble Kalman filter (EnKF) is a popular data assimilation (DA) technique that has been extensively used in environmental sciences for combining complementary information from model predictions and observations. One of the major challenges in EnKF applications is the description of model un...... with respect to performance and sensitivity. Results show that inappropriate definition of model uncertainty can greatly degrade the assimilation performance, and an appropriate combination of different model uncertainty sources is advised....

Nuclear safety project

International Nuclear Information System (INIS)

1984-11-01

The semiannual progress report 1984/1 is a description of work within the Nuclear Safety Project performed in the first six month of 1984 in the nuclear safety field by KfK institutes and departements and by external institutions on behalf of KfK. The chosen kind of this report is that of short summaries, containing the topics work performed, results obtained and plans for future work. This report was compiled by the project management. (orig./RW) [de

First semiannual report 1979/1

International Nuclear Information System (INIS)

1980-02-01

The 15th semi-annual report 1979/1 is a description of work within the Nuclear Safety Project performed in the first six month of 1979 in the nuclear safety field by KfK institutes and departments and by external institutions on behalf of KfK. The chosen kind of this report is that of short summaries, containing the topics: - work performed, results obtained, plans for future work. This report was compiled by the project management. (orig.) [de

Project Nuclear Safety

International Nuclear Information System (INIS)

1981-11-01

The semiannual progress report 1981/1 is a description of work within the Nuclear Safety Project performed in the first six month of 1981 in the nuclear safety field by KfK institutes and departments and by external institutions on behalf of KfK. The chosen kind of this report is that of short summaries, containing the topics, work performed, results obtained, plans for future work. This report was compiled by the project management. (orig.) [de

List of scientific publications of Nuclear Research Center Karlsruhe 1983

International Nuclear Information System (INIS)

1984-04-01

This report contains the titles of the publications edited in the year 1983. The scientific and technical-scientific publications of the Nuclear Research Center Karlsruhe are printed as books, as original contributions in scientific or technical specialists' journals, as scripts for habilitation, thesis, scripts for diploma, as patents, as KfK-Reports (KfK=Kernforschungszentrum Karlsruhe) and are being presented as lectures on scientific meetings. No further separate abstracts of this list of publications were prepared. (orig./HBR) [de

Transforming Lactococcus lactis into a microbial cell factory

DEFF Research Database (Denmark)

Petersen, Kia Vest

the potential of Lactococcus lactis as a platform organism for production of biofuels and-chemicals with a focus on characterization and optimization of the xylose metabolism. The plant isolate L. lactis KF147 was selected as the potential platform organism due to its natural ability to utilize both the pentose....... To simplify further analysis arcA encoding the arginine deiminase was deleted, thus eliminating the arginine catabolism. We found that in L. lactis KF147 xylose is metabolized through two pathways namely the phosphoketolase pathway and the non-oxidative part of the pentose phosphate pathway. The only products......, and ethanol. Three adaptive mutations were identified in AD29. Two is by all accounts involved in regulatory mechanisms either to stress (yhfB) or more globally (ytgF), and the last facilitate improved uptake of xylose (ptnC). Based on the above findings we conclude that L. lactis KF147 possesses many...

Prevalence and molecular characterization of Hepatozoon canis in dogs from urban and rural areas in Southeast Brazil.

Science.gov (United States)

de Miranda, R L; O'Dwyer, L H; de Castro, J R; Metzger, B; Rubini, A S; Mundim, A V; Eyal, O; Talmi-Frank, D; Cury, M C; Baneth, G

2014-10-01

The objective of this survey was to investigate the prevalence of Hepatozoon infection in dogs in the rural and urban areas of Uberlândia, Brazil by PCR and molecular characterization. DNA was obtained from blood samples collected from 346 local dogs from both genders and various ages. Seventeen PCR products from positive blood samples of urban dogs and 13 from the rural dogs were sequenced. Partial sequences of the 18S rRNA gene indicated that all 30 dogs were infected with Hepatozoon canis similar in sequence to H. canis from southern Europe. Four local dog sequences were submitted to GenBank (accessions JN835188; KF692038; KF692039; KF692040). This study indicates that H. canis is the cause of canine hepatozoonosis in Uberlândia and that infection is similarly widespread in rural and urban dogs. Copyright © 2014. Published by Elsevier Ltd.

The importance of on-line monitoring systems within the environmental monitoring program of the Karlsruhe Nuclear Research Center

International Nuclear Information System (INIS)

Koenig, L.A.; Winter, M.; Schmitt, A.

1980-10-01

The two on-line monitoring systems used in KfK environmental monitoring should be taken as measures of accident precaution and they are restricted to measurement of gamma local dose rates and of the (β + γ)-radiation levels. One of the systems serves to monitor the KfK operational area, the second serves to monitor the surrounding communities up to a radius of 8 km. By use of two different types of detectors the first system covers a range of measurement of 10 μrem/h to 1000 rem/h. By the second system only increases in the radiation level can be detected. It allows to record accidents in which countermeasures must be taken very urgently. The two monitoring systems are described which have been operated and partly been developed at the KfK. The possibilities and limits of using them for environmental monitoring are discussed. (orig./HP) [de

List of scientific and technical publications of the Karlsruhe Nuclear Research Centre, 1985

International Nuclear Information System (INIS)

1986-05-01

The report lists the titles and other bibliographic data of the publications released in 1985. Lectures not yet available in printed form are listed separately. The patent section gives information on patent rights granted or published in 1985. Technical lectures or material prepared for courses held by the SKT (Nuclear Engineering School) are not part of the list. The data are arranged by institutes, information on project activities is given referring to published project reports and other publications prepared by project staff. The list also presents R and D reports printed by KfK for informationn on the PFT project, fabrication technologies, which is a joint enterprise by KfK, several other institutes, and industry. Publications of the branch institute of the Federal Food Research Institute are also given, followed by a list of publications prepared by guest scientists of the KfK. (orig./PW) [de

Application and Study of Precipitation Schemes in Weather Simulation in Summer and Winter over China

Institute of Scientific and Technical Information of China (English)

XU Guoqiang; WAN Qilin; HUANG Liping; XUE Jishan; CHEN Dehui

2006-01-01

Through simulation of summer and winter precipitation cases in China, the cloud precipitation schemes of model were examined. Results indicate that it is discrepant between convective precipitation simulated by the Kain-Fritsch (KF) scheme and Betts-Miller (BM) scheme in summer, the former scheme is better than the latter in this case. The ambient atmosphere may be varied by different convective schemes. The air is wetter and the updraft is stronger in the KF scheme than in the BM scheme, which can induce the more grid scale precipitation in the KF scheme, i.e., the different cumulus schemes may have the different and important effect on the grid scale precipitation. However, there is almost no convective rain in winter in northern China, so the effect of cumulus precipitation on the grid scale precipitation can be disregarded.Therefore, the gird scale precipitation is primary in the winter of northern China.

A two-update ensemble Kalman filter for land hydrological data assimilation with an uncertain constraint

Science.gov (United States)

Khaki, M.; Ait-El-Fquih, B.; Hoteit, I.; Forootan, E.; Awange, J.; Kuhn, M.

2017-12-01

Assimilating Gravity Recovery And Climate Experiment (GRACE) data into land hydrological models provides a valuable opportunity to improve the models' forecasts and increases our knowledge of terrestrial water storages (TWS). The assimilation, however, may harm the consistency between hydrological water fluxes, namely precipitation, evaporation, discharge, and water storage changes. To address this issue, we propose a weak constrained ensemble Kalman filter (WCEnKF) that maintains estimated water budgets in balance with other water fluxes. Therefore, in this study, GRACE terrestrial water storages data are assimilated into the World-Wide Water Resources Assessment (W3RA) hydrological model over the Earth's land areas covering 2002-2012. Multi-mission remotely sensed precipitation measurements from the Tropical Rainfall Measuring Mission (TRMM) and evaporation products from the Moderate Resolution Imaging Spectroradiometer (MODIS), as well as ground-based water discharge measurements are applied to close the water balance equation. The proposed WCEnKF contains two update steps; first, it incorporates observations from GRACE to improve model simulations of water storages, and second, uses the additional observations of precipitation, evaporation, and water discharge to establish the water budget closure. These steps are designed to account for error information associated with the included observation sets during the assimilation process. In order to evaluate the assimilation results, in addition to monitoring the water budget closure errors, in situ groundwater measurements over the Mississippi River Basin in the US and the Murray-Darling Basin in Australia are used. Our results indicate approximately 24% improvement in the WCEnKF groundwater estimates over both basins compared to the use of (constraint-free) EnKF. WCEnKF also further reduces imbalance errors by approximately 82.53% (on average) and at the same time increases the correlations between the

Real-time bias-adjusted O 3 and PM 2.5 air quality index forecasts and their performance evaluations over the continental United States

Science.gov (United States)

Kang, Daiwen; Mathur, Rohit; Trivikrama Rao, S.

2010-06-01

The National Air Quality Forecast Capacity (NAQFC) system, which links NOAA's North American Mesoscale (NAM) meteorological model with EPA's Community Multiscale Air Quality (CMAQ) model, provided operational ozone (O 3) and experimental fine particular matter (PM 2.5) forecasts over the continental United States (CONUS) during 2008. This paper describes the implementation of a real-time Kalman Filter (KF) bias-adjustment technique to improve the accuracy of O 3 and PM 2.5 forecasts at discrete monitoring locations. The operational surface-level O 3 and PM 2.5 forecasts from the NAQFC system were post-processed by the KF bias-adjusted technique using near real-time hourly O 3 and PM 2.5 observations obtained from EPA's AIRNow measurement network. The KF bias-adjusted forecasts were created daily, providing 24-h hourly bias-adjusted forecasts for O 3 and PM 2.5 at all AIRNow monitoring sites within the CONUS domain. The bias-adjustment post-processing implemented in this study requires minimal computational cost; requiring less than 10 min of CPU on a single processor Linux machine to generate 24-h hourly bias-adjusted forecasts over the entire CONUS domain. The results show that the real-time KF bias-adjusted forecasts for both O 3 and PM 2.5 have performed as well as or even better than the previous studies when the same technique was applied to the historical O 3 and PM 2.5 time series from archived AQF in earlier years. Compared to the raw forecasts, the KF forecasts displayed significant improvement in the daily maximum 8-h O 3 and daily mean PM 2.5 forecasts in terms of both discrete (i.e., reduced errors, increased correlation coefficients, and index of agreement) and categorical (increased hit rate and decreased false alarm ratio) evaluation metrics at almost all locations during the study period in 2008.

Sequential Assimilation of Volcanic Monitoring Data to Quantify Eruption Potential: Application to Kerinci Volcano, Sumatra

Directory of Open Access Journals (Sweden)

Yan Zhan

2017-12-01

Full Text Available Quantifying the eruption potential of a restless volcano requires the ability to model parameters such as overpressure and calculate the host rock stress state as the system evolves. A critical challenge is developing a model-data fusion framework to take advantage of observational data and provide updates of the volcanic system through time. The Ensemble Kalman Filter (EnKF uses a Monte Carlo approach to assimilate volcanic monitoring data and update models of volcanic unrest, providing time-varying estimates of overpressure and stress. Although the EnKF has been proven effective to forecast volcanic deformation using synthetic InSAR and GPS data, until now, it has not been applied to assimilate data from an active volcanic system. In this investigation, the EnKF is used to provide a “hindcast” of the 2009 explosive eruption of Kerinci volcano, Indonesia. A two-sources analytical model is used to simulate the surface deformation of Kerinci volcano observed by InSAR time-series data and to predict the system evolution. A deep, deflating dike-like source reproduces the subsiding signal on the flanks of the volcano, and a shallow spherical McTigue source reproduces the central uplift. EnKF predicted parameters are used in finite element models to calculate the host-rock stress state prior to the 2009 eruption. Mohr-Coulomb failure models reveal that the host rock around the shallow magma reservoir is trending toward tensile failure prior to 2009, which may be the catalyst for the 2009 eruption. Our results illustrate that the EnKF shows significant promise for future applications to forecasting the eruption potential of restless volcanoes and hind-cast the triggering mechanisms of observed eruptions.

Test-Retest Reliability of Isokinetic Knee Strength Measurements in Children Aged 8 to 10 Years.

Science.gov (United States)

Fagher, Kristina; Fritzson, Annelie; Drake, Anna Maria

Isokinetic dynamometry is a useful tool to objectively assess muscle strength of children and adults in athletic and rehabilitative settings. This study examined test-retest reliability of isokinetic knee strength measurements in children aged 8 to 10 years and defined limits for the minimum difference (MD) in strength that indicates a clinically important change. Isokinetic knee strength measurements (using the Biodex System 4) in children will provide reliable results. Descriptive laboratory study. In 22 healthy children, 5 maximal concentric (CON) knee extensor (KE) and knee flexor (KF) contractions at 2 angular velocities (60 deg/s and 180 deg/s) and 5 maximal eccentric (ECC) KE/KF contractions at 60 deg/s were assessed 7 days apart. The intraclass correlation coefficient (ICC 2.1 ) was used to examine relative reliability, and the MD was calculated on the basis of standard error of measurement. ICCs for CON KE/KF peak torque measurements were fair to excellent (range, 0.49-0.81). The MD% values for CON KE and KF ranged from 31% to 37% at 60 deg/s and from 34% to 39% at 180 deg/s. ICCs in the ECC mode were good (range, 0.60-0.70), but associated MD% values were high (>50%). There was no systematic error for CON KE/KF and ECC KE strength measurements at 60 deg/s, but systematic error was found for all other measurements. The dynamometer provides a reliable analysis of isokinetic CON knee strength measurements at 60 deg/s in children aged 8 to 10 years. Measurements at 180 deg/s and in the ECC mode were not reliable, indicating a need for more familiarization prior to testing. The MD values may help clinicians to determine whether a change in knee strength is due to error or intervention.

Hybrid vs Adaptive Ensemble Kalman Filtering for Storm Surge Forecasting

Science.gov (United States)

Altaf, M. U.; Raboudi, N.; Gharamti, M. E.; Dawson, C.; McCabe, M. F.; Hoteit, I.

2014-12-01

Recent storm surge events due to Hurricanes in the Gulf of Mexico have motivated the efforts to accurately forecast water levels. Toward this goal, a parallel architecture has been implemented based on a high resolution storm surge model, ADCIRC. However the accuracy of the model notably depends on the quality and the recentness of the input data (mainly winds and bathymetry), model parameters (e.g. wind and bottom drag coefficients), and the resolution of the model grid. Given all these uncertainties in the system, the challenge is to build an efficient prediction system capable of providing accurate forecasts enough ahead of time for the authorities to evacuate the areas at risk. We have developed an ensemble-based data assimilation system to frequently assimilate available data into the ADCIRC model in order to improve the accuracy of the model. In this contribution we study and analyze the performances of different ensemble Kalman filter methodologies for efficient short-range storm surge forecasting, the aim being to produce the most accurate forecasts at the lowest possible computing time. Using Hurricane Ike meteorological data to force the ADCIRC model over a domain including the Gulf of Mexico coastline, we implement and compare the forecasts of the standard EnKF, the hybrid EnKF and an adaptive EnKF. The last two schemes have been introduced as efficient tools for enhancing the behavior of the EnKF when implemented with small ensembles by exploiting information from a static background covariance matrix. Covariance inflation and localization are implemented in all these filters. Our results suggest that both the hybrid and the adaptive approach provide significantly better forecasts than those resulting from the standard EnKF, even when implemented with much smaller ensembles.

Assessing sequential data assimilation techniques for integrating GRACE data into a hydrological model

KAUST Repository

Khaki, M.

2017-07-06

The time-variable terrestrial water storage (TWS) products from the Gravity Recovery And Climate Experiment (GRACE) have been increasingly used in recent years to improve the simulation of hydrological models by applying data assimilation techniques. In this study, for the first time, we assess the performance of the most popular data assimilation sequential techniques for integrating GRACE TWS into the World-Wide Water Resources Assessment (W3RA) model. We implement and test stochastic and deterministic ensemble-based Kalman filters (EnKF), as well as Particle filters (PF) using two different resampling approaches of Multinomial Resampling and Systematic Resampling. These choices provide various opportunities for weighting observations and model simulations during the assimilation and also accounting for error distributions. Particularly, the deterministic EnKF is tested to avoid perturbing observations before assimilation (that is the case in an ordinary EnKF). Gaussian-based random updates in the EnKF approaches likely do not fully represent the statistical properties of the model simulations and TWS observations. Therefore, the fully non-Gaussian PF is also applied to estimate more realistic updates. Monthly GRACE TWS are assimilated into W3RA covering the entire Australia. To evaluate the filters performances and analyze their impact on model simulations, their estimates are validated by independent in-situ measurements. Our results indicate that all implemented filters improve the estimation of water storage simulations of W3RA. The best results are obtained using two versions of deterministic EnKF, i.e. the Square Root Analysis (SQRA) scheme and the Ensemble Square Root Filter (EnSRF), respectively improving the model groundwater estimations errors by 34% and 31% compared to a model run without assimilation. Applying the PF along with Systematic Resampling successfully decreases the model estimation error by 23%.

[Development and evaluation of a dance-based exercise therapy for patients with haemophilia].

Science.gov (United States)

Czepa, D; van Ravenstein, S; Stäuber, F; Hilberg, T

2013-01-01

So far, the use of methods derived from creative arts has not been considered in the haemophilia treatment. The AIM was to investigate the expectations for a dance-based exercise therapy for patients with haemophilia and the extent of its acceptance. The one-hour dance-based exercise therapy was offered to 30 haemophilia patients (HI30) (49 ± 11, 30-67 years). For the evaluation of expectations, questionnaires were created and filled out by participants before and after the intervention. Additionally, 19 haemophilia patients (HF) and 20 controls without haemophilia (KF) who did not participate in the intervention were also questioned. The RESULTS show that haemophilia patients have more experience in dance than controls (HI30:62%, HF:74%, KF:45%). In contrast, the proportion of those who are currently dancing is higher in controls without haemophilia (HI30: 17%, HF: 10%, KF:26%). The termination of dance activity in patients with haemophilia who were part of the intervention was mainly due to pain (HI30: 40%, HF: 29%, KF: 0%), whereby controls without intervention terminated the dance activity mainly due to lack of time (HI30: 30%, HF: 57%, KF: 56%). Ultimately, 24 out of 30 patients with haemophilia (HI24) completed the intervention. All HI24 met their expectations. 38% felt limited by haemophilia while carrying out the exercises. The majority of the participants were able to follow the exercises well (96%) and were did not overstrain physically (92%) nor mentally (87%), also 79% did not have pain. 23 of HI24 (96%) can envision a continuation of the dance-based exercise therapy. The experience with the dance-based exercise therapy was predominantly positive. It represents an alternative sports therapy programme for patients with haemophilia. Further studies are needed in order to make statements concerning the long-term use of such training.

A Two-update Ensemble Kalman Filter for Land Hydrological Data Assimilation with an Uncertain Constraint

KAUST Repository

Khaki, M.

2017-10-25

Assimilating Gravity Recovery And Climate Experiment (GRACE) data into land hydrological models provides a valuable opportunity to improve the models’ forecasts and increases our knowledge of terrestrial water storages (TWS). The assimilation, however, may harm the consistency between hydrological water fluxes, namely precipitation, evaporation, discharge, and water storage changes. To address this issue, we propose a weak constrained ensemble Kalman filter (WCEnKF) that maintains estimated water budgets in balance with other water fluxes. Therefore, in this study, GRACE terrestrial water storages data are assimilated into the World-Wide Water Resources Assessment (W3RA) hydrological model over the Earth’s land areas covering 2002 – 2012. Multi-mission remotely sensed precipitation measurements from the Tropical Rainfall Measuring Mission (TRMM) and evaporation products from the Moderate Resolution Imaging Spectroradiometer (MODIS), as well as ground-based water discharge measurements are applied to close the water balance equation. The proposed WCEnKF contains two update steps; first, it incorporates observations from GRACE to improve model simulations of water storages, and second, uses the additional observations of precipitation, evaporation, and water discharge to establish the water budget closure. These steps are designed to account for error information associated with the included observation sets during the assimilation process. In order to evaluate the assimilation results, in addition to monitoring the water budget closure errors, in-situ groundwater measurements over the Mississippi River Basin in the US and the Murray-Darling Basin in Australia are used. Our results indicate approximately 24% improvement in the WCEnKF groundwater estimates over both basins compared to the use of (constraint-free) EnKF. WCEnKF also further reduces imbalance errors by approximately 82.53% (on average) and at the same time increases the correlations between the

Kick frequency affects the energy cost of aquatic locomotion in elite monofin swimmers.

Science.gov (United States)

Boitel, Guillaume; Vercruyssen, Fabrice; Alberty, Morgan; Nesi, Xavier; Bourdon, Lionel; Brisswalter, Jeanick

2010-08-01

The aim of this study was to evaluate the influence of kick frequency (K(F)) on the energy cost of aquatic locomotion in elite monofin (Mf) swimmers at the surface. Eight subjects of international calibre (4 females, 4 males) were requested to perform in a 50-m outdoor swimming pool: (1) a continuous multi-stage incremental test to determine maximal physiological responses and (2) a submaximal exercise composed of five constant Mf-swimming tests (600-m exercise, 5-min rest) at an intensity corresponding to 90% of the velocity at the maximal oxygen uptake (VO2max). The first submaximal Mf-swimming test was systematically conducted at a freely chosen K(F) (FCK(F)) and the other tests were performed at FCK(F) - 15%, FCK(F) - 10%, FCK(F) + 10% and FCK(F) + 20% in a random order. No significant effect of K(F) on ventilation, heart rate and blood lactate concentration was observed throughout the submaximal Mf-swimming tests. However, mean values in Ec or fraction of VO2max were significantly lower during the FCK(F) + 10% condition as compared to those observed during the FCK(F) - 15% (-11.5 and -9.6%, respectively, P < 0.05) and FCK(F) - 10% (-10.4 and -9.3%, respectively, P < 0.05) conditions. In conclusion, the lack of significant differences between FCK(F) + 10% and FCK(F) or FCK(F) + 20% does not allow to identify a specific trend, but suggests the occurrence of an energetically optimal K(F) close to that freely chosen by the Mf swimmers. Variations in muscle activity level and active drag have been hypothesized to explain the observed differences in Ec consecutive to the selection of various K(F).

Kissed awake. From timbered house to a KfW efficiency house monument; Wachgekuesst. Vom Fachwerkhaus zum KfW-Effizienzhaus Denkmal

Energy Technology Data Exchange (ETDEWEB)

Siegele, Klaus

2013-02-15

More than twenty years after acquisition of a courtyard area from the 18th century the owners decided to retrofit the building comprehensively and gently. This building is under preservation order. An interior thermal insulation using wood fibre boards with wall heating and clay plaster, framed windows as well as a new pellet-fuelled heating system halved the heat requirement and enhanced the indoor comfort in the gorgeous timbered house.

Language training

CERN Multimedia

2015-01-01

General & Professional French courses The next General & Professional French course will start on 4 May. These collective courses aim to bring participants who have at least level A1 to higher levels (up to C2). The workload of each course is 60 hours and consists of a combination of face-to-face sessions (40 hours) with personal work (20 hours) following a specially designed programme. A final progress test takes place at the end of the term. If you have not followed a French course in January please sign up for a placement test! French courses for beginners The aim of this course is to give some basic skills to beginners in order to be able to communicate in simple daily life situations in both social and professional life. These courses can start at any time during the year, as soon as a group of beginners has been identified. Participants can apply for a semi-intensive (10-week courses with 6 hours of classes per week) course and choose between different schedules (morning-lunch time &...

Language training

CERN Multimedia

2015-01-01

General and Professional French courses The next General and Professional French course will start on 4 May. These collective courses aim to bring participants who have at least level A1 to higher levels (up to C2). The workload of each course is 60 hours and consists of a specially designed programme combining face-to-face sessions (40 hours) and indipendent study (20 hours). A final progress test takes place at the end of the term. If you did not take a French course in January, please sign up for a placement test! French courses for beginners The aim of this course is to give some basic skills to beginners in order to be able to communicate in simple daily life situations in both social and professional life. These courses can start at any time during the year, as soon as a group of beginners has been identified. Participants can apply for a semi-intensive course (10-weeks with 6 hours of classes per week) and choose between different timetables (morning-lunch time – late afternoon). If ...

A Sparse Bayesian Imaging Technique for Efficient Recovery of Reservoir Channels With Time-Lapse Seismic Measurements

KAUST Repository

Sana, Furrukh

2016-06-01

Subsurface reservoir flow channels are characterized by high-permeability values and serve as preferred pathways for fluid propagation. Accurate estimation of their geophysical structures is thus of great importance for the oil industry. The ensemble Kalman filter (EnKF) is a widely used statistical technique for estimating subsurface reservoir model parameters. However, accurate reconstruction of the subsurface geological features with the EnKF is challenging because of the limited measurements available from the wells and the smoothing effects imposed by the \\\\ell _{2} -norm nature of its update step. A new EnKF scheme based on sparse domain representation was introduced by Sana et al. (2015) to incorporate useful prior structural information in the estimation process for efficient recovery of subsurface channels. In this paper, we extend this work in two ways: 1) investigate the effects of incorporating time-lapse seismic data on the channel reconstruction; and 2) explore a Bayesian sparse reconstruction algorithm with the potential ability to reduce the computational requirements. Numerical results suggest that the performance of the new sparse Bayesian based EnKF scheme is enhanced with the availability of seismic measurements, leading to further improvement in the recovery of flow channels structures. The sparse Bayesian approach further provides a computationally efficient framework for enforcing a sparse solution, especially with the possibility of using high sparsity rates through the inclusion of seismic data.

The role of model dynamics in ensemble Kalman filter performance for chaotic systems

Science.gov (United States)

Ng, G.-H.C.; McLaughlin, D.; Entekhabi, D.; Ahanin, A.

2011-01-01

The ensemble Kalman filter (EnKF) is susceptible to losing track of observations, or 'diverging', when applied to large chaotic systems such as atmospheric and ocean models. Past studies have demonstrated the adverse impact of sampling error during the filter's update step. We examine how system dynamics affect EnKF performance, and whether the absence of certain dynamic features in the ensemble may lead to divergence. The EnKF is applied to a simple chaotic model, and ensembles are checked against singular vectors of the tangent linear model, corresponding to short-term growth and Lyapunov vectors, corresponding to long-term growth. Results show that the ensemble strongly aligns itself with the subspace spanned by unstable Lyapunov vectors. Furthermore, the filter avoids divergence only if the full linearized long-term unstable subspace is spanned. However, short-term dynamics also become important as non-linearity in the system increases. Non-linear movement prevents errors in the long-term stable subspace from decaying indefinitely. If these errors then undergo linear intermittent growth, a small ensemble may fail to properly represent all important modes, causing filter divergence. A combination of long and short-term growth dynamics are thus critical to EnKF performance. These findings can help in developing practical robust filters based on model dynamics. ?? 2011 The Authors Tellus A ?? 2011 John Wiley & Sons A/S.

A Sparse Bayesian Imaging Technique for Efficient Recovery of Reservoir Channels With Time-Lapse Seismic Measurements

KAUST Repository

Sana, Furrukh; Ravanelli, Fabio; Al-Naffouri, Tareq Y.; Hoteit, Ibrahim

2016-01-01

Subsurface reservoir flow channels are characterized by high-permeability values and serve as preferred pathways for fluid propagation. Accurate estimation of their geophysical structures is thus of great importance for the oil industry. The ensemble Kalman filter (EnKF) is a widely used statistical technique for estimating subsurface reservoir model parameters. However, accurate reconstruction of the subsurface geological features with the EnKF is challenging because of the limited measurements available from the wells and the smoothing effects imposed by the \\ell _{2} -norm nature of its update step. A new EnKF scheme based on sparse domain representation was introduced by Sana et al. (2015) to incorporate useful prior structural information in the estimation process for efficient recovery of subsurface channels. In this paper, we extend this work in two ways: 1) investigate the effects of incorporating time-lapse seismic data on the channel reconstruction; and 2) explore a Bayesian sparse reconstruction algorithm with the potential ability to reduce the computational requirements. Numerical results suggest that the performance of the new sparse Bayesian based EnKF scheme is enhanced with the availability of seismic measurements, leading to further improvement in the recovery of flow channels structures. The sparse Bayesian approach further provides a computationally efficient framework for enforcing a sparse solution, especially with the possibility of using high sparsity rates through the inclusion of seismic data.

Automated control system structure of the USSR Academy of Science Kaon facility

International Nuclear Information System (INIS)

Ivanov, Yu.S.; Konovalov, V.A.; Murin, B.P.; Filipchicov, L.L.; Esin, S.K.; Senichev, Yu.V.

1992-01-01

Up to date at Nuclear Research Institute of the USSR AS (Moscow-Troitsk) it is finished building of Moscow Meson Facility high intensity current proton Linear Accelerator (LA) (beam parameters: energy - 600 MeV, average current - 0.5 mA, pulse current - 50 mA). The LA proposed to serve as Kaon facility (KF) injector which is under working out [1]. Kaon complex, in addition to LA, includes: buster proton synchrotron (BR) with output energy 7.5 GeV, main synchrotron (SR) with proton energy up to 45 GeV and storer-stretcher (SS). The KF is proposed to work at 3 regimes. At first regime SS follows SR and is used as beam stretcher. KF time work diagram is cleaned by Fig.la. A half of beam pulses from LA and BR is used at ones for physical experiments. At second regime SS is inserted between BR and SR and works as collector. At third regime it is supposed to store in SS 4-6 beam pulses with next fast exit to experiment. The such kind using allows to receive terra watt power level pulses (8 · 10 14 particles with 45 GeV energy) with frequency of 1 Hz. There are presented below brief description of KF systems, which are concerned of radiotechnical systems (RTS) control (ACS) and adjusting (AAS). (author)

Three-dimensional echocardiography

International Nuclear Information System (INIS)

Buck, Thomas

2011-01-01

Presents tips and tricks for beginners and experts Provides educational material for 3D training courses Features comprehensively illustrated cases Includes an accompanying DVD with video clips of all sample cases Three-dimensional echocardiography is the most recent fundamental advancement in echocardiography. Since real-time 3D echocardiography became commercially available in 2002, it has rapidly been accepted in echo labs worldwide. This book covers all clinically relevant aspects of this fascinating new technology, including a comprehensive explanation of its basic principles, practical aspects of clinical application, and detailed descriptions of specific uses in the broad spectrum of clinically important heart disease. The book was written by a group of well-recognized international experts in the field, who have not only been involved in the scientific and clinical evolution of 3D echocardiography since its inception but are also intensively involved in expert training courses. As a result, the clear focus of this book is on the practical application of 3D echocardiography in daily clinical routine with tips and tricks for both beginners and experts, accompanied by more than 150 case examples comprehensively illustrated in more than 800 images and more than 500 videos provided on a DVD. In addition to an in-depth review of the most recent literature on real-time 3D echocardiography, this book represents an invaluable reference work for beginners and expert users of 3D echocardiography. - Tips and tricks for beginners and experts - Educational material for 3D training courses - Comprehensively illustrated cases - DVD with video clips of all sample cases.

Initial CAD investigations for NET

International Nuclear Information System (INIS)

Katz, F.; Leinemann, K.; Ludwig, A.; Marek, U.; Olbrich, W.; Schlechtendahl, E.G.

1985-11-01

This report summarizes the work done under contract no. 164/84-7/FU-D-/NET between the Commission of the European Communities and KfK during the period from June 1, 1984, through May 31, 1985. The following topics are covered in this report: Initial modelling of NET version NET2A, CAD system extension for remote handling studies, analysis of the CAD information structure, work related to the transfer of CAD information between KfK and the NET team. (orig.) [de

Nachhaltigkeit von drei graslandbasierten Milchproduktionssystemen in der Schweiz mit der Bewertungsmethode RISE

OpenAIRE

Sperling, P.; Thalmann, Christian; Reidy, B.; Kneubühler, L.; Grenz, Jan; Hofstetter, Pius

2017-01-01

Dairy farming is a key sector for Swiss agriculture and the food industry. Therefore, sustainability of dairy farms is important. Grassland-based farming systems are the most common production system, combining the indoor feeding of fresh grass with partial grazing. The effects of three dairy production systems (VW: full grazing plus on avg. 46±93 SD kg concentrate (KF), GFKF: indoor feeding/partial grazing plus on avg. 345±204 SD kg KF and GFKFplus: indoor feeding/partial grazing plus...

Stock Market Integration Measurement: Investigation of Malaysia and Singapore Stock Markets

OpenAIRE

B. K. Yeoh; Z. Arsad; C. W. Hooy

2010-01-01

This paper tests the level of market integration between Malaysia and Singapore stock markets with the world market. Kalman Filter (KF) methodology is used on the International Capital Asset Pricing Model (ICAPM) and the pricing errors estimated within the framework of ICAPM are used as a measure of market integration or segmentation. The advantage of the KF technique is that it allows for time-varying coefficients in estimating ICAPM and hence able to capture the varying degree of market int...

Windows 10 simplified

CERN Document Server

McFedries, Paul

2015-01-01

Learn Windows 10 quickly and painlessly with this beginner's guide Windows 10 Simplified is your absolute beginner's guide to the ins and outs of Windows. Fully updated to cover Windows 10, this highly visual guide covers all the new features in addition to the basics, giving you a one-stop resource for complete Windows 10 mastery. Every page features step-by-step screen shots and plain-English instructions that walk you through everything you need to know, no matter how new you are to Windows. You'll master the basics as you learn how to navigate the user interface, work with files, create

Language in use intermediate : classroom book

CERN Document Server

Doff, Adrian

1995-01-01

ach of the four levels comprises about 80 hours of class work, with additional time for the self-study work. The Teacher's Book contains all the pages from the Classroom Book, with interleaved teaching notes including optional activities to cater for different abilities. There is a video to accompany the Beginner, Pre-intermediate and Intermediate levels. Each video contains eight stimulating and entertaining short programmes, as well as a booklet of photocopiable activities. Free test material is available in booklet and web format for Beginner and Pre-intermediate levels. Visit www.cambridge.org/elt/liu or contact your local Cambridge University Press representative.

Language in use intermediate : teacher's book

CERN Document Server

Doff, Adrian

1998-01-01

Each of the four levels comprises about 80 hours of class work, with additional time for the self-study work. The Teacher's Book contains all the pages from the Classroom Book, with interleaved teaching notes including optional activities to cater for different abilities. There is a video to accompany the Beginner, Pre-intermediate and Intermediate levels. Each video contains eight stimulating and entertaining short programmes, as well as a booklet of photocopiable activities. Free test material is available in booklet and web format for Beginner and Pre-intermediate levels. Visit www.cambridge.org/elt/liu or contact your local Cambridge University Press representative.

Language in use intermediate : self-study workbook

CERN Document Server

Doff, Adrian

1994-01-01

Each of the four levels comprises about 80 hours of class work, with additional time for the self-study work. The Teacher's Book contains all the pages from the Classroom Book, with interleaved teaching notes including optional activities to cater for different abilities. There is a video to accompany the Beginner, Pre-intermediate and Intermediate levels. Each video contains eight stimulating and entertaining short programmes, as well as a booklet of photocopiable activities. Free test material is available in booklet and web format for Beginner and Pre-intermediate levels. Visit www.cambridge.org/elt/liu or contact your local Cambridge University Press representative.

Microsoft Windows Security Essentials

CERN Document Server

Gibson, Darril

2011-01-01

Windows security concepts and technologies for IT beginners IT security can be a complex topic, especially for those new to the field of IT. This full-color book, with a focus on the Microsoft Technology Associate (MTA) program, offers a clear and easy-to-understand approach to Windows security risks and attacks for newcomers to the world of IT. By paring down to just the essentials, beginners gain a solid foundation of security concepts upon which more advanced topics and technologies can be built. This straightforward guide begins each chapter by laying out a list of topics to be discussed,

Enhanced recovery of subsurface geological structures using compressed sensing and the Ensemble Kalman filter

KAUST Repository

Sana, Furrukh

2015-07-26

Recovering information on subsurface geological features, such as flow channels, holds significant importance for optimizing the productivity of oil reservoirs. The flow channels exhibit high permeability in contrast to low permeability rock formations in their surroundings, enabling formulation of a sparse field recovery problem. The Ensemble Kalman filter (EnKF) is a widely used technique for the estimation of subsurface parameters, such as permeability. However, the EnKF often fails to recover and preserve the channel structures during the estimation process. Compressed Sensing (CS) has shown to significantly improve the reconstruction quality when dealing with such problems. We propose a new scheme based on CS principles to enhance the reconstruction of subsurface geological features by transforming the EnKF estimation process to a sparse domain representing diverse geological structures. Numerical experiments suggest that the proposed scheme provides an efficient mechanism to incorporate and preserve structural information in the estimation process and results in significant enhancement in the recovery of flow channel structures.

Dynamic calibration of agent-based models using data assimilation.

Science.gov (United States)

Ward, Jonathan A; Evans, Andrew J; Malleson, Nicolas S

2016-04-01

A widespread approach to investigating the dynamical behaviour of complex social systems is via agent-based models (ABMs). In this paper, we describe how such models can be dynamically calibrated using the ensemble Kalman filter (EnKF), a standard method of data assimilation. Our goal is twofold. First, we want to present the EnKF in a simple setting for the benefit of ABM practitioners who are unfamiliar with it. Second, we want to illustrate to data assimilation experts the value of using such methods in the context of ABMs of complex social systems and the new challenges these types of model present. We work towards these goals within the context of a simple question of practical value: how many people are there in Leeds (or any other major city) right now? We build a hierarchy of exemplar models that we use to demonstrate how to apply the EnKF and calibrate these using open data of footfall counts in Leeds.

Enhanced recovery of subsurface geological structures using compressed sensing and the Ensemble Kalman filter

KAUST Repository

Sana, Furrukh; Katterbauer, Klemens; Al-Naffouri, Tareq Y.; Hoteit, Ibrahim

2015-01-01

Recovering information on subsurface geological features, such as flow channels, holds significant importance for optimizing the productivity of oil reservoirs. The flow channels exhibit high permeability in contrast to low permeability rock formations in their surroundings, enabling formulation of a sparse field recovery problem. The Ensemble Kalman filter (EnKF) is a widely used technique for the estimation of subsurface parameters, such as permeability. However, the EnKF often fails to recover and preserve the channel structures during the estimation process. Compressed Sensing (CS) has shown to significantly improve the reconstruction quality when dealing with such problems. We propose a new scheme based on CS principles to enhance the reconstruction of subsurface geological features by transforming the EnKF estimation process to a sparse domain representing diverse geological structures. Numerical experiments suggest that the proposed scheme provides an efficient mechanism to incorporate and preserve structural information in the estimation process and results in significant enhancement in the recovery of flow channel structures.

Operational aspects of asynchronous filtering for improved flood forecasting

Science.gov (United States)

Rakovec, Oldrich; Weerts, Albrecht; Sumihar, Julius; Uijlenhoet, Remko

2014-05-01

Hydrological forecasts can be made more reliable and less uncertain by recursively improving initial conditions. A common way of improving the initial conditions is to make use of data assimilation (DA), a feedback mechanism or update methodology which merges model estimates with available real world observations. The traditional implementation of the Ensemble Kalman Filter (EnKF; e.g. Evensen, 2009) is synchronous, commonly named a three dimensional (3-D) assimilation, which means that all assimilated observations correspond to the time of update. Asynchronous DA, also called four dimensional (4-D) assimilation, refers to an updating methodology, in which observations being assimilated into the model originate from times different to the time of update (Evensen, 2009; Sakov 2010). This study investigates how the capabilities of the DA procedure can be improved by applying alternative Kalman-type methods, e.g., the Asynchronous Ensemble Kalman Filter (AEnKF). The AEnKF assimilates observations with smaller computational costs than the original EnKF, which is beneficial for operational purposes. The results of discharge assimilation into a grid-based hydrological model for the Upper Ourthe catchment in Belgian Ardennes show that including past predictions and observations in the AEnKF improves the model forecasts as compared to the traditional EnKF. Additionally we show that elimination of the strongly non-linear relation between the soil moisture storage and assimilated discharge observations from the model update becomes beneficial for an improved operational forecasting, which is evaluated using several validation measures. In the current study we employed the HBV-96 model built within a recently developed open source modelling environment OpenStreams (2013). The advantage of using OpenStreams (2013) is that it enables direct communication with OpenDA (2013), an open source data assimilation toolbox. OpenDA provides a number of algorithms for model calibration

A derékfájás

DEFF Research Database (Denmark)

Tamás, Illés S.

2015-01-01

goal of the treatment is to prevent becoming chronic the symptomatology. Objectives of the management of chronic low back pain are effective pain reduction, continuous maintainance of physical activity, prevention of permanent disability, and restoration of working ability. Analgesics, non steroid anti...

Reference manual for the KfK code PCROSS

International Nuclear Information System (INIS)

Ravndal, S.; Oblozinsky, P.; Kelzenberg, S.; Cierjacks, S.

1991-12-01

The PCROSS code calculates the so-called 'pseudo' cross sections for sequential (x,n) reactions and merges them together with 'effective' cross section for neutron induced reactions into one file of 'collapsed' cross sections. The file is tailored to provide an input for the FISPACT inventory code that calculates the activation and related radiological quantities of material irradiated in given neutron fields. The report summarizes calculational procedure and provides the reader with essential technical details of the code PCROSS (version 1.0) such as description of parameters, common blocks and subroutines. (orig.) [de

Nuclear Safety Project. Annual report 1986

International Nuclear Information System (INIS)

1987-09-01

The annual report 1986 is a detailed description of work within the Nuclear Safety Project performed in 1986 in the nuclear safety field by KfK institutes and departments and by external institutes on behalf of KfK. It includes individual research activities on dynamic loads and strains of reactor components under accident conditions, fuel behaviour under accident conditions, investigation and control of LWR core-meltdown accidents, improvement of fission product retention and reduction of radiation exposure, and on behaviour, impact and removal of released pollutants. (DG)

Proceedings of the Joint International Symposium on Molten Salts. Held in Honolulu Hawaii on 18-23 October 1987. Volume 87-7

Science.gov (United States)

1987-01-01

A C4 < ’~ - C C. *2 580 BEHAVIOUR OF HF/H 2 ELECTRODE IN A MOLTEN LiF-KF SYSTEM Keiko Ema, Yasuhiko Ito, Toshihide Takenaka and Jun Oishi Department...n (911. 0mo .I t 794. SMOOTH ELECTRODEPOSITS OF MOLYBDENUM FROM KF-B 2 03-Li 2MoO 4 MELT Koichiro Koyama and Yasuhiko Hashimoto Department of...HAtDE Hideki Yabe, Yasuhiko Ito, Keiko Ema and Jun Oishi Department of Nuclear Engineering, Faculty of Engineering, Kyoto University, Sakyo-ku, Kyoto 606

Particle Kalman Filtering: A Nonlinear Bayesian Framework for Ensemble Kalman Filters*

KAUST Repository

Hoteit, Ibrahim

2012-02-01

This paper investigates an approximation scheme of the optimal nonlinear Bayesian filter based on the Gaussian mixture representation of the state probability distribution function. The resulting filter is similar to the particle filter, but is different from it in that the standard weight-type correction in the particle filter is complemented by the Kalman-type correction with the associated covariance matrices in the Gaussian mixture. The authors show that this filter is an algorithm in between the Kalman filter and the particle filter, and therefore is referred to as the particle Kalman filter (PKF). In the PKF, the solution of a nonlinear filtering problem is expressed as the weighted average of an “ensemble of Kalman filters” operating in parallel. Running an ensemble of Kalman filters is, however, computationally prohibitive for realistic atmospheric and oceanic data assimilation problems. For this reason, the authors consider the construction of the PKF through an “ensemble” of ensemble Kalman filters (EnKFs) instead, and call the implementation the particle EnKF (PEnKF). It is shown that different types of the EnKFs can be considered as special cases of the PEnKF. Similar to the situation in the particle filter, the authors also introduce a resampling step to the PEnKF in order to reduce the risk of weights collapse and improve the performance of the filter. Numerical experiments with the strongly nonlinear Lorenz-96 model are presented and discussed.

Pore pressure propagation in a permeable thin-layer coal seam based on a dual porosity model: A case of risk prediction of water inrush in coalmines

Science.gov (United States)

Zhu, B.; Gao, F.; Yang, J. W.; Zhou, G. Q.

2016-08-01

Thin-layer coal seams, a type of filling coal rock body, are considered aquifer systems made up of dual porosity medium with immediate floor. A numerical simulation for the pore pressure propagation along a thin-layer coal seam was carried out for the case of the Zhaogezhuang coalmine in China. By valuing the permeability (Kf ) of the thin-layer coal seam, pore pressure variation with time was simulated and compared to the analytical solutions of a dual porosity model (DPM). The main conclusions were drawn as follow: (1) Seepage in the thin-layer coal seam was predominant in the whole process, and the distance of seepage was lengthened and the pore pressure decreased with increased Kf , (2) A series of simulated hydraulic graphs demonstrated that the pore pressure characteristics of peak-occurring and time-lag effects agreed with the analytical solutions of DPM; (3) By adjusting the parameters of DPM, two results of analytical solutions and numerical solutions fit well, particularly in the thin-layer coal seam, (4) The power law relationship between the peak-values and lag time of pore pressure were derived statistically under consideration of the Kf parameter in the range of 10-8 to 10-10 m2/pa-s orders, and it was reasonable that the Kf of the thin-layer coal seam was in the range of 10-8 m2/pa-s orders. The results were significantly helpful in decision-making for mining water prevention and prediction in practice.

Robust Ensemble Filtering and Its Relation to Covariance Inflation in the Ensemble Kalman Filter

KAUST Repository

Luo, Xiaodong

2011-12-01

A robust ensemble filtering scheme based on the H∞ filtering theory is proposed. The optimal H∞ filter is derived by minimizing the supremum (or maximum) of a predefined cost function, a criterion different from the minimum variance used in the Kalman filter. By design, the H∞ filter is more robust than the Kalman filter, in the sense that the estimation error in the H∞ filter in general has a finite growth rate with respect to the uncertainties in assimilation, except for a special case that corresponds to the Kalman filter. The original form of the H∞ filter contains global constraints in time, which may be inconvenient for sequential data assimilation problems. Therefore a variant is introduced that solves some time-local constraints instead, and hence it is called the time-local H∞ filter (TLHF). By analogy to the ensemble Kalman filter (EnKF), the concept of ensemble time-local H∞ filter (EnTLHF) is also proposed. The general form of the EnTLHF is outlined, and some of its special cases are discussed. In particular, it is shown that an EnKF with certain covariance inflation is essentially an EnTLHF. In this sense, the EnTLHF provides a general framework for conducting covariance inflation in the EnKF-based methods. Some numerical examples are used to assess the relative robustness of the TLHF–EnTLHF in comparison with the corresponding KF–EnKF method.

Efficient Data Assimilation Algorithms for Bathymetry Applications

Science.gov (United States)

Ghorbanidehno, H.; Kokkinaki, A.; Lee, J. H.; Farthing, M.; Hesser, T.; Kitanidis, P. K.; Darve, E. F.

2016-12-01

Information on the evolving state of the nearshore zone bathymetry is crucial to shoreline management, recreational safety, and naval operations. The high cost and complex logistics of using ship-based surveys for bathymetry estimation have encouraged the use of remote sensing monitoring. Data assimilation methods combine monitoring data and models of nearshore dynamics to estimate the unknown bathymetry and the corresponding uncertainties. Existing applications have been limited to the basic Kalman Filter (KF) and the Ensemble Kalman Filter (EnKF). The former can only be applied to low-dimensional problems due to its computational cost; the latter often suffers from ensemble collapse and uncertainty underestimation. This work explores the use of different variants of the Kalman Filter for bathymetry applications. In particular, we compare the performance of the EnKF to the Unscented Kalman Filter and the Hierarchical Kalman Filter, both of which are KF variants for non-linear problems. The objective is to identify which method can better handle the nonlinearities of nearshore physics, while also having a reasonable computational cost. We present two applications; first, the bathymetry of a synthetic one-dimensional cross section normal to the shore is estimated from wave speed measurements. Second, real remote measurements with unknown error statistics are used and compared to in situ bathymetric survey data collected at the USACE Field Research Facility in Duck, NC. We evaluate the information content of different data sets and explore the impact of measurement error and nonlinearities.

Mass size distribution of particle-bound water

Science.gov (United States)

Canepari, S.; Simonetti, G.; Perrino, C.

2017-09-01

The thermal-ramp Karl-Fisher method (tr-KF) for the determination of PM-bound water has been applied to size-segregated PM samples collected in areas subjected to different environmental conditions (protracted atmospheric stability, desert dust intrusion, urban atmosphere). This method, based on the use of a thermal ramp for the desorption of water from PM samples and the subsequent analysis by the coulometric KF technique, had been previously shown to differentiate water contributes retained with different strength and associated to different chemical components in the atmospheric aerosol. The application of the method to size-segregated samples has revealed that water showed a typical mass size distribution in each one of the three environmental situations that were taken into consideration. A very similar size distribution was shown by the chemical PM components that prevailed during each event: ammonium nitrate in the case of atmospheric stability, crustal species in the case of desert dust, road-dust components in the case of urban sites. The shape of the tr-KF curve varied according to the size of the collected particles. Considering the size ranges that better characterize the event (fine fraction for atmospheric stability, coarse fraction for dust intrusion, bi-modal distribution for urban dust), this shape is coherent with the typical tr-KF shape shown by water bound to the chemical species that predominate in the same PM size range (ammonium nitrate, crustal species, secondary/combustion species - road dust components).

Different hydraulic traits of woody plants from tropical forests with contrasting soil water availability.

Science.gov (United States)

Zhu, Shi-Dan; Chen, Ya-Jun; Fu, Pei-Li; Cao, Kun-Fang

2017-11-01

In southwestern China, tropical karst forests (KF) and non-karst rain forests (NKF) have different species composition and forest structure owing to contrasting soil water availability, but with a few species that occur in both forests. Plant hydraulic traits are important for understanding the species' distribution patterns in these two forest types, but related studies are rare. In this study, we investigated hydraulic conductivity, vulnerability to drought-induced cavitation and wood anatomy of 23 abundant and typical woody species from a KF and a neighboring NKF, as well as two Bauhinia liana species common to both forests. We found that the KF species tended to have higher sapwood density, smaller vessel diameter, lower specific hydraulic conductivity (ks) and leaf to sapwood area ratio, and were more resistant to cavitation than NKF species. Across the 23 species distinctly occurring in either KF or NKF, there was a significant tradeoff between hydraulic efficiency and safety, which might be an underlying mechanism for distributions of these species across the two forests. Interestingly, by possessing rather large and long vessels, the two Bauhinia liana species had extremely high ks but were also high resistance to cavitation (escaping hydraulic tradeoff). This might be partially due to their distinctly dimorphic vessels, but contribute to their wide occurrence in both forests. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Treino musical e capacidade da memória operacional em crianças iniciantes, veteranas e sem conhecimentos musicais Musical training and working memory span in beginners, veterans and with no musical knowledge children

Directory of Open Access Journals (Sweden)

Fabiana Silva Ribeiro

2012-01-01

Full Text Available A memória operacional e a atividade musical ativam áreas encefálicas recíprocas e homólogas, contudo não há evidências se o treino musical pode ampliar a capacidade da memória operacional. Objetivo: Avaliar o desempenho do treino musical sob a memória operacional em crianças de 9 e 10 anos de idade, praticantes de treino musical e sem experiência musical. PARTICIPANTES: Crianças Iniciantes (n=20, Veteranas (n=20 e Grupo Controle (n=20. MATERIAIS: Instrumentos computadorizados para avaliação da memória operacional. RESULTADOS: Crianças veteranas apresentaram melhores pontuações no BCPR (Teste de Repetição de Pseudopalavras para crianças brasileiras e em subtestes da AWMA (Avaliação Automatizada da Memória Operacional. CONCLUSÃO: O treino musical parece ter contribuído para o desenvolvimento da memória operacional em crianças veteranas no programa de treino musical.Working memory and musical activity activate reciprocal and homologues brain areas. However, there is a lack of evidence if musical training can amplify the working memory span. Objective: To assess the performance of musical training on working memory in children aged 9 and 10 years old who regularly have musical training or with no musical training at all. PARTICIPANTS: Beginners (n=20, Veterans (n=20 and a Control Group (n=20. MATERIALS: Computerized instruments to assess working memory. RESULTS: Veteran children presented higher scores in BCPR (Brazilian Children's Test of Pseudoword Repetition and in specific tasks of AWMA (Automated Working Memory Assessment. CONCLUSION: Musical training seems to have contributed for working memory development in veteran children under musical training programs.

Is CEUS (contrast enhanced ultrasonography a useful tool in a beginner’s hands? How much can CAD (computer assisted diagnosis prototype help us in the characterization of malignancy in focal lesions of the liver?

Directory of Open Access Journals (Sweden)

Tudor Voicu Moga1,

2016-12-01

Full Text Available OBJECTIVES CEUS improved the characterization of focal lesions of the liver (FLLs, but it remains an operator-dependent method. The goal of this scientific paper was to test a computer assisted diagnosis (CAD prototype. MATERIALS AND METHODS 97 CEUS videos [34% hepatocellular carcinomas (HCC, 12.3% hypervascular metastases (HiperM, 11.3% hypovascular metastases (HipoM, 24.7% hemangiomas (HMG, 17.5% focal nodular hyperplasia (FNH] were used to develop a CAD prototype based on an algorithm that tested a binary decision classifier. Two young MDs, two experts and the CAD prototype, reevaluated 50 CEUS videos (diagnosis of benign vs. malignant lesions, in order to evaluate the beginner vs. expert diagnostic gap, the first being blinded by clinical data. RESULTS I-Beginner misdiagnosed 4/10-FNH, 3/10-HCC, 2/10-HMG, 1/10-HiperM, 1/10-HipoM. After being informed about the clinical data 2/10-FNH, 1/10-HCC. II-beginner misdiagnosed: 3/10-FNH; 3/10-HCC, 2/10- HMG, 1/10-HiperM. Unblinded: 1/10-HCC, 1/10- HMG. I-Expert: only 1/10-FNH, 1/10-HCC, 1/10- HMG misdiagnosed. Unblinded: all lesions were correctly diagnosed. II-Expert: 1/10-FNH, 1/10-HCC misdiagnosed. Unblinded: only 1/10-FNH was misdiagnosed. The CAD classifier managed a 75.2% overall correct classification rate. The overall classification before and after the uncovering of clinical data was: I beginner 78 %; 94%, II 82%; 96%. I expert 94%; 100%. II 96%; 98%. CONCLUSIONS The CAD prototype can assist a beginner for a better CEUS diagnostic accuracy. The integration of clinical data in the CAD algorithm is essential. Graphical abstract: Average Intensity variation in Arterial and Late Phase with supra unitary (meaning wash in and sub unitary pattern (meaning washout. REFERENCES 1.Sugimoto K, Shiraishi J, Moriyasu F, Doi K. Computer-aided diagnosis for contrast-enhanced ultrasound in the liver. World J Gastroenterol. 2010;2:215-223. 2. Gatos I, Tsantis S, Spiliopoulos S, Skouroliakou A, Theotokas I

Dicty_cDB: AFM177 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ESFGGATTFNFTS SILPIPFKSIIECNGLEEVNQSSKSYKFNDTIKINPFEIKTFRFISN*klkiklinkykn kf Translated Amino Acid sequence...ISETPFSLASTTHIDKTFISTNKEAIIVDTIKKAEDGTSFVVRVYESFGGATTFNFTS SILPIPFKSIIECNGLEEVNQSSKSYKFNDTIKINPFEIKTFRFISN*klkiklinky

Multimedia-assisted breathwalk-aware system.

Science.gov (United States)

Yu, Meng-Chieh; Wu, Huan; Lee, Ming-Sui; Hung, Yi-Ping

2012-12-01

Breathwalk is a science of combining specific patterns of footsteps synchronized with the breathing. In this study, we developed a multimedia-assisted Breathwalk-aware system which detects user's walking and breathing conditions and provides appropriate multimedia guidance on the smartphone. Through the mobile device, the system enhances user's awareness of walking and breathing behaviors. As an example application in slow technology, the system could help meditator beginners learn "walking meditation," a type of meditation which aims to be as slow as possible in taking pace, to synchronize footstep with breathing, and to land every footstep with toes first. In the pilot study, we developed a walking-aware system and evaluated whether multimedia-assisted mechanism is capable of enhancing beginner's walking awareness while walking meditation. Experimental results show that it could effectively assist beginners in slowing down the walking speed and decreasing incorrect footsteps. In the second experiment, we evaluated the Breathwalk-aware system to find a better feedback mechanism for learning the techniques of Breathwalk while walking meditation. The experimental results show that the visual-auditory mechanism is a better multimedia-assisted mechanism while walking meditation than visual mechanism and auditory mechanism.

Benign and efficient preparation of thioethers by solvent-free S-alkylation of thiols with alkyl halides catalyzed by potassium fluoride on alumina

DEFF Research Database (Denmark)

Nguyen, Kha Ngoc; Duus, Fritz; Luu, Thi Xuan Thi

2016-01-01

The preparation of thioethers by S-alkylation of various thiols with alkyl halides under solvent-free reaction conditions using potassium fluoride on alumina (KF/Al2O3) as a solid catalyst has been investigated in detail with respect to three different modes of reaction activation (ultrasound...... irradiation, microwave irradiation, and conventional heating) for obtaining maximum yield of the thioether. The importance of KF/Al2O3 as a particularly efficient catalyst was corroborated for all three modes of reaction activation, although the reaction time was found to be strongly dependent on the mode...

Recursive B-spline approximation using the Kalman filter

Directory of Open Access Journals (Sweden)

Jens Jauch

2017-02-01

Full Text Available This paper proposes a novel recursive B-spline approximation (RBA algorithm which approximates an unbounded number of data points with a B-spline function and achieves lower computational effort compared with previous algorithms. Conventional recursive algorithms based on the Kalman filter (KF restrict the approximation to a bounded and predefined interval. Conversely RBA includes a novel shift operation that enables to shift estimated B-spline coefficients in the state vector of a KF. This allows to adapt the interval in which the B-spline function can approximate data points during run-time.

Public relations activities of the Karlsruhe Nuclear Research Center - a national research center contributes to opinion forming

International Nuclear Information System (INIS)

Koerting, K.

1988-01-01

At the Karlsruhe Nuclear Research Center, the Public Relations Department directly reports to the Chief Executive Officer. The head of the Public Relation Department acts as spokesman of the center in the public, which requires him to be fully informed of the work of all units and of the policy goals of the executive board. The key tools used by the Public Relations Department are KfK-Hausmitteilungen, accident information, the scientific journal KfK-Nachrichten, press releases, exhibitions, fairs, guided tours, and nuclear energy information staff. (DG)

An overview of physico-chemical properties of molten fluoride for nuclear applications

International Nuclear Information System (INIS)

Dash, Smruti

2013-01-01

The general aim of this study is to provide an overview of the key research trends of physicochemical properties of molten salts. This study also calculated the coefficient of viscosities of NaF, KF, FeF 2 , NiF 2 and different compositions of NaF + KF melt using FactSage programme. This programme linked the slag viscosity to the internal structure of melts through second nearest neighbor bonds concentrations which was calculated from the advanced quasi-chemical thermodynamic model. The calculated coefficients of viscosities were compared with that reported in the literature. (author)

Linux shell scripting cookbook

CERN Document Server

Tushar, Shantanu

2013-01-01

This book is written in a Cookbook style and it offers learning through recipes with examples and illustrations. Each recipe contains step-by-step instructions about everything necessary to execute a particular task. The book is designed so that you can read it from start to end for beginners, or just open up any chapter and start following the recipes as a reference for advanced users.If you are a beginner or an intermediate user who wants to master the skill of quickly writing scripts to perform various tasks without reading the entire manual, this book is for you. You can start writing scri

Efficient Ensemble State-Parameters Estimation Techniques in Ocean Ecosystem Models: Application to the North Atlantic

Science.gov (United States)

El Gharamti, M.; Bethke, I.; Tjiputra, J.; Bertino, L.

2016-02-01

Given the recent strong international focus on developing new data assimilation systems for biological models, we present in this comparative study the application of newly developed state-parameters estimation tools to an ocean ecosystem model. It is quite known that the available physical models are still too simple compared to the complexity of the ocean biology. Furthermore, various biological parameters remain poorly unknown and hence wrong specifications of such parameters can lead to large model errors. Standard joint state-parameters augmentation technique using the ensemble Kalman filter (Stochastic EnKF) has been extensively tested in many geophysical applications. Some of these assimilation studies reported that jointly updating the state and the parameters might introduce significant inconsistency especially for strongly nonlinear models. This is usually the case for ecosystem models particularly during the period of the spring bloom. A better handling of the estimation problem is often carried out by separating the update of the state and the parameters using the so-called Dual EnKF. The dual filter is computationally more expensive than the Joint EnKF but is expected to perform more accurately. Using a similar separation strategy, we propose a new EnKF estimation algorithm in which we apply a one-step-ahead smoothing to the state. The new state-parameters estimation scheme is derived in a consistent Bayesian filtering framework and results in separate update steps for the state and the parameters. Unlike the classical filtering path, the new scheme starts with an update step and later a model propagation step is performed. We test the performance of the new smoothing-based schemes against the standard EnKF in a one-dimensional configuration of the Norwegian Earth System Model (NorESM) in the North Atlantic. We use nutrients profile (up to 2000 m deep) data and surface partial CO2 measurements from Mike weather station (66o N, 2o E) to estimate

Current research and development at the Nuclear Research Center Karlsruhe

International Nuclear Information System (INIS)

Kuesters, H.

1982-01-01

The Nuclear Research Center Karlsruhe (KfK) is funded to 90% by the Federal Republic of Germany and to 10% by the State of Baden-Wuerttemberg. Since its foundation in 1956 the main objective of the Center is research and development (R and D) in the aera of the nuclear technology and about 2/3 of the research capacity is now devoted to this field. Since 1960 a major activity of KfK is R and D work for the design of fast breeder reactors, including material research, physics, and safety investigations; a prototype of 300 MWe is under construction now in the lower Rhine Valley. For enrichment of 235 U fissile material KfK developed the separation nozzle process; its technical application is realized within an international contract between the Federal Republic of Germany and Brazil. Within the frame of the European Programme on fusion technology KfK develops and tests superconducting magnets for toroidal fusion systems; a smaller activity deals with research on inertial confinement fusion. A broad research programme is carried through for safety investigations of nuclear installations, especially for PWRs; this activity is supplemented by research and development in the field of nuclear materials' safeguards. Development of fast reactors has to initiate research for the reprocessing of spent fuel and waste disposal. In the pilot plant WAK spent fuel from LKWs is reprocessed; research especially tries e.g. to improve the PUREX-process by electrochemical means, vitrification of high active waste is another main activity. First studies are being performed now to clarify the necessary development for reprocessing fast reactor fuel. About 1/3 of the research capacity of KfK deals with fundamental research in nuclear physics, solid state physics, biology and studies on the impact of technology on environment. Promising new technologies as e.g. the replacement of gasoline by hydrogen cells as vehicle propulsion are investigated. (orig.)

Influence of biofilm-forming lactic acid bacteria against methicillin-resistant Staphylococcus aureus (MRSA S547

Directory of Open Access Journals (Sweden)

Laavanya M. Kumar

2017-12-01

Full Text Available Objective: To investigate the antibacterial effect of selected lactic acid bacteria (LAB biofilms on the planktonic and biofilm population of methicillin-resistant Staphylococcus aureus (MRSA (S547. Methods: In this study, biofilm-forming LAB were isolated from tairu and kefir. Isolate Y1 and isolate KF were selected based on their prominent inhibition against test pathogens (using spot-on-agar method and agar-well-diffusion assay and efficient biofilm production (using tissue culture plate method. They were then identified as Lactobacillus casei (L. casei Y1 and Lactobacillus plantarum (L. plantarum KF, respectively using 16S rDNA gene sequencing. The influence of incubation time, temperature and aeration on the biofilm production of L. casei Y1 and L. plantarum KF was also investigated using tissue culture plate method. The inhibitory activity of both the selected LAB biofilms was evaluated against MRSA (Institute for Medical Research code: S547 using L. plantarum ATCC 8014 as the reference strain. Results: L. casei Y1 showed the highest reduction of MRSA biofilms, by 3.53 log at 48 h while L. plantarum KF records the highest reduction of 2.64 log at 36 h. In inhibiting planktonic population of MRSA (S547, both L. casei Y1 and L. plantarum KF biofilms recorded their maximum reduction of 4.13 log and 3.41 log at 24 h, respectively. Despite their inhibitory effects being time-dependent, both LAB biofilms exhibited good potential in controlling the biofilm and planktonic population of MRSA (S547. Conclusions: The results from this study could highlight the importance of analysing biofilms of LAB to enhance their antibacterial efficacy. Preferably, these protective biofilms of LAB could also be a better alternative to control the formation of biofilms by pathogens such as MRSA. Keywords: MRSA, Biofilms, Lactic acid bacteria, Antibacterial

Cluster of differentiation 14 gene polymorphism and its association with incidence of clinical mastitis in Karan fries cattle

Directory of Open Access Journals (Sweden)

A. Sakthivel Selvan

2014-12-01

Full Text Available Aim: The present study was undertaken with the objectives to characterize, identify DNA polymorphism in cluster of differentiation 14 (CD14 gene in Karan Fries (KF cattle and to analyze association between genetic variants with incidence of clinical mastitis in National Dairy Research Institute (NDRI herd, Karnal. Materials and Methods: Genomic DNA was extracted using blood of randomly selected hundred KF lactating cattle by phenol-chloroform method. After checking its quality and quantity, polymerase chain reaction (PCR was carried out using reported primers to amplify 832 base pair region covering nucleotide base position number 1012 to 1843 (part of promoter, 5’UTR, exon 1, intron 1 and part of exon 2 of bovine CD14 gene. The PCR amplified target product was purified, sequenced and further ClustalW analysis was done to align edited sequence with reported Bos taurus sequence (EU148610.1. The restriction fragment length polymorphism (RFLP analysis was performed for each KF cow using HinfI restriction enzyme (RE. Cows were assigned genotypes obtained by PCR-RFLP analysis and association study was done using Chi-square (χ2 test. Results: After PCR amplification, DNA sequencing of amplicon confirmed the 832 bases covering 1012 to 1843 nucleotide base position of bovine CD14 gene. ClustalW multiple sequence alignment program for DNA revealed six nucleotide changes in KF cows at positions T1117D, T1239G, T1291C, G1359C, G1361A, and G1811A. Cows were also screened using PCR-RFLP with HinfI RE, which revealed three genotypes CC, CD and DD that differed significantly regarding mastitis incidence. Within CC genotype, 72.73% of cows were in a mastitis non-affected group whereas, those in CD and DD genotypes 69.44% and 60.38% respectively were mastitis affected. Conclusion: KF cows with allele C of CD14 gene were less susceptibility to mastitis compared with D allele.

Impact of cloud parameterization on the numerical simulation of a super cyclone

Energy Technology Data Exchange (ETDEWEB)

Deshpande, M.S.; Pattnaik, S.; Salvekar, P.S. [Indian Institute of Tropical Meteorology, Pune (India)

2012-07-01

This study examines the role of parameterization of convection and explicit moisture processes on the simulated track, intensity and inner core structure of Orissa super cyclone (1999) in Bay of Bengal (north Indian Ocean). Sensitivity experiments are carried out to examine the impact of cumulus parameterization schemes (CPS) using MM5 model (Version 3.7) in a two-way nested domain (D1 and D2) configuration at horizontal resolutions (45-15 km). Three different cumulus parameterization schemes, namely Grell (Gr), Betts-Miller (BM) and updated Kain Fritsch (KF2), are tested. It is noted that track and intensity both are very sensitive to CPS and comparatively, KF2 predicts them reasonably well. Particularly, the rapid intensification phase of the super cyclone is best simulated by KF2 compared to other CPS. To examine the effect of the cumulus parameterization scheme at high resolution (5 km), the three-domain configuration (45-15-5 km resolution) is utilized. Based on initial results, KF2 scheme is used for both the domains (D1 and D2). Two experiments are conducted: one in which KF2 is used as CPS and another in which no CPS is used in the third domain. The intensity is well predicted when no CPS is used in the innermost domain. The sensitivity experiments are also carried out to examine the impact from microphysics parameterization schemes (MPS). Four cloud microphysics parameterization schemes, namely mixed phase (MP), Goddard microphysics with Graupel (GG), Reisner Graupel (RG) and Schultz (Sc), are tested in these experiments. It is noted that the tropical cyclone tracks and intensity variation have considerable sensitivity to the varying cloud microphysical parameterization schemes. The MPS of MP and Sc could very well capture the rapid intensification phase. The final intensity is well predicted by MP, which is overestimated by Sc. The MPS of GG and RG underestimates the intensity. (orig.)

A comparison of the performance of the 3-D super-ensemble and an ensemble Kalman filter for short-range regional ocean prediction

Directory of Open Access Journals (Sweden)

Baptiste Mourre

2014-01-01

Full Text Available This study compares the ability of two approaches integrating models and data to forecast the Ligurian Sea regional oceanographic conditions in the short-term range (0–72 hours when constrained by a common observation dataset. The post-processing 3-D super-ensemble (3DSE algorithm, which uses observations to optimally combine multi-model forecasts into a single prediction of the oceanic variable, is first considered. The 3DSE predictive skills are compared to those of the Regional Ocean Modeling System model in which observations are assimilated through a more conventional ensemble Kalman filter (EnKF approach. Assimilated measurements include sea surface temperature maps, and temperature and salinity subsurface observations from a fleet of five underwater gliders. Retrospective analyses are carried out to produce daily predictions during the 11-d period of the REP10 sea trial experiment. The forecast skill evaluation based on a distributed multi-sensor validation dataset indicates an overall superior performance of the EnKF, both at the surface and at depth. While the 3DSE and EnKF perform comparably well in the area spanned by the incorporated measurements, the 3DSE accuracy is found to rapidly decrease outside this area. In particular, the univariate formulation of the method combined with the absence of regular surface salinity measurements produces large errors in the 3DSE salinity forecast. On the contrary, the EnKF leads to more homogeneous forecast errors over the modelling domain for both temperature and salinity. The EnKF is found to consistently improve the predictions with respect to the control solution without assimilation and to be positively skilled when compared to the climatological estimate. For typical regional oceanographic applications with scarce subsurface observations, the lack of physical spatial and multivariate error covariances applicable to the individual model weights in the 3DSE formulation constitutes a major

A beginners guide to the SVXII

International Nuclear Information System (INIS)

Yarema, R.; Kipnis, I.; Kleinfelder, S.; Luo, L.; Milgrome, O.; Sarraj, M.; Yarema, R.; Zimmerman, T.

1994-06-01

In the late 1980's, several versions of a full custom chip called the SVX were built and tested. The chip was designed to be a second generation silicon strip readout chip incorporating new features such as data sparsification for silicon strip detectors. The SVX designed by Stuart Kleinfelder and others at LBL contained 128 channels of electronics and proved to be very popular. Initially the chip was fabricated in 3.0 micron process and later transferred to a 1.2 micron radiation hard process. Based on the success of the first SVX (referred herein as SVXI), a need arose for a third generation device. This new 128 channel device called the SVXII was developed by a collaboration of engineers at Fermilab and Lawrence Berkeley Laboratory. The SVXII, designed in a 1.2 micron process, contains many new features including analog storage and digitization of the analog information. In addition to the new features, the SXVII is intended to operate with interaction times approximately 25 times faster than the original SVX, have the same or better noise characteristics, and have a minimal increase in power. The SVXII is an engineering challenge. This report is a first detailed attempt to introduce the SVXIII to the user. Knowledge of the original SVX and its operation would be helpful and can be obtained from references 1--3

Geometric measure theory a beginner's guide

CERN Document Server

Morgan, Frank

1995-01-01

Geometric measure theory is the mathematical framework for the study of crystal growth, clusters of soap bubbles, and similar structures involving minimization of energy. Morgan emphasizes geometry over proofs and technicalities, and includes a bibliography and abundant illustrations and examples. This Second Edition features a new chapter on soap bubbles as well as updated sections addressing volume constraints, surfaces in manifolds, free boundaries, and Besicovitch constant results. The text will introduce newcomers to the field and appeal to mathematicians working in the field.

A beginners guide for video production

Energy Technology Data Exchange (ETDEWEB)

1991-11-01

The Seattle-King County Hazardous Waste Management Plan provides the framework for an intensive effort to keep Household Hazardous Waste (HHW) and Small Quantity Generator (SQG) wastes from entering the municipal solid and liquid waste streams. Many innovative programs for managing small sources of hazardous waste have been developed in response to the Plan. With the assistance of Urban Consortium grants, the City of Seattle has researched and developed a series of reports describing the planning, operation and evaluation of the plan`s HHW collection programs. Three of the Plan`s programs of particular interest to other jurisdictions are the fixed site and mobile HHW Collection Facilities, and the Business Waste Consultations provided to SQG`s. In 1991, Seattle received an Urban Consortium grant to produce two videos showing how the HHW Collection Facilities and Business Consultations programs work. This report provides an overviews of the video development and production process and a discussion of the lessons learned by the staff directing the production.

GNOME 3 application development beginner's guide

CERN Document Server

Anwari, Mohammad

2013-01-01

This book is a step-by-step guide with ready-to-run codes to guide you in developing applications with GNOME. If you have programming skill either in Linux or other operating systems and want to have GNOME 3 as one of your deployment targets, then this book is for you. This book is also for commercial software developers or an open source software hacker. The reader needs to be familiar with Vala and JavaScript before starting to develop Gtk+ and Clutter applications.

Web application security: a beginner's guide

National Research Council Canada - National Science Library

Sullivan, Bryan; Liu, Vincent

2012-01-01

.... This practical resource includes chapters on authentication, authorization, and session management, along with browser, database, and file security--all supported by true stories from industry...

Engineering haptic devices a beginner's guide

CERN Document Server

Hatzfeld, Christian

2014-01-01

In this greatly reworked second edition of Engineering Haptic Devices the psychophysic content has been thoroughly revised and updated. Chapters on haptic interaction, system structures and design methodology were rewritten from scratch to include further basic principles and recent findings. New chapters on the evaluation of haptic systems and the design of three exemplary haptic systems from science and industry have been added. This book was written for students and engineers that are faced with the development of a task-specific haptic system. It is a reference book for the basics of hap

4-H Textile Science Beginner Projects.

Science.gov (United States)

Scholl, Jan

This packet contains three 4-H projects for students beginning the sewing sequence of the textile sciences area. The projects cover basics of sewing using sewing machines, more difficult sewing machine techniques, and hand sewing. Each project provides an overview of what the student will learn, what materials are needed, and suggested projects…

Renormalization Methods - A Guide For Beginners

International Nuclear Information System (INIS)

Cardy, J

2004-01-01

The stated goal of this book is to fill a perceived gap between undergraduate texts on critical phenomena and advanced texts on quantum field theory, in the general area of renormalization methods. It is debatable whether this gap really exists nowadays, as a number of books have appeared in which it is made clear that field-theoretic renormalization group methods are not the preserve of particle theory, and indeed are far more easily appreciated in the contexts of statistical and condensed matter physics. Nevertheless, this volume does have a fresh aspect to it, perhaps because of the author's background in fluid dynamics and turbulence theory, rather than through the more traditional migration from particle physics. The book begins at a very elementary level, in an effort to motivate the use of renormalization methods. This is a worthy effort, but it is likely that most of this section will be thought too elementary by readers wanting to get their teeth into the subject, while those for whom this section is apparently written are likely to find the later chapters rather challenging. The author's particular approach then leads him to emphasise the role of renormalized perturbation theory (rather than the renormalization group) in a number of problems, including non-linear systems and turbulence. Some of these ideas will be novel and perhaps even surprising to traditionally trained field theorists. Most of the rest of the book is on far more familiar territory: the momentum-space renormalization group, epsilon-expansion, and so on. This is standard stuff, and, like many other textbooks, it takes a considerable chunk of the book to explain all the formalism. As a result, there is only space to discuss the standard φ 4 field theory as applied to the Ising model (even the N-vector model is not covered) so that no impression is conveyed of the power and extent of all the applications and generalizations of the techniques. It is regrettable that so much space is spent on rather oversimplified and unrelated models in the first part of the book that, in the end, the reader is left breathless on the threshold of the really interesting material. Despite the earlier emphasis on the application of renormalization ideas in dynamics, in the end the full power of the field-theoretical approach is not applied to the obvious arena of dynamic critical phenomena (where there certainly is currently a gap in the literature) but to the Navier--Stokes equations. The development of the book is somewhat illogical in places. Mean field theory interrupts discussion of block spin methods and scaling arguments---the two are distinct approaches. The Callan--Symanzik equation is introduced before Feynman diagrams are explained, so that there is a hiatus before the actual results for the critical exponents can be found. I think this book is too broad in some respects, and too limited in others, to be a really useful textbook for a course on renormalization methods. Those who have learned these ideas either from field theory, or from nonlinear systems, will find it more rewarding for the sections covering the topics with which they are less familiar. For this reason alone, the book should at least find a place on most library reference shelves. (book review)

ACER Checklists for School Beginners: Manual.

Science.gov (United States)

Rowe, Helga A. H.

This assessment package consists of a checklist for teachers, a checklist for parents, a class record sheet, and a manual designed to be used by teachers to highlight the strengths and weaknesses of individual children soon after their entry into school or during their last term in preschool or kindergarten classes. The Checklist for Teachers…

Web application security: a beginner's guide

National Research Council Canada - National Science Library

Sullivan, Bryan; Liu, Vincent

2012-01-01

.... Sullivan and Liu have created a savvy, essentials-based approach to web app security packed with immediately applicable tools for any information security practitioner sharpening his or her tools or just starting...

PrestaShop 1.5 beginner's guide

CERN Document Server

Caro, Jose Antonio Tizon

2013-01-01

This book is written in a friendly voice with lots of tips, tricks, and screenshots to help you set up, extend, and personalize your own online shop. If you want to start your own e-commerce business, then this book will help you do that.This book is for people who are interested in creating an online shop. Basic HTML and CSS skills would be beneficial but are not required as we will provide you with all the code and know-how you need.

The Glymphatic System: A Beginner's Guide.

Science.gov (United States)

Jessen, Nadia Aalling; Munk, Anne Sofie Finmann; Lundgaard, Iben; Nedergaard, Maiken

2015-12-01

The glymphatic system is a recently discovered macroscopic waste clearance system that utilizes a unique system of perivascular tunnels, formed by astroglial cells, to promote efficient elimination of soluble proteins and metabolites from the central nervous system. Besides waste elimination, the glymphatic system also facilitates  brain-wide distribution of several compounds, including glucose, lipids, amino acids, growth factors, and neuromodulators. Intriguingly, the glymphatic system function mainly during sleep and is largely disengaged during wakefulness. The biological need for sleep across all species may therefore reflect that the brain must enter a state of activity that enables elimination of potentially neurotoxic waste products, including β-amyloid. Since the concept of the glymphatic system is relatively new, we will here review its basic structural elements, organization, regulation, and functions. We will also discuss recent studies indicating that glymphatic function is suppressed in various diseases and that failure of glymphatic function in turn might contribute to pathology in neurodegenerative disorders, traumatic brain injury and stroke.

A beginner's guide to mathematical logic

CERN Document Server

Smullyan, Raymond M

2014-01-01

Combining stories of great philosophers, quotations, and riddles with the fundamentals of mathematical logic, this new textbook for first courses in mathematical logic was written by the subject's creative master. Raymond Smullyan offers clear, incremental presentations of difficult logic concepts with creative explanations and unique problems related to proofs, propositional logic and first-order logic, undecidability, recursion theory, and other topics.

A Beginner's Sequence of Programming Activities.

Science.gov (United States)

Slesnick, Twila

1984-01-01

Presents various programing activities using the BASIC and LOGO programing languages. Activities are included in separate sections with a title indicating the nature of the activities and the "tools" (commands) needed. For example, "Old-fashioned drawing" requires several tools (PRINT, LIST, RUN, GOTO) to make drawings using…

WS-BPEL 2.0 beginner's guide

CERN Document Server

Juric, Matjaz B

2014-01-01

If you are a software architect, a designer, a software developer, an SOA and BPM architect, a project manager, or a business process analyst who is responsible for the design and development of business processes, composite applications, and BPM/SOA solutions, then this book is for you. You should have a clear grasp of general SOA concepts including business processes and web services, but no prior knowledge of the BPEL language is required.

Influence of potassium fluoride on the syntheses of methylpiperazine-modified poly(vinyl chloride)s for use as fixed-site proton carrier membranes.

Science.gov (United States)

Roudman, A R; Kusy, R P

1998-03-15

Aminated poly(vinyl chloride) (PVC) membranes were prepared that had a Nernstian response over a wide range of pH. The reaction between PVC and methyl-piperazine (MePIP) in dimethylformamide (DMF) was studied over a wide range of time and temperature, and in the presence of the catalyst, potassium fluoride (KF). Time, temperature, and KF increased the nitrogen (N) content of the resulting polymers, but sometimes at the expense of decreasing their specific viscosities (molecular weights). Activation energies of processes that occurred in different temperature ranges were estimated assuming an Arrhenius relationship. A Nernstian response occurred once the N content approached to about 0.3 w/w %, and was accelerated by the presence of KF at elevated temperatures. Increasing the N content above about 3% led to a loss of the Nernstian response either because of an increase in the double bond content and a subsequent decrease in polymer mobility, or because of a decrease in the molecular weight of the copolymer and concomitant difficulties in film preparation.

Interactions of alkali metals and electrolyte with cathode carbons

Energy Technology Data Exchange (ETDEWEB)

Naas, Tyke

1997-12-31

The Hall-Heroult process for electrolytic reduction of alumina has been the only commercial process for production of primary aluminium. The process runs at high temperature and it is important to minimize the energy consumption. To save energy it is desirable to reduce the operating temperature. This can be achieved by adding suitable additives such as LiF or KF to the cryolitic electrolyte. This may conflict with the objective of extending the lifetime of the cathode linings of the cell as much as possible. The thesis investigates this possibility and the nature of the interactions involved. It supports the hypothesis that LiF-additions to the Hall-Heroult cell electrolyte is beneficial to the carbon cathode performance because the diminished sodium activity reduces the sodium induced stresses during the initial period of electrolysis. The use of KF as an additive is more dangerous, but the results indicate that additions up to 5% KF may be tolerated in acidic melts with semigraphitic or graphitic cathodes with little risk of cathode problems. 153 refs., 94 figs., 30 tabs.

Ensemble Kalman filtering with residual nudging

KAUST Repository

Luo, X.

2012-10-03

Covariance inflation and localisation are two important techniques that are used to improve the performance of the ensemble Kalman filter (EnKF) by (in effect) adjusting the sample covariances of the estimates in the state space. In this work, an additional auxiliary technique, called residual nudging, is proposed to monitor and, if necessary, adjust the residual norms of state estimates in the observation space. In an EnKF with residual nudging, if the residual norm of an analysis is larger than a pre-specified value, then the analysis is replaced by a new one whose residual norm is no larger than a pre-specified value. Otherwise, the analysis is considered as a reasonable estimate and no change is made. A rule for choosing the pre-specified value is suggested. Based on this rule, the corresponding new state estimates are explicitly derived in case of linear observations. Numerical experiments in the 40-dimensional Lorenz 96 model show that introducing residual nudging to an EnKF may improve its accuracy and/or enhance its stability against filter divergence, especially in the small ensemble scenario.

The preparation and thermoelectric properties of molten salt electrodeposited boron wafers

International Nuclear Information System (INIS)

Kumashiro, Y.; Ozaki, S.; Sato, K.; Kataoka, Y.; Hirata, K.; Yokoyama, T.; Nagatani, S.; Kajiyama, K.

2004-01-01

We have prepared electrodeposited boron wafer by molten salts with KBF 4 -KF at 680 deg. C using graphite crucible for anode and silicon wafer and nickel plate for cathodes. Experiments were performed by various molar ratios KBF 4 /KF and current densities. Amorphous p-type boron wafers with purity 87% was deposited on nickel plate for 1 h. Thermal diffusivity by ring-flash method and heat capacity by DSC method produced thermal conductivity showing amorphous behavior in the entire temperature range. The systematical results on thermoelectric properties were obtained for the wafers prepared with KBF 4 -KF (66-34 mol%) under various current densities in the range 1-2 A/cm 2 . The temperature dependencies of electrical conductivity showed thermal activated type with activation energy of 0.5 eV. Thermoelectric power tended to increase with increasing temperature up to high temperatures with high values of (1-10) mV/K. Thermoelectric figure-of-merit was 10 -4 /K at high temperatures. Estimated efficiency of thermoelectric energy conversion would be calculated to be 4-5%

Linear and nonlinear dynamic systems in financial time series prediction

Directory of Open Access Journals (Sweden)

Salim Lahmiri

2012-10-01

Full Text Available Autoregressive moving average (ARMA process and dynamic neural networks namely the nonlinear autoregressive moving average with exogenous inputs (NARX are compared by evaluating their ability to predict financial time series; for instance the S&P500 returns. Two classes of ARMA are considered. The first one is the standard ARMA model which is a linear static system. The second one uses Kalman filter (KF to estimate and predict ARMA coefficients. This model is a linear dynamic system. The forecasting ability of each system is evaluated by means of mean absolute error (MAE and mean absolute deviation (MAD statistics. Simulation results indicate that the ARMA-KF system performs better than the standard ARMA alone. Thus, introducing dynamics into the ARMA process improves the forecasting accuracy. In addition, the ARMA-KF outperformed the NARX. This result may suggest that the linear component found in the S&P500 return series is more dominant than the nonlinear part. In sum, we conclude that introducing dynamics into the ARMA process provides an effective system for S&P500 time series prediction.

Dicty_cDB: CHE515 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available hvpkkxv*lilqsilmitmhvplipvhhqlvfptlqltvmi vnpctidscnnstglxxhsnqw****slvp*ih--- --...FGLXGGFXGGGTXGKXDCXTCKN*xtxfi*lxfkk ixkkfxkkfxkkkklfvflsniynf*k*kf Frame C: nkctvdscsnstgcvntpincddsnpctvdscnns

Integration of Physical, Genetic, and Cytogenetic Mapping Data for Cellulose Synthase (CesA) Genes in Flax (Linum usitatissimum L.).

Science.gov (United States)

Yurkevich, Olga Y; Kirov, Ilya V; Bolsheva, Nadezhda L; Rachinskaya, Olga A; Grushetskaya, Zoya E; Zoschuk, Svyatoslav A; Samatadze, Tatiana E; Bogdanova, Marina V; Lemesh, Valentina A; Amosova, Alexandra V; Muravenko, Olga V

2017-01-01

Flax, Linum usitatissimum L., is a valuable multi-purpose plant, and currently, its genome is being extensively investigated. Nevertheless, mapping of genes in flax genome is still remaining a challenging task. The cellulose synthase ( CesA ) multigene family involving in the process of cellulose synthesis is especially important for metabolism of this fiber crop. For the first time, fluorescent in situ hybridization (FISH)-based chromosomal localization of the CesA conserved fragment (KF011584.1), 5S, and 26S rRNA genes was performed in landrace, oilseed, and fiber varieties of L. usitatissimum . Intraspecific polymorphism in chromosomal distribution of KF011584.1 and 5S DNA loci was revealed, and the generalized chromosome ideogram was constructed. Using BLAST analysis, available data on physical/genetic mapping and also whole-genome sequencing of flax, localization of KF011584.1, 45S, and 5S rRNA sequences on genomic scaffolds, and their anchoring to the genetic map were conducted. The alignment of the results of FISH and BLAST analyses indicated that KF011584.1 fragment revealed on chromosome 3 could be anchored to linkage group (LG) 11. The common LG for 45S and 5S rDNA was not found probably due to the polymorphic localization of 5S rDNA on chromosome 1. Our findings indicate the complexity of integration of physical, genetic, and cytogenetic mapping data for multicopy gene families in plants. Nevertheless, the obtained results can be useful for future progress in constructing of integrated physical/genetic/cytological maps in L. usitatissimum which are essential for flax breeding.

Multisource data assimilation in a Richards equation-based integrated hydrological model: a real-world application to an experimental hillslope

Science.gov (United States)

Camporese, M.; Botto, A.

2017-12-01

Data assimilation is becoming increasingly popular in hydrological and earth system modeling, as it allows for direct integration of multisource observation data in modeling predictions and uncertainty reduction. For this reason, data assimilation has been recently the focus of much attention also for integrated surface-subsurface hydrological models, whereby multiple terrestrial compartments (e.g., snow cover, surface water, groundwater) are solved simultaneously, in an attempt to tackle environmental problems in a holistic approach. Recent examples include the joint assimilation of water table, soil moisture, and river discharge measurements in catchment models of coupled surface-subsurface flow using the ensemble Kalman filter (EnKF). Although the EnKF has been specifically developed to deal with nonlinear models, integrated hydrological models based on the Richards equation still represent a challenge, due to strong nonlinearities that may significantly affect the filter performance. Thus, more studies are needed to investigate the capabilities of EnKF to correct the system state and identify parameters in cases where the unsaturated zone dynamics are dominant. Here, the model CATHY (CATchment HYdrology) is applied to reproduce the hydrological dynamics observed in an experimental hillslope, equipped with tensiometers, water content reflectometer probes, and tipping bucket flow gages to monitor the hillslope response to a series of artificial rainfall events. We assimilate pressure head, soil moisture, and subsurface outflow with EnKF in a number of assimilation scenarios and discuss the challenges, issues, and tradeoffs arising from the assimilation of multisource data in a real-world test case, with particular focus on the capability of DA to update the subsurface parameters.

Calibration of a Land Subsidence Model Using InSAR Data via the Ensemble Kalman Filter.

Science.gov (United States)

Li, Liangping; Zhang, Meijing; Katzenstein, Kurt

2017-11-01

The application of interferometric synthetic aperture radar (InSAR) has been increasingly used to improve capabilities to model land subsidence in hydrogeologic studies. A number of investigations over the last decade show how spatially detailed time-lapse images of ground displacements could be utilized to advance our understanding for better predictions. In this work, we use simulated land subsidences as observed measurements, mimicking InSAR data to inversely infer inelastic specific storage in a stochastic framework. The inelastic specific storage is assumed as a random variable and modeled using a geostatistical method such that the detailed variations in space could be represented and also that the uncertainties of both characterization of specific storage and prediction of land subsidence can be assessed. The ensemble Kalman filter (EnKF), a real-time data assimilation algorithm, is used to inversely calibrate a land subsidence model by matching simulated subsidences with InSAR data. The performance of the EnKF is demonstrated in a synthetic example in which simulated surface deformations using a reference field are assumed as InSAR data for inverse modeling. The results indicate: (1) the EnKF can be used successfully to calibrate a land subsidence model with InSAR data; the estimation of inelastic specific storage is improved, and uncertainty of prediction is reduced, when all the data are accounted for; and (2) if the same ensemble is used to estimate Kalman gain, the analysis errors could cause filter divergence; thus, it is essential to include localization in the EnKF for InSAR data assimilation. © 2017, National Ground Water Association.

Benchmarking the Algorithms to Detect Seasonal Signals Under Different Noise Conditions

Science.gov (United States)

Klos, A.; Bogusz, J.; Bos, M. S.

2017-12-01

Global Positioning System (GPS) position time series contain seasonal signals. Among the others, annual and semi-annual are the most powerful. Widely, these oscillations are modelled as curves with constant amplitudes, using the Weighted Least-Squares (WLS) algorithm. However, in reality, the seasonal signatures vary over time, as their geophysical causes are not constant. Different algorithms have been already used to cover this time-variability, as Wavelet Decomposition (WD), Singular Spectrum Analysis (SSA), Chebyshev Polynomial (CP) or Kalman Filter (KF). In this research, we employed 376 globally distributed GPS stations which time series contributed to the newest International Terrestrial Reference Frame (ITRF2014). We show that for c.a. 20% of stations the amplitudes of seasonal signal varies over time of more than 1.0 mm. Then, we compare the WD, SSA, CP and KF algorithms for a set of synthetic time series to quantify them under different noise conditions. We show that when variations of seasonal signals are ignored, the power-law character is biased towards flicker noise. The most reliable estimates of the variations were found to be given by SSA and KF. These methods also perform the best for other noise levels while WD, and to a lesser extend also CP, have trouble in separating the seasonal signal from the noise which leads to an underestimation in the spectral index of power-law noise of around 0.1. For real ITRF2014 GPS data we discovered, that SSA and KF are capable to model 49-84% and 77-90% of the variance of the true varying seasonal signals, respectively.

Efficient Data Assimilation Tool For Real Time CO2 Reservoir Monitoring and Characterization

Science.gov (United States)

Li, J. Y.; Ambikasaran, S.; Kokkinaki, A.; Darve, E. F.; Kitanidis, P. K.

2014-12-01

Reservoir forecasting and management are increasingly relying on a data-driven approach, which involves data assimilation to calibrate and keep up to date the complex model of multi-phase flow and transport in the geologic formation and to evaluate its uncertainty using monitoring data of different types and temporal resolution. The numbers of unknowns and measurements are usually very large, which represents a major computational challenge. Kalman filter (KF), the archetypical recursive filter, provides the framework to assimilate reservoir monitoring data into a dynamic system but the cost of implementing the original algorithm to large systems is computationally prohibitive. In our work, we have developed several Kalman-filter based approaches that reduce the computational and storage cost of standard KF from O (m2) to O (m), where m is the number of unknowns, and have the potential to be applied to field-scale problems. HiKF, a linear filter based on the hierarchical matrix approach, takes advantage of the informative high-frequency data acquired quasi-continuously and uses a random-walk model in the state forecast step when the a state evolution model is unavailable. A more general-purpose nonlinear filter CSKF achieves computational efficiency by exploiting the fact that the state covariance matrix for most dynamical systems can be approximated adequately through a low-rank matrix, and it allows using a forward simulator as a black-box for nonlinear error propagation. We will demonstrate both methods using synthetic CO2 injection cases and compare with the standard ensemble Kalman filter (EnKF).

Construct and face validity of the educational computer-based environment (ECE) assessment scenarios for basic endoneurosurgery skills.

Science.gov (United States)

Cagiltay, Nergiz Ercil; Ozcelik, Erol; Sengul, Gokhan; Berker, Mustafa

2017-11-01

In neurosurgery education, there is a paradigm shift from time-based training to criterion-based model for which competency and assessment becomes very critical. Even virtual reality simulators provide alternatives to improve education and assessment in neurosurgery programs and allow for several objective assessment measures, there are not many tools for assessing the overall performance of trainees. This study aims to develop and validate a tool for assessing the overall performance of participants in a simulation-based endoneurosurgery training environment. A training program was developed in two levels: endoscopy practice and beginning surgical practice based on four scenarios. Then, three experiments were conducted with three corresponding groups of participants (Experiment 1, 45 (32 beginners, 13 experienced), Experiment 2, 53 (40 beginners, 13 experienced), and Experiment 3, 26 (14 novices, 12 intermediate) participants). The results analyzed to understand the common factors among the performance measurements of these experiments. Then, a factor capable of assessing the overall skill levels of surgical residents was extracted. Afterwards, the proposed measure was tested to estimate the experience levels of the participants. Finally, the level of realism of these educational scenarios was assessed. The factor formed by time, distance, and accuracy on simulated tasks provided an overall performance indicator. The prediction correctness was very high for the beginners than the one for experienced surgeons in Experiments 1 and 2. When non-dominant hand is used in a surgical procedure-based scenario, skill levels of surgeons can be better predicted. The results indicate that the scenarios in Experiments 1 and 2 can be used as an assessment tool for the beginners, and scenario-2 in Experiment 3 can be used as an assessment tool for intermediate and novice levels. It can be concluded that forming the balance between perceived action capacities and skills is

Comparison of Predictive Factors for Postoperative Incontinence of Holmium Laser Enucleation of the Prostate by the Surgeons' Experience During Learning Curve.

Science.gov (United States)

Shigemura, Katsumi; Tanaka, Kazushi; Yamamichi, Fukashi; Chiba, Koji; Fujisawa, Masato

2016-03-01

To detect predictive factors for postoperative incontinence following holmium laser enucleation of the prostate (HoLEP) according to surgeon experience (beginner or experienced) and preoperative clinical data. Of 224 patients, a total of 203 with available data on incontinence were investigated. The potential predictive factors for post-HoLEP incontinence included clinical factors, such as patient age, and preoperative urodynamic study results, including detrusor overactivity (DO). We also classified the surgeons performing the procedure according to their HoLEP experience: beginner (predictive factor at the super-short period (the next day of catheter removal: odds ratio [OR], 3.375; P=0.000). Additionally, patient age, surgeon mentorship (inverse correlation), and prostate volume were significant predictive factors at the 1-month interval after HoLEP (OR, 1.072; P=0.004; OR, 0.251; P=0.002; and OR, 1.008; P=0.049, respectively). With regards to surgeon experience, DO and preoperative International Prostate Symptom Score (inverse) at the super-short period, and patient age and mentorship (inverse correlation) at the 1-month interval after HoLEP (OR, 3.952; P=0.002; OR, 1.084; P=0.015; and OR,1.084; P=0.015; OR, 0.358; P=0.003, respectively) were significant predictive factors for beginners, and first desire to void (FDV) at 1 month after HoLEP (OR, 1.009; P=0.012) was a significant predictive factor for experienced surgeons in multivariate analysis. Preoperative DO, IPSS, patient age, and surgeon mentorship were significant predictive factors of postoperative patient incontinence for beginner surgeons, while FDV was a significant predictive factors for experienced surgeons. These findings should be taken into account by surgeons performing HoLEP to maximize the patient's quality of life with regards to urinary continence.