Liikennesuunnittelu eri kaavoitusvaiheissa
Verkamo, Harri
2008-01-01
Tässä insinöörityössä kartoitettiin eri kaavavaiheiden liikennesuunnitelmia ja niiden sisältöä. Kartoituksen pohjalta laadittiin ohjeistus Helsingin kaupunkisuunnitteluviraston liikennesuunnitteluosastolle. Nykyään kaupunkisuunnitteluvirastossa ei ole ohjeita suunnittelijoiden avuksi eri kaavavaiheiden liikennesuunnitelmien laadintaan, mutta sellaiselle on selkeä tarve. Johdonmukaisella ohjeistuksella saadaan luotua yhtenäisempi käytäntö eri kaavavaiheiden liikennesuunnitelmien laatimiselle. ...
Energy Technology Data Exchange (ETDEWEB)
Puuronen, M.; Mikkonen, T. [Vapo Oy, Oulu (Finland)
1996-12-31
Reed canary grass plantations have been grown on 39 ha in 1995 as planned. The growths were at the Hirvineva mire in Liminka and the Ahmaneva mire in Vihanti. At the Hirvineva mire the cultivation of reed canary grass will be carried out on the area withdrawn from peat production. The Ahmaneva mire is almost totally peatland dried but not yet prepared for peat production. Utilization of e.g. municipal waste water sludges for fertilizing of the plantations, and steel plant slag and wood waste boiler ashes will be used as liming substances. The first reed canary grass harvest will be harvested in spring 1997, then it is possible to find out the effect of ashes and slag on growth, as well as the effect of different fertilizing levels on harvest at the mires. Ruukki research center has made reed canary grass plantations at the Hirvineva mire in Liminka, there the fertilization levels will be studied. Field biomasses are a newcomer on the Finnish bioenergy markets so the procurement chains will also be developed for Finnish conditions. Procurement chains have first to be designed for prevailing field biomasses such as straw and reed grass. It is naturally reasonable to utilize in the first place the prevailing biomasses. E.g. in Denmark the utilization of field biomass is very common. The experiences gained in other countries have to be applied for Finnish conditions. The effective procurement chain of peat production has to be utilized, and procurement chains will be developed in the project in order to produce biomasses profitably on peat production fields. Possible field biomasses in Finland are straw, reed grass and reed canary grass
75 FR 51379 - Safety Zone; Celebrate Erie, Presque Isle Bay, Erie, PA
2010-08-20
... display. DATES: This rule is effective from 9:30 p.m. until 10:30 p.m. on August 22, 2010. ADDRESSES...: Temporary final rule. SUMMARY: The Coast Guard is establishing a temporary safety zone on Presque Isle Bay... Presque Isle Bay in Erie, PA during the Celebrate Erie fireworks display, August 22, 2010. This temporary...
Energy Technology Data Exchange (ETDEWEB)
Puuronen, M.; Mikkonen, T. [Vapo Oy, Oulu (Finland)
1997-12-01
New reed canary grass plantations have been made at the Hirvineva in Liminka on 39 ha in 1996 as planned. At Hirvineva the plantation of reed canary grass was carried out on the area withdrawn from peat production. The peat layer depth was 0 - 20 cm. Municipal waste water sludges were used for fertilising the plantations in order to reduce the fertilising costs. The Kemper cutting machine was tested at the natural common reed area in the Liminka gulf in the spring 1996. Compared to the reed canary grass plantations the common reed is more difficult to harvest. The reed canary grass is also more productive to harvest. The first reed canary grass harvest will be harvested in spring 1997, then it is possible to find out the effect of ashes and slag on growth, as well as the effect of different fertilising levels on harvest at the mires. Ruukki research center has made reed canary grass test plantations at the Hirvineva in Liminka where the fertilisation levels will be studied. (orig.)
Annotated Bibliography for Lake Erie. Volume I. Biological,
1974-10-01
maculosa Le Sueur; calico bass, or Lake Erie bass, Pomoxis sparoides Lacepede. (SM) 52. Reardslee, Clark S. 1944. Bonapart’s gull on the Niagara...of the burbot, Lota lota maculosa (LeSueur), in Lake Erie. Trans. Am. Fish. Soc. 80:163-173. Growth studies were made on 2,329 Lake Erie burbot...almo -- hystus; whitefish, oe onus albus; common shad salmon, Coregonus a upelformis; aobony pike, Lepisosteus bison; spotted burbot, Lota maculosa ; and
Impacts of aquatic nonindigenous invasive species on the Lake Erie ecosystem
Austen, Madeline J.W.; Ciborowski, Jan J.H.; Corkum, Lynda D.; Johnson, Tim B.; MacIsaac, Hugh J.; Metcalfe-Smith, Janice L.; Schloesser, Donald W.; George, Sandra E.
2002-01-01
Lake Erie is particularly vulnerable to the introduction and establishment of aquatic nonindigenous invasive species (NIS) populations. A minimum of 144 aquatic NIS have been recorded in the Lake Erie basin including several species [e.g., Eurasian watermilfoil (Myriophyllum spicatum); zebra mussel (Dreissena polymorpha); quagga mussel (Dreissena bugensis); an amphipod (Echinogammarus ischnus); round goby (Neogobius melanostomus); and sea lamprey (Petromyzon marinus)] that have had discernible impacts on the lake's ecology. NIS pose threats to the Lake Erie ecosystem for a variety of reasons including their ability to proliferate quickly, compete with native species, and transfer contaminants (e.g., PCBs) and disease through the food web. Six of the 14 beneficial use impairments listed in Annex 2 of the Great Lakes Water Quality Agreement are impaired in Lake Erie, in part as a result of the introduction of NIS. The Lake Erie Lakewide Management Plan (LaMP) has adopted an ecosystem approach to restore beneficial use impairments in the lake. Furthermore, a research consortium, known as the Lake Erie Millennium Network, is working alongside the LaMP, to address research problems regarding NIS, the loss of habitat, and the role of contaminants in the Lake Erie ecosystem.
Annotated Bibliography for Lake Erie. Volume IV. Physical,
1974-10-01
cruise 69-101, February 6-27; cruise 69-103, May 29-June 4; cruise 69-104, July 2-6; cruise 69-105, July 28-August 2, 1969. Canadian Oceano - graphic...ber 13 and covered 64 sampling locations. 98. Canada Centre for Inland Waters. 1969. Lake Erie cruise 66-11, August 8-14, 1966. Canadian Oceano - 59... sol - uble phosphorus is remarkably uniform at any one place in Lake Erie, with occasional variations. Concentrations gen- erally decrease from shore
Managing inherent complexity for sustainable walleye fisheries in Lake Erie
Roseman, Edward F.; Drouin, Richard; Gaden, Marc; Knight, Roger; Tyson, Jeff; Zhao, Yingming; Taylor, William W.; Lynch, Abigail J.; Léonard, Nancy J.
2012-01-01
In Lake Erie, Walleye (Sander vitreus vitreus) is king. The naturally occurring species is the foundation of commercial fishing operations on the Canadian side of the lake and is a much-prized sport fish on the American side. Management of Lake Erie walleye fisheries is complex and takes place in an inter-jurisdictional setting composed of resource agencies from the states of Michigan (MDNR), Ohio (ODNR), Pennsylvania (PFBC), and New York (NYDEC) and the province of Ontario (OMNR). The complexity of walleye management is exacerbated by interactions among environmental and ecological changes in Lake Erie, complex life-history characteristics of the species, public demand for walleye, and cultural/governance differences among managing groups and their respective constituents. Success of future management strategies will largely hinge upon our ability to understand these inherent complexities and to employ tactics that successfully accommodate stock productivity and human demand in a highly dynamic environment. In this report, we review the history of Lake Erie walleye management, outline the multi-jurisdictional process for international management of walleye, and discuss strategies to address challenges facing managers.
77 FR 38490 - Safety Zone; Mentor Harbor Yachting Club Fireworks, Lake Erie, Mentor, OH
2012-06-28
...-AA00 Safety Zone; Mentor Harbor Yachting Club Fireworks, Lake Erie, Mentor, OH AGENCY: Coast Guard, DHS... Erie, Mentor, OH. This safety zone is intended to restrict vessels from a portion of Lake Erie during the Mentor Harbor Yachting Club fireworks display. This temporary safety zone is necessary to protect...
78 FR 34575 - Safety Zone; Bay Swim VI, Presque Isle Bay, Erie, PA
2013-06-10
... June 22, 2013, a large scale swimming event will be held on Presque Isle Bay near the Erie Yacht Club...'48.82'' W and extend in a straight line 1,000 feet wide to the Erie Yacht Club at position 42[deg]07... wide to the Erie Yacht Club at position 42[deg]07'21.74'' N, 80[deg]07'58.30'' W. (NAD 83) (b...
Ohio Lake Erie Commission Homepage
management of Lake Erie: including, water quality protection, fisheries management, wetlands restoration over 365 projects since 1993. Projects have focused on an array of issues critical to the effective quality of its waters and ecosystem, and to promote economic development of the region by ensuring the
78 FR 59649 - Approval of Subzone Status, Hardinger Transfer Co., Erie and Grove City, Pennsylvania
2013-09-27
..., Hardinger Transfer Co., Erie and Grove City, Pennsylvania On July 24, 2013, the Executive Secretary of the Foreign-Trade Zones (FTZ) Board docketed an application submitted by the Erie Western Pennsylvania Port..., on behalf of Hardinger Transfer Co., in Erie and Grove City, Pennsylvania. The application was...
Evaluation of different strains of eri silkworms ( Samia cynthia ricini B ...
African Journals Online (AJOL)
Eri silkworms, Samia cynthia ricini B., is one of the silkworm races under utilization in Ethiopia. However, it has several strains with wide variation in their commercial traits and selection and utilization of best suited strains of this eri silkworm race that adapt to different agro-ecologies will help to increase silk productivity and ...
Population models of burrowing mayfly recolonization in Western Lake Erie
Madenjian, C.P.; Schloesser, D.W.; Krieger, K.A.
1998-01-01
Burrowing mayflies, Hexagenia spp. (H. limbata and H. rigida), began recolonizing western Lake Erie during the 1990s. Survey data for mayfly nymph densities indicated that the population experienced exponential growth between 1991 and 1997. To predict the time to full recovery of the mayfly population, we fitted logistic models, ranging in carrying capacity from 600 to 2000 nymphs/m2, to these survey data. Based on the fitted logistic curves, we forecast that the mayfly population in western Lake Erie would achieve full recovery between years 1998 and 2000, depending on the carrying capacity of the western basin. Additionally, we estimated the mortality rate of nymphs in western Lake Erie during 1994 and then applied an age-based matrix model to the mayfly population. The results of the matrix population modeling corroborated the exponential growth model application in that both methods yielded an estimate of the population growth rate, r, in excess of 0.8 yr-1. This was the first evidence that mayfly populations are capable of recolonizing large aquatic ecosystems at rates comparable with those observed in much smaller lentic ecosystems. Our model predictions should prove valuable to managers of power plant facilities along the western basin in planning for mayfly emergences and to managers of the yellow perch (Perca flavescens) fishery in western Lake Erie.
2010-04-01
... on the islands of Lake Erie across the States of New York, Pennsylvania, and Ohio. The beginning... approximately one mile north of Rock Creek, Ohio. (7) The boundary proceeds southwestward, then westward, then... is reached which is due north of the easternmost point of Kelleys Island. (9) The boundary then...
Historical Sediment Budget (1860s to Present) for the United States Shoreline of Lake Erie
2016-08-01
Soil Classification polygons with 1 km reaches. Each polygon has a 2- to 4-digit classification code indicating the dominant soil type...1988). Photograph shows high quantity of shale plates in soil column (USACE 2004). ................ 125 Figure A-1. New York shore stratigraphy... USLS 1935, NGVD29, USLS 1903, Mean Level of Lake Erie (1860–1875) (Toledo-Conneaut), Mean Lake Level of Lake Erie (1860–1875) (Erie-Buffalo), and Mean
Targets set to reduce Lake Erie algae
Evans, Mary
2016-01-01
In February 2016, the Great Lakes Executive Committee, which oversees the implementation of the Great Lakes Water Quality Agreement (GLWQA) between the U.S. and Canada, approved phosphorus loading targets for Lake Erie to reduce the size of harmful algal blooms (HABs), reduce the presence of the low oxygen zone in the central basin, and protect nearshore water quality. The targets are set with respect to the nutrient loads calculated for 2008. To reduce the impacts of HABs on Lake Erie a target was set of a 40 percent reduction in total and soluble reactive phosphorus loads in the spring from two Canadian rivers and several Michigan and Ohio rivers, especially the Maumee River (https://binational.net/2016/02/22/ finalptargets-ciblesfinalesdep/). States and the province of Ontario are already developing Domestic Action Plans to accomplish the reductions and scientists are developing research and monitoring plans to assess progress.
Meetings and Events about Western Lake Erie Basin
Western Lake Erie Basin, near Toledo (Ohio), Louisiana of the Urban Waters Federal Partnership (UWFP) reconnects urban communities with their waterways by improving coordination among federal agencies and collaborating with community-led efforts
Zhang, Junbo; Yin, Shuanghong; Guo, Fei; Meng, Ren; Chen, Chuangfu; Zhang, Hui; Li, Zhiqiang; Fu, Qiang; Shi, Huijun; Hu, Shengwei; Ni, Wei; Li, Tiansen; Zhang, Ke
2014-08-01
Brucellosis is a globally distributed zoonotic disease that causes animal and human diseases. However, the current Brucella abortus vaccines (S19 and RB51) are deficient; they can cause abortion in pregnant animals. Moreover, when the vaccine S19 is used, tests cannot differentiate natural from vaccinated infection. Therefore, a safer and more potent vaccine is needed. A Brucella abortus 2308 ery promoter mutant (Δery) was constructed to overcome these drawbacks. The growth of the Δery mutant was significantly attenuated in macrophages and mice and induced high protective immunity in mice. Moreover, Δery induced an anti-Brucella-specific IgG (immunoglobulin G) response and stimulated the expression of interferon-gamma (INF-γ) and interleukin-4 (IL-4). Furthermore, the expression of EryA antigen allowed for the serological differentiation between natural and vaccinated infection in mice. These results indicate that the Δery mutant is a potential attenuated live vaccine candidate against virulent Brucella abortus 2308 (S2308) infection.
33 CFR 162.132 - Connecting waters from Lake Huron to Lake Erie; communications rules.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; communications rules. 162.132 Section 162.132 Navigation and Navigable Waters COAST... NAVIGATION REGULATIONS § 162.132 Connecting waters from Lake Huron to Lake Erie; communications rules. (a...
33 CFR 162.140 - Connecting waters from Lake Huron to Lake Erie; miscellaneous rules.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; miscellaneous rules. 162.140 Section 162.140 Navigation and Navigable Waters COAST... NAVIGATION REGULATIONS § 162.140 Connecting waters from Lake Huron to Lake Erie; miscellaneous rules. (a...
FERC approves process for Lake Erie link: Project meets significant regulatory milestone
International Nuclear Information System (INIS)
Anon
2002-01-01
The Federal Electric Regulatory Commission (FERC) of the United States has issued an order to TransEnergie US Ltd., and Hydro One Inc., authorizing the sale of transmission rights for the proposed Lake Erie link. This project will consists of bi-directional high voltage direct current facilities connecting the transmission grids of Ontario, Canada and the United States. The sale is authorized to proceed via a non-discriminatory 'open season' process. The project will consist of buried underwater cables under Lake Erie connecting the transmission systems near Simcoe, Ontario with those in the US at either, or both, of Springfield, Pennsylvania, and Ashtabula, Ohio. The project will provide an increase in transmission capability of up to 975 MW between the electric control areas of the Ontario Independent Electricity Market Operator, the East Central Area Reliability Coordination Agreement in Ohio and the Pennsylvania-New Jersey-Maryland Interconnection. The Lake Erie Link will be financially supported by those consumers who see value in the associated transmission rights, rather than through the regulated rates paid by transmission customers in general. The article provides an overview of the background of the Lake Erie Link, the cable system, the converter station, and the potential economic benefits
Occurrence of zebra mussels in near-shore areas of western Lake Erie
Custer, Christine M.; Custer, T.W.
1997-01-01
Zebra mussels (Dreissena polymorpha) invaded the Great Lakes in the mid-1980s and quickly reached high densities. The objective of this study was to determine current consumption of zebra mussels by waterfowl in the Great Lakes region. Feeding Lesser Scaups (Aythya affinis), Greater Scaups (A. marila), Canvasbacks (A. valisineria), Redheads (A. americana), Buffleheads (Bucephala albeola) and Common Goldeneyes (B. clangula) were collected in western Lake Erie and in Lake St. Clair between fall and spring, 1992-1993 to determine food habits. All 10 Redheads, 97% of Lesser Scaups, 83% of Goldeneyes, 60% of Buffleheads and 9% of Canvasbacks contained one or more zebra mussels in their upper gastrointestinal tracts. The aggregate percent of zebra mussels in the diet of Lesser Scaups was higher in Lake Erie (98.6%) than in Lake St. Clair (54.4%). Zebra mussels, (aggregate percent) dominated the diet of Common Goldeneyes (79.2%) but not in Buffleheads (23.5%), Redheads (21%) or Canvasbacks (9%). Lesser Scaups from Lake Erie fed on larger zebra mussels ( = 10.7 i?? 0.66 mm SE) than did Lesser Scaups from Lake St. Clair ( = 4.4 i?? 0.22 mm). Lesser Scaups, Buffleheads and Common Goldeneyes from Lake Erie consumed zebra mussels of similar size.
Bathymetry of Lake Erie and Lake Saint Clair
National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry of Lake Erie and Lake Saint Clair has been compiled as a component of a NOAA project to rescue Great Lakes lake floor geological and geophysical data and...
33 CFR 162.130 - Connecting waters from Lake Huron to Lake Erie; general rules.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; general rules. 162.130 Section 162.130 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.130 Connecting waters from Lake Huron to Lake Erie; general rules. (a) Purpose. The...
A preliminary study of the Hg flux from selected Ohio watersheds to Lake Erie
International Nuclear Information System (INIS)
Fitzgibbon, T.O.; Berry Lyons, W.; Gardner, Christopher B.; Carey, Anne E.
2008-01-01
New measurements of riverine dissolved and particulate Hg fluxes into Lake Erie from 12 northern Ohio watersheds have been determined from samples collected in April 2002 and analyzed using ultra-clean techniques with cold-vapor atomic fluorescence spectrometry. Total Hg concentrations ranged through 2.5-18.5 ng L -1 , with a mean of 10.4 ng L -1 with most Hg in particulate form. Dissolved Hg concentrations ranged through 0.8-4.3 ng L -1 , with a mean of 2.5 ng L -1 . Highest total Hg concentrations were observed in western rivers with primarily agricultural land use and eastern rivers with mixed land use in their watersheds. Total suspended solid concentrations ranged through 10-180 mg L -1 with particulate Hg concentrations ranging through 47-170 ng g -1 , with a mean of 99 ng g -1 . Particulate Hg was similar to published data for central Lake Erie bottom sediments but much lower than for bottom sediments in western Lake Erie. Total Hg concentrations were positively correlated with suspended sediment concentrations and negatively with dissolved NO 3 - concentrations. The total estimated annual Hg fluxes from these rivers into Lake Erie is estimated to be 85 kg, but because only one event was sampled during high flow conditions, this may be an overestimate. This is much lower than previous published estimates of riverine Hg input into Lake Erie
33 CFR 162.134 - Connecting waters from Lake Huron to Lake Erie; traffic rules.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; traffic rules. 162.134 Section 162.134 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.134 Connecting waters from Lake Huron to Lake Erie; traffic rules. (a) Detroit River. The...
33 CFR 162.138 - Connecting waters from Lake Huron to Lake Erie; speed rules.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; speed rules. 162.138 Section 162.138 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.138 Connecting waters from Lake Huron to Lake Erie; speed rules. (a) Maximum speed limit for...
33 CFR 162.136 - Connecting waters from Lake Huron to Lake Erie; anchorage grounds.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; anchorage grounds. 162.136 Section 162.136 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.136 Connecting waters from Lake Huron to Lake Erie; anchorage grounds. (a) In the Detroit...
Longvah, Thingnganing; Manghtya, Korra; Qadri, Syed S Y H
2012-07-01
The study was undertaken to provide value addition to spent eri silkworm as an alternative source of edible oil for the food and feed industry by carrying out a short-term nutritional and toxicological evaluation of eri silkworm pupae oil using Wistar NIN rats. Growth performance of rats fed either sunflower oil (Control) or eri silkworm pupae oil (Experimental) was comparable. Histopathological examination of the various tissues showed no signs of toxicity even after feeding the eri silkworm oil for 18 weeks. Serum cholesterol and triglyceride was significantly reduced (P oil. The study showed that eri silkworm pupae oil is safe and nutritionally equivalent to commonly used vegetable oils. Eri silkworm pupae can be harvested to provide a cost effective alternative edible oil that can be used to nutritional advantage in the food and feed industry. Therefore eri silkworm and its host plants offer an excellent example of multiple product crops and of sustainable agricultural practice with excellent opportunity for economic and nutritional benefits. Copyright © 2012 Society of Chemical Industry.
2011-08-16
... as a home range. In the winter, Lake Erie watersnakes hibernate below the frost level, in cracks or... undertaken on each island property to avoid injury and harm to the Lake Erie watersnake during typical land...
Assessing Vulnerability of Lake Erie Landscapes to Soil Erosion: Modelled and Measured Approaches
Joosse, P.; Laamrani, A.; Feisthauer, N.; Li, S.
2017-12-01
Loss of soil from agricultural landscapes to Lake Erie via water erosion is a key transport mechanism for phosphorus bound to soil particles. Agriculture is the dominant land use in the Canadian side of the Lake Erie basin with approximately 75% of the 2.3 million hectares under crop or livestock production. The variable geography and diversity of agricultural production systems and management practices makes estimating risk of soil erosion from agricultural landscapes in the Canadian Lake Erie basin challenging. Risk of soil erosion depends on a combination of factors including the extent to which soil remains bare, which differs with crop type and management. Two different approaches of estimating the vulnerability of landscapes to soil erosion will be compared among Soil Landscapes of Canada in the Lake Erie basin: a modelling approach incorporating farm census and soil survey data, represented by the 2011 Agriculture and Agri-Food Canada Agri-Environmental Indicator for Soil Erosion Risk; and, a measured approach using remotely sensed data that quantifies the magnitude of bare and covered soil across the basin. Results from both approaches will be compared by scaling the national level (1:1 million) Soil Erosion Risk Indicator and the remotely sensed data (30x30 m resolution) to the quaternary watershed level.
76 FR 55564 - Safety Zone; Revolution 3 Triathlon, Sandusky Bay, Lake Erie, Cedar Point, OH
2011-09-08
...-AA00 Safety Zone; Revolution 3 Triathlon, Sandusky Bay, Lake Erie, Cedar Point, OH AGENCY: Coast Guard... Erie during the Revolution 3 Triathlon. This temporary safety zone is necessary to protect participants..., between 9 a.m. and 5 p.m., Monday through Friday, except Federal holidays. FOR FURTHER INFORMATION CONTACT...
75 FR 55477 - Safety Zone; Revolution 3 Triathlon, Lake Erie & Sandusky Bay, Cedar Point, OH
2010-09-13
...-AA00 Safety Zone; Revolution 3 Triathlon, Lake Erie & Sandusky Bay, Cedar Point, OH AGENCY: Coast Guard... portions of the Lake Erie during the Revolution 3 Cedar Point Triathlon. The temporary safety zone is... 5 p.m., Monday through Friday, except Federal holidays. FOR FURTHER INFORMATION CONTACT: If you have...
Lessons Learned from Stakeholder-Driven Modeling in the Western Lake Erie Basin
Muenich, R. L.; Read, J.; Vaccaro, L.; Kalcic, M. M.; Scavia, D.
2017-12-01
Lake Erie's history includes a great environmental success story. Recognizing the impact of high phosphorus loads from point sources, the United States and Canada 1972 Great Lakes Water Quality Agreement set load reduction targets to reduce algae blooms and hypoxia. The Lake responded quickly to those reductions and it was declared a success. However, since the mid-1990s, Lake Erie's algal blooms and hypoxia have returned, and this time with a dominant algae species that produces toxins. Return of the algal blooms and hypoxia is again driven by phosphorus loads, but this time a major source is the agriculturally-dominated Maumee River watershed that covers NW Ohio, NE Indiana, and SE Michigan, and the hypoxic extent has been shown to be driven by Maumee River loads plus those from the bi-national and multiple land-use St. Clair - Detroit River system. Stakeholders in the Lake Erie watershed have a long history of engagement with environmental policy, including modeling and monitoring efforts. This talk will focus on the application of interdisciplinary, stakeholder-driven modeling efforts aimed at understanding the primary phosphorus sources and potential pathways to reduce these sources and the resulting algal blooms and hypoxia in Lake Erie. We will discuss the challenges, such as engaging users with different goals, benefits to modeling, such as improvements in modeling data, and new research questions emerging from these modeling efforts that are driven by end-user needs.
2011-10-27
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 5984-063] Erie Boulevard Hydropower, L.P.; Notice of Application Accepted for Filing, Soliciting Comments, Motions To Intervene, and....: 5984-063. c. Date Filed: May 10, 2011. d. Applicant: Erie Boulevard Hydropower, L.P. (dba Brookfield...
Horizontal drilling under Lake Erie
Energy Technology Data Exchange (ETDEWEB)
Meller, R.
2001-07-01
Drilling oil wells under Lake Erie calls for horizontal drilling wells to be drilled from shore out into the pay-zone under the lake. The nature and characteristics of horizontal wells as compared to vertical wells are explored. Considerations that have to be taken into account in drilling horizontal wells are explained (the degree of curvature, drilling fluid quality, geosteering in the pay-zone, steering instrumentation, measurements while drilling (MWD), logging while drilling (LWD)). The concept and reasons for extended reach wells are outlined, along with characteristic features of multilateral wells.
Lucifer's Planet: Photolytic Hazes in the Atmosphere of 51 Eri b
Zahnle, Kevin
2016-01-01
We use a 1D model to address photochemistry and possible haze formation in the irradiated atmosphere of 51 Eri b (2016arXiv160407388Z). The intended focus was to have been on carbon and organic hazes, but sulfur photochemistry turns out to be interesting and possibly more important. The case for organic photochemical hazes is intriguing but falls short of being compelling. If organic hazes form abundantly, they are likeliest to do so if vertical mixing in 51 Eri b is weaker than in Jupiter, and they would be found below the altitudes where methane and water are photolyzed. The more novel result is that photochemistry turns H2S into elemental sulfur, here treated as S8. In the cooler models, S8 is predicted to condense in optically significant clouds of solid sulfur particles, whilst in the warmer models S8 remains a vapor along with several other sulfur allotropes that are both visually striking and potentially observable. For 51 Eri b, the division between models with and without condensed sulfur is at an effective temperature of 700 K, which is within error its actual effective temperature; the local temperature where sulfur condenses is between 280 and 320 K. The sulfur photochemistry we discuss is quite general and ought to be found in a wide variety of worlds over a broad temperature range, both colder and hotter than the 650-750 K range studied here, and we show that products of sulfur photochemistry will be nearly as abundant on planets where the UV irradiation is orders of magnitude weaker than it is on 51 Eri b.
Environmental review of natural gas production in Lake Erie
International Nuclear Information System (INIS)
O'Shea, K.
2002-01-01
The water of Lake Erie is used as a source of drinking water for Ontario, New York, Pennsylvania, Ohio and Michigan. An environmental review has been conducted to determine the impact of drilling operations on the overall ecology of the lake. Since 1913, 2000 natural gas wells have been drilled in Lake Erie, of which 550 currently produce gas and account for 75 per cent of Ontario's total gas production. 180 wells are shut-in or suspended and the remaining wells have been abandoned. The gas wells are connected to onshore production facilities by approximately 1,600 km of small diameter pipelines that lie buried near shore or on top of the lake bed. Nearly 90 per cent of the in-lake infrastructure is in water depths of more than 20 metres. Talisman Energy is actively involved with the Canadian Coast Guard, the Department of Fisheries and Oceans, and the Ministry of Natural Resources to ensure cooperation between regulators and off-shore personnel. The environmental assessment of natural gas production in Lake Erie included a review of regulatory and best management practices, a biophysical overview of the lake, and a review of drilling practices, well completions, handling of waste streams, materials management, operations inspections, wastewater discharge, air emissions, and oil spills. It was revealed that for most drilling programs, cuttings are washed and discharged to the Lake. Ongoing testing will determine the impact that this practice has on benthic populations. The drill muds used for drilling operations are water based, environmentally friendly, and re-used between well locations. For completion programs, all well activities are closed circuit operations. Wells are abandoned through plugging with cement, removing wellheads and casing below the lake bottom. There has been a reported volume of about 23,000 litres of spilled product from 1990 to 2001, of which 68 per cent has come from 3 industrial companies that operate near Lake Erie. The offshore gas
PHOTOLYTIC HAZES IN THE ATMOSPHERE OF 51 ERI B
Energy Technology Data Exchange (ETDEWEB)
Zahnle, K.; Marley, M. S. [NASA Ames Research Center, Moffett Field, CA 94035 (United States); Morley, C. V. [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Moses, J. I., E-mail: Kevin.J.Zahnle@NASA.gov, E-mail: kzahnle@mail.arc.NASA.gov, E-mail: Mark.S.Marley@NASA.gov, E-mail: cmorley@ucolick.org, E-mail: jmoses@spacescience.org [Space Science Institute, 4750 Walnut Street, Suite 205, Boulder, CO 80301 (United States)
2016-06-20
We use a 1D model to address photochemistry and possible haze formation in the irradiated warm Jupiter, 51 Eridani b. The intended focus was to be carbon, but sulfur photochemistry turns out to be important. The case for organic photochemical hazes is intriguing but falls short of being compelling. If organic hazes form, they are likeliest to do so if vertical mixing in 51 Eri b is weaker than in Jupiter, and they would be found below the altitudes where methane and water are photolyzed. The more novel result is that photochemistry turns H{sub 2}S into elemental sulfur, here treated as S{sub 8}. In the cooler models, S{sub 8} is predicted to condense in optically thick clouds of solid sulfur particles, while in the warmer models S{sub 8} remains a vapor along with several other sulfur allotropes that are both visually striking and potentially observable. For 51 Eri b, the division between models with and without condensed sulfur is at an effective temperature of 700 K, which is within error its actual effective temperature; the local temperature where sulfur condenses is between 280 and 320 K. The sulfur photochemistry we have discussed is quite general and ought to be found in a wide variety of worlds over a broad temperature range, both colder and hotter than the 650–750 K range studied here, and we show that products of sulfur photochemistry will be nearly as abundant on planets where the UV irradiation is orders of magnitude weaker than it is on 51 Eri b.
2013-11-13
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 7320-042] Erie Boulevard Hydropower, L.P.; Notice of Scoping Meetings and Environmental Site Review and Soliciting Scoping Comments.... Date filed: July 1, 2013. d. Applicant: Erie Boulevard Hydropower, L.P. e. Name of Project: Chasm...
Zebra mussels invade Lake Erie muds
Berkman, Paul Arthur; Haltuch, Melissa A.; Tichich, Emily; Garton, David W.; Kennedy, Gregory W.; Gannon, John E.; Mackey, Scudder D.; Fuller, Jonathan A.; Liebenthal, Dale L.
1998-01-01
Zebra mussels (Dreissena polymorpha) originated in western Russia but have now become widespread in Europe and North America. They are widely known for their conspicuous invasion of rocks and other hard substrates in North American and European watersheds. We have found beds of zebra mussels directly colonizing sand and mud sediments each year across hundreds of square kilometres of North America's Lake Erie. This transformation of sedimentary habitats into mussel beds represents an unforeseen change in the invasive capacity of this species.
Thermodynamic assessments of the Ag-Er and Er-Y systems
International Nuclear Information System (INIS)
Wang, S.L.; Wang, C.P.; Liu, X.J.; Tang, A.T.; Pan, F.S.; Ishida, K.
2010-01-01
The phase diagrams and thermodynamic properties in the Ag-Er and Er-Y binary systems have been assessed by using the CALPHAD (Calculation of Phase Diagrams) method on the basis of the experimental data including the thermodynamic properties and phase equilibria. The Gibbs free energies of the liquid, bcc, fcc, and hcp phases were described by the subregular solution model with the Redlich-Kister equation, and those of intermetallic compounds (Ag 2 Er and AgEr phases) were treated as stoichiometric compounds, and Ag 51 Er 14 phase was modeled by the sublattice model in the Ag-Er binary system. The thermodynamic parameters of the Ag-Er and Er-Y binary systems were obtained, and an agreement between the calculated results and experimental data was obtained for each binary system.
2013-10-18
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 7320-042] Erie Boulevard Hydropower, L.P.; Notice of Application Accepted for Filing and Soliciting Motions To Intervene and Protests.... Date filed: July 1, 2013. d. Applicant: Erie Boulevard Hydropower, L.P. e. Name of Project: Chasm...
Fisheries research and monitoring activities of the Lake Erie Biological Station, 2014
Bodamer Scarbro, Betsy L.; Edwards, William; Gawne, Carrie; Kocovsky, Patrick M.; Kraus, Richard T.; Rogers, Mark W.; Stewart, Taylor
2015-01-01
In 2014, the USGS LEBS successfully completed large vessel surveys in all three of Lake Erie’s basins. Lake Erie Biological Station’s primary vessel surveys included the Western Basin Forage Fish Assessment and East Harbor Forage Fish Assessment as well as contributing to the cooperative multi-agency Central Basin Hydroacoustics Assessment, the Eastern Basin Coldwater Community Assessment, and LTLA (see FTG, CWTG, and FTG reports, respectively). Results from the surveys contribute to Lake Erie Committee Task Group data needs and analyses of trends in Lake Erie’s fish communities. The cruise survey schedule in 2014 was greatly increased by LEBS’s participation in the Lake Erie CSMI, which consisted of up-to two weeks of additional sampling per month from April to October. CSMI is a bi-national effort that occurs at Lake Erie every five years with the purpose of addressing data and knowledge gaps necessary to management agencies and the Lake Erie LaMP. LEBS deepwater science capabilities also provided a platform for data collection by Lake Erie investigators from multiple agencies and universities including: the USGS GLSC, ODW, KSU, OSU, UM, PU, UT, and the USNRL. Samples from this survey are being processed and a separate report of the findings will be made available in a separate document. Our 2014 vessel operations were initiated in mid-April, as soon after ice-out as possible, and continued into early December. During this time, crews of the R/V Muskie and R/V Bowfin deployed 196 bottom trawls covering 48.5 km of lake-bottom, nearly 6 km of gillnet, collected data from 60 hydroacoustics transects, 285 lower trophic (i.e., zooplankton and benthos) samples, and 330 water quality measures (e.g., temperature profiles, water samples). Thus, 2014 was an intensive year of field activity. Our June and September bottom trawl surveys in the Western Basin were numerically dominated by Emerald Shiner, White Perch, and Yellow Perch; however, Freshwater Drum were
Investment in agricultural conservation practices (CPs) to address Lake Erie's re-eutrophication may offer benefits that extend beyond the lake, such as improved habitat conditions for fish communities throughout the watershed. If such conditions are not explicitly considered in Lake Erie nutrient ...
2008 Federal Emergency Management Agency (FEMA) New York Lidar: Erie County
National Oceanic and Atmospheric Administration, Department of Commerce — Using Leica Geosystems ALS50 Laser Systems, 89 flight lines with a nominal point spacing = 1.4 meters (4.59 feet) were collected over Erie County, NY (approximately...
Predation of the zebra mussel (Dreissena polymorpha) by freshwater drum in western Lake Erie
French, John R. P.; Bur, Michael T.; Nalepa, Thomas F.; Schloesser, Donald W.
1992-01-01
Environmental and economic problems associated with the colonization of zebra mussels (Dreissena polymorpha) in western Lake Erie created a need to investigate control mechanisms. Predation by fishes is one potential means of control, but predation on zebra mussels by native fishes in Lake Erie is unknown. The freshwater drum (Aplodinotus grunniens) is the most likely fish predator since it is the only fish with pharyngeal teeth capable of crushing mollusk shells. In 1990, freshwater drum were collected in western Lake Erie from 9 sites near rocky reefs and 13 sites with silt or sand bottoms, and gut contents were examined. Predation on zebra mussels increased as drum size increased. Small drum (200-249 mm in length) fed mainly on dipterans, amphipods, and small fish; small zebra mussels (375 mm in length) fed almost exclusively on zebra mussels (seasons and locations combined). The smallest drum capable of crushing zebra mussel shells was 265 mm. Since freshwater drum over 375 mm feed heavily on zebra mussels, they may become a possible biological control mechanism for mussels in portions of North America.
2010-08-20
... Hydropower, L.P.; Notice of Intent To File License Application, Filing of Pre-Application Document, and.... Project No.: 7320-040. c. Dated Filed: June 29, 2010. d. Submitted By: Erie Boulevard Hydropower, L.P. e...: John Mudre at (202) 502-8902; or e-mail at [email protected] . j. Erie Boulevard Hydropower, L.P...
BOTULISM E IN LAKE ERIE: ECOLOGY AND LOWER FOOD WEB TRANSFER
This project will determine the environmental conditions that favor botulism Type E bacteria in Lake Erie and explore whether quagga mussels are altering bottom sediment conditions to favor C. botulinum growth. Analysis of environmental parameters, including water chemistry, alg...
Nuebling, Matthias; Seidler, Andreas; Garthus-Niegel, Susan; Latza, Ute; Wagner, Mandy; Hegewald, Janice; Liebers, Falk; Jankowiak, Sylvia; Zwiener, Isabella; Wild, Philipp S; Letzel, Stephan
2013-06-04
Several instruments have been developed to assess psychosocial workload. We compared two of these instruments, the Effort-Reward Imbalance (ERI) model and the Copenhagen Psychosocial Questionnaire (COPSOQ) with regard to congruent validity and internal validity. This analysis is based on a population-based sample of the baseline examination of 2,783 employees from the Gutenberg Health Study (GHS). About half of the participants completed the ERI questionnaire (n = 1,342), the other half completed the COPSOQ (n = 1,441). First, the two samples were compared and descriptive analyses were carried out calculating mean values for both instruments in general, then separately for age, gender and main occupational groups. Second, we analyzed the relationship between ERI and COPSOQ scales on the workplace situation and on the workplace outcomes: job satisfaction, general health, burnout, satisfaction with life, by applying stepwise logistic regression analysis. For the majority of occupations, high effort as reflected by the ERI corresponded with high demands as reflected by the COPSOQ. Comparably, high reward (according to ERI) yielded a good agreement with high "influence and development" (according to COPSOQ). However, we could also find differences between ERI and COPSOQ concerning the intensity of psychosocial workload in some occupations (e.g., physicians/pharmacists or warehouse managers/warehousemen/transport workers). These differences point to differing theoretical concepts of ERI and COPSOQ. When the ability of ERI and COPSOQ was examined to determine the associations with health and work outcomes, burnout could be better predicted by the COPSOQ; this might be due to the fact that COPSOQ comprises the constructs "work-privacy conflict" and "emotional demand", which are closely related to burnout. However, methodological differences between these instruments limit their direct comparability. The ERI and COPSOQ instrument yielded similar results for most
Esteetilis-praktiline töö kui eriõppe alternatiiv / Uffe Bjerre
Bjerre, Uffe
2005-01-01
Milleks tuupida lapsele pähe seda, millega ta hakkama ei saa, selle asemel et arendada õpilase tugevaid külgi? Samas ka koolipsühholoogide, eripedagoogide Tove Hvidi ja Howard Gardneri väited eriõpet vajavate laste kohta
International Nuclear Information System (INIS)
1977-01-01
Erie 1 and 2 reactors will be located on a site consisting of 1,740 acres in Berlin Township about 2.4 miles south of Lake Erie and 8.9 miles southeast of Sandusky, Ohio. Lake Erie will provide makeup water. The ultimate heat sink will be a 40 acre cooling reservoir shared by both units. Each unit has a proposed core thermal power level of 3,760 MW(t) and a nominal net capacity of about 1282 MW(e). Unit 1 is scheduled for commercial operation by 4/1/84 and Unit 2 by 4/1/86. Fuel will be Zircaloy-4 clad tubes containing cylindrical fuel pellets of UO 2 . B and W pressurized water reactor units to be employed are described in DOCKET-STN-50561
Minimum size limits for yellow perch (Perca flavescens) in western Lake Erie
Hartman, Wilbur L.; Nepszy, Stephen J.; Scholl, Russell L.
1980-01-01
During the 1960's yellow perch (Perca flavescens) of Lake Erie supported a commercial fishery that produced an average annual catch of 23 million pounds, as well as a modest sport fishery. Since 1969, the resource has seriously deteriorated. Commercial landings amounted to only 6 million pounds in 1976, and included proportionally more immature perch than in the 1960's. Moreover, no strong year classes were produced between 1965 and 1975. An interagency technical committee was appointed in 1975 by the Lake Erie Committee of the Great Lakes Fishery Commission to develop an interim management strategy that would provide for greater protection of perch in western Lake Erie, where declines have been the most severe. The committee first determined the age structure, growth and mortality rates, maturation schedule, and length-fecundity relationship for the population, and then applied Ricker-type equilibrium yield models to determine the effects of various minimum length limits on yield, production, average stock weight, potential egg deposition, and the Abrosov spawning frequency indicator (average number of spawning opportunities per female). The committee recommended increasing the minimum length limit of 5.0 inches to at least 8.5 inches. Theoretically, this change would increase the average stock weight by 36% and potential egg deposition by 44%, without significantly decreasing yield. Abrosov's spawning frequency indicator would rise from the existing 0.6 to about 1.2.
First records of a European cladoceran, Bythotrephes cederstroemi, in Lakes Erie and Huron
Bur, Michael T.; Klarer, David M.; Krieger, Kenneth A.
1986-01-01
Adult forms of the cladoceran Bythotrephes cederstroemi Schoedler (Cercopagidae), a widespread European freshwater zooplankter, occurred in the stomachs of four common species of Lake Erie fish (yellow perch, Perca flavescens; white perch, Morone americana; white bass, M. chrysops; and walleye, Stizostedion vitreum vitreum) collected in early October 1985. The fish were collected at several stations in the nearshore open waters of the central basin between Ashtabula and Huron, Ohio. Other investigators have seen this species in other locations in Lake Erie and also in Lake Huron. The report of B. cederstroemi in Lake Huron in December 1984 appears to be the first record of this species in North America.
El idealismo en la filosofía medieval: el caso de Juan Escoto Eriúgena
Moran, Dermont
2012-01-01
Quiero sostener en este artículo (en contra de la posición de Myles Burnyeat) que el idealismo es una posibilidad filosófica genuina previa a Descartes. En efecto, podemos encontrar una versión del idealismo que supone un concepto desarrollado de subjetividad en una sofisticada versión del Periphyseon de Escoto Eriúgena. El inmaterialismo intelectualista extremo de Eriúgena difiere del idealismo moderno en la medida en que aquél no está motivado tanto por una consideración epistemológica de ...
Lake trout rehabilitation in Lake Erie: a case history
Cornelius, Floyd C.; Muth, Kenneth M.; Kenyon, Roger
1995-01-01
Native lake trout (Salvelinus namaycush) once thrived in the deep waters of eastern Lake Erie. The impact of nearly 70 years of unregulated exploitation and over 100 years of progressively severe cultural eutrophication resulted in the elimination of lake trout stocks by 1950. Early attempts to restore lake trout by stocking were unsuccessful in establishing a self-sustaining population. In the early 1980s, New York's Department of Environmental Conservation, Pennsylvania's Fish and Boat Commission, and the U.S. Fish and Wildlife Service entered into a cooperative program to rehabilitate lake trout in the eastern basin of Lake Erie. After 11 years of stocking selected strains of lake trout in U.S. waters, followed by effective sea lamprey control, lake trout appear to be successfully recolonizing their native habitat. Adult stocks have built up significantly and are expanding their range in the lake. Preliminary investigations suggest that lake trout reproductive habitat is still adequate for natural reproduction, but natural recruitment has not been documented. Future assessments will be directed toward evaluation of spawning success and tracking age-class cohorts as they move through the fishery.
International Nuclear Information System (INIS)
Shen Li; Gewurtz, Sarah B.; Reiner, Eric J.; MacPherson, Karen A.; Kolic, Terry M.; Helm, Paul A.; Brindle, Ian D.; Marvin, Chris H.
2008-01-01
This study determines spatial trends and congener patterns of 2378-substituted polychlorinated dibenzo-p-dioxins (PCDDs) and polychlorinated dibenzofurans (PCDFs) in surficial sediments of Lakes Erie and Ontario. Sediments are enriched in 2378-PCDFs in Lake Ontario, and the PCDD/F concentrations increased from shallow near-shore sediments towards deep-water depositional zone sediments. In Lake Erie, sediments were dominated by octachlorodibenzo-p-dioxin, and the highest PCDD/F concentrations were observed in the western basin and the southern shoreline of the central basin with a decrease towards the eastern basin and the northern shoreline of the central basin. Principal components analysis revealed that chemical manufacture and disposal of chemical waste along the Niagara River has been a major PCDD/F source to Lake Ontario; while PCDD/Fs in Lake Erie are from multiple sources including industrial sources along the Detroit River, major tributaries along the southern shoreline of the lake, and atmospherically-derived material from the upper lakes and connecting channels. - Lake-wide 2378-PCDD/F congener patterns are first reported in L. Erie and L. Ontario sediments
Larson, James H.; Evans, Mary Anne; Kennedy, Robert J.; Bailey, Sean; Loftin, Keith A.; Laughrey, Zachary; Femmer, Robin; Schaeffer, Jeff; Richardson, William B.; Wynne, Timothy; Nelson, J. C.; Duris, Joseph W.
2018-01-01
Large lakes provide a variety of ecological services to surrounding cities and communities. Many of these services are supported by ecological processes that are threatened by the increasing prevalence of cyanobacterial blooms which occur as aquatic ecosystems experience cultural eutrophication. Over the past 10 yr, Lake Erie experienced cyanobacterial blooms of increasing severity and frequency, which have resulted in impaired drinking water for the surrounding communities. Cyanobacterial blooms may impact ecological processes that support other services, but many of these impacts have not been documented. Secondary production (production of primary consumers) is an important process that supports economically important higher trophic levels. Cyanobacterial blooms may influence secondary production because cyanobacteria are a poor‐quality food resource and cyanotoxins may be harmful to consumers. Over 3 yr at 34 sites across the western basin of Lake Erie, we measured three indices of secondary production that focus on the dominant bivalve taxa: (1) growth of a native unionid mussel, (2) the size of young‐of‐year dreissenid mussels, and (3) the mass of colonizing animals on a Hester‐Dendy sampler. Associations between these indices and cyanobacterial data were estimated to assess whether cyanobacteria are associated with variation in secondary production in the western basin of Lake Erie. The results suggest cyanobacterial abundance alone is only weakly associated with secondary production, but that cyanotoxins have a larger effect on secondary production. Given recurring late‐summer cyanobacterial blooms, this impact on secondary production has the potential to undermine Lake Erie's ability to sustain important ecosystem services.
Chilton, E.W.; Lowe, R.L.; Schurr, K.M.
1986-01-01
The appearance of the marine alga Bangia atropurpurea (Rhodophyta) in Lake Erie has been followed by its rapid dispersal throughout the eulittoral zone of the lake. Bangia was extensively sampled to determine its suitability as a habitat for littoral organisms. Present data indicate that the only organisms capable of maintaining populations on Bangia filaments are larval Chironomidae. Cladophora supports a larger and more diverse community. It is concluded that the mucilaginous cell wall of Bangia provides a less stable substrate for attached or clinging organisms than does the cellulose cell wall of Cladophora. The presence of Bangia in the littoral zone of Lake Erie results in a reduction of the quantity and diversity of algal epiphytes and may negatively impact the littoral food web.
Jackson, P. Ryan; Contantinescu, G.; Garcia, M.; Hanes, D.
2016-01-01
Animations of highly dynamic water-surface profiles through the St. Clair and Detroit Rivers have identified transient disturbances propagating from Lakes Huron and Erie into the St. Clair and Detroit Rivers, respectively. To determine any relation to seiche and tidal oscillations on Lakes Huron and Erie, a spectral analysis was performed on stage and discharge data from the Huron-Erie Corridor. There is excellent agreement between the observed oscillations in stage and discharge in the St. Clair and Detroit Rivers and the documented frequencies of oscillations in Lakes Huron and Erie. The fundamental seiche, some higher-order seiche modes, and the semidiurnal tide from Lakes Huron and Erie are evident in the stage and discharge records at gages along the St. Clair and Detroit Rivers, respectively. Lake St. Clair appears to act as a damper in the system. If not accounted for, these oscillations may complicate monitoring, modeling, and restoration of this system.
A description of the nearshore fish communities in the Huron-Erie Corridor using multiple gear types
Francis, James T.; Chiotti, Justin A.; Boase, James C.; Thomas, Mike V.; Manny, Bruce A.; Roseman, Edward F.
2013-01-01
Great Lakes coastal wetlands provide a critical habitat for many fish species throughout their life cycles. Once home to one of the largest wetland complexes in the Great Lakes, coastal wetlands in the Huron–Erie Corridor (HEC) have decreased dramatically since the early 1900s. We characterized the nearshore fish communities at three different wetland complexes in the HEC using electrofishing, seines, and fyke nets. Species richness was highest in the Detroit River (63), followed by the St. Clair Delta (56), and Western Lake Erie (47). The nearshore fish communities in the Detroit River and St. Clair Delta consisted primarily of shiners, bluntnose minnow, centrarchids, and brook silverside, while the Western Lake Erie sites consisted of high proportions of non-native taxa including common carp, gizzard shad, goldfish, and white perch. Species richness estimates using individual-based rarefaction curves were higher when using electrofishing data compared to fyke nets or seine hauls at each wetland. Twelve fish species were captured exclusively during electrofishing assessments, while one species was captured exclusively in fyke nets, and none exclusively during seine hauls. Western Lake Erie wetlands were more indicative of degraded systems with lower species richness, lower proportion of turbidity intolerant species, and increased abundance of non-native taxa. This work highlights the importance of coastal wetlands in the HEC by capturing 69 different fish species utilizing these wetlands to fulfill life history requirements and provides insight when selecting gears to sample nearshore littoral areas.
Lake Erie, phosphorus and microcystin: Is it really the farmer's fault?
Agricultural loss of phosphorus (P) have been identified as a primary contributor to eutrophication and the associated release of toxins (i.e., mycrocystin) in Lake Erie. These losses are commonly deemed excessive by the media and the public, singling out agriculture as the culprit in spite of redu...
Historical Documentation of Warm-Season Grasses Management at Erie National Wildlife Refuge 1989
Department of the Interior — The early accounts of an active grassland management program at Erie National Wildlife Refuge dates back to 1977. This report is an attempt to document the refuge’s...
Farhadzadeh, A.; Hashemi, M. R.
2016-02-01
Lake Erie, the fourth largest in surface area, smallest in volume and shallowest among the Great Lakes is approximately 400 km long and 90 km wide. Short term lake level variations are due to storm surge generated by high winds and moving pressure systems over the lake mainly in the southwest-northeast direction, along the lakes longitudinal axis. The historical wave data from three active offshore buoys shows that significant wave height can exceed 5 m in the eastern and central basins. The long-term lake level data show that storm surge can reach up to 3 m in eastern Lake Erie. Owing its shallow depth, Lake Erie frequently experiences seiching motions, the low frequency oscillations that are initiated by storm surge. The seiches whose first mode of oscillations has a period of nearly 14.2 hours can last from several hours to days. In this study, the Lake Erie potential for power generation, primarily using storm surge and seiche and also waves are assessed. Given the cyclic lake level variations due to storm-induced seiching, a concept similar to that of tidal range development is utilized to assess the potential of storm surge and seiche energy harvesting mechanisms for power generation. In addition, wave energy resources of the Lake is characterized -. To achieve these objectives, the following steps are taken : (1) Frequency of occurrence for extreme storm surge and wave events is determined using extreme value analysis such as Peak-Over-Threshold method for the long-term water level and wave data; (2) Spatial and temporal variations of wave height, storm surge and seiche are characterized. The characterization is carried out using the wave and storm surge outputs from numerical simulation of a number of historical extreme events. The coupled ADCIRC and SWAN model is utilized for the modeling; (3) Assessment of the potentials for marine renewable power generation in Lake Erie is made. The approach can be extended to the other lakes in the Great Lakes region.
Krishnan, A.; Mou, X. J.
2015-12-01
Lake Erie, the smallest and warmest lake among the Laurentian Great Lakes, is known for its problem of eutrophication and frequent occurrence of harmful cyanobacterial blooms (CyanoHABs). One major harmful effect of CyanoHABs is the production of cyanotoxins, especially microcystins. Microcystins (MC) are a group of hepatotoxins and the predominant variant of them is MC-LR. Field measurements and lab experiments indicate that MC degradation in Lake Erie is mainly carried out by indigenous bacteria. However, our knowledge on taxa involved in this process is very limited. This study aimed to fill this knowledge gap using a culture-dependent approach. Water and surface sediment samples were collected from Lake Erie in 2014 and 2015 and enriched with MC-LR. Cells were plated on a number of culturing media. The obtained pure bacterial cultures were screened for MC degrading abilities by MT2 BIO-LOG assays and by growing cells in liquid media containing MC-LR as the sole carbon source. In the latter experiment, MC concentrations were measured using HPLC. Isolates showing positive MC degradation activities in the screening steps were designated MC+ bacteria and characterized based on their phenotypic properties, including colony pigmentation, elevation, opacity, margin, gram nature and motility. The taxonomic identity of MC+ bacteria was determined by 16S rRNA gene full-length DNA sequencing. The presence of mlrA, a gene encoding MC cleavage pathway, was detected by PCR. Our culturing efforts obtained 520 pure cultures; 44 of them were identified as MC+. These MC+ isolates showed diversity in taxonomic identities and differed in their morphology, gram nature, colony characteristics and motility. PCR amplification of mlrA gene yield negative results for all MC+ isolates, indicating that the primers that were used may not be ubiquitous enough to cover the heterogeneity of mlrA genes or, more likely, alternative degradative genes/pathways were employed by Lake Erie bacteria
Reconstructing Heat Fluxes Over Lake Erie During the Lake Effect Snow Event of November 2014
Fitzpatrick, L.; Fujisaki-Manome, A.; Gronewold, A.; Anderson, E. J.; Spence, C.; Chen, J.; Shao, C.; Posselt, D. J.; Wright, D. M.; Lofgren, B. M.; Schwab, D. J.
2017-12-01
The extreme North American winter storm of November 2014 triggered a record lake effect snowfall (LES) event in southwest New York. This study examined the evaporation from Lake Erie during the record lake effect snowfall event, November 17th-20th, 2014, by reconstructing heat fluxes and evaporation rates over Lake Erie using the unstructured grid, Finite-Volume Community Ocean Model (FVCOM). Nine different model runs were conducted using combinations of three different flux algorithms: the Met Flux Algorithm (COARE), a method routinely used at NOAA's Great Lakes Environmental Research Laboratory (SOLAR), and the Los Alamos Sea Ice Model (CICE); and three different meteorological forcings: the Climate Forecast System version 2 Operational Analysis (CFSv2), Interpolated observations (Interp), and the High Resolution Rapid Refresh (HRRR). A few non-FVCOM model outputs were also included in the evaporation analysis from an atmospheric reanalysis (CFSv2) and the large lake thermodynamic model (LLTM). Model-simulated water temperature and meteorological forcing data (wind direction and air temperature) were validated with buoy data at three locations in Lake Erie. The simulated sensible and latent heat fluxes were validated with the eddy covariance measurements at two offshore sites; Long Point Lighthouse in north central Lake Erie and Toledo water crib intake in western Lake Erie. The evaluation showed a significant increase in heat fluxes over three days, with the peak on the 18th of November. Snow water equivalent data from the National Snow Analyses at the National Operational Hydrologic Remote Sensing Center showed a spike in water content on the 20th of November, two days after the peak heat fluxes. The ensemble runs presented a variation in spatial pattern of evaporation, lake-wide average evaporation, and resulting cooling of the lake. Overall, the evaporation tended to be larger in deep water than shallow water near the shore. The lake-wide average evaporations
Schloesser, Don W.; Krieger, Kenneth A.; Ciborowski, Jan J.H.; Corkum, Lynda D.
2000-01-01
Burrowing mayflies of the genus Hexagenia spp. were widely distributed (ca. 80% of sites) and abundant (ca. 160 nymphs/m2) in the western basin of Lake Erie of the Laurentian Great Lakes in 1929–1930, prior to a period of anoxia in the mid 1950s. Nymphs were absent or rare in the basin between 1961 and 1973–1975. In 1979–1991, nymphs were infrequently found (13–46% of sites) in low abundance (3–40 nymphs/m2) near shore (recolonized sediments of western Lake Erie and that their abundance may be similar to levels observed before their disappearance in the mid 1950s. However, prior to the mid 1950s, densities were greater in offshore than nearshore waters, but between 1979 and 1998 greater densities occurred near shore than offshore. In addition, there were two areas in the 1990s where low densities consistently occurred. Therefore, recovery of nymphs in western Lake Erie may not have been complete in 1998. At present we do not know the cause for the sudden recolonization of nymphs in large portions of western Lake Erie. Undoubtedly, pollution-abatement programs contributed to improved conditions that would have ultimately led to mayfly recovery in the future. However, the explosive growth of the exotic zebra mussel, Dreissena polymorpha, undoubtedly diverted plankton foods to bottom substrates which could have increased the speed at which Hexagenia spp. nymphs recolonized sediments in western Lake Erie in the 1990s.
Turbidity as a factor in the decline of Great Lakes fishes with special reference to Lake Erie
Van Oosten, John
1948-01-01
Fish live and thrive in water with turbidities that range above 400 p.p.m. and average 200 p.p.m. The waters of the Great Lakes usually are clear except in Lake Erie where the turbidities of the inshore areas averaged 37 p.p.m.; the turbidities of the offshore waters averaged less. Lake Erie waters were no clearer 50 years ago than they are now. In fact, the turbidity values are less now than they were in the earlier years; the annual average of the inshore waters dropped from 44 p.p.m. before 1930 to 32 p.p.m. in 1930 and later, and the April-May values decreased from 72 p.p.m. to 46 p.p.m. Any general decline in the Lake Erie fishes cannot be attributed to increased turbidities. Furthermore, these turbidities averaged well below 100 p.p.m. and, therefore, were too low to affect fishes adversely.
78 FR 26416 - Environmental Impact Statement: City of Buffalo, Erie County, New York
2013-05-06
... from the US Border Port of Entry/Peace Bridge Plaza (Plaza), in the City of Buffalo, Erie County, New... Drive, and to provide alternate access from Porter Avenue to the Plaza. Letters describing the proposed...
Eri aistijärjestelmiä aktivoivat tasapainoharjoitteluvälineet
Kytölinna, Pauliina
2017-01-01
Opinnäytetyön tarkoituksena oli selvittää tämänhetkiset näyttöön perustuvat tasapainoharjoittelukeinot sekä – välineet, jonka perusteella Satakunnan ammattikorkeakoulun fysioterapian koulutusohjelmille laaditaan tasapainovälineiden hankintasuunnitelma. Tasapainovälineiden hankintasuunnitelman näkökulmaksi valittiin tasapainoharjoittelun pienvälineet, jotka monipuolisesti aktivoivat eri aistijärjestelmiä. Kuvailevan kirjallisuuskatsauksen keinoin opinnäytetyössä selvitettiin aistijärjeste...
78 FR 60009 - Environmental Impact Statement: Erie and Genesee Counties, New York
2013-09-30
... and Genesee Counties, New York AGENCY: Federal Highway Administration (FHWA), DOT; New York State... counties of Erie and Genesee, New York (NYSDOT Project Identification Number: 5528.28). A Notice of Intent... CONTACT: Jonathan McDade, Division Administrator, Federal Highway Administration, New York Division, Leo W...
The Fossil Fauna of the Islands Region of Western Lake Erie.
Bowe, Lulu M., Comp.
The islands of western Lake Erie are rock-bound isles that abound in rocky outcrops and quarries. The rocks of these islands are of two distinct types, Silurian dolomites and Devonian limestones. The dolomites, exposed in the Bass Islands and Sister Islands are virtually devoid of fossils. Conversely, the limestones of Johnson Island, Marblehead,…
Water resources of the Lake Erie shore region in Pennsylvania
Mangan, John William; Van Tuyl, Donald W.; White, Walter F.
1952-01-01
An abundant supply of water is available to the Lake Erie Shore region in Pennsylvania. Lake i£rie furnishes an almost inexhaustible supply of water of satisfactory chemical quality. Small quantities of water are available from small streams in the area and from the ground. A satisfactory water supply is one of the factors that affect the economic growth of a region. Cities and towns must have adequate amounts of pure water for human consumption. Industries must have suitable water ih sufficient quantities for all purposes. In order to assure. success and economy, the development of water resources should be based on adequate knowledge of the quantity and quality of the water. As a nation, we can not afford to run the risk of dissipating our resources, especially in times of national emergency, by building projects that are not founded on sound engineering and adequate water-resources information. The purpose of this report is to summarize and interpret all available water-resources information for the Lake Erie Shore region in Pennsylvania. The report will be useful for initial guidance in the location or expansion of water facilities for defense and nondefense industries and the municipalities upon which they are dependent. It will also be useful in evaluating the adequacy of the Geological Survey's part of the basic research necessary to plan the orderly development of the water resources of the Lake Erie Shore region. Most of the data contained inthis report have been obtained'by the U. S. Geological Survey in cooperation with the Pennsylvania Department of Forests and Waters, the Pennsylvania Department of Internal Affairs, and the Pennsylvania State Planning Board, Department of Commerce. The Pennsylv~nia Department of Health furnished information on water pollution. The report was prepared in the Water Resources Division of the U. S. Geological Survey b:y John W. Mangan (Surface Water). Donald W. VanTuyl (Ground Water). and Walter F. White, Jr. (Quality of
Assessing and addressing the re-eutrophication of Lake Erie: central basin hypoxia
Scavia, Donald; Allan, J. David; Arend, Kristin K.; Bartell, Steven; Beletsky, Dmitry; Bosch, Nate S.; Brandt, Stephen B.; Briland, Ruth D.; Daloğlu, Irem; DePinto, Joseph V.; Dolan, David M.; Evans, Mary Anne; Farmer, Troy M.; Goto, Daisuke; Han, Haejin; Höök, Tomas O.; Knight, Roger; Ludsin, Stuart A.; Mason, Doran; Michalak, Anna M.; Richards, R. Peter; Roberts, James J.; Rucinski, Daniel K.; Rutherford, Edward; Schwab, David J.; Sesterhenn, Timothy M.; Zhang, Hongyan; Zhou, Yuntao
2014-01-01
Relieving phosphorus loading is a key management tool for controlling Lake Erie eutrophication. During the 1960s and 1970s, increased phosphorus inputs degraded water quality and reduced central basin hypolimnetic oxygen levels which, in turn, eliminated thermal habitat vital to cold-water organisms and contributed to the extirpation of important benthic macroinvertebrate prey species for fishes. In response to load reductions initiated in 1972, Lake Erie responded quickly with reduced water-column phosphorus concentrations, phytoplankton biomass, and bottom-water hypoxia (dissolved oxygen 2) requires cutting total phosphorus loads by 46% from the 2003–2011 average or reducing dissolved reactive phosphorus loads by 78% from the 2005–2011 average. Reductions to these levels are also protective of fish habitat. We provide potential approaches for achieving those new loading targets, and suggest that recent load reduction recommendations focused on western basin cyanobacteria blooms may not be sufficient to reduce central basin hypoxia to 2000 km2.
Diode-pumped high power 2.7 μm Er:Y2O3 ceramic laser at room temperature
Wang, Li; Huang, Haitao; Shen, Deyuan; Zhang, Jian; Chen, Hao; Tang, Dingyuan
2017-09-01
Investigation of room temperature laser performance of the polycrystalline Er:Y2O3 ceramic at 2.7 μm with respect to dopant concentrations was conducted. With 7 at.% Er3+ concentration Er:Y2O3 ceramic as laser gain medium, over 2.05 W of CW output power at 2.7 μm was generated with a slope efficiency of 11.1% with respect to the absorbed LD pump power. The prospects for improvement in lasing efficiency and output power are considered.
Recruitment of Hexagenia mayfly nymphs in western Lake Erie linked to environmental variability
Bridgeman, Thomas B.; Schloesser, Don W.; Krause, Ann E.
2006-01-01
After a 40-year absence caused by pollution and eutrophication, burrowing mayflies (Hexagenia spp.) recolonized western Lake Erie in the mid 1990s as water quality improved. Mayflies are an important food resource for the economically valuable yellow perch fishery and are considered to be major indicator species of the ecological condition of the lake. Since their reappearance, however, mayfly populations have suffered occasional unexplained recruitment failures. In 2002, a failure of fall recruitment followed an unusually warm summer in which western Lake Erie became temporarily stratified, resulting in low dissolved oxygen levels near the lake floor. In the present study, we examined a possible link between Hexagenia recruitment and periods of intermittent stratification for the years 1997-2002. A simple model was developed using surface temperature, wind speed, and water column data from 2003 to predict stratification. The model was then used to detect episodes of stratification in past years for which water column data are unavailable. Low or undetectable mayfly recruitment occurred in 1997 and 2002, years in which there was frequent or extended stratification between June and September. Highest mayfly reproduction in 2000 corresponded to the fewest stratified periods. These results suggest that even relatively brief periods of stratification can result in loss of larval mayfly recruitment, probably through the effects of hypoxia. A trend toward increasing frequency of hot summers in the Great Lakes region could result in recurrent loss of mayfly larvae in western Lake Erie and other shallow areas in the Great Lakes.
Nonlinear convective flow of Powell-Erying magneto nanofluid with Newtonian heating
Directory of Open Access Journals (Sweden)
Sajid Qayyum
Full Text Available Objective of present article is to describe magnetohydrodynamic (MHD non-linear convective flow of Powell-Erying nanofluid over a stretching surface. Characteristics of Newtonian heat and mass conditions in this attempt is given attention. Heat and mass transfer analysis is examined in the frame of thermal radiation and chemical reaction. Brownian motion and thermophoresis concept is introduced due to presence of nanoparticles. Nonlinear equations of momentum, energy and concentration are transformed into dimensionless expression by invoking suitable variables. The series solutions are obtained through homotopy analysis method (HAM. Impact of embedded variables on the velocity, temperature and nanoparticles concentration is graphically presented. Numerical values of skin friction coefficient, local Nusselt and Sherwood numbers are computed and analyzed. It is concluded that velocity field enhances for fluid variable while reverse situation is noticed regarding Hartman number. Temperature and heat transfer rate behave quite reverse for Prandtl number. It is also noted that the concentration and local Sherwood number have opposite behavior in the frame of Brownian motion. Keywords: Powell-Erying nanofluid, Magnetohydrodynamic (MHD, Nonlinear convection, Thermal radiation, Chemical reaction, Newtonian heat and mass conditions
International Nuclear Information System (INIS)
Demoss, D.; Mendelsberg, J.I.
1992-01-01
This paper reports on the 1991 zebra mussel veliger settlement monitoring program undertaken to record and evaluate zebra mussel veliger settlement in Lake Erie and Lake Michigan. Studies by Dr. Gerald Mackie of Canada in 1990 indicated veliger settlement may be occurring primarily during short time periods every season corresponding with warmer water temperatures. Veliger settlement monitoring was performed using a plexiglass sampler apparatus. The samplers were simple in design and consisted of a 20-inch-square plexiglass base panel with thirty-six 1 inch x 3 inch clear plexiglass microscope slides attached. The results of the monitoring program indicate the existence of preferential settlement periods for veligers correlating with sustained lake water temperatures above 70 degrees F. Veliger settlement concentrations in the south basin of Lake Michigan appear to be similar to those in western Lake Erie
77 FR 35860 - Safety Zone; Bay Swim V, Presque Isle Bay, Erie, PA
2012-06-15
... Yacht Club at position 42[deg]07'21.74'' N, 80[deg]07'58.30'' W (DATUM: NAD 83). Entry into, transiting... extend in a straight line 1,000 feet wide to the Erie Yacht Club at position 42[deg]07'21.74'' N, 80[deg...
78 FR 36662 - Safety Zone; Fairport Harbor Mardi Gras, Lake Erie, Fairport, OH
2013-06-19
... the Fairport Harbor Mardi Gras Fireworks display. This temporary safety zone is necessary to protect spectators and vessels from the hazards associated with a fireworks display. DATES: This rule is effective...: Temporary final rule. SUMMARY: The Coast Guard is establishing a temporary safety zone on Lake Erie...
Profiles of Wind and Turbulence in the Coastal Atmospheric Boundary Layer of Lake Erie
Wang, H; Barthelmie, R J; Crippa, P; Doubrawa, P; Pryor, S C
2014-01-01
Prediction of wind resource in coastal zones is difficult due to the complexity of flow in the coastal atmospheric boundary layer (CABL). A three week campaign was conducted over Lake Erie in May 2013 to investigate wind characteristics and improve
76 FR 65717 - Erie Boulevard Hydropower, L.P.; Notice of Availability of Environmental Assessment
2011-10-24
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 2713-082-New York] Erie Boulevard Hydropower, L.P.; Notice of Availability of Environmental Assessment In accordance with the National Environmental Policy Act of 1969 and the Federal Energy Regulatory Commission's (Commission...
Eriçó de mar: Estudi antropològic, geolingüístic i etimològic
Directory of Open Access Journals (Sweden)
Antoni Corcoll Llobet
2013-01-01
Full Text Available Els objectius bàsics d’aquest treball monogràfic sobre l’eriçó de mar és donar a conèixer els termes genèrics i aquells que fan referència a una o unes espècies en concret d’aquest animal marí, la seva distribució geogràfica, la seva vitalitat i la motivació semàntica o l’etimologia de tots aquests significants. Així mateix, faig esment de possibles castellanismes i d’algunes peculiaritats fonètiques que afecten diversos significants de l’eriçó de mar.
Internal loading of phosphorus in western Lake Erie
Matisoff, Gerald; Kaltenberg, Eliza M.; Steely, Rebecca L.; Hummel, Stephanie K.; Seo, Jinyu; Gibbons, Kenneth J.; Bridgeman, Thomas B.; Seo, Youngwoo; Behbahani, Mohsen; James, William F.; Johnson, Laura; Doan, Phuong; Dittrich, Maria; Evans, Mary Anne; Chaffin, Justin D.
2016-01-01
This study applied eight techniques to obtain estimates of the diffusive flux of phosphorus (P) from bottom sediments throughout the western basin of Lake Erie. The flux was quantified from both aerobic and anaerobic incubations of whole cores; by monitoring the water encapsulated in bottom chambers; from pore water concentration profiles measured with a phosphate microelectrode, a diffusive equilibrium in thin films (DET) hydrogel, and expressed pore waters; and from mass balance and biogeochemical diagenetic models. Fluxes under aerobic conditions at summertime temperatures averaged 1.35 mg P/m2/day and displayed spatial variability on scales as small as a centimeter. Using two different temperature correction factors, the flux was adjusted to mean annual temperature yielding average annual fluxes of 0.43–0.91 mg P/m2/day and a western basin-wide total of 378–808 Mg P/year as the diffusive flux from sediments. This is 3–7% of the 11,000 Mg P/year International Joint Commission (IJC) target load for phosphorus delivery to Lake Erie from external sources. Using these average aerobic fluxes, the sediment contributes 3.0–6.3 μg P/L as a background internal contribution that represents 20–42% of the IJC Target Concentration of 15 μg P/L for the western basin. The implication is that this internal diffusive recycling of P is unlikely to trigger cyanobacterial blooms by itself but is sufficiently large to cause blooms when combined with external loads. This background flux may be also responsible for delayed response of the lake to any decrease in the external loading.
76 FR 46287 - Erie Boulevard Hydropower, L.P.; Notice of Availability of Environmental Assessment
2011-08-02
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 2047-049] Erie Boulevard Hydropower, L.P.; Notice of Availability of Environmental Assessment In accordance with the National Environmental Policy Act of 1969 and the Federal Energy Regulatory Commission's (Commission or FERC) regulations...
GC-MS analysis of polybrominated diphenyl ethers in Lake Erie
Vagula, Mary C.; Vartak, Marissa; Tallmadge, Weslene
2012-06-01
Lake Erie is one of the five great lakes of North America. It is the shallowest, the warmest, and the most biologically productive of the Great Lakes producing more fish than all of the other four lakes combined. It is also a source of drinking water for 11 million people and a recreational asset. On the flipside, it is also very vulnerable and troubled with environmental challenges because it has the smallest water volume, but the greatest pressures from the human settlement. One of the many issues faced by the Lake is pollution. It receives larger loads of many pollutants than any other Great Lake. Even with the best pollution controls many pesticides and organohalogens continue to enter the lake. Polybrominated diphenyl ethers (PBDEs) are a class of flame-retardants that have been used in a variety of consumer products since the 1970s. They are added to many commercial and household products such as computers, foam mattresses, carpets, etc. Being largely non-polar and chemically stable, these chemicals are extremely lipophilic and resist degradation in the environment, thus giving them a high affinity for their bioaccumulation. Due to these properties PBDEs have become ubiquitous environmental contaminants. These compounds are reported to be endocrine disruptors and could cause oxidative damage. This report presents the sample preparation protocol, the GC-MS analysis of PBDEs in Lake Erie sediment samples.
The role of groundwater discharge fluxes on Si:P ratios in a major tributary to Lake Erie.
Maavara, Taylor; Slowinski, Stephanie; Rezanezhad, Fereidoun; Van Meter, Kimberly; Van Cappellen, Philippe
2018-05-01
Groundwater discharge can be a major source of nutrients to river systems. Although quantification of groundwater nitrate loading to streams is common, the dependence of surface water silicon (Si) and phosphorus (P) concentrations on groundwater sources has rarely been determined. Additionally, the ability of groundwater discharge to drive surface water Si:P ratios has not been contextualized relative to riverine inputs or in-stream transformations. In this study, we quantify the seasonal dynamics of Si and P cycles in the Grand River (GR) watershed, the largest Canadian watershed draining into Lake Erie, to test our hypothesis that regions of Si-rich groundwater discharge increase surface water Si:P ratios. Historically, both the GR and Lake Erie have been considered stoichiometrically P-limited, where the molar Si:P ratio is greater than the ~16:1 phytoplankton uptake ratio. However, recent trends suggest that eastern Lake Erie may be approaching Si-limitation. We sampled groundwater and surface water for dissolved and reactive particulate Si as well as total dissolved P for 12months within and downstream of a 50-km reach of high groundwater discharge. Our results indicate that groundwater Si:P ratios are lower than the corresponding surface water and that groundwater is a significant source of bioavailable P to surface water. Despite these observations, the watershed remains P-limited for the majority of the year, with localized periods of Si-limitation. We further find that groundwater Si:P ratios are a relatively minor driver of surface water Si:P, but that the magnitude of Si and P loads from groundwater represent a large proportion of the overall fluxes to Lake Erie. Copyright © 2017 Elsevier B.V. All rights reserved.
Age and growth of the lake whitefish, Coregonus clupeaformis (Mitchill), in Lake Erie
Van Oosten, John; Hile, Ralph
1949-01-01
Although the whitefish has by no means ranked first from the standpoint of production, it has always been an important commercial species in Lake Erie. Trends in the output of whitefish have differed in the United States and Canadian waters of the lake. The 1893–1946 average annual yield of 1,201,000 pounds in the United States was only 38.3 percent of the 1879–1890 mean of 3,133,000 pounds, whereas in Canada the more recent (1907–1946) average annual take of 1,397,000 pounds has been 5.48 times the 1871–1906 mean of 255,000 pounds. The United States fishery was centered in the western part of Lake Erie (61.5 percent of the production in Michigan and Ohio) before 1921 and in the eastern part (62.6 percent in Pennsylvania and New York) in 1921–1946. The eastern part of Lake Erie (east of Port Burwell) dominated the Canadian production in 1900–1909 (65.4 percent) and in 1922–1946 (57.2 percent) but the western end was the more productive in 1871–1899 (79.8 percent) and 1910–1921 (69.7 percent). Ages were determined and individual growth histories calculated from the examination and measurement of the scales of 3,399 Lake Erie whitefish captured off four ports (Sandusky, Lorain, and Conneaut, Ohio, and Erie, Pennsylvania) over the period, 1927–1930. The number of specimens used for the investigation of other phases of the life history varied according to the amount of data available or required. Age-group III was typically (but not invariably) dominant in random samples from gear employed for the commercial production of whitefish (trap nets, pound nets, and large-mesh gill nets). The same age group also dominated most samples of the marketable catch (that is, whitefish that equalled or exceeded the minimum legal weight of 1 3/4 pounds) taken in late summer, autumn, and early winter. Age-group IV, however, was strongest among marketable fish from trap nets in early July although the III group was dominant in the random samples from the same nets
Heikkilä, Raili
2007-01-01
Tämä opinnäytetyön liittyy kotimaisten ruusunmarjojen sekä tuore- ja höyrysoseiden Cvitamiinin säilymiseen eri prosessointimenetelmien ja pakkassäilytyksen aikana. Näytteinä tutkimuksessa olivat kokonaisena poimitut pakastetut ruusunmarjat, tuore pakastettu ruusunmarjasose ja kuumakäsitelty (höyrytetty) ruusunmarjasose. Tutkittavan ruusunmarjan pakastesäilytysaika oli ollut kokonaisuudessaan yksi vuosi. Tutkimus toteutettiin Haapaveden ammattiopistolla. Ruusunmarjan C- vitamiinipitoisuudet an...
Understanding the Atmosphere of 51 Eri b: Do Photochemical Hazes Cloud the Planets Spectrum?
Marley, Mark Scott; Zahnle, Kevin; Moses, J.; Morley, C.
2015-01-01
The first young giant planet to be discovered by the Gemini Planet Imager was the (is) approximately 2MJ planet 51 Eri b. This approximately 20 Myr old young Jupiter is the first directly imaged planet to show unmistakable methane in H band. To constrain the planet's mass, atmospheric temperature, and composition, the GPI J and H band spectra as well as some limited photometric points were compared to the predictions of substellar atmosphere models. The best fitting models reported in the discovery paper (Macintosh et al. 2015) relied upon a combination of clear and cloudy atmospheric columns to reproduce the data. However for an object as cool as 700 K, the origin of the cloud coverage is somewhat puzzling, as the global silicate and iron clouds would be expected to have sunk well below the photosphere by this effective temperature. While strong vertical mixing in these low gravity atmospheres remains a plausible explanation, we have explored whether atmospheric photochemistry, driven by the UV flux from the primary star, may yield hazes that also influence the observed spectrum of the planet. To explore this possibility we have modeled the atmospheric photochemistry of 51 Eri b using two state-of-the-art photochemical models, both capable of predicting yields of complex hydrocarbons under various atmospheric conditions. In our presentation we will summarize the modeling approach employed to characterize 51 Eri b, explaining constraints on the planet's effective temperature, gravity, and atmospheric composition and also present results of our studies of atmospheric photochemistry. We will discuss whether photochemical hazes could indeed be responsible for the particulate opacity that apparently sculpts the spectrum of the planet.
Directory of Open Access Journals (Sweden)
Rose M. Cory
2016-04-01
Full Text Available Hydrogen peroxide (H2O2 has been suggested to influence cyanobacterial community structure and toxicity. However, no study has investigated H2O2 concentrations in freshwaters relative to cyanobacterial blooms when sources and sinks of H2O2 may be highly variable. For example, photochemical production of H2O2 from chromophoric dissolved organic matter (CDOM may vary over the course of the bloom with changing CDOM and UV light in the water column, while microbial sources and sinks of H2O2 may change with community biomass and composition. To assess relationships between H2O2 and harmful algal blooms dominated by toxic cyanobacteria in the western basin of Lake Erie, we measured H2O2 weekly at six stations from June – November, 2014 and 2015, with supporting physical, chemical, and biological water quality data. Nine additional stations across the western, eastern, and central basins of Lake Erie were sampled during August and October, 2015. CDOM sources were quantified from the fluorescence fraction of CDOM using parallel factor analysis (PARAFAC. CDOM concentration and source were significantly correlated with specific conductivity, demonstrating that discharge of terrestrially-derived CDOM from rivers can be tracked in the lake. Autochthonous sources of CDOM in the lake increased over the course of the blooms. Concentrations of H2O2 in Lake Erie ranged from 47 ± 16 nM to 1570 ± 16 nM (average of 371 ± 17 nM; n = 225, and were not correlated to CDOM concentration or source, UV light, or estimates of photochemical production of H2O2 by CDOM. Temporal patterns in H2O2 were more closely aligned with bloom dynamics in the lake. In 2014 and 2015, maximum concentrations of H2O2 were observed prior to peak water column respiration and chlorophyll a, coinciding with the onset of the widespread Microcystis blooms in late July. The spatial and temporal patterns in H2O2 concentrations suggested that production and decay of H2O2 from aquatic
77 FR 39638 - Safety Zone; Barbara Harder Wedding Fireworks, Lake Erie, Lake View, NY
2012-07-05
... environmental risk to health or risk to safety that may disproportionately affect children. 10. Indian Tribal... be held on Lake Erie near Lake View, NY. The Captain of the Port Buffalo has determined that fireworks launched proximate to a gathering of watercraft pose a significant risk to public safety and...
Directory of Open Access Journals (Sweden)
Kevin Anthony Meyer
Full Text Available Blooms of the potentially toxic cyanobacterium Microcystis are increasing worldwide. In the Laurentian Great Lakes they pose major socioeconomic, ecological, and human health threats, particularly in western Lake Erie. However, the interpretation of "omics" data is constrained by the highly variable genome of Microcystis and the small number of reference genome sequences from strains isolated from the Great Lakes. To address this, we sequenced two Microcystis isolates from Lake Erie (Microcystis aeruginosa LE3 and M. wesenbergii LE013-01 and one from upstream Lake St. Clair (M. cf aeruginosa LSC13-02, and compared these data to the genomes of seventeen Microcystis spp. from across the globe as well as one metagenome and seven metatranscriptomes from a 2014 Lake Erie Microcystis bloom. For the publically available strains analyzed, the core genome is ~1900 genes, representing ~11% of total genes in the pan-genome and ~45% of each strain's genome. The flexible genome content was related to Microcystis subclades defined by phylogenetic analysis of both housekeeping genes and total core genes. To our knowledge this is the first evidence that the flexible genome is linked to the core genome of the Microcystis species complex. The majority of strain-specific genes were present and expressed in bloom communities in Lake Erie. Roughly 8% of these genes from the lower Great Lakes are involved in genome plasticity (rapid gain, loss, or rearrangement of genes and resistance to foreign genetic elements (such as CRISPR-Cas systems. Intriguingly, strain-specific genes from Microcystis cultured from around the world were also present and expressed in the Lake Erie blooms, suggesting that the Microcystis pangenome is truly global. The presence and expression of flexible genes, including strain-specific genes, suggests that strain-level genomic diversity may be important in maintaining Microcystis abundance during bloom events.
Evidence that lake trout served as a buffer against sea lamprey predation on burbot in Lake Erie
Stapanian, M.A.; Madenjian, C.P.
2007-01-01
The population of burbot Lota lota in Lake Erie recovered during 1986–2003, mainly because of the control of sea lamprey Petromyzon marinus, which began in 1986. Burbot populations continued to grow during 1996–1998, when sea lamprey control was substantially reduced. We calculated mortality parameters for burbot in Lake Erie by estimating age at capture for 2,793 burbot caught in annual gill-net surveys of eastern Lake Erie from 1994 to 2003. Based on catch-curve analysis, annual mortality in Lake Erie during 1994–2003 was estimated as 33%. Annual mortality of the 1992 year-class of burbot was estimated as 30%. The mortality of burbot during the years of reduced sea lamprey control was not different from that during the 3 years preceding reduced control and was significantly lower than that during the entire portion of the time series in which full sea lamprey control was conducted. These results suggest that the reduction in sea lamprey control did not lead to increased burbot mortality. The catch per gill-net lift of large burbot (total length > 600 mm), the size preferred by sea lampreys, was lower than that of adult lake trout Salvelinus namaycush (age 5 and older; total length > 700 mm) before lampricide application was reduced. Although adult lake trout populations declined, the abundance of large burbot did not change during the period of reduced lampricide application. These results support a hypothesis that a healthy population of adult lake trout can serve as a buffer species, acting to reduce predation of burbot by sea lampreys when sea lamprey populations increase. Burbot attained sexual maturity at a relatively early age (3 or 4 years) and a total length (approximately 500 mm) that was smaller than the preferred prey size for sea lampreys. These characteristics and the buffering effect of the lake trout population enabled growth of the burbot population during the brief period when lamprey control was reduced.
2010-06-01
... frost level, in cracks or crevices in the bedrock, interstitial spaces of rocky substrates, tree roots... actions that will be undertaken on each island property to avoid injury and harm to the Lake Erie...
77 FR 24880 - Safety Zone; Jet Express Triathlon, Sandusky Bay, Lake Erie, Lakeside, OH
2012-04-26
... the Federal Register. Background and Purpose The organization Endurance Sports Productions is... safety zone would encompass all waters of Lake Erie within a direct line from 41-33'-49'' N, 082-47-8'' W to 41-33'- 25'' N, 82-48'-8'' W and 15 yards on either side of direct line. All geographic...
76 FR 12103 - Erie Boulevard Hydropower, L.P; Notice of Settlement Agreement and Soliciting Comments
2011-03-04
... Hydropower, L.P; Notice of Settlement Agreement and Soliciting Comments Take notice that the following... Boulevard Hydropower, L.P. e. Location: The existing multi-development project is located on the Oswegatchie... 791 (a)-825(r) h. Applicant Contact: Daniel Daoust, Erie Boulevard Hydropower, 33 West 1st Street...
77 FR 50923 - Safety Zone; Jet Express Triathlon, Sandusky Bay, Lake Erie, Lakeside, OH
2012-08-23
... fireworks display. B. Basis and Purpose The organization Endurance Sports Productions is sponsoring a... waters of Lake Erie within a direct line from 41[deg]33'49'' N, 082[deg]47'8'' W to 41[deg]33'25'' N, 82[deg]48'8'' W and 15 yards on either side of direct line. All geographic coordinates are North American...
2010-11-22
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 7518-012--New York] Erie Boulevard Hydropower L.P.; Notice of Scoping Meetings and Environmental Site Review November 15, 2010. Commission staff will be conducting two public scoping meetings and an environmental site review in support...
The Inner 25 au Debris Distribution in the ϵ Eri System
Energy Technology Data Exchange (ETDEWEB)
Su, Kate Y. L.; Rieke, George H.; Ballering, Nicholas P. [Steward Observatory, University of Arizona, 933 N Cherry Avenue, Tucson, AZ 85721 (United States); De Buizer, James M.; Vacca, William D. [SOFIA-USRA, NASA Ames Research Center, MS 232-12, Moffett Field, CA 94035 (United States); Krivov, Alexander V.; Löhne, Torsten [Astrophysikalisches Institut und Universitätssternwarte, Friedrich-Schiller-Universität Jena, Schillergäßchen 2–3, D-07745 Jena (Germany); Marengo, Massimo [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Stapelfeldt, Karl R. [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)
2017-05-01
Debris disk morphology is wavelength dependent due to the wide range of particle sizes and size-dependent dynamics influenced by various forces. Resolved images of nearby debris disks reveal complex disk structures that are difficult to distinguish from their spectral energy distributions. Therefore, multi-wavelength resolved images of nearby debris systems provide an essential foundation to understand the intricate interplay between collisional, gravitational, and radiative forces that govern debris disk structures. We present the Stratospheric Observatory for Infrared Astronomy (SOFIA) 35 μ m resolved disk image of ϵ Eri, the closest debris disk around a star similar to the early Sun. Combining with the Spitzer resolved image at 24 μ m and 15–38 μ m excess spectrum, we examine two proposed origins of the inner debris in ϵ Eri: (1) in situ planetesimal belt(s) and (2) dragged-in grains from the cold outer belt. We find that the presence of in situ dust-producing planetesmial belt(s) is the most likely source of the excess emission in the inner 25 au region. Although a small amount of dragged-in grains from the cold belt could contribute to the excess emission in the inner region, the resolution of the SOFIA data is high enough to rule out the possibility that the entire inner warm excess results from dragged-in grains, but not enough to distinguish one broad inner disk from two narrow belts.
International Nuclear Information System (INIS)
McGoldrick, Daryl J.; Chan, Cecilia; Drouillard, Ken G.; Keir, Michael J.; Clark, Mandi G.; Backus, Sean M.
2014-01-01
We examine the concentrations and food web biomagnification of three cyclic volatile methylsiloxanes (cVMS) octamethylcyclotetrasiloxane (D4), decamethylcyclopentasiloxane (D5), and dodecamethylcyclohexasiloxane (D6) using aquatic biota collected from Lake Erie. Concentrations of cVMS in biota were within the range reported for other studies of cVMS in aquatic biota. Trophic magnification factors (TMF) were assessed in various food web configurations to investigate the effects of food web structure. TMF estimates were highly dependent on the inclusion/exclusion of the organisms occupying the highest and lowest trophic levels and were >1 for D4 and D5, indicating biomagnification, in only 1 of the 5 food web configurations investigated and were <1 in the remaining 4 food web configurations. TMF estimates for PCB180 were also dependant on food web configuration, but did not correspond with those obtained for cVMS materials. These differences may be attributed to environmental exposure and/or lipid partitioning differences between PCB180 and cVMS. -- Highlights: • We investigated trophic magnification of siloxanes in aquatic biota from Lake Erie. • Trophic magnification estimates were variable and sensitive to food web structure. • Lipid partitioning of siloxanes and PCBs differ and may contribute to variability. -- Biomagnification estimates for siloxanes in Lake Erie are sensitive to food web structure, contaminant exposure pathways, and lipid partitioning differences between PCBs and siloxanes
77 FR 40266 - Safety Zone; Conneaut 4th of July Festival, Lake Erie, Conneaut, OH
2012-07-09
... 1625-AA00 Safety Zone; Conneaut 4th of July Festival, Lake Erie, Conneaut, OH AGENCY: Coast Guard, DHS... the Conneaut 4th of July Festival Fireworks display. This temporary safety zone is necessary to... vessels during the Conneaut 4th of July Festival Fireworks. This zone will be effective and enforced from...
Using water quality to assess ecological condition in the St. Marys River and Huron-Erie Corridor
The St. Marys River and Huron-Erie-Corridor were assessed by EPA for the first time in 2014-2016 as part of the National Coastal Condition Assessment (NCCA). NCCA uses a probabilistic survey design to allow unbiased assessment of ecological condition across the entire Great Lakes...
Growth, reproduction, mortality, distribution, and biomass of freshwater drum in Lake Erie
Bur, Michael T.
1984-01-01
Predominant age-groups in the Lake Erie freshwater drum Aplodinotus grunnienspopulation were 3, 4, and 5 as determined from gill net, trap net, bottom trawl, and midwater trawl samples. Age and growth calculations indicated that females grew faster than males. However, the length-weight relation did not differ between sexes and was described by the equation: log W = −5.4383 + 3.1987 log L. Some males became sexually mature at age 2 and all were mature by age 6. Females matured 1 year later than males. Three sizes of eggs were present in ovaries; the average total number was 127,000 per female for 20 females over a length range of 270 to 478 mm. Seasonal analysis of the ovary-body weight ratio indicated that spawning extended from June to August. A total annual mortality rate of 49% for drum aged 4 through 11 was derived from catch-curve analysis. Freshwater drum were widely distributed throughout Lake Erie in 1977–1979, the greatest concentration being in the western basin. They moved into warm, shallow water (less than 10 m deep) during summer, and returned to deeper water in late fall. Summer biomass estimates for the western basin, based on systematic surveys with bottom trawls, were 9,545 t in 1977 and 2,333 t in 1978.
Directory of Open Access Journals (Sweden)
Yaşar Tonta
1996-09-01
Full Text Available The number of information systems that are accessible through the Internet is constantly increasing. Information systems on those systems are getting varied and occupy more space, too. Up until a few years ago, only textual information sources were accessible via computer networks, whereas today multimedia information sources containing graphics, sound, pictures, and animation are also accessible over the Internet. Geographic information systems, electronic libraries, film and TV archives can he given as examples of multimedia information sources, We point out that information retrieval should he seen as an integral component of the computer networks, and technological, economic, and legal problems in this field should he solved. We end up with what should he done to improve the library and information services that arc accessible through the Internet in Turkey. Günümüzde Internet aracılığıyla erişilebilen bilgi sistemlerinin sayısı hızla artmaktadır. Bu sistemler üzerindeki bilgi kaynakları da giderek çeşitlenmekte ve daha fazla yer kaplamaktadır. Yakın zamana dek bilgisayar ağları aracılığıyla çoğunlukla metin (text türü bilgilere erişim sağlanabilirken, günümüzde grafik, ses, görüntü, canlandırma ve diğer görsel-işitsel veriler içeren çokluortam (multimedia türü bilgiler de Internet üzerinde hizmete sunulabilmektedir. Coğrafik bilgi sistemleri, elektronik kütüphaneler, film ve TV arşivleri bu tür bilgilere örnek olarak gösterilebilir. Bu makalede Internet aracılığıyla bilgi erişim ve bilgi keşfetmede karşılaşılan sorunlar incelenmekte ve sayıca giderek artan ve çeşitlenen bilgi kaynaklarına erişimi kolaylaştırmak için yapılması gerekenler kısaca özetlenmektedir. Sonuç olarak bilgi erişimin, büyük paralar ve entellektüel çabalar harcanarak kurulan bilgisayar ağlarının bir parçası olarak görülmesi gerektiğine işaret edilerek bu alandaki teknolojik
Hittle, Elizabeth A.
2017-04-20
Bacteria-driven restrictions and (or) advisories on swimming at beaches in Presque Isle State Park (PISP), Erie, Pennsylvania, can occur during the summer months. One of the suspected sources of bacteria is sediment. A terrestrial sediment source to the west of PISP is Walnut Creek, which discharges to Lake Erie about 8.5 kilometers southwest of PISP Beach 1. On June 24, June 25, August 18, and August 19, 2015, synoptic surveys were conducted by the U.S. Geological Survey, in cooperation with the Pennsylvania Sea Grant, in Lake Erie between Walnut Creek and PISP Beach 1 to characterize the water-current velocity and direction to determine whether sediment from Walnut Creek could be affecting the PISP beaches. Water-quality data (temperature, specific conductance, and turbidity) were collected in conjunction with the synoptic surveys in June. Water-quality data (Escherichia coli [E. coli] bacteria, temperature, and turbidity) were collected about a meter from the shore (nearshore) on June 24, August 19, and after a precipitation event on August 11, 2015. Additionally, suspended sediment was collected nearshore on June 24 and August 11, 2015. Samples collected near Walnut Creek during all three bacterial sampling events contained higher counts than other samples. Counts steadily decreased from west to east, then increased about 1–2 kilometers from PISP Beach 1; however, this study was not focused on examining other potential sources of bacteria.The Velocity Mapping Toolbox (VMT) was used to process the water-current synoptic surveys, and the results were visualized within ArcMap. For the survey accomplished on June 24, 2015, potential paths a particle could take between Walnut Creek and PSIP Beach 1 if conditions remained steady over a number of hours were visualized. However, the water-current velocity and direction were variable from one day to the other, indicating this was likely an unrealistic assumption for the study area. This analysis was not accomplished
Izzaty Riwayat, Akhtar; Nazri, Mohd Ariff Ahmad; Hazreek Zainal Abidin, Mohd
2018-04-01
In recent years, Electrical Resistivity Imaging (ERI) has become part of important method in preliminary stage as to gain more information in indicate the hidden water in underground layers. The problem faces by engineers is to determine the exact location of groundwater zone in subsurface layers. ERI seen as the most suitable tools in exploration of groundwater as this method have been applied in geotechnical and geo-environment investigation. This study was conducted using resistivity at UTHM campus to interpret the potential shallow aquifer and potential location for borehole as observation well. A Schlumberger array was setup during data acquisition as this array is capable in imaging deeper profile data and suitable for areas with homogeneous layer. The raw data was processed using RES2DINV software for 2D subsurface image. The result obtained indicate that the thickness of shallow aquifer for both spread line varies between 7.5 m to 15 m. The analysis of rest raw data using IP showed that the chargeability parameter is equal to 0 which strongly indicated the presence of groundwater aquifer in the study area.
Effects of the exotic zebra mussel (Dreissena polymorpha) on metal cycling in Lake Erie
International Nuclear Information System (INIS)
Klerks, P.L.; Fraleigh, P.C.; Lawniczak, J.E.
1997-01-01
This research demonstrated the impact of high densities of the zebra mussel (Dreissena polymorpha) on the cycling of copper, nickel, and zinc in a lake environment. Experiments with mussels on sedimentation traps in western Lake Erie and with mussels in flow-through tanks receiving Lake Erie water showed that zebra mussels remove metals from the water column, incorporate metals in their tissues, and deposit metals on the lake bottom. Removal of metals from the water column was estimated at 10-17%·day -1 of the amounts present. This material was largely deposited on the lake bottom; zebra mussels more than doubled the rate at which metals were being added to the lake bottom. Metal biodeposition rates were extremely high (e.g., 50 mg Zn·m -2 ·day -1 ) in high-turbidity areas with elevated metal levels. Two factors contributed to metal biodeposition by zebra mussels. First, their production of feces and pseudofeces increased the rate at which suspended matter was being added to the sediment (accounting for 92% of the increased metal biodeposition). Second, the material coming out of suspension had higher metal concentrations when zebra mussels were present (constituting 8% of the increased biodeposition). (author)
2011-04-28
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. P-2713-082] Erie Boulevard...: Kimberly D. Bose, Secretary, Federal Energy Regulatory Commission, 888 First Street, NE., Washington, DC... Environmental Conservation, New York State Council of Trout Unlimited, U.S. Fish and Wildlife Service, the...
Urban growth and agricultural production have caused an influx of nutrients into Lake Erie, leading to eutrophic zones. These conditions result in the formation of algal blooms, some of which are toxic due to the presence of Microcystis (a cyanobacteria), which produces the hepat...
Alexiadis, Anastasios; Delidakis, Christos; Kalantidis, Kriton
2017-07-01
The conserved 3'-5' RNA exonuclease ERI1 is implicated in RNA interference inhibition, 5.8S rRNA maturation and histone mRNA maturation and turnover. The single ERI1 homologue in Drosophila melanogaster Snipper (Snp) is a 3'-5' exonuclease, but its in vivo function remains elusive. Here, we report Snp requirement for normal Drosophila development, since its perturbation leads to larval arrest and tissue-specific downregulation results in abnormal tissue development. Additionally, Snp directly interacts with histone mRNA, and its depletion results in drastic reduction in histone transcript levels. We propose that Snp protects the 3'-ends of histone mRNAs and upon its absence, histone transcripts are readily degraded. This in turn may lead to cell cycle delay or arrest, causing growth arrest and developmental perturbations. © 2017 Federation of European Biochemical Societies.
Simultaneous X-ray, UV, and Optical Variations in lambda ERI (B2e)
Smith, M. A.; Murakami, T.; Anandarao, B.
1996-12-01
We have carried out a simultaneous observing campaign on the prototypical Be star lambda Eri using ground stations and ROSAT, ASCA, IUE, and Voyager spacecrafts during the week of February-March 1995; a smaller campaign was carried out the following September. In late February lambda Eri showed extraordinary disk-wind activity. ROSAT/HRI monitoring disclosed no large flares such as ROSAT observed in 1991 in lambda Eri. Possible low amplitude fluctuations in the 1995 data occurred at the same time with unusual activity in Hα , HeI lambda 6678, HeII lambda 1640, CIII, and the CIV doublet. The helium line activity suggests that mass ejection occurred at the base of the wind. The strong CIII and CIV lines implies that shock interactions originated in the wind flow. It is not clear that the X-ray fluctuations are directly related to the increases in wind line absorption. Within hours of the mild X-ray flux variations found by ROSAT on February 28, the Voyager UVS observed a ``ringing" that decayed over three 3-hr. cycles. The amplitude of these fluctuations was large (50%) at lambda lambda 950-1100, decreased rapidly with wavelength, and faded to nondetection above lambda 1300. Various considerations indicate that these continuum variations were not due to an instrument pathology in the UVS. Rather, they appear to be due to a time-dependent flux deficit in the lambda lambda 1250 during the minima of these cycles. We outline a scenario in which dense plasma over the star's surface is alternately heated and cooled quasi-periodically to produce the flux changes. Additional examples of this new phenomenon are needed. Amateur astronomers can make a significant contribution to the understanding of flickering in Be star light curves during their outburst phases. We also draw attention to an increase in the emission of the Hα line that occurred at about the same time the FUV ringing started. This increased emission hints that ~ 50,000K plasma near the star's surface can
77 FR 35619 - Safety Zone; Old Fashion 4th July Fireworks, Presque Isle Bay, Erie, PA
2012-06-14
...-AA00 Safety Zone; Old Fashion 4th July Fireworks, Presque Isle Bay, Erie, PA AGENCY: Coast Guard, DHS... during the Old Fashion 4th July Fireworks display. This temporary safety zone is necessary to protect... ensure the safety of spectators and vessels during the Old Fashion 4th July Fireworks. [[Page 35620...
Detection and Modeling of a Meteotsunami in Lake Erie During a High Wind Event on May 27, 2012
Anderson, E. J.; Schwab, D. J.; Lombardy, K. A.; LaPlante, R. E.
2012-12-01
On May 27, 2012, a mesoscale convective system moved southeast across the central basin of Lake Erie (the shallowest of the Great Lakes) causing an increase in surface wind speed from 3 to 15 m/s over a few minutes. Although no significant pressure change was observed during this period (+1 mbar), the storm resulted in 3 reported edge waves on the southern shore (5 minutes apart), with wave heights up to 7 feet (2.13 m). Witnesses along the coast reported that the water receded before the waves hit, the only warning of the impending danger. After impact on the southern shore, several individuals were stranded in the water near Cleveland, Ohio. Fortunately, there were no fatalities or serious injury as a result of the edge waves. The storm event yielded two separate but similar squall line events that impacted the southern shore of Lake Erie several hours apart. The first event had little impact on nearshore conditions, however, the second event (moving south-eastward at 21.1 m/s or 41 knots), resulted in 7 ft waves near Cleveland as reported above. The thunderstorms generated three closely packed outflow boundaries that intersected the southern shore of Lake Erie between 1700 and 1730 UTC. The outflow boundaries were followed by a stronger outflow at 1800 UTC. Radial velocities on the WSR-88D in Cleveland, Ohio indicated the winds were stronger in the second outflow boundary. The radar indicated winds between 20.6 and 24.7 m/s (40 and 48 knots) within 240 meters (800 feet) above ground level. In order to better understand the storm event and the cause of the waves that impacted the southern shore, a three-dimensional hydrodynamic model of Lake Erie has been developed using the Finite Volume Coastal Ocean Model (FVCOM). The model is being developed as part of the Great Lakes Coastal Forecasting (GLCFS), a set of experimental real-time pre-operational hydrodynamic models run at the NOAA Great Lakes Research Laboratory that forecast currents, waves, temperature, and
2011-09-27
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 7518-012] Erie Boulevard Hydropower L.P.; Notice of Dispute Resolution Panel Meeting and Technical Conference On September 16, 2011, Commission staff, in response to the filing of notice of study dispute by the New York State Department of...
Energy Technology Data Exchange (ETDEWEB)
Dobson, E. P; Mackie, G. L. [Guelph Univ., Dept. of Zoology, ON (Canada)
1998-05-01
Biodeposition of polychlorinated biphenyls (PCBs)and cadmium by zebra mussels in the western basin of Lake Erie was investigated using sediment traps, and compared to natural rates of sedimentation. On a per unit area of organic matter, deposition rates by zebra mussels up to eight to ten times higher than natural rates of sedimentation were found. These results suggest that zebra mussels are altering contaminant movement in western Lake Erie. At the same time, it was also suggested that the net effect of biodeposition may not be as great as shown in this study since only the effects of zebra mussels on the flux of the contaminants was examined and the re-suspension factor was not considered. It was recommended that to better understand the overall effects of zebra mussels on contaminant dynamics in aquatic environments, future studies should incorporate the re-suspension factors. 27 refs., 8 tabs., 3 figs.
Long-term ecosystem monitoring and assessment of the Detroit River and Western Lake Erie.
Hartig, J H; Zarull, M A; Ciborowski, J J H; Gannon, J E; Wilke, E; Norwood, G; Vincent, A N
2009-11-01
Over 35 years of US and Canadian pollution prevention and control efforts have led to substantial improvements in environmental quality of the Detroit River and western Lake Erie. However, the available information also shows that much remains to be done. Improvements in environmental quality have resulted in significant ecological recovery, including increasing populations of bald eagles (Haliaeetus leucocephalus), peregrine falcons (Falco columbarius), lake sturgeon (Acipenser fulvescens), lake whitefish (Coregonus clupeaformis), walleye (Sander vitreus), and burrowing mayflies (Hexagenia spp.). Although this recovery is remarkable, many challenges remain, including population growth, transportation expansion, and land use changes; nonpoint source pollution; toxic substances contamination; habitat loss and degradation; introduction of exotic species; and greenhouse gases and global warming. Research/monitoring must be sustained for effective management. Priority research and monitoring needs include: demonstrating and quantifying cause-effect relationships; establishing quantitative endpoints and desired future states; determining cumulative impacts and how indicators relate; improving modeling and prediction; prioritizing geographic areas for protection and restoration; and fostering long-term monitoring for adaptive management. Key management agencies, universities, and environmental and conservation organizations should pool resources and undertake comprehensive and integrative assessments of the health of the Detroit River and western Lake Erie at least every 5 years to practice adaptive management for long-term sustainability.
Effects of the exotic zebra mussel (Dreissena polymorpha) on metal cycling in Lake Erie
Energy Technology Data Exchange (ETDEWEB)
Klerks, P.L. [Univ. of Southwestern Louisiana, Dept. of Biology, Lafayette, Louisiana (United States)]. E-mail: klerks@usl.edu; Fraleigh, P.C.; Lawniczak, J.E. [Univ. of Toledo, Dept. of Biology, Toledo, Ohio (United States)
1997-07-15
This research demonstrated the impact of high densities of the zebra mussel (Dreissena polymorpha) on the cycling of copper, nickel, and zinc in a lake environment. Experiments with mussels on sedimentation traps in western Lake Erie and with mussels in flow-through tanks receiving Lake Erie water showed that zebra mussels remove metals from the water column, incorporate metals in their tissues, and deposit metals on the lake bottom. Removal of metals from the water column was estimated at 10-17%{center_dot}day{sup -1} of the amounts present. This material was largely deposited on the lake bottom; zebra mussels more than doubled the rate at which metals were being added to the lake bottom. Metal biodeposition rates were extremely high (e.g., 50 mg Zn{center_dot}m{sup -2}{center_dot}day{sup -1}) in high-turbidity areas with elevated metal levels. Two factors contributed to metal biodeposition by zebra mussels. First, their production of feces and pseudofeces increased the rate at which suspended matter was being added to the sediment (accounting for 92% of the increased metal biodeposition). Second, the material coming out of suspension had higher metal concentrations when zebra mussels were present (constituting 8% of the increased biodeposition). (author)
Usûlî Kıyasın Bilgi ve Amel Değeri
Directory of Open Access Journals (Sweden)
Yrd.Doç.Dr. Temel Kacır
2016-06-01
Full Text Available “Ortak bir illete sahip olmaları nedeniyle, aslın hükmünün fer‘e verilmesidir" şeklinde tanımlanan usûlî kıyasın bilgi ve amel değeri, ilk dönemden itibaren tartışma konusu olmuştur. Şöyle ki; hüküm verme yetkisi sadece Şar‘î’e ait olduğu halde usûlî kıyasın dinde hüküm verme anlamına geldiği ve bilgi değerinin de nasslarca yerilmiş zan olduğu gibi bazı argümanlar ileri sürerek usûlî kıyası reddedenler olsa da, çoğunluk tarafından usûlî kıyas aslî ve şer‘î delil olarak kabul edilmiş ve elde edilen bu hüküm ile amel edilmesi gerekli görülmüştür. Bu çalışma, usûlî kıyası kabul eden ve etmeyenlerin görüşlerini mukayese etmenin ötesinde, usûlî kıyasın salt aklî bir çaba olmadığını, kendisi ile ulaşılan bilginin naslarda yerilen zan olmayıp aksine delile dayalı zannın en üst derecesi olduğunu ve bunun da furû fıkıhta amel için yeterli olduğunu naklî ve aklî deliller ile ele alan bir çalışmadır. Kıyasla ilgili genel bir çerçeve çizildikten sonra, usûlî kıyas ve deliller hiyerarşisindeki yeri ve kıyasın bilgi ve amelî değeri ile sınırlandırılan bu makale ile usûlî kıyasın bilgi ve amel değeri konusundaki tartışmalara açıklık getirilmek istenmektedir.
Papachristos, Alexander; Edwards, Elton; Dowrick, Adam; Gosling, Cameron
2014-09-01
Despite a number of injury prevention campaigns and interventions, horse riding continues to be a dangerous activity, resulting in more accidents per hour than motorcycling, skiing and football. Injuries are often serious, with one in four patients requiring admission to hospital. This study aims to describe the severity of equestrian-related injuries (ERIs) using both clinical parameters and patient-reported outcomes. A retrospective study of all patients aged ≥18 years admitted to The Alfred Hospital between January 2003 and January 2008 with an ERI was performed. Specific clinical data were extracted from the medical record. In addition, a questionnaire was conducted identifying the details of the accident, the required recovery time and levels of ongoing pain and physical disability. During the study period 172 patients met the inclusion criteria. There were three deaths (2%). Eighty-two patients (48%) suffered head injuries. Forty-one patients (24%) were admitted to the ICU and 31 patients (18%) required mechanical ventilation. On discharge, 41 patients (24%) required transfer to a sub-acute rehabilitation facility. One-hundred-and-twenty-four patients (72%) completed the questionnaire. Thirty-nine respondents (31%) were not wearing a helmet. Among patients injured for more than 6 months, 38 (35%) still experienced moderate or severe pain or disability. Ninety-five patients had returned to work at the time of review, among which 47(50%) required longer than 6 months to recover, and 40 (42%) returned at a reduced capacity. The clinical and patient-reported outcomes of ERIs requiring hospital admission are poor. Persistent pain and disability are common, even up to 5 years post-injury. A large proportion of patients required longer than 6 months to return to work and many return at a reduced capacity. Copyright © 2014 Elsevier Ltd. All rights reserved.
2011-01-24
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 2713-082] Erie Boulevard... Oswegatchie River and consists of: (1) A 941-foot-long dam with a 192-foot-long, 69-foot-high concrete gravity... seasonal flash boards; (2) a 168-acre reservoir with a gross storage capacity of 3,234 acre-feet and a...
Zanatta, David T.; Bossenbroek, Jonathan M.; Burlakova, Lyubov E.; Crail, Todd D.; Szalay, Ferenc de; Griffith, Traci A.; Kapusinski, Douglas; Karatayev, Alexander Y.; Krebs, Robert A.; Meyer, Elizabeth S.; Paterson, Wendy L.; Prescott, Trevor J.; Rowe, Matthew T.; Schloesser, Donald W.; Walsh, Mary C.
2015-01-01
Over the past 25 years, unionid mussels in the Laurentian Great Lakes of North America have been adversely impacted by invasive dreissenid mussels, which directly (e.g., by attachment to unionid shells) and indirectly (e.g., by competing for food) cause mortality. Despite the invasion, unionids have survived in several areas in the presence of dreissenid mussels. We investigated current spatial patterns in these native mussel refuges based on surveys for unionid mussels across 48 sampling locations (141 sites) in 2011 and 2012, and documented species abundance and diversity in coastal areas of lakes St. Clair and Erie. The highest-quality assemblages of native mussels (densities, richness, and diversity) appear to be concentrated in the St. Clair delta, where abundance continues to decline, as well as in in Thompson Bay of Presque Isle in Lake Erie and in just a few coastal wetlands and drowned river-mouths in the western basin of Lake Erie. The discovery of several new refuge areas suggests that unionids have a broader distribution within the region than previously thought.
Salk, Kateri R.; Bullerjahn, George S.; McKay, Robert Michael L.; Chaffin, Justin D.; Ostrom, Nathaniel E.
2018-05-01
Recent global water quality crises point to an urgent need for greater understanding of cyanobacterial harmful algal blooms (cHABs) and their drivers. Nearshore areas of Lake Erie such as Sandusky Bay may become seasonally limited by nitrogen (N) and are characterized by distinct cHAB compositions (i.e., Planktothrix over Microcystis). This study investigated phytoplankton N uptake pathways, determined drivers of N depletion, and characterized the N budget in Sandusky Bay. Nitrate (NO3-) and ammonium (NH4+) uptake, N fixation, and N removal processes were quantified by stable isotopic approaches. Dissimilatory N reduction was a relatively modest N sink, with denitrification, anammox, and N2O production accounting for 84, 14, and 2 % of sediment N removal, respectively. Phytoplankton assimilation was the dominant N uptake mechanism, and NO3- uptake rates were higher than NH4+ uptake rates. Riverine N loading was sometimes insufficient to meet assimilatory and dissimilatory demands, but N fixation alleviated this deficit. N fixation made up 23.7-85.4 % of total phytoplankton N acquisition and indirectly supports Planktothrix blooms. However, N fixation rates were surprisingly uncorrelated with NO3- or NH4+ concentrations. Owing to temporal separation in sources and sinks of N to Lake Erie, Sandusky Bay oscillates between a conduit and a filter of downstream N loading to Lake Erie, delivering extensively recycled forms of N during periods of low export. Drowned river mouths such as Sandusky Bay are mediators of downstream N loading, but climate-change-induced increases in precipitation and N loading will likely intensify N export from these systems.
Directory of Open Access Journals (Sweden)
Xiaozhen Mou
Full Text Available Cyanobacterial harmful blooms (CyanoHABs that produce microcystins are appearing in an increasing number of freshwater ecosystems worldwide, damaging quality of water for use by human and aquatic life. Heterotrophic bacteria assemblages are thought to be important in transforming and detoxifying microcystins in natural environments. However, little is known about their taxonomic composition or pathways involved in the process. To address this knowledge gap, we compared the metagenomes of Lake Erie free-living bacterioplankton assemblages in laboratory microcosms amended with microcystins relative to unamended controls. A diverse array of bacterial phyla were responsive to elevated supply of microcystins, including Acidobacteria, Actinobacteria, Bacteroidetes, Planctomycetes, Proteobacteria of the alpha, beta, gamma, delta and epsilon subdivisions and Verrucomicrobia. At more detailed taxonomic levels, Methylophilales (mainly in genus Methylotenera and Burkholderiales (mainly in genera Bordetella, Burkholderia, Cupriavidus, Polaromonas, Ralstonia, Polynucleobacter and Variovorax of Betaproteobacteria were suggested to be more important in microcystin degradation than Sphingomonadales of Alphaproteobacteria. The latter taxa were previously thought to be major microcystin degraders. Homologs to known microcystin-degrading genes (mlr were not overrepresented in microcystin-amended metagenomes, indicating that Lake Erie bacterioplankton might employ alternative genes and/or pathways in microcystin degradation. Genes for xenobiotic metabolism were overrepresented in microcystin-amended microcosms, suggesting they are important in bacterial degradation of microcystin, a phenomenon that has been identified previously only in eukaryotic systems.
2013-10-18
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 7518-015] Erie Boulevard... and a maximum storage capacity of approximately 112 acre-feet; (2) a 247- foot-long, 11.5-foot-high concrete gravity dam with a spillway crest elevation of 165.2 feet above mean sea level; (3) a 34-foot-long...
2011-10-14
... provide common carrier rail service over the Line, connecting with and interchanging traffic with NSR, and... DEPARTMENT OF TRANSPORTATION Surface Transportation Board [Docket No. FD 35555] Midwest Rail d/b/a... Railway and Museum, Inc. Midwest Rail d/b/a Toledo, Lake Erie and Western Railway (Toledo), a noncarrier...
Hayden, Todd A.; Binder, Thomas; Holbrook, Christopher; Vandergoot, Christopher; Fielder, David G.; Cooke, Steven J.; Dettmers, John M.; Krueger, Charles C.
2018-01-01
Fidelity to spawning habitats can maximise reproductive success of fish by synchronising movements to sites of previous recruitment. To determine the role of reproductive fidelity in structuring walleye Sander vitreus populations in the Laurentian Great Lakes, we used acoustic telemetry combined with Cormack–Jolly–Seber capture–recapture models to estimate spawning site fidelity and apparent annual survival for the Tittabawassee River in Lake Huron and Maumee River in Lake Erie. Walleye in spawning condition were tagged from the Tittabawassee River in Lake Huron and Maumee River in Lake Erie in 2011–2012. Site fidelity and apparent annual survival were estimated from return of individuals to the stream where tagged. Site fidelity estimates were higher in the Tittabawassee River (95%) than the Maumee River (70%) and were not related to sex or fish length at tagging. Apparent annual survival of walleye tagged in the Tittabawassee did not differ among spawning seasons but was higher for female than male walleye and decreased linearly as fish length increased. Apparent annual survival of walleye tagged in the Maumee River did not differ among spawning seasons but was higher for female walleye than male walleye and increased linearly as fish length increased. Greater fidelity of walleye tagged in the Tittabawassee River than walleye tagged in the Maumee River may be related to the close proximity to the Maumee River of other spawning aggregations and multiple spawning sites in Lake Erie. As spawning site fidelity increases, management actions to conserve population structure require an increasing focus on individual stocks.
Review of Reports on Lake Erie - Lake Ontario Waterway, New York. Appendix D. Economics.
1973-10-01
Venezuela (29 percent). Canada produced 48.3 million tons of iron ore in 1970 ,of which 23.9 million tons were exported to the United States (14.4 million...grain traffic, 1971 D-14 D-6 U.S. - Great Lakes grain exports 1960 - 1971 and projected D-15 D-7 U.S. doal traffic, Lake Erie - Lake Ontario, 1958-1970...Soybeans Wheat Barley Oats Rice Sorghum Grains Flaxseed Oilseeds, n.e.c. Tobacco, leaf Hay and Fodder Field crops, n.e.c. Fresh fruits Co ffee Cocoa beans
Energy Technology Data Exchange (ETDEWEB)
Zapotosky, J.E.; White, W.S.
1980-10-01
A reconnaissance survey of the central and eastern basins of Lake Erie (22,240 km/sup 2/) was conducted from September 17 to 27, 1978. The survey provided baseline information on natural gas and oil losses from geologic formations, prior to any potential development of natural gas resources beneath the United States portion of the Lake. Lightweight hydrocarbons indicative of natural gas (methane, ethane, propane, isobutane, and n-butane) are introduced into the waters of Lake Erie by escape from geologic formations and by biological/photochemical processes. The geochemical exploration technique of hydrocarbon sniffing provided enough data to reveal significant distribution patterns, approximate concentrations, and potential sources. Twelve sites with elevated lightweight hydrocarbon concentrations had a composition similar to natural gas. In one area of natural gas input, data analysis suggested a potential negative effect of natural gas on phytoplanktonic metabolism (i.e., ethylene concentration). Samples taken for liquid hydrocarbon analysis (carbon tetrachloride extractable hydrocarbons) correlated best with biologically derived lightweight hydrocarbons.
Ormiston, A.; Mou, X.
2012-12-01
Harmful cyanobacteria blooms (cyanoHABs) are a serious issue that affects wildlife, human health, recreation and local economics worldwide. CyanoHABs produce cyanotoxins, such as microcystins (MCs) that lead to skin irritation, illness and liver tumors. Bacterially mediated degradation of MCs plays a key role to transform these toxic substrates to less harmful metabolites in natural environments. However, only a few Sphingomonos species have been isolated for degradation of MCs and many of which are from other habitats such as water plants. This project aims to isolate and identify bacteria that can degrade MC-LR and MC-RR, two major forms of MCs found during cyanoHABs in Lake Erie. Water samples were collected from the surface of Sandusky Bay and Maumee Bay of Lake Erie and immediately filtered through 3.0 -μm-pore-size membrane filters to obtain bacterioplankton fraction. The filtrates were amended with excessive inorganic nitrogen and phosphorus compounds and incubated in the dark for a week to purposely establish a carbon-limited condition. Afterwards, enrichment microcosms were established in flasks filled with pre-incubated bacterioplankton and single MC compounds (final concentration 10 μM). Once cell growth was confirmed by flow cytometry-based cell counting, bacterial cells in enriched microcosms were transferred onto solid surfaces, i.e., GFF filter and noble agar for colony isolation. Obtained single colonies were inoculated in defined liquid media with MCs as single carbon source. DNA was extracted from each purified isolate and analyzed by restriction fragment length polymorphism analysis (RFLP). A total of 18 different RFLP banding patterns were found, indicating MC-degrading bacteria may be heterogeneous in studied water samples. 16S rRNA genes of selected bacterial isolates were PCR amplified and sequenced for taxonomic identification. Our results demonstrated that MCs can be degraded by multiple bacterial species in Lake Erie. Future directions
Effects of complex effluents on photosynthesis in Lake Erie and Lake Huron
International Nuclear Information System (INIS)
Bridgham, S.D.; McNaught, D.C.; Meadows, C.
1988-01-01
Phytoplankton are the base of the food chain in most large lake ecosystems; if affected by environmental pollutants, significant ecosystem changes can result with potential impact on higher trophic levels. The research determined the effects of a complex effluent discharge from the River Raisin in Monroe County, Michigan, on the Lake Erie ecosystem. The river flows through southern Michigan and has large nutrient and industrial inputs, especially in the Monroe Harbor area. The functional parameters measured were bacterial uptake rate of acetate, zooplankton feeding and reproduction rates, and primary production. The results of the effects of complex effluents on gross photosynthesis, measured as carbon-14 ((14)C) uptake, are presented in the paper
Hydrology and environmental aspects of Erie Canal (1817-99)
Langbein, Walter Basil
1976-01-01
As the first major water project in the United States, the old Erie Canal provides an example of the hydrological and environmental consequences of water development. The available record shows that the project aroused environmental fears that the canal might be impaired by the adverse hydrologic effects of land development induced by the canal. Water requirements proved greater than anticipated, and problems of floods and hydraulic inefficiencies beset navigation throughout its history. The Erie Canal proved the practicality of major hydraulic works to the extent that operations and maintenance could cope with the burdens of deficiencies in design. The weight of prior experience that upland streams, such as the Potomac and Mohawk Rivers, had proved unsatisfactory for dependable navigation, led to a decision to build an independent canal which freed the location from the constraints of river channels and made possible a cross-country water route directly to Lake Erie. The decision on dimensioning the canal prism--chiefly width and depth-involved balance between a fear of building too small and thus not achieving the economic potentials, and a fear of building too expensively. The constraints proved effective, and for the first part of its history the revenues collected were sufficient to repay all costs. So great was the economic advantage of the canal that the rising trend in traffic soon induced an enlargement of the canal cross section, based upon a new but riskier objective-build as large as the projected trend in toll revenues would finance. The increased revenues did not materialize. Water supplies were a primary concern for both the planners and the operators of the canal. Water required for lockage, although the most obvious to the planners, proved to be a relatively minor item compared with the amounts of water that were required to compensate for leakage through the bed and banks of the canal. Leakage amounted to about 8 inches of depth per day. The total
Binary Star Orbits. V. The Nearby White Dwarf/Red Dwarf Pair 40 Eri BC
Mason, Brian D.; Hartkopf, William I.; Miles, Korie N.
2017-11-01
A new relative orbit solution with new dynamical masses is determined for the nearby white dwarf-red dwarf pair 40 Eri BC. The period is 230.09 ± 0.68 years. It is predicted to close slowly over the next half-century, getting as close as 1.″32 in early 2066. We determine masses of 0.575 ± 0.018 {{ M }}⊙ for the white dwarf and 0.2041 ± 0.0064 {{ M }}⊙ for the red dwarf companion. The inconsistency of the masses determined by gravitational redshift and dynamical techniques, due to a premature orbit calculation, no longer exists.
UHT Yöntemiyle İşlenmiş Sterilize Sütün Besin Değeri
Directory of Open Access Journals (Sweden)
Emel Sezgin
2015-02-01
Full Text Available Sütün bir gıda olarak değeri günümüzde artık çok iyi bilinmektedir. Özellikle ülkemiz gibi hayvansal proteinin az tüketildiği yerlerde, içinde ihtiyacımız olan besin elementlerinin hemen hemen hepsini yeterli ve dengeli bir şekilde bulunduran sütün önemi daha da artmaktadır. Bilindiği gibi sütün besin değeri tamamen sütün bileşimiyle ilgili bulunmakta ve bu da hayvanın, türü, ırkı, yem, laktasyon mevsim ve benzeri faktörlerle geniş ölçüde değişmektedir. Süt esas olarak protein, kalsiyum ve bazı suda eriyen vitaminler yönünden önem taşımaktadır. Örneğin, 0.5 L süt 5 yaşındaki bir çocuğun protein ihtiyacının %40’ını kalsiyum ve riboflavin ihtiyacının %70’ni, tiamin, folik asit, A vitamini ihtiyacının 1/3’ni, B12 vitamini ihtiyacının ise tamamını karşılayabilmektedir.
Food of forage fishes in western Lake Erie, 1975-76
Muth, Kenneth M.; Busch, Wolf-Dieter N.
1989-01-01
In western Lake Erie in the summer and fall of 1975–1976, food eaten by seven forage fishes—emerald shiner (Notropis atherinoides), spottail shiner (Notropis hudsonius), trout-perch (Percopsis omiscomaycus), andyoung-of-the-year (YOY) of alewife (Alosa pseudoharengus), gizzard shad (Dorosoma cepedianum), white bass (Morone chrysops), and freshwater drum (Aplodi-notus grunniens)—was divided among six major taxa: Cladocera, Copepoda, Diptera, Ostracoda, Amphipoda, and Algae. In addition, fish were eaten by YOY white bass, and Rotifera were consumed by YOY gizzard shad. Interspecies diet overlap indices, calculated to compare the food of the different species and to evaluate diet similarities, were usually highest for YOY white bass and YOY freshwater drum when compared with the other species and usually lowest between emerald shiners and all other forage fishes. Understanding the feeding interactions among fishes that could influence production at the forage-food level of the food web could provide insight into how cascading trophic interactions influence the production of piscivorous predators.
Larson, James H.; Richardson, William B.; Evans, Mary Anne; Schaeffer, Jeff; Wynne, Timothy; Bartsch, Michelle; Bartsch, Lynn; Nelson, J. C.; Vallazza, Jon M.
2016-01-01
Lake Erie is a large lake straddling the border of the U.S. and Canada that has become increasingly eutrophic in recent years. Eutrophication is particularly focused in the shallow western basin. The western basin of Lake Erie is hydrodynamically similar to a large estuary, with riverine inputs from the Detroit and Maumee Rivers mixing together and creating gradients in chemical and physical conditions. This study was driven by two questions: How does secondary production and food quality for consumers vary across this large mixing zone? and Are there correlations between cyanobacterial abundance and secondary production or food quality for consumers? Measuring spatial and temporal variation in secondary production and food quality is difficult for a variety of logistical reasons, so here a common consumer approach was used. In a common consumer approach, individuals of a single species are raised under similar conditions until placed in the field across environmental gradients of interest. After some period of exposure, the response of that common consumer is measured to provide an index of spatial variation in conditions. Here, a freshwater mussel (Lampsilis siliquoidea) was deployed at 32 locations that spanned habitat types and a gradient in cyanobacterial abundance in the western basin of Lake Erie to measure spatial variation in growth (an index of secondary production) and fatty acid (FA) content (an index of food quality). We found secondary production was highest within the Maumee rivermouth and lowest in the open waters of the lake. Mussel tissues in the Maumee rivermouth also included more eicosapentaenoic and docosapentaenoic fatty acids (EPA and DPA, respectively), but fewer bacterial FAs, suggesting more algae at the base of the food web in the Maumee rivermouth compared to open lake sites. The satellite-derived estimate of cyanobacterial abundance was not correlated to secondary production, but was positively related to EPA and DPA content in the
E. S. Riddell; S. A. Lorentz; D. C. Kotze
2010-01-01
Wetlands are undergoing considerable degradation in South Africa. As interventions are often technical and costly, there is a requirement to develop conceptual process models for these wetland systems so that rehabilitation attempts will be successful. This paper presents an approach using the geophysical methods of Electrical Resistivity Imaging (ERI) and Induced Polarization (IP) to delineate sub-surface hydro-geomorphic controls that maintain equilibrium disconnectivity of wetland-catchmen...
Azim, M Ekram; Kumarappah, Ananthavalli; Bhavsar, Satyendra P; Backus, Sean M; Arhonditsis, George
2011-03-15
The temporal trends of total mercury (THg) in four fish species in Lake Erie were evaluated based on 35 years of fish contaminant data. Our Bayesian statistical approach consists of three steps aiming to address different questions. First, we used the exponential and mixed-order decay models to assess the declining rates in four intensively sampled fish species, i.e., walleye (Stizostedion vitreum), yellow perch (Perca flavescens), smallmouth bass (Micropterus dolomieui), and white bass (Morone chrysops). Because the two models postulate monotonic decrease of the THg levels, we included first- and second-order random walk terms in our statistical formulations to accommodate nonmonotonic patterns in the data time series. Our analysis identified a recent increase in the THg concentrations, particularly after the mid-1990s. In the second step, we used double exponential models to quantify the relative magnitude of the THg trends depending on the type of data used (skinless-boneless fillet versus whole fish data) and the fish species examined. The observed THg concentrations were significantly higher in skinless boneless fillet than in whole fish portions, while the whole fish portions of walleye exhibited faster decline rates and slower rates of increase relative to the skinless boneless fillet data. Our analysis also shows lower decline rates and higher rates of increase in walleye relative to the other three fish species examined. The food web structural shifts induced by the invasive species (dreissenid mussels and round goby) may be associated with the recent THg trends in Lake Erie fish.
Vannah, Benjamin; Chang, Ni-Bin
2013-09-01
Urban growth and agricultural production have caused an influx of nutrients into Lake Erie, leading to eutrophic zones. These conditions result in the formation of algal blooms, some of which are toxic due to the presence of Microcystis (a cyanobacteria), which produces the hepatotoxin microcystin. Microcystis has a unique advantage over its competition as a result of the invasive zebra mussel population that filters algae out of the water column except for the toxic Microcystis. The toxin threatens human health and the ecosystem, and it is a concern for water treatment plants using the lake water as a tap water source. This presentation demonstrates the prototype of a near real-time early warning system using Integrated Data Fusion techniques with the aid of both hyperspectral remote sensing data to determine spatiotemporal microcystin concentrations. The temporal resolution of MODIS is fused with the higher spatial and spectral resolution of MERIS to create synthetic images on a daily basis. As a demonstration, the spatiotemporal distributions of microcystin within western Lake Erie are reconstructed using the band data from the fused products and applied machine-learning techniques. Analysis of the results through statistical indices confirmed that the this type of algorithm has better potential to accurately estimating microcystin concentrations in the lake, which is better than current two band models and other computational intelligence models.
Fecundity of walleyes in western Lake Erie, 1966 and 1990-91
Muth, Kenneth M.; Ickes, Brian S.
1993-01-01
Ovaries were collected from walleyes (Stizostedion vitreum vitreum) in western Lake Erie just prior to spawning in 1990 and 1991 to determine current fecundity. Results were compared with fecundity determined in 1966 prior to stock rehabilitation when walleye abundance was lower and fish size at age was greater. Fecundity estimates determined from 121 fish aged 3-10 ranged from 53,000 to 426,000 eggs per female. Increases in egg production correlated with increases in length and weight, and weight accounting for most of the variability. In 1990-91 the mean egg production of the dominant age groups of spawners (ages 4 to 8) was approximately 25% lower than fishes of similar age in 1966. The mean egg diameter in 1990-91 (1.63 mm) was not related to the size or age of the fish and was not significantly smaller than the egg diameter in 1966 (1.72 mm).
Influencia de Gregorio de Nisa sobre Juan Escoto Eriúgena: Aproximación a partir del Periphyseon
Pachas, José Antonio
2004-01-01
A partir de los cinco libros del Periphyseon el autor intenta un acercamiento entre el pensamiento de Juan Escoto Eriúgena y Gregorio de Nisa, buscando sobre todo las principales influencias del segundo sobre el primero. Encuentra una plataforma de amplia base común entre ambos pensadores, marcada principalmente por un tipo de pensamiento circular según el esquema: procesión y retorno. Sin embargo, es notoria la influencia del Niseno sobre el Carolingio, principalmente cuando se trata de plan...
2002-01-01
Eri Klasi ja Tampere Linnaorkestri CD helilooja Einar Englundi loominguga pälvis mainekaplaadiauhinna, Cannes Classical Award'i. 7.-24. veebruarini on Eesti Filharmoonia Kammerkoorringreisil USAs ja Kanadas. Festivali "opeNBaroque" kontsertidest. Chopini loomingule pühendatud Läänemeremaade noorte pianistide konkursist Narvas. Tubina ühingu aastakoosolekust 5. veebruaril
Heeren, A.; Toman, E.; Wilson, R. S.; Martin, J.
2016-12-01
Lake Erie is the most productive of the Great Lakes. However, harmful algal blooms (HABs) caused by nutrient run-off threaten the lake. Experts have proposed numerous best management practices (BMPs) designed to reduce nutrient and sediment run-off. However, for these practices to be effective at reducing HABs, a significant portion of farmers and landowners within Lake Erie's watersheds have to first adopt and implement these practices. In order to better understand how farmers and landowners make decisions about whether or not to adopt and implement BMPs we conducted a series of focus groups and a mail survey of Lake Erie's largest watershed. We found that many farmers were supportive of adopting BMPs. For example, 60% of farmers in the watershed have already adopted using grid soil sampling while another 30% are willing to adopt the practice in the future. However, other practices were less popular, for example, only 18% of farmers had already adopted cover crops. Farmers also expressed several reservations about adopting some BMPs. For example, farmers were concerned about the costs of some BMPs, such as cover crops and drainage management systems, and how such practices might interfere with the planting of subsequent crops. Our research has several implications for reducing nutrient production by promoting BMPs. First, we identified potential concerns and limitations farmers faced in implementing specific BMPs. For example, conservationists can design future programs and communication efforts to target these specific concerns. Second, through examining the socio-psychological and cognitive characteristics that influence farmer decision-making, we identified that willingness to adopt nutrient BMPs is association with how strongly a farmer identifies with conservation and how effective they believed the BMP was at reducing run-off. Messages and information about BMPs may be more effective if they are framed in a way that aligns with identities and beliefs about
Bur, M.T.; Stapanian, M.A.; Bernhardt, G.; Turner, M.W.
2008-01-01
Although published studies indicate the contrary, there is concern among many sport anglers that migrating red-breasted mergansers (Mergus serrator) and other waterbirds pose a competitive threat to sport fish species such as walleye (Sander vitreus) in Lake Erie. We quantified the diet of autumn-migrant mergansers and walleye during 1998-2000 in Sandusky Bay and adjacent waters of western Lake Erie. We hypothesized that the diets of both predators would be similar in species composition, but because of different foraging ecologies their diets would differ markedly in size of prey consumed. In addition to predator samples, we used trawl data from the same general area as an index of prey availability. We found that mergansers fed almost exclusively on fish (nine species). Gizzard shad (Dorosoma cepedianum), emerald shiner (Notropis atherinoides) and round goby (Neogobius melanostomus) were consumed in the greatest numbers, most frequently and comprised the greatest biomass. Walleye fed exclusively on fish: gizzard shad, alewife (Alosa psuedoharengus) and emerald shiner were consumed in the greatest numbers, most frequently and comprised the greatest biomass. Diet overlap between mergansers and walleye was 67% by weight and 66% by species frequency. Mean total lengths of gizzard shad, emerald shiner and round goby found in walleye stomachs exceeded those captured in trawls by 47%, on average. Mean total lengths of gizzard shad, emerald shiner and round goby were greater in walleye stomachs than in merganser stomachs. Mean total lengths of emerald shiner and round goby were less in merganser stomachs than in trawls. Our results suggest that although the diets of walleye and mergansers overlapped considerably, mergansers generally consumed smaller fish than walleye. Given the abundance and diversity of prey species available, and the transient nature of mergansers on Lake Erie during migration, we conclude that competition for food between these species is minimal.
Energy Technology Data Exchange (ETDEWEB)
Kaiser, G.; Vlahos, P.; Betts, B.
2005-06-20
This document presents the transcripts of an Ontario Energy Board hearing regarding an application filed by Erie Shores Wind Farm Limited to construct transmission facilities that will connect Erie Shores' wind farm on the north shore of Lake Erie to the transmission facilities of Hydro One Network. This document presents the examinations by representatives of the Board Counsel, Erie Shores Wind Farm Limited Partnership, Hydro One Networks Inc., Ontario's Independent Electricity System Operator and intervenors. Erie Shores is a limited partnership between AIM PowerGen Corporation and Clean Power Income Fund. The proposed wind farm is to be located along the north shore of Lake Erie, covering about 14,000 acres of farmland in the townships of Bayham, Malahide and Norfolk County. It consists of 66 wind turbines with a net output of 99 MW. The construction of transmission facilities would involve the construction of a new transformer station with a 34.5/115 kV transformer, a capacitor bank, switch gear, and space for a future transformer. It would also include a transmission line from the Port Burwell transmission station to Hydro One's circuits at Cranberry Junction near Tillsonburg. Erie Shores also proposes to construct 27 km of the transmission line within the existing Otter Valley utility corridor, 3 km along the active Canadian Pacific Rail corridor, and over certain private lands located south of Tillsonburg Junction. Erie Shores was one of the successful bidders that has entered into a 20-year renewable energy supply contract with the Ontario Electricity Financial Corporation. The Board considers that the project is in the public interest and granted approval for the project, subject to certain conditions regarding communications, monitoring and reporting requirements. 2 refs., 1 appendix.
Baker, David B; Johnson, Laura T; Confesor, Remegio B; Crumrine, John P
2017-11-01
During the re-eutrophication of Lake Erie, dissolved reactive phosphorus (DRP) loading and concentrations to the lake have nearly doubled, while particulate phosphorus (PP) has remained relatively constant. One potential cause of increased DRP concentrations is P stratification, or the buildup of soil-test P (STP) in the upper soil layer (soil samples (0-5 or 0-2.5 cm) alongside their normal agronomic samples (0-20 cm) ( = 1758 fields). The mean STP level in the upper 2.5 cm was 55% higher than the mean of agronomic samples used for fertilizer recommendations. The amounts of stratification were highly variable and did not correlate with agronomic STPs (Spearman's = 0.039, = 0.178). Agronomic STP in 70% of the fields was within the buildup or maintenance ranges for corn ( L.) and soybeans [ (L.) Merr.] (0-46 mg kg Mehlich-3 P). The cumulative risks for DRP runoff from the large number of fields in the buildup and maintenance ranges exceeded the risks from fields above those ranges. Reducing stratification by a one-time soil inversion has the potential for larger and quicker reductions in DRP runoff risk than practices related to drawing down agronomic STP levels. Periodic soil inversion and mixing, targeted by stratified STP data, should be considered a viable practice to reduce DRP loading to Lake Erie. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.
International Nuclear Information System (INIS)
1977-11-01
The proposed action is the issuance of construction permits to the Ohio Edison Company, acting on behalf of itself, the Cleveland Electric Illuminating Company, Duquesne Light Company, Pennsylvania Power Company, and the Toledo Edison Company, for the construction of the Erie Nuclear Plant Units 1 and 2, located in Erie County, Ohio. A total of 704 hectares (ha) (1740 acres) will be used for the Erie plant site. Construction-related activities on the primary site will disturb about 223 ha (551 acres). Approximately 641 ha (1584 acres) will be required for transmission line rights-of-way. The 3.86-km (2.4-mile) intake and discharge pipeline land corridor will involve alteration of approximately 13 ha (32 acres) of corridor and 1 ha (2.5 acres) for shore facilities. Also, 3.9 ha (9.6 acres) of lake bottom will be disturbed to provide 15-m-wide (50-ft-wide) trenches and an additional 15-m-wide (50-ft-wide) area for storage of excavated material for subsequent backfill for the 701-m (2300-ft) intake and 579-m (1900-ft) discharge lines. Plant construction will involve some community impacts. No residents will be displaced from the site property. Traffic on local roads will increase due to construction and commuting activities. The influx of construction workers' families (a peak work force of about 2700) is expected to cause no major housing or school problems. It is assumed that aquatic organisms entrained in the circulating water system will be killed due to thermal and mechanical shock. The maximum impact based on the population densities of phytoplankton and zooplankton organisms in the adjacent lake area will be the destruction of 0.1% of the entrainable organisms from the lake water. The entrainment of fish larvae will not constitute a significant impact on the lake fishery. 62 figs., 32 tabs
Meteotsunamis in the Great Lakes and Investigation into the May 27, 2012 Event on Lake Erie
Anderson, E. J.; Bechle, A.; Wu, C. H.; Schwab, D. J.; Mann, G.
2016-02-01
Meteotsunami events have been documented in several countries around the world in the coastal ocean, semi-enclosed basins, and in the Great Lakes. In particular, investigations in the Great Lakes have raised the issue of dangers posed by enclosed basins due to the reflection and interaction of meteotsunami waves, in which the destructive waves can arrive several hours after the atmospheric disturbance has passed. This disassociation in time and space between the atmospheric disturbance and resultant meteotsunami wave can pose a significant threat to the public. In a recent event on May 27, 2012, atmospheric conditions gave rise to two convective systems that generated a series of waves in the meteotsunami band on Lake Erie. The resulting waves swept three swimmers a half-mile offshore, inundated a marina, and may have led to a capsized boat along the southern shoreline. Examination of the observed conditions shows that these events occurred at a time between the arrivals of these two storm systems when atmospheric conditions were relatively calm but water level displacements were at their greatest. In this work, we attempt to explain the processes that led to these conditions through a combination of atmospheric and hydrodynamic modeling and an analysis of the observed radial velocities associated with the meteotsunami-inducing front. Results from a high-resolution atmospheric model and hydrodynamic model reveal that the formation of these destructive waves resulted from a combination of wave reflection, focusing, and edge waves that impacted the southern shore of Lake Erie. This event illustrates the unique danger posed by temporal lags between the inducing atmospheric conditions and resulting dangerous nearshore wave conditions.
Does behavioural thermoregulation underlie seasonal movements in Lake Erie walleye?
Raby, Graham D.; Vandergoot, Christopher; Hayden, Todd A.; Faust, Matthew D.; Kraus, Richard T.; Dettmers, John M.; Cooke, Steven J.; Zhao, Yingming; Fisk, Aaron T.; Krueger, Charles C.
2018-01-01
Thermoregulation is presumed to be a widespread determinant of behaviour in fishes, but has not often been investigated as a mechanism shaping long-distance migrations. We used acoustic telemetry and animal-borne thermal loggers to test the hypothesis that seasonal migration in adult walleye (Sander vitreus) in Lake Erie is size- and (or) sex-specific and related to behavioural thermoregulation. Female walleye migrated out of the warm, shallow western basin earlier than did males and were 1.8 times more likely to be detected on acoustic receivers in the deeper and cooler eastern basin. The few fish that remained in the western basin were restricted to a smaller range of higher temperatures (≥20 °C) than those that migrated to the central and eastern basins (∼16–21 °C). However, temperature records from walleye in the central basin were nearly indistinguishable from those in the eastern basin, suggesting thermal preferences alone could not explain migration to the eastern basin. As such, our effort to understand the mechanisms that cause migratory behaviours has generated mixed evidence on the role of temperature and that factors like foraging opportunities may have synergistic roles in the migration.
Short-Pulse-Width Repetitively Q-Switched ~2.7-μm Er:Y2O3 Ceramic Laser
Directory of Open Access Journals (Sweden)
Xiaojing Ren
2017-11-01
Full Text Available A short-pulse-width repetitively Q-switched 2.7-μm Er:Y2O3 ceramic laser is demonstrated using a specially designed mechanical switch, a metal plate carved with slits of both slit-width and duty-cycle optimized. With a 20% transmission output coupler, stable pulse trains with durations (full-width at half-maximum, FWHM of 27–38 ns were generated with a repetition rate within the range of 0.26–4 kHz. The peak power at a 0.26 kHz repetition rate was ~3 kW.
Focused risk assessment: Mound Plant, Miami-Erie Canal Operable Unit 4
International Nuclear Information System (INIS)
Rogers, D.R.; Dunning, D.F.
1994-01-01
In 1969, an underground waste line at Mound Plant ruptured and released plutonium-238 in a dilute nitric acid solution to the surrounding soils. Most of the acid was neutralized by the native soils. The plutonium, which in a neutral solution is tightly sorbed onto clay particles, remained within the spill area. During remediation, a severe storm eroded some of the contaminated soil. Fine grained plutonium-contaminated clay particles were carried away through the natural drainage courses to the remnants of the Miami-Erie Canal adjacent to Mound Plant, and then into the Great Miami River. This focused risk assessment considers exposure pathways relevant to site conditions, including incidental ingestion of contaminated soils, ingestion of drinking water and fish, and inhalation of resuspended soils and sediments. For each potential exposure pathway, a simplified conceptual model and exposure scenarios have been used to develop conservative estimates of potential radiation dose equivalents and health risks. The conservatism of the dose and risk estimates provides a substantive margin of safety in assuring that the public health is protected
Seasonal and interannual effects of hypoxia on fish habitat quality in central Lake Erie
Arend, Kristin K.; Beletsky, Dmitry; DePinto, Joseph; Ludsin, Stuart A.; Roberts, James J.; Rucinski, Daniel K.; Scavia, Donald; Schwab, David J.; Höök, Tomas O.
2011-01-01
1. Hypoxia occurs seasonally in many stratified coastal marine and freshwater ecosystems when bottom dissolved oxygen (DO) concentrations are depleted below 2–3 mg O2 L-1. 2. We evaluated the effects of hypoxia on fish habitat quality in the central basin of Lake Erie from 1987 to 2005, using bioenergetic growth rate potential (GRP) as a proxy for habitat quality. We compared the effect of hypoxia on habitat quality of (i) rainbow smelt, Osmerus mordax mordax Mitchill (young-of-year, YOY, and adult), a cold-water planktivore, (ii) emerald shiner, Notropis atherinoides Rafinesque (adult), a warm-water planktivore, (iii) yellow perch, Perca flavescens Mitchill (YOY and adult), a cool-water benthopelagic omnivore and (iv) round goby Neogobius melanostomus Pallas (adult) a eurythermal benthivore. Annual thermal and DO profiles were generated from 1D thermal and DO hydrodynamics models developed for Lake Erie’s central basin. 3. Hypoxia occurred annually, typically from mid-July to mid-October, which spatially and temporally overlaps with otherwise high benthic habitat quality. Hypoxia reduced the habitat quality across fish species and life stages, but the magnitude of the reduction varied both among and within species because of the differences in tolerance to low DO levels and warm-water temperatures. 4. Across years, trends in habitat quality mirrored trends in phosphorus concentration and water column oxygen demand in central Lake Erie. The per cent reduction in habitat quality owing to hypoxia was greatest for adult rainbow smelt and round goby (mean: -35%), followed by adult emerald shiner (mean: -12%), YOY rainbow smelt (mean: -10%) and YOY and adult yellow perch (mean: -8.5%). 5. Our results highlight the importance of differential spatiotemporally interactive effects of DO and temperature on relative fish habitat quality and quantity. These effects have the potential to influence the performance of individual fish species as well as population dynamics
Stott, Wendylee; Ebener, Mark P.; Mohr, Lloyd; Hartman, Travis; Johnson, Jim; Roseman, Edward F.
2013-01-01
Lake whitefish (Coregonus clupeaformis (Mitchill)) are important commercially, culturally, and ecologically in the Laurentian Great Lakes. Stocks of lake whitefish in the Great Lakes have recovered from low levels of abundance in the 1960s. Reductions in abundance, loss of habitat and environmental degradation can be accompanied by losses of genetic diversity and overall fitness that may persist even as populations recover demographically. Therefore, it is important to be able to identify stocks that have reduced levels of genetic diversity. In this study, we investigated patterns of genetic diversity at microsatellite DNA loci in lake whitefish collected between 1927 and 1929 (historical period) and between 1997 and 2005 (contemporary period) from Lake Huron and Lake Erie. Genetic analysis of lake whitefish from Lakes Huron and Erie shows that the amount of population structuring varies from lake to lake. Greater genetic divergences among collections from Lake Huron may be the result of sampling scale, migration patterns and demographic processes. Fluctuations in abundance of lake whitefish populations may have resulted in periods of increased genetic drift that have resulted in changes in allele frequencies over time, but periodic genetic drift was not severe enough to result in a significant loss of genetic diversity. Migration among stocks may have decreased levels of genetic differentiation while not completely obscuring stock boundaries. Recent changes in spatial boundaries to stocks, the number of stocks and life history characteristics of stocks further demonstrate the potential of coregonids for a swift and varied response to environmental change and emphasise the importance of incorporating both spatial and temporal considerations into management plans to ensure that diversity is preserved.
Martin, J.; Wilson, R. S.; Aloysius, N.; Kalcic, M. M.; Roe, B.; Howard, G.; Irwin, E.; Zhang, W.; Liu, H.
2017-12-01
In early 2016, the United States and Canada formally agreed to reduce phosphorus inputs to Lake Erie by 40% to reduce the severity of annual Harmful Algal Blooms (HABs). These blooms have become more severe, with record events occurring in 2011 and 2015, and have compromised public safety, shut down drinking water supplies, and negatively impacted the economy of the western Lake Erie basin. Now, a key question is what management options should be pursued to reach the 40% reduction. This presentation will highlight interdisciplinary research to compare the amount and types of practices needed for this reduction to the current and projected levels of adoption. Multiple models of the Maumee watershed identified management plans and adoption rates needed to reach the reduction targets. For example, one successful scenario estimated necessary adoption rates of 50% for subsurface application of fertilizer on row crops, 58% for cover crops, and 78% for buffer strips. Current adoption is below these levels, but future projections based on farmer surveys shows these levels are possible. This information was then used to guide another round of watershed modeling analysis to evaluate scenarios that represented more realistic scenarios based on potential levels of management adoption. In general, these results show that accelerated adoption of management plans is needed compared to past adoption rates, and that some of these greater adoption levels are possible based on likely adoption rates. Increasing the perceived efficacy of the practices is one method that will support greater voluntary rates of adoption.
McGrath, Darby M.; Murphy, Stephen D.
2012-08-01
The context for this study is the management concerns over the severity and extent of the impact of cormorants on island flora in the recent past on Lake Erie islands. Accordingly, this study sought to quantify the nesting colonies' influence on coarse woody litter and how nest densities and litter depth may influence the herbaceous layer, the seed bank composition and viability across the extent of three Lake Erie islands. The data for this study were collected from 2004 to 2008 on East Sister Island and Middle Island using two main strategies. First, herbaceous layer surveys, cormorant nest counts, soil seed bank cores, and litter depth measurements were executed using a plotless-point quarter method to test island-wide impacts from nesting activities (data were also collected on a third island, West Sister Island as a reference for the other two islands). Secondly, a sub-sample of the entire plot set was examined in particularly high nesting density areas for two islands (Middle Island and East Sister Island). Kruskal-Wallis tests indicated that there are subtle changes in the herbaceous diversity (total, native and exotic) and seed bank composition across the islands. The sub sample set of the plots demonstrated that Phalacrocorax auritus nest density does influence litter depth, herbaceous species abundance and diversity. Cormorant nesting pressures are restricted to areas of high nesting pressures and competition. However, there remains a risk to the interior herbaceous layer of the island if the effects of nesting pressures at the edges advance inward from this perimeter.
International Nuclear Information System (INIS)
Boyd, C.A.; Jelinek, J.
1979-06-01
The goal of the Energy Research Information System (ERIS) is to provide an inventory of the energy related programs and research activities from 1974 to the present in the States of Montana, Nebraska, North Dakota, South Dakota and Wyoming. Areas of research covered include: coal, petroleum, oil shales, fission fuels, synthetic fuels, hydro-energy, renewable energy, resources, energy policy, reclamation, socioeconomic impacts, environmental impacts and land use. Each project description lists title, investigator(s), research institution, sponsor, funding, time frame, location, a descriptive abstract of the research and the titles of reports and/or publications generated by the research. All projects are indexed by location, personal names, organizations and subject keywords
Directory of Open Access Journals (Sweden)
Chao-wei Wen
2016-01-01
Full Text Available 1-Deoxynojirimycin (DNJ, the main hypoglycemic constituent in mulberry (Morus alba latex, has been extensively researched. Although there is considerable interest in the biological effects of DNJ, the roles of 1-deoxynojirimycin (DNJ in glycometabolism and energy metabolism in insects have received little attention. In this paper, 1H nuclear magnetic resonance (1H NMR based metabonomic was performed to study the effects of the oral supplementation of 0.25% DNJ, 0.5% DNJ, latex, and the mixture of 0.5% DNJ and latex (1 : 1 on the fat body glycometabolism and energy metabolism of the fourth-instar larvae of Eri silkworms, Samia cynthia ricini. Metabolic pattern recognition analysis (partial least square-discriminant analysis, PLS-DA of fat body extracts indicated that the groups of 0.25% DNJ, 0.5% DNJ, latex, and the mixture of 0.5% DNJ and latex (1 : 1 were significantly different from the control group. Further, compared to the control group, the metabolites levels of lactate, trehalose, succinate, malate, and fumarate were remarkably changed in experimental groups, which were involved in glycolysis, hydrolysis of trehalose, and tricarboxylic acid (TCA cycle. Our results indicate that DNJ has a positive impact on the reverse energy metabolism of Eri silkworms and metabonomic analysis based on NMR can be used as a tool to identify potential biomarkers.
Flow of an Erying-Powell fluid over a stretching sheet in presence of chemical reaction
Directory of Open Access Journals (Sweden)
Khan Ilyas
2016-01-01
Full Text Available In this paper we study the flow of an incompressible Erying-Powell fluid bounded by a linear stretching surface. The mass transfer analysis in the presence of destructive /generative chemical reactions is also analyzed. A similarity transformation is used to transform the governing partial differential equations into ordinary differential equations. Computations for dimensionless velocity and concentration fields are performed by an efficient approach namely the homotopy analysis method (HAM and numerical solution is obtained by shooting technique along with Runge-Kutta-Fehlberg integration scheme. Graphical results are prepared to illustrate the details of flow and mass transfer characteristics and their dependence upon the physical parameters. The values for gradient of mass transfer are also evaluated and analyzed. A comparison of the present solutions with published results in the literature is performed and the results are found to be in excellent agreement.
Stability of plutonium contaminated sediments in the Miami--Erie Canal
International Nuclear Information System (INIS)
Farmer, B.M.; Carfagno, D.G.
1978-01-01
This study was conducted to evaluate the stability of plutonium-contaminated sediment in the Miami-Erie Canal. Correlations were sought to relate concentrations at air sampling stations to plutonium-238 concentrations in air and stack emissions, wind direction, particulate loading, rainfall, and construction activities. There appears to be some impact on airborne concentrations at air sampling stations 122 and 123 from the contaminated sediment in the canal and ponds area. For purposes of this evaluation, it was assumed that the plutonium-238 found in the air samples came from the contaminated sediment in the canal/ponds area. To complete the evaluation of the inhalation pathway, dose calculations were performed using actual airborne concentrations of plutonium-238 measured at sampler 123. The dose equivalent to an individual in that area was calculated for 1 yr and 70 yr. Dose calculations were also performed on potential uptake of contaminated vegetation from that area for 1 yr and 70 yr. This study indicates that, although the contaminated sediments in the canal and pond area appear to contribute to airborne plutonium-238, the observed maximum monthly concentration of plutonium-238 in air is a small fraction of the DOE Radioactivity Concentration Guide (RCG) and the nine-month average concentration of plutonium-238 in air observed thus far during 1977 is less than 1% of the RCG. Dose equivalents, conservatively calculated from these actual data, are well within existing DOE standards and proposed EPA guidance
McKenna, J.E.; Castiglione, C.
2010-01-01
Classification is a valuable conservation tool for examining natural resource status and problems and is being developed for coastal aquatic habitats. We present an objective, multi-scale hydrospatial framework for nearshore areas of the Great Lakes. The hydrospatial framework consists of spatial units at eight hierarchical scales from the North American Continent to the individual 270-m spatial cell. Characterization of spatial units based on fish abundance and diversity provides a fish-guided classification of aquatic areas at each spatial scale and demonstrates how classifications may be generated from that framework. Those classification units then provide information about habitat, as well as biotic conditions, which can be compared, contrasted, and hierarchically related spatially. Examples within several representative coastal or open water zones of the Western Lake Erie pilot area highlight potential application of this classification system to management problems. This classification system can assist natural resource managers with planning and establishing priorities for aquatic habitat protection, developing rehabilitation strategies, or identifying special management actions.
Using wind setdown and storm surge on Lake Erie to calibrate the air-sea drag coefficient.
Drews, Carl
2013-01-01
The air-sea drag coefficient controls the transfer of momentum from wind to water. In modeling storm surge, this coefficient is a crucial parameter for estimating the surge height. This study uses two strong wind events on Lake Erie to calibrate the drag coefficient using the Coupled Ocean Atmosphere Wave Sediment Transport (COAWST) modeling system and the the Regional Ocean Modeling System (ROMS). Simulated waves are generated on the lake with Simulating WAves Nearshore (SWAN). Wind setdown provides the opportunity to eliminate wave setup as a contributing factor, since waves are minimal at the upwind shore. The study finds that model results significantly underestimate wind setdown and storm surge when a typical open-ocean formulation without waves is used for the drag coefficient. The contribution of waves to wind setdown and storm surge is 34.7%. Scattered lake ice also increases the effective drag coefficient by a factor of 1.1.
La vinculación de Juan Escoto Eriúgena con la tradición en las obras de Brucker, Tennemann y Rixner
Natalia Strok
2014-01-01
Se busca dar cuenta de la filiación filosófica que tres historiadores de la filosofía (de los siglos XVIII y XIX) otorgan a Juan Escoto Eriúgena (siglo IX). El iluminista J. Brucker, el kantiano W. Tennemann y el romántico T. Rixner son representan- tes del periodo de gestación de la historia de la filosofía como disciplina, y sus obras son fuentes para destacados filósofos, como por ejemplo Hegel. Se muestra hasta qué punto las líneas interpretativas que iniciaron estos autores se conti- núa...
Directory of Open Access Journals (Sweden)
Guoqing Wang
2017-12-01
Full Text Available Phytoplankton pigments absorb sunlight for photosynthesis, protect the chloroplast from damage caused by excess light energy, and influence the color of the water. Some pigments act as bio-markers and are important for separation of phytoplankton functional types. Among many efforts that have been made to obtain information on phytoplankton pigments from bio-optical properties, Gaussian curves decomposed from phytoplankton absorption spectrum have been used to represent the light absorption of different pigments. We incorporated the Gaussian scheme into a semi-analytical model and obtained the Gaussian curves from remote sensing reflectance. In this study, a series of sensitivity tests were conducted to explore the potential of obtaining the Gaussian curves from multi-spectral satellite remote sensing. Results showed that the Gaussian curves can be retrieved with 35% or less mean unbiased absolute percentage differences from MEdium Resolution Imaging Spectrometer (MERIS and Moderate Resolution Imaging Spectroradiometer (MODIS-like sensors. Further, using Lake Erie as an example, the spatial distribution of chlorophyll a and phycocyanin concentrations were obtained from the Gaussian curves and used as metrics for the spatial extent of an intense cyanobacterial bloom occurred in Lake Erie in 2014. The seasonal variations of Gaussian absorption properties in 2011 were further obtained from MERIS imagery. This study shows that it is feasible to obtain Gaussian curves from multi-spectral satellite remote sensing data, and the obtained chlorophyll a and phycocyanin concentrations from these Gaussian peak heights demonstrated potential application to monitor harmful algal blooms (HABs and identification of phytoplankton groups from satellite ocean color remote sensing semi-analytically.
Hartmann, Ulrich
1992-01-01
Lepo Sumera neljanda sümfoonia "Serena Borealis" esiettekanne Karlsruhes: Eri Klas dirigeeris kontserdil kultuuripäevade raames ka Arvo Pärdi ja Eduard Tubina muusikat. Eesti muusikute esinemisest Karlsruhe kultuuripäevadel
Fabrication and characterization of biomaterial film from gland silk of muga and eri silkworms.
Dutta, Saranga; Talukdar, Bijit; Bharali, Rupjyoti; Rajkhowa, Rangam; Devi, Dipali
2013-05-01
This study discusses the possibilities of liquid silk (Silk gland silk) of Muga and Eri silk, the indigenous non mulberry silkworms of North Eastern region of India, as potential biomaterials. Silk protein fibroin of Bombyx mori, commonly known as mulberry silkworm, has been extensively studied as a versatile biomaterial. As properties of different silk-based biomaterials vary significantly, it is important to characterize the non mulberry silkworms also in this aspect. Fibroin was extracted from the posterior silk gland of full grown fifth instars larvae, and 2D film was fabricated using standard methods. The films were characterized using SEM, Dynamic contact angle test, FTIR, XRD, DSC, and TGA and compared with respective silk fibers. SEM images of films reveal presence of some globules and filamentous structure. Films of both the silkworms were found to be amorphous with random coil conformation, hydrophobic in nature, and resistant to organic solvents. Non mulberry silk films had higher thermal resistance than mulberry silk. Fibers were thermally more stable than the films. This study provides insight into the new arena of research in application of liquid silk of non mulberry silkworms as biomaterials. Copyright © 2012 Wiley Periodicals, Inc.
Petrology of the Devonian gas-bearing shale along Lake Erie helps explain gas shows
Energy Technology Data Exchange (ETDEWEB)
Broadhead, R.F.; Potter, P.E.
1980-11-01
Comprehensive petrologic study of 136 thin sections of the Ohio Shale along Lake Erie, when combined with detailed stratigraphic study, helps explain the occurrence of its gas shows, most of which occur in the silty, greenish-gray, organic poor Chagrin Shale and Three Lick Bed. Both have thicker siltstone laminae and more siltstone beds than other members of the Ohio Shale and both units also contain more clayshales. The source of the gas in the Chagrin Shale and Three Lick Bed of the Ohio Shale is believed to be the bituminous-rich shales of the middle and lower parts of the underlying Huron Member of the Ohio Shale. Eleven petrographic types were recognized and extended descriptions are provided of the major ones - claystones, clayshales, mudshales, and bituminous shales plus laminated and unlaminated siltstones and very minor marlstones and sandstones. In addition three major types of lamination were identified and studied. Thirty-two shale samples were analyzed for organic carbon, whole rock hydrogen and whole rock nitrogen with a Perkin-Elmer 240 Elemental Analyzer and provided the data base for source rock evaluation of the Ohio Shale.
Directory of Open Access Journals (Sweden)
Duanpen Wongsorn
2015-10-01
Full Text Available The selection of eri silkworm ecoraces with high yield and distinct morphological characters is necessary for variety improvement. The five ecoraces SaKKU1, SaKKU2, SaKKU3, SaKKU4 and SaKKU5 were derived mostly by international academic cooperation. They were cultured using castor leaves of TCO 101 cultivar as food plant at 25±2°C, 80±5% R.H. Based on morphological characters, they are similar, except the body of the 5th instar larva of SaKKU1 is clearly covered with more creamy white powder and the mature larva has a shiny dominant yellow color. The duration of the life cycle among ecoraces was also similar; 46-53 days (SaKKU1, 42-53 days (SaKKU2, 42-52 days (SaKKU3, 40-56 days (SaKKU4 and 41-52 days (SaKKU5. SaKKU1 had the highest survival rate at larval stage (1st – 5th instar (100.00% and larva (1st – 5th instar - adult (88.89%, including the predominant heaviest average larva weight of all instars, 0.0317 g (2nd instar, 0.2206 g (3rd instar, 1.0788 g (4th instar, 4.0102 g (5th instar, and 8.9940 g (5 days of 5th instar, which was significantly different (P<0.05 to other ecoraces. Moreover, this ecorace gave the highest average yields: fresh cocoon weight (3.8016 g, pupa weight (3.2532 g, shell weight (0.5287 g, shell ratio (14.01%, fresh cocoon weight/10,000 larvae (38.01 kg, eggs/moth (531.13 eggs, total eggs (6,375.27 eggs and total hatching eggs (6,006.13 eggs, which was also significantly different (P<0.05 than other ecoraces. Of those properties, especially survival rates and yields, this ecorace (SaKKU1 is favored for further varietal improvement program. In parallel, genetic relationship analysis of eri silkworm ecoraces using inter-simple sequence repeat (ISSR technique was also carried out. The result revealed from dendrogram analysis that SaKKU1 was the farthest distance than other ecoraces, especially against SaKKU3. Based on all above results, the SaKKU1 ecorace was considered to be the most suitable for heat tolerant
Fekel, Francis C.; Quigley, Robert; Gillies, Kim; Africano, John L.
1987-01-01
Spectroscopic observations of the chromospherically active G5 IV single-lined binary HD 26337 = EI Eri are presented. An orbital period of 1.94722 days is found for the star. It has moderately strong Ca II H and K emission and strong ultraviolet emission features, while H-alpha is a weak absorption feature that is variable in strength. The inclination of the system is 46 + or - 12 deg, and the unseen secondary is probably a late K or early M dwarf. The v sin i of the primary is 50 + or - 3 km/s, resulting in a minimum radius of 1.9 + or - 0.1 solar radius. The star is within the required limits for Doppler imaging. The primary is close to filling its Roche lobe, resulting in a strong constraint that the mass ratio is 2.6 or greater, with a primary mass of at least 1.4 solar mass. The distance to the system is estimated at 75 pc.
Bartolotta, Jill F; Hardy, Scott D
2018-02-01
Given the growing saliency of plastic marine debris, and the impact of plastics on beaches and aquatic environments in the Laurentian Great Lakes, applied research is needed to support municipal and nongovernmental campaigns to prevent debris from reaching the water's edge. This study addresses this need by examining the barriers and benefits to positive behavior for two plastic debris items in northeast Ohio's Lake Erie basin: plastic bags and plastic water bottles. An online survey is employed to gather data on the use and disposal of these plastic items and to solicit recommendations on how to positively change behavior to reduce improper disposal. Results support a ban on plastic bags and plastic water bottles, with more enthusiasm for a bag ban. Financial incentives are also seen as an effective way to influence behavior change, as are location-specific solutions focused on education and outreach. Copyright © 2017 Elsevier Ltd. All rights reserved.
Cuenca Almenar, Salvador
2012-01-01
Se analiza la relación entre un fragmento de la sexta parte de La insoportable levedad del ser de Milan Kundera y los dos textos que le sirven de fuente: el Peri physeon de Escoto Eriúgena y el De civitate Dei de Agustín de Hipona. Los tres fragmentos analizados en este artículo mantienen una relación de copresencia llamada “alusión” por Genette. Se defiende que el paso de Kundera no es plenamente comprensible sin la intelección de sus fuentes. El problema conceptual desarrollado por los tres...
Flatiron-Erie 115kV transmission line project, Larimer, Weld and Boulder Counties, Colorado
International Nuclear Information System (INIS)
1993-05-01
Western Area Power Administration (Western) proposes to uprate its existing 115-kV Flatiron-Erie transmission line. The line is located in Larimer, Weld and Boulder Counties, Colorado, and passes through the City of Longmont. The line connects Flatiron Substation and several of the substations supplying Longmont. It is a single circuit 115-kV line, 31.5 miles long, and was built in 1950-51 on a 75-foot wide right-of-way (ROW) using wood H-frame structures. Western proposes to build 27 new structures along the line, to replace or modify 45 of the existing structures and to remote 11 of them. Many of these additions and changes would involve structures that are approximately 5 to 15 feet taller than the existing ones. The existing conductors and ground wires would remain in place. The purpose of these actions would be to allow the power carrying capability of the line to be increased and to replace deteriorating/structural members. Western would be the sole participant in the proposed project. This report gives an analysis of the study area environment and the development of alternative routes. An assessment is presented of the impacts of the primary alternative routes. The environmental consequences of this project are addressed
BAYRAKTAR, DUYGU; KHORSHTD, LEYLA
2018-01-01
Başlık:Ölçüm Öncesi Dinlenme Süresinin ve DinlenmeEsnasında Konuşmanın İndirekt Kan Basıncı Ölçüm Değeri Üzerine EtkisiTitle:Özet: Amaç: Buaraştırma, indirekt arteriyel kan basıncı ölçerken bireyin dinlenme süresininve dinlenme esnasında konuşmanın ölçüm değeri üzerine etkisini incelemekamacıyla yapılmıştır.Gereç-Yöntem:Örneklemini, bir üniversite hastanesinin İç Hastalıkları Polikliniği’nebaşvuran 18 yaşın üzerinde olan, 60 normotansif ve 60 hipertansif bireyleroluşturmuştur. Veri...
Johnson, M. V. V.; Behrman, K. D.; Atwood, J. D.; White, M. J.; Norfleet, M. L.
2017-12-01
There is substantial interest in understanding how conservation practices and agricultural management impact water quality, particularly phosphorus dynamics, in the Western Lake Erie Basin (WLEB). In 2016, the US and Canada accepted total phosphorus (TP) load targets recommended by the Great Lakes Water Quality Agreement Annex 4 Objectives and Targets Task Team; these were 6,000 MTA delivered to Lake Erie and 3,660 MTA delivered to WLEB. Outstanding challenges include development of metrics to determine achievement of these goals, establishment of sufficient monitoring capacity to assess progress, and identification of appropriate conservation practices to achieve the most cost-effective results. Process-based modeling can help inform decisions to address these challenges more quickly than can system observation. As part of the NRCS-led Conservation Effects Assessment Project (CEAP), the Soil Water Assessment Tool (SWAT) was used to predict impacts of conservation practice adoption reported by farmers on TP loss and load delivery dynamics in WLEB. SWAT results suggest that once the conservation practices in place in 2003-06 and 2012 are fully functional, TP loads delivered to WLEB will average 3,175 MTA and 3,084 MTA, respectively. In other words, SWAT predicts that currently adopted practices are sufficient to meet Annex 4 TP load targets. Yet, WLEB gauging stations show Annex 4 goals are unmet. There are several reasons the model predictions and current monitoring efforts are not in agreement: 1. SWAT assumes full functionality of simulated conservation practices; 2. SWAT does not simulate changing management over time, nor impacts of past management on legacy loads; 3. SWAT assumes WLEB hydrological system equilibrium under simulated management. The SWAT model runs used to construct the scenarios that informed the Annex 4 targets were similarly constrained by model assumptions. It takes time for a system to achieve equilibrium when management changes and it
Directory of Open Access Journals (Sweden)
E. S. Riddell
2010-08-01
Full Text Available Wetlands are undergoing considerable degradation in South Africa. As interventions are often technical and costly, there is a requirement to develop conceptual process models for these wetland systems so that rehabilitation attempts will be successful. This paper presents an approach using the geophysical methods of Electrical Resistivity Imaging (ERI and Induced Polarization (IP to delineate sub-surface hydro-geomorphic controls that maintain equilibrium disconnectivity of wetland-catchment processes, which through gully erosion are increasing the catchments connectivity through loss of water and sediment. The findings presented here give insight into the geomorphic processes that maintain the wetland in an un-degraded state, this allows for the development of a conceptual model outlining the wetland forming processes. The analysis suggests that sub-surface clay-plugs, within an otherwise sandy substrate are created by illuviation of clays from the surrounding hillslopes particularly at zones of valley confinement.
Ichthyoplankton assemblages of coastal west-central Lake Erie and associated habitat characteristics
McKenna, J.E.; Hunter, R. Douglas; Fabrizio, M.C.; Savino, J.F.; Todd, T.N.; Bur, M.
2008-01-01
Early life stage survival often determines fish cohort strength and that survival is affected by habitat conditions. The structure and dynamics of ichthyoplankton assemblages can tell us much about biodiversity and fish population dynamics, but are poorly understood in nearshore areas of the Great Lakes, where most spawning and nursery habitats exist. Ichthyoplankton samples were collected with a neuston net in waters 2-13 m deep weekly or biweekly from mid-April through August, during 3 years (2000-2002) as part of a study of fish assemblages in west-central Lake Erie. A suite of abiotic variables was simultaneously measured to characterize habitat. Cluster and ordination analyses revealed several distinct ichthyoplankton assemblages that changed seasonally. A lake whitefish (Coregonus clupeaformis) dominated assemblage appeared first in April. In May, assemblages were dominated by several percid species. Summer assemblages were overwhelmingly dominated by emerald shiner (Notropis atherinoides), with large gizzard shad (Dorosoma cepedianum) and alewife (Alosa pseudoharengus) components. This seasonal trend in species assemblages was also associated with increasing temperature and water clarity. Water depth and drift processes may also play a role in structuring these assemblages. The most common and widely distributed assemblages were not associated with substratum type, which we characterized as either hard or soft. The timing of hatch and larval growth separated the major groups in time and may have adaptive significance for the members of each major assemblage. The quality and locations (with reference to lake circulation) of spawning and nursery grounds may determine larval success and affect year class strength.
The Delta Scuti star 38 Eri from the ground and from space
Paparó, M.; Kolláth, Z.; Shobbrook, R. R.; Matthews, J. M.; Antoci, V.; Benkő, J. M.; Park, N.-K.; Mirtorabi, M. T.; Luedeke, K.; Kusakin, A.; Bognár, Zs; Sódor, Á.; García-Hernández, A.; Pe na, J. H.; Kuschnig, R.; Moffat, A. F. J.; Rowe, J.; Rucinski, S. M.; Sasselov, D.; Weiss, W. W.
2018-04-01
We present and discuss the pulsational characteristics of the Delta Scuti star 38 Eri from photometric data obtained at two widely spaced epochs, partly from the ground (1998) and partly from space (MOST, 2011). We found 18 frequencies resolving the discrepancy among the previously published frequencies. Some of the frequencies appeared with different relative amplitudes at two epochs, however, we carried out investigation for amplitude variability for only the MOST data. Amplitude variability was found for one of three frequencies that satisfy the necessary frequency criteria for linear-combination or resonant-mode coupling. Checking the criteria of beating and resonant-mode coupling we excluded them as possible reason for amplitude variability. The two recently developed methods of rotational-splitting and sequence-search were applied to find regular spacings based only on frequencies. Doublets or incomplete multiplets with l = 1, 2 and 3 were found in the rotational splitting search. In the sequence search method we identified four sequences. The averaged spacing, probably a combination of the large separation and the rotational frequency, is 1.724 ± 0.092 d-1. Using the spacing and the scaling relation \\bar{ρ }= [0.0394, 0.0554] gcm-3 was derived. The shift of the sequences proved to be the integer multiple of the rotational splitting spacing. Using the precise MOST frequencies and multi-colour photometry in a hybrid way, we identified four modes with l = 1, two modes with l = 2, two modes with l = 3, and two modes as l = 0 radial modes.
Selective food preferences of walleyes of the 1959 year class in Lake Erie
Parsons, John W.
1971-01-01
Stomachs were examined from 1,473 walleyes (Stizostedion vitreum vitreum) of the 1959 year class collected in western Lake Erie from June 1959 to October 1960. In the same period, the relative abundance and lengths of potential forage species were determined from trawl catches. The walleye fed almost entirely on fish. In 1959 the food was dominated first (in June and July) by yellow perch (Perca flavescens) and then, in sequence, by spottail shiners (Notropis hudsonius) and emerald shiners (Notropis atherinoides). In 1960, the walleyes fed mostly on yearling spottail shiners and emerald shiners in the spring and summer but young alewives (Alosa pseudoharengus) became the dominant food in the fall. The length of forage fish increased with the length of walleyes and walleyes of a given length usually ate forage fish within a restricted range of lengths. This size preference was shown by walleyes of the same length in the same and different months. The increased in length of forage fish with length of walleye was not proportionate. Walleyes 2.5 inches long ate forage fish 0.44 times their length whereas walleyes 15.5 inches long ate forage fish only 0.28 times their length. The diet of the walleyes changed according to species and lengths of forage fish available. Since young of several species hatched in different months and grew at different rates, abundance and suitability as forage sometimes changed rapidly.
Directory of Open Access Journals (Sweden)
Korhan Levent Ertürk
2010-03-01
Full Text Available The scholars begin to place their works into the open repositories or open access journals as well as their personal web sites. In the international arena, the open repositories contain a total of 14,000 Turkey-based scholarly contents. The focus of this study is to determine the level of awareness for open access concept of scholars in Hacettepe University. An electronic questionnaire was conducted to scholars. The data were collected through questionnaire from full time academic staff member in Hacettepe University. It was found that 50% of scholars are aware of the open access concept and 92% of the scholars are willing to place their works into the institutional repository of their university. According to questionnaire study result, different types of works such as articles and assertions can be placed in the institutional open repositories in Turkey and their functionality can be increased in a short time. Bilimsel iletişimin en önemli paydaşı olan bilim insanları, bilimsel bilgilerinin görünürlüğünü artırabilmek için bilimsel eserlerini Web sayfalarında ve/veya açık erişim arşivlerinde depolamaya ya da açık erişim dergilerinde yayınlamaya başlamışlardır. Uluslararası açık erişim arşivlerinde yaklaşık 14 bin Türkiye kaynaklı bilimsel içerik bulunmaktadır. Bu çalışma Hacettepe Üniversitesi’ndeki bilim insanlarının açık erişim farkındalığını belirlemek, kurumsal açık arşivlerin etkin kullanımını konusundaki görüşlerini ortaya çıkarmak amacıyla yapılmıştır. Veriler, Hacettepe Üniversitesi’nde tam zamanlı çalışan öğretim üyelerinden elektronik anket yoluyla elde edilmiştir. Bulgulara göre öğretim üyelerinin en azından yarısının (%50 açık erişim farkındalığına sahip olduğu tespit edilmiştir. Farkındalığı olan öğretim üyeleri yüksek bir çoğunlukla (%92 yayınlarının kendi üniversitelerinde yapılandırılabilecek kurumsal açık ar
Sex difference in polychlorinated biphenyl concentrations of burbot Lota lota from Lake Erie
Madenjian, C.P.; Stapanian, M.A.; Rediske, R.R.; O’Keefe, J. P.
2013-01-01
Whole-fish polychlorinated biphenyl (PCB) concentrations were determined for 25 female and 25 male burbot Lota lota from Lake Erie. Bioenergetics modeling was used to investigate whether the sex difference in growth rate resulted in a difference in gross growth efficiency (GGE) between the sexes. For ages 6–13 years, male burbot averaged 28 % greater PCB concentrations than female burbot. The sex difference in PCB concentrations widened for ages 14–17 years, with male burbot having, on average, 71 % greater PCB concentrations than female burbot. Bioenergetics modeling results showed that the faster growth rate exhibited by female burbot did not lead to greater GGE in female individuals of the younger burbot and that the faster growth by female fish led to female GGE being only 2 % greater than male GGE in older burbot. Although our bioenergetics modeling could not explain the observed sex difference in PCB concentrations, we concluded that a sex difference in GGE was the most plausible explanation for the sex difference in PCB concentrations of burbot ages 6–13 years. Not only are male fish likely to be more active than female fish, but the resting metabolic rate of male fish may be greater than that of female fish. We also concluded that the widening of the sex difference in PCB concentrations for the older burbot may be due to many of the older male burbot spending a substantial amount of time in the vicinity of mouths of rivers contaminated with PCBs.
Energy Technology Data Exchange (ETDEWEB)
Nikku, P [ed.
1997-12-01
The aim of the programme is to increase the use of economically profitable and environmentally sound bioenergy by improving the competitiveness of present peat and wood fuels. Research and development projects will also develop new economically competitive biofuels, new equipment and methods for production, handling and utilisation of biofuels. The total funding for 1996 was 27.3 million FIM and the number of projects 63. The number of projects concerning bioenergy use was 10 and biomass conversion 6. Results of the projects carried out in 1996 are presented in this publication. The aim of the bioenergy use is to develop and demonstrate at least 3-4 new equipment or methods for handling and use of biofuels. The equipment and/or methods should provide economically competitive and environmentally sound energy production. The second aim is to demonstrate 2-3 large-scale biofuel end-use technologies. Each of these should have a potential of 0.2- 0.3 million toe/a till the year 2000. The aims have been achieved in the field of fuel handling technologies and small-scale combustion concepts, but large-scale demonstration projects before the year 2000 seems to be a very challenging aim. The aim of the biomass conversion is to produce basic information on biomass conversion, to evaluate the quality of products, their usability, environmental effects of use as well as the total economy of the production. The objective of biomass conversion is to develop 2-3 new methods, which could be demonstrated, for the production and utilisation of liquefied, gasified and other converted biofuels. The production target is 0.2-0.3 million toe/a by the year 2000 at a competitive price level. The studies focused on the development of flash pyrolysis technology for biomass, and on the study of storage stability of imported wood oils and of their suitability for use in oil-fired boilers and diesel power plants
Energy Technology Data Exchange (ETDEWEB)
Alakangas, E. [ed.
1996-12-31
Bioenergy Research Programme is one of the energy technology research programmes of the Technology Development Centre TEKES. The aim of the bioenergy Research Programme is to increase, by using technical research and development, the economically profitable and environmentally sound utilisation of bioenergy, to improve the competitiveness of present peat and wood fuels, and to develop new competitive fuels and equipment related to bioenergy. The funding for 1995 was nearly 52 million FIM and the number of projects 66. The research area of biomass conversion consisted of 8 projects in 1995, and the research area of bioenergy utilization of 14 projects. The results of these projects carried out in 1995 are presented in this publication. The aim of the biomass conversion is to produce more bio-oils and electric power as well as wood processing industry as at power plants than it is possible at present appliances. The conversion research was pointed at refining of the waste liquors of pulping industry and the extracts of them into fuel-oil and liquid engine fuels, on production of wood oil via flash pyrolysis, and on combustion tests. Other conversion studies dealt with production of fuel-grade ethanol. For utilization of agrobiomass in various forms of energy, a system study is introduced where special attention is how to use rapeseed oil unprocessed in heating boilers and diesel engines. The main aim of the research in bioenergy utilization is to create the technological potential for increasing the bioenergy use. The aim is further defined as to get into commercial phase 3-4 new techniques or methods and to start several demonstrations, which will have 0.2-0.3 million toe bioenergy utilization potential
Strok, Natalia Soledad
2013-01-01
Se busca dar cuenta de la filiación filosófica que tres historiadores de la filosofía (de los siglos XVIII y XIX) otorgan a Juan Escoto Eriúgena (siglo IX). El iluminista J. Brucker, el kantiano W. Tennemann y el romántico T. Rixner son representantes del periodo de gestación de la historia de la filosofía como disciplina, y sus obras son fuentes para destacados filósofos, como por ejemplo Hegel. Se muestra hasta qué punto las líneas interpretativas que iniciaron estos autores se continúan ha...
Fish community responses to submerged aquatic vegetation in Maumee Bay, Western Lake Erie
Miller, Jacob; Kocovsky, Patrick; Wiegmann, Daniel; Miner, Jeffery G.
2018-01-01
Submerged aquatic vegetation (SAV) in clearwater systems simultaneously provides habitat for invertebrate prey and acts as refugia for small fishes. Many fishes in Lake Erie rely on shallow, heavily vegetated bays as spawning grounds and the loss or absence of which is known to reduce recruitment in other systems. The Maumee River and Maumee Bay, which once had abundant macrophyte beds, have experienced a decline of SAV and an increase in suspended solids (turbidity) over the last century due to numerous causes. To compare fish communities in open‐water (turbid) and in SAV (clearer water) habitats in this region, which is designated by the U.S. Environmental Protection Agency as an Area of Concern, and to indicate community changes that could occur with expansion of SAV habitat, we sampled a 300‐ha sector of northern Maumee Bay that contained both habitats. Using towed neuston nets through patches of each habitat, we determined that areas of SAV contained more species and a different species complex (based on the Jaccard index and the wetland fish index), than did the open‐water habitat (averaging 8.6 versus 5 species per net trawl). The SAV habitat was dominated by centrarchids, namely Largemouth Bass Micropterus salmoides, Bluegill Lepomis macrochirus, and Black Crappie Pomoxis nigromaculatus. Open‐water habitat was dominated by Spottail Shiner Notropis hudsonius, Gizzard Shad Dorosoma cepedianum, and White Perch Morone americana, an invasive species. These results indicate that restoration efforts aimed at decreasing turbidity and increasing the distribution of SAV could cause substantive shifts in the fish community and address important metrics for assessing the beneficial use impairments in this Area of Concern.
Tabibnejad, Mahsa; Alikhani, Mohammad Yousef; Arjomandzadegan, Mohammad; Hashemi, Seyed Hamid; Naseri, Zahra
2016-04-01
Brucellosis is a zoonosis disease which is widespread across the world. The aim of the present study is the evaluation of culture-negative blood samples. A total of 100 patients with suspected brucellosis were included in this experimental study and given positive serological tests. Diagnosis was performed on patients with clinical symptoms of the disease, followed by the detection of a titer that was equal to or more than 1:160 (in endemic areas) by the standard tube agglutination method. Blood samples were cultured by a BACTEC 9050 system, and subsequently by Brucella agar. At the same time, DNA from all blood samples was extracted by Qiagen Kit Company (Qia Amp Mini Kit). A molecular assay of blood samples was carried out by detection of eryD transcriptase and bcsp 31 genes in specific double PCR reactions. The specificity of the primers was evaluated by DNA from pure and approved Brucella colonies found in the blood samples, by DNA from other bacteria, and by ordinary PCR. DNA extraction from the pure colonies was carried out by both Qiagen Kit and Chelex 100 methods; the two were compared. 39 cases (39%) had positive results when tested by the BACTEC system, and 61 cases (61%) became negative. 23 culture-positive blood samples were randomly selected for PCR reactions; all showed 491 bp for the eryD gene and 223 bp for the bcsp 31 gene. Interestingly, out of 14 culture-negative blood samples, 13 cases showed positive bonds in PCR. The specificity of the PCR method was equal to 100%. DNA extraction from pure cultures was done by both Chelex 100 and Qiagen Kit; these showed the same results for all samples. The results prove that the presented double PCR method could be used to detect positive cases from culture-negative blood samples. The Chelex 100 method is simpler and safer than the use of Qiagen Kit for DNA extraction.
Francy, Donna S.; Graham, Jennifer L.; Stelzer, Erin A.; Ecker, Christopher D.; Brady, Amie M. G.; Pam Struffolino,; Loftin, Keith A.
2015-11-06
Harmful cyanobacterial “algal” blooms (cyanoHABs) and associated toxins, such as microcystin, are a major water-quality issue for Lake Erie and inland lakes in Ohio. Predicting when and where a bloom may occur is important to protect the public that uses and consumes a water resource; however, predictions are complicated and likely site specific because of the many factors affecting toxin production. Monitoring for a variety of environmental and water-quality factors, for concentrations of cyanobacteria by molecular methods, and for algal pigments such as chlorophyll and phycocyanin by using optical sensors may provide data that can be used to predict the occurrence of cyanoHABs.
Profiles of Wind and Turbulence in the Coastal Atmospheric Boundary Layer of Lake Erie
Wang, H
2014-06-16
Prediction of wind resource in coastal zones is difficult due to the complexity of flow in the coastal atmospheric boundary layer (CABL). A three week campaign was conducted over Lake Erie in May 2013 to investigate wind characteristics and improve model parameterizations in the CABL. Vertical profiles of wind speed up to 200 m were measured onshore and offshore by lidar wind profilers, and horizontal gradients of wind speed by a 3-D scanning lidar. Turbulence data were collected from sonic anemometers deployed onshore and offshore. Numerical simulations were conducted with the Weather Research Forecasting (WRF) model with 2 nested domains down to a resolution of 1-km over the lake. Initial data analyses presented in this paper investigate complex flow patterns across the coast. Acceleration was observed up to 200 m above the surface for flow coming from the land to the water. However, by 7 km off the coast the wind field had not yet reached equilibrium with the new surface (water) conditions. The surface turbulence parameters over the water derived from the sonic data could not predict wind profiles observed by the ZephlR lidar located offshore. Horizontal wind speed gradients near the coast show the influence of atmospheric stability on flow dynamics. Wind profiles retrieved from the 3-D scanning lidar show evidence of nocturnal low level jets (LLJs). The WRF model was able to capture the occurrence of LLJ events, but its performance varied in predicting their intensity, duration, and the location of the jet core.
Directory of Open Access Journals (Sweden)
Sevgi Daştan
2012-02-01
Full Text Available Özet. Parazit veya simbiyoz olarak bitki üzerinde yaşayan böcek, nematod, akar, bakteri ya da mantarların neden olduğu tahriş ve beslenme fizyolojisinden doğan olumsuzluklara karşı bitkilerin savunma tepkimesi olarak oluşturdukları anormal büyüme şekli gal olarak tanımlanmaktadır. En kompleks, en iyi organize olmuş gallerin birçoğu, gal arıları (Hymenoptera: Cynipidae tarafından meydana getirilirler. En çok tanınan cynipid galleri gül ve meşelerde yer almaktadır. Bu çalışmada; Sivas çevresinde yetişen, bazı meşe ve gül türlerinin, gal oluşturmayan ve yoğun olarak sürgün ve meyva gali oluşturan bireylerinden yaprak, meyva ve sürgün gal örnekleri toplanmıştır. Yaprak, meyva ve gallerdeki total protein miktarları, Bradford Mikro Assay, Biüret, Lowry yöntemleri ve ayrıca Ultraviyole (UV spektrofotometresi kullanılarak 280 nm de ölçümleri yapılmak suretiyle hesaplanmıştır. Bu şekilde elde edilen veriler üzerinden hem galli ve galsiz bireyler arasındaki protein miktarları açısından farklılıklar hem de kullanılan dört farklı yöntem arasındaki farklılıklar karşılaştırılmıştır. Yapılan deneyler sonucunda; galli bireylerdeki total protein miktarının galsiz bireylere göre anlamlı şekilde fazla olduğu saptanmıştır. Yine meşelerdeki protein içeriğinin güllerdeki protein içeriğine göre yaklaşık 2 katı değerlerde olduğu tespit edilmiştir. Aylara göre protein içeriğindeki farklılıklara baktığımızda ise, meşeler için eylül ayında, kuşburnu bitkisi için ise ağustos ayında daha fazla protein içeriği tespit edilmiştir. Anahtar Kelimeler: Gal, Rosa sp., Quercus sp., Cynipidae, Total protein içeriği Abstract. Plant galls are an abnormal growth pattern that plants develop as a defense reaction to irritations and negative nutritional physiology caused by insects, nematodes, mites, bacteria and fungi living in a parasitic or symbiotic
International Nuclear Information System (INIS)
Hiriart, V.P.; Greenberg, B.M.; Guildford, S.J.; Smith, R.E.H.
2002-01-01
The impact of natural solar ultraviolet radiation (UVR), particularly UVB (297-320 nm), on phytoplankton primary production in Lake Erie was investigated during the spring and summer of 1997. Radiocarbon incorporation and size-selective filtration was used to trace total production and its distribution among particulate and dissolved pools. On average, 1-h exposures produced half the UVB-dependent inhibition of total production realized in 8-h exposures, indicating rapid kinetics of photoinhibition. Cumulative UVB-dependent photoinhibition averaged 36% in 8-h simulated surface exposures. The efficiency of photoinhibition was greater for N-deficient than N-replete communities, but was not related to phytoplankton light history, P limitation, or the dominant genera. The proportion of recently fixed carbon occurring in the dissolved pool after 8-h exposures was significantly greater in higher-UVB treatments, whereas the share in picoplankton (<2 μm) was significantly lower. Significant UVB-dependent inhibition of total production was limited on average to relatively severe exposures, but the rapid kinetics of inhibition and the apparent effects on the allocation of carbon suggest it may be important to the lake's food web. Differences in optical properties and thermal stratification patterns suggested that the relatively turbid west basin was potentially more susceptible to UVR photoinhibition than the more transparent east or central basins. (author)
Soong, D. T.; Santacruz, S.; Jones, L.; Garcia, T.; Kočovský, P. M.; Embke, H.
2017-12-01
Grass Carp Ctenopharyngodon idella (Cyprinidae) is an invasive fish species that spawns in rivers during high-flow events. In their native range, it is believed eggs must hatch within the riverine environment in order to eventually result in production of adult fish. The lower Sandusky River is approximately 26 km long extending from its confluence with Sandusky Bay upstream to the Ballville Dam, which is impassible for Grass Carp. Grass Carp are known to have spawned in the Sandusky River, a tributary to Lake Erie, in 2011, 2013, 2015, and 2017. This study characterizes the thermal and hydraulic conditions under which these eggs could hatch in the lower Sandusky River, a relatively short river reach for egg hatching. Grass Carp eggs collected in 2015 were previously analyzed for hatching locations using a one-dimensional steady-state HEC-RAS hydraulic model. In this study we refine estimates of hatching locations by incorporating the influence of fluctuating water levels downstream due to seiches in Lake Erie and overland and tributary inflows using an unsteady 1D/2D HEC-RAS hydraulic model. Additionally, conditions conducive to successful hatching, which occurs when eggs reach the hatching stage within the river, were analyzed from nine high-flow events between 2011 and 2015. Simulated hydraulic and water temperature data were used as inputs to the Fluvial Egg Drift Simulator (FluEgg) model, which was used to analyze the transport and dispersal of Grass carp eggs until hatching. We will describe the differences in steady- and unsteady-state hydraulic modeling in predicting hatching locations of Grass Carp eggs for the 2015 spawning events. Results will also include hydraulic and temperature variables that contribute to the successful/unsuccessful in-river hatching for the nine flow events simulated.
Energy Technology Data Exchange (ETDEWEB)
Al-Aasm, I.S.; Clarke, J.D.; Fryer, B.J. [Windsor Univ., ON (Canada). Dept. of Earth Sciences
1998-02-01
Dreissena polymorpha is an exotic freshwater bivalve species which was introduced into the Great Lakes system in the fall of 1985 through the release of ballast water from European freighters. Utilizing individual growth rings of the shells, the stable isotope distribution ({delta}{sup 18}O and {delta}{sup 13}C) was determined for the life history of selected samples which were collected from the western basin of Lake Erie. These bivalves deposit their shell in near equilibrium with the ambient water and thus reflect any annual variation of the system in the isotopic records held within their shells. Observed values for {delta}{sup 18}O range from -6.64 to -9.46 permille with an average value of -7.69 permille PDB, while carbon values ranged from -0.80 to -4.67 permille with an average value of -1.76 permille PDB. Dreissena polymorpha shells incorporate metals into their shells during growth. Individual shell growth increments were analyzed for Pb, Fe, Mg, Mn, Cd, Cu, and V concentrations. The shells show increased uptake of certain metals during periods of isotopic enrichment which correspond with warmer water temperatures. Since metals are incorporated into the shells, the organism may be useful as a biomonitor of metal pollution within aquatic environments. (orig.)
Sapere–menetelmän soveltuvuus toimintaterapian terapiamenetelmänä
Leino, Kaisa
2012-01-01
Ravitsemuksen ja ruokailemisen pulmat ovat kasvava haaste lasten keskuudessa. Ruokaileminen on yksi ihmisen tärkeimmistä päivittäisistä toiminnoista ja se on myös lapsen kasvun ja kehityksen ehdoton edellytys. Sapere–menetelmä on lasten ruoka- ja ravitsemuskasvatusmenetelmä, jonka avulla lapsi oppii uusia asioita ruoasta ja ruokailemisesta kaikkien aistikanaviensa välityksellä. Sapere–menetelmän avulla lapsi oppii toimimaan tarkoituksenmukaisemmin arjen askareissa. Opinnäytetyön tarkoituk...
Kirjanpito-ohjelmistojen soveltuvuus ja kartoitus tilitoimistotyöhön
Kesseli, Dmitri
2013-01-01
Smart Office Oy on vuonna 1995 perustettu Helsingissä toimiva pienikokoinen tilitoimisto. 2000-luvun lopussa yrityksen toimitusjohtaja havaitsi kasvavan tarpeen modernisoida yrityksensä kirjanpitoa. Päätös osoittautui hankalaksi, minkä vuoksi sitä lykättiin myöhemmäksi. Yrityksen kasvutavoitteet sekä kehittyvä markkinatilanne kuitenkin pakottivat muutostarvetta. Lopuksi vuonna 2012 tehtävän päätti ottaa vastaan työharjoitteluun palkattu taloushallinnon opiskelija. Tämän opinnäytetyön tark...
A DFT study of hydrogen adsorption on Be, Mg and Ca frameworks in erionite zeolite
Energy Technology Data Exchange (ETDEWEB)
Fellah, Mehmet Ferdi, E-mail: mferdi.fellah@btu.edu.tr
2017-02-01
Highlights: • Mg-ERI and Ca-ERI clusters have much lower chemical potential and hardness. • Adsorption enthalpies for Mg- and Ca-ERI are importantly greater than the liquefaction enthalpy of hydrogen. • Mg-ERI and Ca-ERI clusters have much HOMO-LUMO gap indicating higher reactivity. • Ca- and Mg-ERI are potential cryoadsorbent materials for hydrogen storage. - Abstract: The molecular hydrogen adsorption was investigated on additional frameworks with earth alkaline metal atoms (Be, Mg and Ca) in 24T ERI zeolite cluster model by means of Density Functional Theory study. HOMO and LUMO energy values, chemical potential, chemical hardness, electronegativity, adsorption energy and adsorption enthalpy values have been calculated in this study. Mg-ERI and Ca-ERI clusters have much lower chemical potentials with much lower adsorption energy values when compared to the value of Be-ERI cluster. Additionally, they are softer than Be-ERI cluster with respect to their lower chemical hardness values. Hydrogen adsorption enthalpy values were computed as −3.6 and −3.9 kJ/mol on Mg-ERI and Ca-ERI clusters, respectively. These adsorption enthalpy values are significantly larger than the enthalpy value of liquefaction for hydrogen molecule. This consequently specifies that Mg-ERI and Ca-ERI zeolite structures which have higher chemical reactivity appear to be a promising candidate cryoadsorbent for hydrogen storage.
Changes in the deep-water benthos of eastern Lake Erie between 1979 and 1993
Energy Technology Data Exchange (ETDEWEB)
Dermott, R.; Kerec, D. [Fisheries and Oceans, Burlington, Ontario (Canada)
1995-06-01
In order to examine changes of the benthic community and benthic biomass as a result of mussel colonization, a survey of the deep-water benthic fauna in eastern Lake Erie was repeated in 1993 using the same sites and methods as in a 1979 survey. During 1979, the community beyond 30 m was dominated by oligochaete worms and the burrowing amphipod Diporeia, which represented 50 and 40% of the total benthic biomass respectively. By 1993, quagga mussels (Dreissena bugensis) formed over 90% of the benthic biomass. Mussels were present at all 13 sites. Densities of individuals >2 mm in length averaged 3,241 mussels m{sup -2}. Of these mussels, 97% were quagga mussels. Total density of all sizes retained on a 180 {mu}m sieve averaged 34,800 mussels m{sup -2} but total biomass decreased from 1.58 to 0.98 g m{sup -2}. The density of the amphipod Diporeia was reduced from 1,844 in 1979 to 218 m{sup -2} in 1993. While present at all sites during 1979, Diporeia remained common only at two sites and were absent at 8 of the 13 sites in 1993. The native fingernail clams, Pisidium spp., were reduced from 327 to 82 m{sup -2}. No significant reduction occurred in the worm and chironomid populations, however the dry biomass of the chironomids was reduced from 0.07 to 0.0008 g m{sup -2}. These reductions may be due to competition with the mussels for freshly settling algae. The meiofauna, which included small nematodes, ostracods, and harpacticoids retained on a 180 {mu}m sieve, all increased in density. Perhaps they benefited from an increase in the detritus deposited as pseudofeces around the mussels.
Martínez, J.; Rey, J.; Gutiérrez, L. M.; Novo, A.; Ortiz, A. J.; Alejo, M.; Galdón, J. M.
2015-12-01
The Giribaile archaeological site is one of the most important Iberian enclaves of the Alto Guadalquivir (Southern Spain). However, to date, only minimal excavation work has been performed at the site. Evaluation requires a preliminary, non-destructive general analysis to determine high-interest areas. This stage required a geophysical survey. Specifically, a 100 m2 grid was selected, where an initial campaign of nine electrical resistivity imaging (ERI) profiles was performed, where each profile was 111 m in length; these profiles were previously located using a detailed topographical survey. A total of 112 electrodes were used for each profile, spaced at 1 m apart with a Wenner-Schlumberger configuration. Secondly, 201 GPR profiles were created using a 500 MHz antenna. The 100 m long profiles were spaced 0.5 m apart and parallel to one another. The present research analyses the efficiency of each of these geophysical tools in supporting archaeological research. Using these methodologies, the position, morphology, and depth of different buried structures can be determined. 3D interpretation of the geophysical survey in 100 × 100 m grid allowed to differentiate structures square and rectangular, interesting buildings in a semicircle (interpreted as ovens) plus delineate different streets. From the geophysical survey follows the Carthaginian presence inside this ancient Iberian enclave.
Elemental contaminants in livers of mute swans on lakes Erie and St. Clair.
Schummer, Michael L; Petrie, Scott A; Badzinski, Shannon S; Deming, Misty; Chen, Yu-Wei; Belzile, Nelson
2011-11-01
Contaminant inputs to the lower Great Lakes (LGL) have decreased since the 1960s and 1970s, but elemental contaminants continue to enter the LGL watershed at levels that are potentially deleterious to migratory waterfowl. Mute swans (Cygnus olor) using the LGL primarily eat plants, are essentially nonmigratory, forage exclusively in aquatic systems, and have increased substantially in number in the last few decades. Therefore, mute swans are an ideal sentinel species for monitoring elemental contaminants available to herbivorous and omnivorous waterfowl that use the LGL. We investigated hepatic concentrations, seasonal dynamics, and correlations of elements in mute swans (n = 50) collected at Long Point, Lake Erie, and Lake St. Clair from 2001 to 2004. Elements detected in liver at levels potentially harmful to waterfowl were copper (Cu) [range 60.3 to 6063.0 μg g(-1) dry weight (dw)] and selenium (SE; range 1.6 to 37.3 μg g(-1) dw). Decreases in aluminum, Se, and mercury (Hg) concentrations were detected from spring (nesting) through winter (nonbreeding). Elemental contaminants may be more available to waterfowl during spring than fall and winter, but study of seasonal availability of elements within LGL aquatic systems is necessary. From April to June, 68% of mute swans had Se levels >10 μg g(-1), whereas only 18% of swans contained these elevated levels of Se from July to March. An increase in the number of mute swans at the LGL despite elevated levels of Cu and Se suggests that these burdens do not substantially limit their reproduction or survival. Se was correlated with Cu (r = 0.85, p < 0.01) and Hg (r = 0.65, p < 0.01), which might indicate interaction between these elements. Some element interactions decrease the toxicity of both elements involved in the interaction. We recommend continued research of elemental contaminant concentrations, including detailed analyses of biological pathways and element forms (e.g., methylmercury) in LGL waterfowl to help
Research on use of bioenergy; Bioenergian kaeyttoe - tutkimusalueen katsaus
Energy Technology Data Exchange (ETDEWEB)
Helynen, S.
1995-12-31
Drying of biomass with hot gases and steam has been modelled in fixed and solid beds based on experimental results by VTT Energy. The pilot plant of bed mixing dryer at Kuusamo district heating power plant has tested successfully with peat, bark and saw dust by IVO. The dryer increases the overall thermal efficiency of the plant 10 - 15 %. An effective and dust free receiving station was designed for wood and peat fired power plants. Surplus time for unloading and sampling was decreased and fine dust control was improved. Development work of a system for receiving, crushing and screening recycled fuel material was also launched. Suppression control of fires and explosions in storages were studied by means of experimental tests with international partners. Two concepts on pressurized piston feeder, needed for pressurized combustion and gasification concepts, have been designed by Foster Wheeler and IVO. Concepts were tested with different types of biomass. Feeders are ready for full-scale demonstration plants. Competitiveness of new small scale power plant concepts were compared to a conventional steam boiler and turbine concept. New concepts include atmospheric gasification with diesel engines, combustion of pulverized wood in a gas turbine and diesel engine using flash pyrolysis oil. New concepts have technical uncertaintities, but their possibilities to become competitive compared to conventional technology are promising
Research on use of bioenergy; Bioenergian kaeyttoe - tutkimusalueen katsaus
Energy Technology Data Exchange (ETDEWEB)
Helynen, S
1996-12-31
Drying of biomass with hot gases and steam has been modelled in fixed and solid beds based on experimental results by VTT Energy. The pilot plant of bed mixing dryer at Kuusamo district heating power plant has tested successfully with peat, bark and saw dust by IVO. The dryer increases the overall thermal efficiency of the plant 10 - 15 %. An effective and dust free receiving station was designed for wood and peat fired power plants. Surplus time for unloading and sampling was decreased and fine dust control was improved. Development work of a system for receiving, crushing and screening recycled fuel material was also launched. Suppression control of fires and explosions in storages were studied by means of experimental tests with international partners. Two concepts on pressurized piston feeder, needed for pressurized combustion and gasification concepts, have been designed by Foster Wheeler and IVO. Concepts were tested with different types of biomass. Feeders are ready for full-scale demonstration plants. Competitiveness of new small scale power plant concepts were compared to a conventional steam boiler and turbine concept. New concepts include atmospheric gasification with diesel engines, combustion of pulverized wood in a gas turbine and diesel engine using flash pyrolysis oil. New concepts have technical uncertaintities, but their possibilities to become competitive compared to conventional technology are promising
Research on use of bioenergy; Bioenergian kaeyttoe. Tutkimusalueen katsaus
Energy Technology Data Exchange (ETDEWEB)
Helynen, S [VTT Energy, Jyvaeskylae (Finland)
1997-12-01
The aims of Bioenergy Research Programme have been achieved in the field of fuel handling technologies and small scale combustion concepts but 3 - 4 large scale demonstration projects (0,2 - 0,3 million toe/year per utilization concept) before the year 2000 seems to be a very challenging aim. Ignition and explosion properties of wood and agro biomasses and biomass-coal mixtures are determined in atmospheric and pressurized conditions by VTT Energy with Spanish, French, Dutch and German partners in JOULE-project. Explosion suppression systems have also been tested successfully in pressurized conditions up to 10 bar with British partners. Feasibility of reed canary grass for chemical pulp and fuel is evaluated in a large FAIR project. VTT Energy is responsible for pelletising of fuel fraction, combustion of pellets, gasification and combustion of pulverized fuel fraction. Development of a system for receiving, crushing and screening recycled fuel material was concentrated on a heavy-duty two-rotor crusher and a crushing screen by BMH Wood Technology. Primary and secondary crushing are needed for optimum particle size distribution. The system will be demonstrated in Sweden. Dry gas-cleaning methods for gasification-diesel power plants and for other atmospheric-pressure applications of biomass gasification are developed by VTT Energy. Catalytic gas-cleaning methods are tested for engine applications in PDU-scale. Removal of trace metals, chlorine and other harmful contaminants of CFB gasification is studied with regard to co-combustion of the product gas in PC boilers
Williams, Mark R.; Livingston, Stanley J.; Penn, Chad J.; Smith, Douglas R.; King, Kevin W.; Huang, Chi-hua
2018-04-01
Understanding the processes controlling nutrient delivery in headwater agricultural watersheds is essential for predicting and mitigating eutrophication and harmful algal blooms in receiving surface waters. The objective of this study was to elucidate nutrient transport pathways and examine key components driving nutrient delivery processes during storm events in four nested agricultural watersheds (298-19,341 ha) in the western Lake Erie basin with poorly drained soils and an extensive artificial drainage network typical of the Midwestern U.S. Concentration-discharge hysteresis patterns of nitrate-nitrogen (NO3-N), dissolved reactive phosphorus (DRP), and particulate phosphorus (PP) occurring during 47 storm events over a 6 year period (2004-2009) were evaluated. An assessment of the factors producing nutrient hysteresis was completed following a factor analysis on a suite of measured environmental variables representing the fluvial and wider watershed conditions prior to, and during the monitored storm events. Results showed the artificial drainage network (i.e., surface tile inlets and subsurface tile drains) in these watersheds was the primary flow pathway for nutrient delivery to streams, but nutrient behavior and export during storm events was regulated by the flow paths to and the intensity of the drainage network, the availability of nutrients, and the relative contributions of upland and in-stream nutrient sources. Potential sources and flow pathways for transport varied among NO3-N, PP, and DRP with results underscoring the challenge of mitigating nutrient loss in these watersheds. Conservation practices addressing both nutrient management and hydrologic connectivity will likely be required to decrease nutrient loss in artificially drained landscapes.
OpenOffice.org -toimisto-ohjelmiston soveltuvuus Sastamalan Tukipalvelu Oy:lle : selvitys
Ojanen, Olli-Veikko
2009-01-01
Tässä opinnäytetyössä selvitettiin OpenOffice.org toimisto-ohjelmiston soveltuvuutta Sastamalan Tukipalvelu Oy:lle, joka huolehtii osakkaittensa tieto-, talous- ja henkilöstöhallinnon palveluista. Sastamalan Tukipalvelu Oy:n osakkaina ovat Kiikoisten, Lavian ja Punkalaitumen kunnat, Sastamalan kaupunki, Sastamalan perusturvakuntayhtymä sekä Sastamalan koulutuskuntayhtymä. Selvityksen tavoitteena oli tuoda esille OpenOffice.org -toimisto-ohjelmistoon siirtymisen hyötyjä, joi...
Use of historical and geospatial data to guide the restoration of a Lake Erie coastal marsh
Kowalski, Kurt P.; Wilcox, Douglas A.
1999-01-01
Historical and geospatial data were used to identify the relationships between water levels, wetland vegetation, littoral drift of sediments, and the condition of a protective barrier beach at Metzger Marsh, a coastal wetland in western Lake Erie, to enhance and guide a joint federal and state wetland restoration project. Eleven sets of large-scale aerial photographs dating from 1940 through 1994 were interpreted to delineate major vegetation types and boundaries of the barrier beach. A geographic information system (GIS) was then used to digitize the data and calculate the vegetated area and length of barrier beach. Supplemented by paleoecological and sedimentological analyses, aerial photographic interpretation revealed that Metzger Marsh was once a drowned-river-mouth wetland dominated by sedges and protected by a sand barrier beach. Extremely high water levels, storm events, and reduction of sediments in the littoral drift contributed to the complete destruction of the barrier beach in 1973 and prevented its recovery. The extent of wetland vegetation, correlated to water levels and condition of the barrier beach, decreased from a high of 108 ha in 1940 to a low of 33 ha in 1994. The lack of an adequate sediment supply and low probability of a period of extremely low lake levels in the near future made natural reestablishment of the barrier beach and wetland vegetation unlikely. Therefore, the federal and state managers chose to construct a dike to replace the protective barrier beach. Recommendations stemming from this historical analysis, however, resulted in the incorporation of a water-control structure in the dike that will retain a hydrologic connection between wetland and lake. Management of the wetland will seek to mimic processes natural to the wetland type identified by this analysis.
Yen, H.; White, M. J.; Arnold, J. G.; Keitzer, S. C.; Johnson, M. V. V.; Atwood, J. D.; Daggupati, P.; Herbert, M. E.; Sowa, S. P.; Ludsin, S.; Robertson, D. M.; Srinivasan, R.; Rewa, C. A.
2016-12-01
By the substantial improvement of computer technology, large-scale watershed modeling has become practically feasible in conducting detailed investigations of hydrologic, sediment, and nutrient processes. In the Western Lake Erie Basin (WLEB), water quality issues caused by anthropogenic activities are not just interesting research subjects but, have implications related to human health and welfare, as well as ecological integrity, resistance, and resilience. In this study, the Soil and Water Assessment Tool (SWAT) and the finest resolution stream network, NHDPlus, were implemented on the WLEB to examine the interactions between achievable conservation scenarios with corresponding additional projected costs. During the calibration/validation processes, both hard (temporal) and soft (non-temporal) data were used to ensure the modeling outputs are coherent with actual watershed behavior. The results showed that widespread adoption of conservation practices intended to provide erosion control could deliver average reductions of sediment and nutrients without additional nutrient management changes. On the other hand, responses of nitrate (NO3) and dissolved inorganic phosphorus (DIP) dynamics may be different than responses of total nitrogen and total phosphorus dynamics under the same conservation practice. Model results also implied that fewer financial resources are required to achieve conservation goals if the goal is to achieve reductions in targeted watershed outputs (ex. NO3 or DIP) rather than aggregated outputs (ex. total nitrogen or total phosphorus). In addition, it was found that the model's capacity to simulate seasonal effects and responses to changing conservation adoption on a seasonal basis could provide a useful index to help alleviate additional cost through temporal targeting of conservation practices. Scientists, engineers, and stakeholders can take advantage of the work performed in this study as essential information while conducting policy
Yen, Haw; White, Michael J.; Arnold, Jeffrey G.; Keitzer, S. Conor; Johnson, Mari-Vaughn V; Atwood, Jay D.; Daggupati, Prasad; Herbert, Matthew E.; Sowa, Scott P.; Ludsin, Stuart A.; Robertson, Dale M.; Srinivasan, Raghavan; Rewa, Charles A.
2016-01-01
Complex watershed simulation models are powerful tools that can help scientists and policy-makers address challenging topics, such as land use management and water security. In the Western Lake Erie Basin (WLEB), complex hydrological models have been applied at various scales to help describe relationships between land use and water, nutrient, and sediment dynamics. This manuscript evaluated the capacity of the current Soil and Water Assessment Tool (SWAT2012) to predict hydrological and water quality processes within WLEB at the finest resolution watershed boundary unit (NHDPlus) along with the current conditions and conservation scenarios. The process based SWAT model was capable of the fine-scale computation and complex routing used in this project, as indicated by measured data at five gaging stations. The level of detail required for fine-scale spatial simulation made the use of both hard and soft data necessary in model calibration, alongside other model adaptations. Limitations to the model's predictive capacity were due to a paucity of data in the region at the NHDPlus scale rather than due to SWAT functionality. Results of treatment scenarios demonstrate variable effects of structural practices and nutrient management on sediment and nutrient loss dynamics. Targeting treatment to acres with critical outstanding conservation needs provides the largest return on investment in terms of nutrient loss reduction per dollar spent, relative to treating acres with lower inherent nutrient loss vulnerabilities. Importantly, this research raises considerations about use of models to guide land management decisions at very fine spatial scales. Decision makers using these results should be aware of data limitations that hinder fine-scale model interpretation.
Yen, Haw; White, Michael J; Arnold, Jeffrey G; Keitzer, S Conor; Johnson, Mari-Vaughn V; Atwood, Jay D; Daggupati, Prasad; Herbert, Matthew E; Sowa, Scott P; Ludsin, Stuart A; Robertson, Dale M; Srinivasan, Raghavan; Rewa, Charles A
2016-11-01
Complex watershed simulation models are powerful tools that can help scientists and policy-makers address challenging topics, such as land use management and water security. In the Western Lake Erie Basin (WLEB), complex hydrological models have been applied at various scales to help describe relationships between land use and water, nutrient, and sediment dynamics. This manuscript evaluated the capacity of the current Soil and Water Assessment Tool (SWAT) to predict hydrological and water quality processes within WLEB at the finest resolution watershed boundary unit (NHDPlus) along with the current conditions and conservation scenarios. The process based SWAT model was capable of the fine-scale computation and complex routing used in this project, as indicated by measured data at five gaging stations. The level of detail required for fine-scale spatial simulation made the use of both hard and soft data necessary in model calibration, alongside other model adaptations. Limitations to the model's predictive capacity were due to a paucity of data in the region at the NHDPlus scale rather than due to SWAT functionality. Results of treatment scenarios demonstrate variable effects of structural practices and nutrient management on sediment and nutrient loss dynamics. Targeting treatment to acres with critical outstanding conservation needs provides the largest return on investment in terms of nutrient loss reduction per dollar spent, relative to treating acres with lower inherent nutrient loss vulnerabilities. Importantly, this research raises considerations about use of models to guide land management decisions at very fine spatial scales. Decision makers using these results should be aware of data limitations that hinder fine-scale model interpretation. Copyright © 2016 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
NONE
2005-10-15
Mercury is a persistent, toxic substance that poses a serious threat to the environment and human health. Mercury compounds can be carried hundreds of kilometers once airborne and inhaling mercury vapours or ingesting mercury can cause serious injury or death. In Canada, mercury is regularly found in thousands of products such as fluorescent lamps, thermostats, fever thermometers and button batteries, as well as a variety of industrial applications. This report discussed a project that was undertaken by the Recycling Council of Ontario (RCO) that targeted schools, within the Grand Erie District School Board (GEDSB), to pilot a program over a period of 3 months to track, collect and recycle sufficient number of fluorescent tubes. The purpose was to successfully divert 2200 mgs of mercury that may otherwise be destined for landfill. The primary objective of the pilot project was to establish an operating system to collect and recycle fluorescent tube lighting and develop recycling guidelines for the GEDSB that would be transferable to other school districts. The report discussed why fluorescent lamp recycling was needed and outlined the project partners. One recycling partner's recycling process, Fluorescent Lamp Recyclers (FLR) was described. The report also discussed regulations affecting the handling and disposal of fluorescent lamps in Ontario. GEDSB's, RCO's and FLR's responsibilities in the project were outlined. The methodology and florescent lamp collection process were described. The report also presented the collection schedule and results. It was concluded that with very little effort, significant amounts of fluorescent lamps could be diverted, preventing mercury from entering landfills. refs., tabs., figs., appendices.
Panda, N; Bissoyi, A; Pramanik, K; Biswas, A
2014-01-01
Stimulating stem cell differentiation without growth factor supplement offers a potent and cost-effective scaffold for tissue regeneration. We hypothesise that surface precipitation of nano-hydroxyapatite (nHAp) over blends of non-mulberry silk fibroin with better hydrophilicity and RGD amino acid sequences can direct the stem cell towards osteogenesis. This report focuses on the fabrication of a blended eri-tasar silk fibroin nanofibrous scaffold (ET) followed by nHAp deposition by a surface precipitation (alternate soaking in calcium and phosphate solution) method. Morphology, hydrophilicity, composition, and the thermal and mechanical properties of ET/nHAp were examined by field emission scanning electron microscopy, TEM, FT-IR, X-ray diffraction, TGA and contact angle measurement and compared with ET. The composite scaffold demonstrated improved thermal stability and surface hydrophilicity with an increase in stiffness and elastic modulus (778 ± 2.4 N/m and 13.1 ± 0.36 MPa) as compared to ET (160.6 ± 1.34 N/m and 8.3 ± 0.4 MPa). Mineralisation studies revealed an enhanced and more uniform surface deposition of HAp-like crystals, while significant differences in cellular viability and attachment were observed through 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay and confocal microscopy study. The cell viability and expression of adhesion molecules (CD 44 and CD 29) are found to be optimum for subsequent stages of growth proliferation and differentiation. The rates of proliferation have been observed to decrease owing to the transition of MSC from a state of proliferation to a state of differentiation. The confirmation of improved osteogenic differentiation was finally verified through the alkaline phosphatase assay, pattern of gene expression related to osteogenic differentiation and morphological observations of differentiated cord blood human mesenchymal stem cells under fluorescence microscope. The results
Duraipandiyan, V; Al-Dhabi, N A; Balachandran, C; Raj, M Karunai; Arasu, M Valan; Ignacimuthu, S
2014-11-01
Streptomyces sp. isolate ERI-26 was obtained from the Nilgiris forest soil of Western Ghats, Tamil Nadu, India. Novel anthraquinone compound was isolated from the active fraction 5; it was identified by spectroscopical data using UV, IR, NMR and MASS. The isolated compound 1,5,7-trihydroxy-3-hydroxy methyl anthraquinone was tested against bacteria and fungi at minimum inhibitory concentration level. The compound showed significant antimicrobial activity against bacteria, Staphylococcus aureus at 125 μg/ml, Staphylococcus epidermidis at 62.5 μg/m, Bacillus subtilis at 31.25 μg/ml, fungi; Epidermophyton floccosum at 62.5 μg/ml, Aspergillus niger at 31.25 μg/ml, Aspergiller flavus at 31.25 μg/ml, Trichophyton rubrum at 62.5 μg/ml and Botrytis cinerea at 62.5 μg/ml. The isolated compound was subjected to molecular docking studies for the inhibition of TtgR, topoisomerase IV and AmpC β-lactamase enzymes which are targets for antimicrobials. Docking studies of the compound showed low docking energy indicating its usefulness as antimicrobial agent. 1,5,7-Trihydroxy-3-hydroxy methyl anthraquinone is new, and its antimicrobial and molecular docking properties are reported for the first time.
International Nuclear Information System (INIS)
Li, Lin; Yue, Grace G.L.; Lau, Clara B.S.; Sun, Handong; Fung, Kwok Pui; Leung, Ping Chung; Han, Quanbin; Leung, Po Sing
2012-01-01
Pancreatic cancer is difficult to detect early and responds poorly to chemotherapy. A breakthrough in the development of new therapeutic agents is urgently needed. Eriocalyxin B (EriB), isolated from the Isodon eriocalyx plant, is an ent-kaurane diterpenoid with promise as a broad-spectrum anti-cancer agent. The anti-leukemic activity of EriB, including the underlying mechanisms involved, has been particularly well documented. In this study, we demonstrated for the first time EriB's potent cytotoxicity against four pancreatic adenocarcinoma cell lines, namely PANC-1, SW1990, CAPAN-1, and CAPAN-2. The effects were comparable to that of the chemotherapeutic camptothecin (CAM), but with much lower toxicity against normal human liver WRL68 cells. EriB's cytoxicity against CAPAN-2 cells was found to involve caspase-dependent apoptosis and cell cycle arrest at the G2/M phase. Moreover, the p53 pathway was found to be activated by EriB in these cells. Furthermore, in vivo studies showed that EriB inhibited the growth of human pancreatic tumor xenografts in BALB/c nude mice without significant secondary adverse effects. These results suggest that EriB should be considered a candidate for pancreatic cancer treatment. -- Highlights: ► We study Eriocalyxin B (EriB)'s cytotoxic effects on pancreatic cancer cell lines. ► EriB inhibits cell proliferation via mediation of apoptosis and cell cycle arrest. ► The effects are involved in caspase-dependent apoptosis and p53 pathway. ► In vivo study also shows EriB inhibits the growth of human pancreatic tumor. ► EriB can be a good candidate for chemotherapy in pancreatic cancer.
Energy Technology Data Exchange (ETDEWEB)
Li, Lin [School of Biomedical Sciences, The Chinese University of Hong Kong, Hong Kong (China); Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); State Key Laboratory of Phytochemistry and Plant Resources in West China, The Chinese University of Hong Kong, Hong Kong (China); Yue, Grace G.L. [Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); State Key Laboratory of Phytochemistry and Plant Resources in West China, The Chinese University of Hong Kong, Hong Kong (China); Lau, Clara B.S. [Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); Sun, Handong [State Key Laboratory of Phytochemistry and Plant Resources in West China, Kunming Institute of Botany, CAS, Yunnan (China); Fung, Kwok Pui [School of Biomedical Sciences, The Chinese University of Hong Kong, Hong Kong (China); Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); State Key Laboratory of Phytochemistry and Plant Resources in West China, The Chinese University of Hong Kong, Hong Kong (China); Leung, Ping Chung [Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); State Key Laboratory of Phytochemistry and Plant Resources in West China, The Chinese University of Hong Kong, Hong Kong (China); Han, Quanbin, E-mail: simonhan@hkbu.edu.hk [Institute of Chinese Medicine, The Chinese University of Hong Kong, Hong Kong (China); State Key Laboratory of Phytochemistry and Plant Resources in West China, The Chinese University of Hong Kong, Hong Kong (China); School of Chinese Medicine, The Hong Kong Baptist University, Hong Kong (China); Leung, Po Sing, E-mail: psleung@cuhk.edu.hk [School of Biomedical Sciences, The Chinese University of Hong Kong, Hong Kong (China)
2012-07-01
Pancreatic cancer is difficult to detect early and responds poorly to chemotherapy. A breakthrough in the development of new therapeutic agents is urgently needed. Eriocalyxin B (EriB), isolated from the Isodon eriocalyx plant, is an ent-kaurane diterpenoid with promise as a broad-spectrum anti-cancer agent. The anti-leukemic activity of EriB, including the underlying mechanisms involved, has been particularly well documented. In this study, we demonstrated for the first time EriB's potent cytotoxicity against four pancreatic adenocarcinoma cell lines, namely PANC-1, SW1990, CAPAN-1, and CAPAN-2. The effects were comparable to that of the chemotherapeutic camptothecin (CAM), but with much lower toxicity against normal human liver WRL68 cells. EriB's cytoxicity against CAPAN-2 cells was found to involve caspase-dependent apoptosis and cell cycle arrest at the G2/M phase. Moreover, the p53 pathway was found to be activated by EriB in these cells. Furthermore, in vivo studies showed that EriB inhibited the growth of human pancreatic tumor xenografts in BALB/c nude mice without significant secondary adverse effects. These results suggest that EriB should be considered a candidate for pancreatic cancer treatment. -- Highlights: ► We study Eriocalyxin B (EriB)'s cytotoxic effects on pancreatic cancer cell lines. ► EriB inhibits cell proliferation via mediation of apoptosis and cell cycle arrest. ► The effects are involved in caspase-dependent apoptosis and p53 pathway. ► In vivo study also shows EriB inhibits the growth of human pancreatic tumor. ► EriB can be a good candidate for chemotherapy in pancreatic cancer.
Bethge, Matthias; Radoschewski, Friedrich Michael; Gutenbrunner, Christoph
2012-10-15
Although data from longitudinal studies are sparse, effort-reward imbalance (ERI) seems to affect work ability. However, the potential pathway from restricted work ability to ERI must also be considered. Therefore, the aim of our study was to analyse cross-sectional and longitudinal associations between ERI and work ability and vice versa. Data come from the Second German Sociomedical Panel of Employees. Logistic regression models were estimated to determine cross-sectional and longitudinal associations. The sample used to predict new cases of poor or moderate work ability was restricted to cases with good or excellent work ability at baseline. The sample used to predict new cases of ERI was restricted to persons without ERI at baseline. The cross-sectional analysis included 1501 full-time employed persons. The longitudinal analyses considered 600 participants with good or excellent baseline work ability and 666 participants without baseline ERI, respectively. After adjustment for socio-demographic variables, health-related behaviour and factors of the work environment, ERI was cross-sectionally associated with poor or moderate work ability (OR = 1.980; 95% CI: 1.428 to 2.747). Longitudinally, persons with ERI had 2.1 times higher odds of poor or moderate work ability after one year (OR = 2.093; 95% CI: 1.047 to 4.183). Conversely, persons with poor or moderate work ability had 2.6 times higher odds of an ERI after one year (OR = 2.573; 95% CI: 1.314 to 5.041). Interventions that enable workers to cope with ERI or address indicators of ERI directly could promote the maintenance of work ability. Integration management programmes for persons with poor work ability should also consider their psychosocial demands.
Borodulina, O R; Kramerov, D A
2001-10-01
Four tRNA-related SINE families were isolated from the genome of the shrew Sorex araneus (SOR element), mole Mogera robusta (TAL element), and hedgehog Mesechinus dauuricus (ERI-1 and ERI-2 elements). Each of these SINEs families is specific for a single Insectivora family: SOR, for Soricidae (shrews); TAL, for Talpidae (moles and desmans); ERI-1 and ERI-2, for Erinaceidae (hedgehogs). There is a long polypyrimidine region (TC-motif) in TAL, ERI-1, and ERI-2 elements located immediately upstream of an A-rich tail with polyadenylation signals (AATAAA) and an RNA polymerase III terminator (T(4-6)) or TCT(3-4)). Ten out of 14 analyzed mammalian tRNA-related SINE families have an A-rich tail similar to that of TAL, ERI-1, and ERI-2 elements. These elements were assigned to class T+. The other four SINEs including SOR element have no polyadenylation signal and transcription terminator in their A-rich tail and were assigned to class T-. Class T+ SINEs occur only in mammals, and most of them have a long polypyrimidine region. Possible models of retroposition of class T+ and T- SINEs are discussed.
Sperlich, Stefanie; Arnhold-Kerri, Sonja; Siegrist, Johannes; Geyer, Siegfried
2013-10-01
So far, Siegrist's model of effort-reward imbalance (ERI) has been tested almost exclusively for paid employment. This article reports results on a newly developed questionnaire measuring ERI in unpaid household and family work. Using data of a population-based sample of 3129 German mothers, logistic regression analyses were performed to test the following three main assumptions: (i) high effort combined with low reward in household and family work increases the risk of poor health; (ii) a high level of overcommitment may enhance the risk of poor health; and (iii) mothers reporting an extrinsic high ERI and a high level of overcommitment have an even higher risk of poor health. ERI was significantly related to self-rated health, somatic complaints and mental health. A high level of overcommitment increased the risk of poor health, whereas ERI and overcommitment combined was associated with the highest risk of poor health. Statistically significant synergy effects of combined exposure of ERI and overcommitment were found for 'anxiety'. With some limitations, all three assumptions underlying the ERI model were confirmed. Thus, we conclude that ERI is applicable to domestic work and may provide an explanatory framework to assess stress experiences in mothers.
Work ability, effort-reward imbalance and disability pension claims.
Wienert, J; Spanier, K; Radoschewski, F M; Bethge, M
2017-12-30
Effort-reward imbalance (ERI) and self-rated work ability are known independent correlates and predictors of intended disability pension claims. However, little research has focused on the interrelationship between the three and whether self-rated work ability mediates the relationship between ERI and intended disability pension claims. To investigate whether self-rated work ability mediates the association between ERI and intended disability pension claims. Baseline data from participants of the Third German Sociomedical Panel of Employees, a 5-year cohort study that investigates determinants of work ability, rehabilitation utilization and disability pensions in employees who have previously received sickness benefits, were analysed. We tested direct associations between ERI with intended disability pension claims (Model 1) and self-rated work ability (Model 2). Additionally, we tested whether work ability mediates the association between ERI and intended disability pension claims (Model 3). There were 2585 participants. Model 1 indicated a significant association between ERI and intended disability pension claims. Model 2 showed a significant association between ERI and self-rated work ability. The mediation in Model 3 revealed a significant indirect association between ERI and intended disability pension claims via self-rated work ability. There was no significant direct association between ERI and intended disability pension claims. Our results support the adverse health-related impact of ERI on self-rated work ability and intended disability pension claims. © The Author 2017. Published by Oxford University Press on behalf of the Society of Occupational Medicine. All rights reserved. For Permissions, please email: journals.permissions@oup.com
Directory of Open Access Journals (Sweden)
Bethge Matthias
2012-10-01
Full Text Available Abstract Background Although data from longitudinal studies are sparse, effort-reward imbalance (ERI seems to affect work ability. However, the potential pathway from restricted work ability to ERI must also be considered. Therefore, the aim of our study was to analyse cross-sectional and longitudinal associations between ERI and work ability and vice versa. Methods Data come from the Second German Sociomedical Panel of Employees. Logistic regression models were estimated to determine cross-sectional and longitudinal associations. The sample used to predict new cases of poor or moderate work ability was restricted to cases with good or excellent work ability at baseline. The sample used to predict new cases of ERI was restricted to persons without ERI at baseline. Results The cross-sectional analysis included 1501 full-time employed persons. The longitudinal analyses considered 600 participants with good or excellent baseline work ability and 666 participants without baseline ERI, respectively. After adjustment for socio-demographic variables, health-related behaviour and factors of the work environment, ERI was cross-sectionally associated with poor or moderate work ability (OR = 1.980; 95% CI: 1.428 to 2.747. Longitudinally, persons with ERI had 2.1 times higher odds of poor or moderate work ability after one year (OR = 2.093; 95% CI: 1.047 to 4.183. Conversely, persons with poor or moderate work ability had 2.6 times higher odds of an ERI after one year (OR = 2.573; 95% CI: 1.314 to 5.041. Conclusions Interventions that enable workers to cope with ERI or address indicators of ERI directly could promote the maintenance of work ability. Integration management programmes for persons with poor work ability should also consider their psychosocial demands.
Effort-Reward Imbalance and Work Productivity Among Hotel Housekeeping Employees: A Pilot Study.
Rosemberg, Marie-Anne S; Li, Yang
2018-03-01
This study explored the relationship between effort-reward imbalance (ERI) at work and work productivity among hotel housekeepers. A community-based approach was used to recruit 23 hotel housekeepers who completed the ERI and Work Performance Questionnaires. Work productivity was determined by combining self-report absenteeism and presenteeism. More than 40% of the participants reported high ERI (ERI >1). Also, 59.1% reported low work productivity. Interestingly, despite the individualized high reports of ERI and low work productivity, correlation analysis showed that high ERI was correlated with high presenteeism and work productivity as a whole. This is the first study to explore work productivity among this worker group. Despite the small sample size and the cross-sectional nature of the study, this study points to the need for organization-based interventions to not only improve employee health but also their work productivity.
Erythrocyte-bound apolipoprotein B in relation to atherosclerosis, serum lipids and ABO blood group.
Directory of Open Access Journals (Sweden)
Boudewijn Klop
Full Text Available INTRODUCTION: Erythrocytes carry apolipoprotein B on their membrane, but the determining factors of erythrocyte-bound apolipoprotein B (ery-apoB are unknown. We aimed to explore the determinants of ery-apoB to gain more insight into potential mechanisms. METHODS: Subjects with and without CVD were included (N = 398. Ery-apoB was measured on fresh whole blood samples using flow cytometry. Subjects with ery-apoB levels ≤ 0.20 a.u. were considered deficient. Carotid intima media thickness (CIMT was determined as a measure of (subclinical atherosclerosis. RESULTS: Mean ery-apoB value was 23.2% lower in subjects with increased CIMT (0.80 ± 0.09 mm, N = 140 compared to subjects with a normal CIMT (0.57 ± 0.08 mm, N = 258 (P = 0.007, adjusted P<0.001. CIMT and ery-apoB were inversely correlated (Spearman's r: -0.116, P = 0.021. A total of 55 subjects (13.6% were considered ery-apoB deficient, which was associated with a medical history of CVD (OR: 1.86, 95% CI 1.04-3.33; adjusted OR: 1.55; 95% CI 0.85-2.82. Discontinuation of statins in 54 subjects did not influence ery-apoB values despite a 58.4% increase in serum apolipoprotein B. Subjects with blood group O had significantly higher ery-apoB values (1.56 ± 0.94 a.u. when compared to subjects with blood group A (0.89 ± 1.15 a.u, blood group B (0.73 ± 0.1.12 a.u. or blood group AB (0.69 ± 0.69 a.u. (P-ANOVA = 0.002. CONCLUSION: Absence or very low values of ery-apoB are associated with clinical and subclinical atherosclerosis. While serum apolipoprotein B is not associated with ery-apoB, the ABO blood group seems to be a significant determinant.
Behrman, K. D.; Johnson, M. V. V.; Atwood, J. D.; Norfleet, M. L.
2016-12-01
Recent algal blooms in Western Lake Erie Basin (WLEB) have renewed scientific community's interest in developing process based models to better understand and predict the drivers of eutrophic conditions in the lake. At the same time, in order to prevent future blooms, farmers, local communities and policy makers are interested in developing spatially explicit nutrient and sediment management plans at various scales, from field to watershed. These interests have fueled several modeling exercises intended to locate "hotspots" in the basin where targeted adoption of additional agricultural conservation practices could provide the most benefit to water quality. The models have also been used to simulate various scenarios representing potential agricultural solutions. The Soil and Water Assessment Tool (SWAT) and its sister model, the Agricultural Policy Environmental eXtender (APEX), have been used to simulate hydrology of interacting land uses in thousands of scientific studies around the world. High performance computing allows SWAT and APEX users to continue to improve and refine the model specificity to make predictions at small-spatial scales. Consequently, data inputs and calibration/validation data are now becoming the limiting factor to model performance. Water quality data for the tributaries and rivers that flow through WLEB is spatially and temporally limited. Land management data, including conservation practice and nutrient management data, are not publicly available at fine spatial and temporal scales. Here we show the data uncertainties associated with modeling WLEB croplands at a relatively large spatial scale (HUC-4) using site management data from over 1,000 farms collected by the Conservation Effects Assessment Project (CEAP). The error associated with downscaling this data to the HUC-8 and HUC-12 scale is shown. Simulations of spatially explicit dynamics can be very informative, but care must be taken when policy decisions are made based on models
Effort-reward imbalance and depression among private practice physicians.
Tsutsumi, Akizumi; Kawanami, Shoko; Horie, Seichi
2012-02-01
Current private practice physicians provide medical services in a harsh economic situation. The effort-reward imbalance (ERI) model puts its emphasis on an imbalance between high efforts spent and low rewards received in occupational life. ERI model includes three different reward factors from task to organizational levels. We examined whether ERI in terms of low organizational reward (poor prospective and job insecurity) could be the most relevant and strongly associated with depression among private practice physicians. This is a cross-sectional questionnaire study of 1,103 private practice physicians who were currently working in clinical settings and completed the data of exposure and outcome. The study questionnaire was mailed to all the physicians listed as members of a local branch of the Japan Medical Association (n = 3,441) between November and December 2008. Outcomes were prevalence of depression as measured by the Center for Epidemiologic Studies Depression Scale and adjusted odds ratios (OR) of depression with respect to ERI. Fifty-seven percent of physicians were exposed to ERI, and 18% of the physicians were depressed. Logistic regression analyses revealed that ERI was significantly associated with depression (OR and 95% confidence interval = 3.57; 2.43-5.26). ERI with regard to organizational reward was most prevalent (60%) and had the strongest association with depression (5.14; 3.36-7.92). Predominant prevalence of ERI in terms of organizational level low reward and strong associations between the ERI component and depression suggests that countermeasures from social perspective are crucial.
Directory of Open Access Journals (Sweden)
Elçin Özbudak
1995-06-01
Full Text Available Evaluation of the use perodicals collections in libraries is important as perodicals report the results of the latest scientific research and they are usually more expensive than other types of library materials. In this study we evaluate the use of Arts and Humanities periodicals in the collection of the Higher Education Council Documentation Center. Although the use of Arts and Humanities periodicals was found to be lower than, say, Biomedical periodicals collection, the number of journal titles in Arts and Humanities appears to be quite satisfactory. Some suggestions are made so as to increase the use of Arts and Humanities periodicals collection. Bilimsel araştırmalar için en güncel bilgileri veren ve maliyeti diğer materyallere göre daha fazla olan süreli yayınların ne oranda kullanıldığının araştırılması, koleksiyon değerlendirmesi açısından önemlidir. Bu amaçla, Yükseköğretim Kurulu Dokümantasyon ve Uluslararası Bilgi Tarama Merkezi süreli yayınlar koleksiyonunun genel bir değerlendirmesi yapılarak "Sanat ve Beşeri Bilimler" konulu süreli yayınların kullanımları incelenmiş, Yükseköğretim Kurulu Dokümantasyon ve Uluslararası Bilgi Tarama Merkezi 'nde önemli ve büyük bir süreli yayınlar koleksiyonu bulunduğu, "Sanat ve Beşeri Bilimler" konulu süreli yayınların da yeterli olduğu sonuçları çıkartılmıştır. "Sanat ve Beşeri Bilimler" konulu süreli yayınların kullanımlarının nispeten düşük oluşu, bu alanda çalışan araştırmacıların süreli yayınlara yeterince ilgi göstermemelerine bağlanarak, kullanımı artırmak için öneriler getirilmiştir.
Sperlich, Stefanie; Peter, Richard; Geyer, Siegfried
2012-01-06
This paper reports on results of a newly developed questionnaire for the assessment of effort-reward imbalance (ERI) in unpaid household and family work. Using a cross-sectional population-based survey of German mothers (n = 3129) the dimensional structure of the theoretical ERI model was validated by means of Confirmatory Factor Analysis (CFA). Analyses of Variance were computed to examine relationships between ERI and social factors and health outcomes. CFA revealed good psychometric properties indicating that the subscale 'effort' is based on one latent factor and the subscale 'reward' is composed of four dimensions: 'intrinsic value of family and household work', 'societal esteem', 'recognition from the partner', and 'affection from the child(ren)'. About 19.3% of mothers perceived lack of reciprocity and 23.8% showed high rates of overcommitment in terms of inability to withdraw from household and family obligations. Socially disadvantaged mothers were at higher risk of ERI, in particular with respect to the perception of low societal esteem. Gender inequality in the division of household and family work and work-family conflict accounted most for ERI in household and family work. Analogous to ERI in paid work we could demonstrate that ERI affects self-rated health, somatic complaints, mental health and, to some extent, hypertension. The newly developed questionnaire demonstrates satisfied validity and promising results for extending the ERI model to household and family work.
Fraker, Michael E.; Anderson, Eric J.; May, Cassandra J.; Chen, Kuan-Yu; Davis, Jeremiah J.; DeVanna, Kristen M.; DuFour, Mark R.; Marschall, Elizabeth A.; Mayer, Christine M.; Miner, Jeffery G.; Pangle, Kevin L.; Pritt, Jeremy J.; Roseman, Edward F.; Tyson, Jeffrey T.; Zhao, Yingming; Ludsin, Stuart A
2015-01-01
Physical processes can generate spatiotemporal heterogeneity in habitat quality for fish and also influence the overlap of pre-recruit individuals (e.g., larvae) with high-quality habitat through hydrodynamic advection. In turn, individuals from different stocks that are produced in different spawning locations or at different times may experience dissimilar habitat conditions, which can underlie within- and among-stock variability in larval growth and survival. While such physically-mediated variation has been shown to be important in driving intra- and inter-annual patterns in recruitment in marine ecosystems, its role in governing larval advection, growth, survival, and recruitment has received less attention in large lake ecosystems such as the Laurentian Great Lakes. Herein, we used a hydrodynamic model linked to a larval walleye (Sander vitreus) individual-based model to explore how the timing and location of larval walleye emergence from several spawning sites in western Lake Erie (Maumee, Sandusky, and Detroit rivers; Ohio reef complex) can influence advection pathways and mixing among these local spawning populations (stocks), and how spatiotemporal variation in thermal habitat can influence stock-specific larval growth. While basin-wide advection patterns were fairly similar during 2011 and 2012, smaller scale advection patterns and the degree of stock mixing varied both within and between years. Additionally, differences in larval growth were evident among stocks and among cohorts within stocks which were attributed to spatiotemporal differences in water temperature. Using these findings, we discuss the value of linked physical–biological models for understanding the recruitment process and addressing fisheries management problems in the world's Great Lakes.
Umaña-Taylor, Adriana J.; Updegraff, Kimberly A.; Jahromi, Laudan B.; Zeiders, Katharine H.
2015-01-01
This study examined trajectories of ethnic-racial identity (ERI) and autonomy development among Mexican-origin adolescent females in the U.S. (N = 181; Mage at Wave 1 = 16.80 years, SD = 1.00) as they transitioned through the first five years of parenthood. Trajectories of ERI and autonomy also were examined in relation to psychosocial functioning. Unconditional latent growth models indicated significant growth in autonomy, ERI resolution, and ERI affirmation from middle to late adolescence. Conditional latent growth models indicated that autonomy and ERI exploration growth trajectories were positively associated with psychosocial adjustment. Although adolescent mothers are experiencing transitions that are not normative during adolescence, they also engage in normative developmental processes, and their engagement in such processes is linked with better adjustment. PMID:26450526
Energy Technology Data Exchange (ETDEWEB)
Solla, Shane R. de; Fernie, Kimberly J
2004-11-01
PCBs, organochlorine pesticides and dioxins/furans in snapping turtle eggs and plasma (Chelydra serpentina) were evaluated at three Areas of Concern (AOCs) on Lake Erie and its connecting channels (St. Clair River, Detroit River, and Wheatley Harbour), as well as two inland reference sites (Algonquin Provincial Park and Tiny Marsh) in 2001-2002. Eggs from the Detroit River and Wheatley Harbour AOCs had the highest levels of p,p'-DDE (24.4 and 57.9 ng/g) and sum PCBs (928.6 and 491.0 ng/g) wet weight, respectively. Contaminant levels in eggs from St. Clair River AOC were generally higher than those from Algonquin Park, but similar to those from Tiny Marsh. Dioxins appeared highest from the Detroit River. The PCB congener pattern in eggs suggested that turtles from the Detroit River and Wheatley Harbour AOCs were exposed to Aroclor 1260. TEQs of sum PCBs in eggs from all AOCs and p,p'-DDE levels in eggs from the Wheatley Harbour and the Detroit River AOCs exceeded the Canadian Environmental Quality Guidelines. Furthermore, sum PCBs in eggs from Detroit River and Wheatley Harbour exceeded partial restriction guidelines for consumption. Although estimated PCB body burdens in muscle tissue of females were well below consumption guidelines, estimated residues in liver and adipose were above guidelines for most sites.
Energy Technology Data Exchange (ETDEWEB)
Solla, Shane R. de; Fernie, Kimberly J
2004-11-01
PCBs, organochlorine pesticides and dioxins/furans in snapping turtle eggs and plasma (Chelydra serpentina) were evaluated at three Areas of Concern (AOCs) on Lake Erie and its connecting channels (St. Clair River, Detroit River, and Wheatley Harbour), as well as two inland reference sites (Algonquin Provincial Park and Tiny Marsh) in 2001-2002. Eggs from the Detroit River and Wheatley Harbour AOCs had the highest levels of p,p'-DDE (24.4 and 57.9 ng/g) and sum PCBs (928.6 and 491.0 ng/g) wet weight, respectively. Contaminant levels in eggs from St. Clair River AOC were generally higher than those from Algonquin Park, but similar to those from Tiny Marsh. Dioxins appeared highest from the Detroit River. The PCB congener pattern in eggs suggested that turtles from the Detroit River and Wheatley Harbour AOCs were exposed to Aroclor 1260. TEQs of sum PCBs in eggs from all AOCs and p,p'-DDE levels in eggs from the Wheatley Harbour and the Detroit River AOCs exceeded the Canadian Environmental Quality Guidelines. Furthermore, sum PCBs in eggs from Detroit River and Wheatley Harbour exceeded partial restriction guidelines for consumption. Although estimated PCB body burdens in muscle tissue of females were well below consumption guidelines, estimated residues in liver and adipose were above guidelines for most sites.
de Solla, Shane R; Fernie, Kimberly J
2004-11-01
PCBs, organochlorine pesticides and dioxins/furans in snapping turtle eggs and plasma (Chelydra serpentina) were evaluated at three Areas of Concern (AOCs) on Lake Erie and its connecting channels (St. Clair River, Detroit River, and Wheatley Harbour), as well as two inland reference sites (Algonquin Provincial Park and Tiny Marsh) in 2001-2002. Eggs from the Detroit River and Wheatley Harbour AOCs had the highest levels of p,p'-DDE (24.4 and 57.9 ng/g) and sum PCBs (928.6 and 491.0 ng/g) wet weight, respectively. Contaminant levels in eggs from St. Clair River AOC were generally higher than those from Algonquin Park, but similar to those from Tiny Marsh. Dioxins appeared highest from the Detroit River. The PCB congener pattern in eggs suggested that turtles from the Detroit River and Wheatley Harbour AOCs were exposed to Aroclor 1260. TEQs of sum PCBs in eggs from all AOCs and p,p'-DDE levels in eggs from the Wheatley Harbour and the Detroit River AOCs exceeded the Canadian Environmental Quality Guidelines. Furthermore, sum PCBs in eggs from Detroit River and Wheatley Harbour exceeded partial restriction guidelines for consumption. Although estimated PCB body burdens in muscle tissue of females were well below consumption guidelines, estimated residues in liver and adipose were above guidelines for most sites.
International Nuclear Information System (INIS)
Solla, Shane R. de; Fernie, Kimberly J.
2004-01-01
PCBs, organochlorine pesticides and dioxins/furans in snapping turtle eggs and plasma (Chelydra serpentina) were evaluated at three Areas of Concern (AOCs) on Lake Erie and its connecting channels (St. Clair River, Detroit River, and Wheatley Harbour), as well as two inland reference sites (Algonquin Provincial Park and Tiny Marsh) in 2001-2002. Eggs from the Detroit River and Wheatley Harbour AOCs had the highest levels of p,p'-DDE (24.4 and 57.9 ng/g) and sum PCBs (928.6 and 491.0 ng/g) wet weight, respectively. Contaminant levels in eggs from St. Clair River AOC were generally higher than those from Algonquin Park, but similar to those from Tiny Marsh. Dioxins appeared highest from the Detroit River. The PCB congener pattern in eggs suggested that turtles from the Detroit River and Wheatley Harbour AOCs were exposed to Aroclor 1260. TEQs of sum PCBs in eggs from all AOCs and p,p'-DDE levels in eggs from the Wheatley Harbour and the Detroit River AOCs exceeded the Canadian Environmental Quality Guidelines. Furthermore, sum PCBs in eggs from Detroit River and Wheatley Harbour exceeded partial restriction guidelines for consumption. Although estimated PCB body burdens in muscle tissue of females were well below consumption guidelines, estimated residues in liver and adipose were above guidelines for most sites
Original Research Original Research
African Journals Online (AJOL)
RAGHAVENDRA
Evaluation of Different Strains of Eri for their Adaptability ... performance compared to other strains in all the locati. Therefore, it is ... significant contribution to the economy of many countr ... green and Eri-marked) eri silkworm strains were ... ope of hope at village level for ..... Proceeding of Regional Seminar on Prospects and.
Directory of Open Access Journals (Sweden)
Sperlich Stefanie
2012-01-01
Full Text Available Abstract Background This paper reports on results of a newly developed questionnaire for the assessment of effort-reward imbalance (ERI in unpaid household and family work. Methods: Using a cross-sectional population-based survey of German mothers (n = 3129 the dimensional structure of the theoretical ERI model was validated by means of Confirmatory Factor Analysis (CFA. Analyses of Variance were computed to examine relationships between ERI and social factors and health outcomes. Results CFA revealed good psychometric properties indicating that the subscale 'effort' is based on one latent factor and the subscale 'reward' is composed of four dimensions: 'intrinsic value of family and household work', 'societal esteem', 'recognition from the partner', and 'affection from the child(ren'. About 19.3% of mothers perceived lack of reciprocity and 23.8% showed high rates of overcommitment in terms of inability to withdraw from household and family obligations. Socially disadvantaged mothers were at higher risk of ERI, in particular with respect to the perception of low societal esteem. Gender inequality in the division of household and family work and work-family conflict accounted most for ERI in household and family work. Analogous to ERI in paid work we could demonstrate that ERI affects self-rated health, somatic complaints, mental health and, to some extent, hypertension. Conclusions The newly developed questionnaire demonstrates satisfied validity and promising results for extending the ERI model to household and family work.
Ortiz, J. D.; Munro-Stasiuk, M. J.; Hart, B. I.; Mokaren, D. M.; Arnold, B.; Chermansky, J. V.; Vlack, Y. A.
2006-12-01
State and national educational standards stress the need to incorporate inquiry-based approaches into the K- 12 science curriculum. However, many teachers either lack training in these pedagogical techniques or science content mastery. Both of these are needed to confidently approach science teaching in the less structured framework associated with a real world exploration of the natural environment. To overcome these barriers to implementation, we have developed an intensive, field-based professional development workshop which explores the connections between the bedrock geology, glacial geomorphology, ecology, and geography of the Lake Erie Islands and the shore of its western basin. This workshop is part of a series of three workshops that form the professional development activities of our NSF funded Graduate Teaching Fellows in K-12 Education (GK-12) project, the Northeast Ohio Geoscience Education Outreach (NEOGEO) Program which seeks to improve the quality of Earth Science education at the middle and high school levels in Northeast Ohio. During the workshop students explored the ecology and geomorphology of a series of coastal wetlands, collecting instrumental data and field observations to evaluate water quality and the forces that created these surface features. Exceptional exposure of glacial scours and striations at Kelleys Island and along the Marblehead Peninsula allowed the participants to reconstruct evolving ice flow paths to see how recent geological history shaped the landscape. Finally, stratigraphic observations in a local quarry enabled the students to understand why the observed glacial features varied as a function of bedrock type. Response to the workshop was overwhelming positive with participants commenting positively on quality and quantity of the material presented and the manner in which inquiry based teaching was modeled. End of term projects which included the conceptualization of a teaching plan to incorporate the approaches learned
Kouvonen, Anne; Kivimäki, Mika; Virtanen, Marianna; Heponiemi, Tarja; Elovainio, Marko; Pentti, Jaana; Linna, Anne; Vahtera, Jussi
2006-02-07
In occupational life, a mismatch between high expenditure of effort and receiving few rewards may promote the co-occurrence of lifestyle risk factors, however, there is insufficient evidence to support or refute this hypothesis. The aim of this study is to examine the extent to which the dimensions of the Effort-Reward Imbalance (ERI) model--effort, rewards and ERI--are associated with the co-occurrence of lifestyle risk factors. Based on data from the Finnish Public Sector Study, cross-sectional analyses were performed for 28,894 women and 7233 men. ERI was conceptualized as a ratio of effort and rewards. To control for individual differences in response styles, such as a personal disposition to answer negatively to questionnaires, occupational and organizational-level ecological ERI scores were constructed in addition to individual-level ERI scores. Risk factors included current smoking, heavy drinking, body mass index > or =25 kg/m2, and physical inactivity. Multinomial logistic regression models were used to estimate the likelihood of having one risk factor, two risk factors, and three or four risk factors. The associations between ERI and single risk factors were explored using binary logistic regression models. After adjustment for age, socioeconomic position, marital status, and type of job contract, women and men with high ecological ERI were 40% more likely to have simultaneously > or =3 lifestyle risk factors (vs. 0 risk factors) compared with their counterparts with low ERI. When examined separately, both low ecological effort and low ecological rewards were also associated with an elevated prevalence of risk factor co-occurrence. The results obtained with the individual-level scores were in the same direction. The associations of ecological ERI with single risk factors were generally less marked than the associations with the co-occurrence of risk factors. This study suggests that a high ratio of occupational efforts relative to rewards may be
Koch, Peter; Kersten, Jan Felix; Stranzinger, Johanna; Nienhaus, Albert
2017-01-01
The prevalence of effort-reward imbalance (ERI) among qualified childcare workers in Germany is currently estimated at around 65%. High rates of burnout and musculoskeletal symptoms (MS) have also been reported for this group. Previous longitudinal studies show inconsistent results with regard to the association between ERI and MS. As yet, no longitudinal studies have been conducted to investigate the association between ERI and burnout or MS in childcare workers. This study aims to investigate the extent to which a relationship between ERI and MS or burnout can be observed in childcare workers in Germany on a longitudinal basis. In 2014 childcare workers ( N = 199, response rate: 57%) of a provider of facilities for children and youth in Hamburg were asked about stress and health effects in the workplace. Follow-up was completed one year later ( N = 106, follow-up rate: 53%) For the baseline assessment, ERI was determined as the primary influencing factor. Data on MS was recorded using the Nordic questionnaire, and burnout using the personal burnout scale of the Copenhagen Burnout Inventory (CBI). The statistical analysis was carried out using multivariate linear and logistic regression. At baseline ERI was present in 65% of the sample population. The mean burnout score at the time of follow-up was 53.7 (SD: 20.7); the prevalence of MS was between 19% and 62%. ERI was identified as a statistically significant factor for MS, after adjusting especially for physical stress (lower back: OR 4.2; 95% CI: 1.14 to 15.50, neck: OR 4.3; 95% CI: 1.25 to 15.0, total MS: OR 4.0; 95% CI: 1.20 to 13.49). With regard to burnout, a relative increase of 10% in the ERI ratio score increased the burnout score by 1.1 points ( p = 0.034). ERI was revealed to be a major factor in relation to MS and burnout in childcare workers. Based on this observation worksite interventions on the individual and organizational level should be introduced in order to prevent ERI.
Directory of Open Access Journals (Sweden)
Oya Gürdal
1993-09-01
Full Text Available Science is a systemized from of knowledge which is a product of human creativity. The aim of this study is to try to explain the nature of the concept of science, and to evaluate librarianship and information science as a scientific discipline in accordance with the synthesis achieved; and invite colleagues to consider this issue. Bilim insan yaratıcılığıyla üretilen bilginin sistematiğe edilmiş şeklidir. Bu çalışmanın amacı, bilim kavramının içeriğini açımlamaya çalışmak; varılacak sentezlerle kütüphanecilik ve enformasyon biliminin bir "bilim disiplini" olarak değerlendirmesini sunmak ve meslektaşları konu üzerinde düşünmeye çağırmaktır.
Wang, Shuo; Sanderson, Kristy; Venn, Alison; Dwyer, Terence; Gall, Seana
2018-01-01
Stress pathways can have origins in childhood, but few early predictors have been explored in relation to adult job stress. This study examined whether childhood school, health or socioeconomic factors were associated with adult job stress. Data came from the Childhood Determinants of Adult Health study that began in 1985 with children aged 7-15 years who reported effortreward imbalance (ERI) scales at ages 31-41 years. Linear regression assessed the association between childhood factors and adult ERI adjusted for age and socioeconomic position (SEP) in childhood and adulthood. There were between 999 and 1390 participants in each analysis. Lower adulthood ERI, indicating less job stress, was predicted by several school-related factors in men. For example, each higher category of learner self-concept was associated with a 19% (95% CI - 32% to 6%) reduction in adult ERI, and each unit increase in academic attainment was associated with a 15% (95% CI -28% to 3%) reduction in adult ERI. Childhood health was associated with adult ERI. For example, in women, overweight children had 14% (95% CI 5% to 22%) higher adult ERI scores compared with healthy weight children, and each unit of negative affect was associated with 2% (95% CI 1% to 4%) increase in adult ERI. Adult SEP had no effect on these associations for men but explained some of the effect in women. Childhood SEP had inconsistent associations with adult ERI. Our findings suggest that a range of childhood socioeconomic, school- and health-related factors might contribute to the development of job stress in adulthood. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.
Directory of Open Access Journals (Sweden)
Eric D. Roy
2010-03-01
Full Text Available Together, lake ecosystems and local human activity form complex social-ecological systems (SESs characterized by feedback loops and discontinuous change. Researchers in diverse fields have suggested that complex systems do not have single stable equilibria in the long term because of inevitable perturbation. During this study, we sought to address the general question of whether or not stable social-ecological equilibria exist in highly stressed and managed lacustrine systems. Using an integrated human-biophysical model, we investigated the impacts of a species invasion and ecosystem restoration on SES equilibrium, defined here as a compromise in phosphorus management among opposing stakeholders, in western Lake Erie. Our integrated model is composed of a calibrated ecological submodel representing Sandusky Bay, and a phosphorus management submodel that reflects the societal benefits and costs of phosphorus regulation. These two submodels together form a dynamic feedback loop that includes freshwater ecology, ecosystem services, and phosphorus management. We found that the invasion of dreissenid mussels decreased ecosystem resistance to eutrophication, necessitating increased phosphorus management to preserve ecosystem services and thus creating the potential for a shift in social-ecological equilibrium. Additionally, our results suggest that net benefits in the region following the invasion of dreissenids may never again reach the pre-invasion level if on-site phosphorus control is the sole management lever. Further demonstrating transient system stability, large-scale wetland restoration shifted points of management compromise to states characterized by less on-site phosphorus management and higher environmental quality, resulting in a significant increase in net benefits in the region. We conclude that lacustrine SESs are open and dynamic, and we recommend that future models of these systems emphasize site-specific perturbation over
Fuel Gas Demonstration Plant Program: Small-Scale Industrial Project. Certificate of need
Energy Technology Data Exchange (ETDEWEB)
None
1978-12-01
This Certificate of Need draft was prepared to meet new requirements as imposed by the Minnesota Energy Agency (MEA) since the original Erie/DOE contract was signed. The preparation of this document was authorized with the approval of the Certificate of Need contained in Contract Amendment No. A-005 of the Erie/DOE contract. With the issue of the Certificate of Need draft, Erie Mining Company considers this document requirement complete as it pertains to Phase I activities and delivered to DOE in accordance with Erie/DOE contract EW-78-C-02-5066 Appendix A, Part 3.I.F.5.
LoRa IoT -radion soveltuvuus käytettyjen työkoneiden tiedonsiirtoon
Hasu, Lassi
2017-01-01
Opinnäytetyön tarkoituksena oli tutkia LoRa-radiotekniikan soveltuvuutta lastinkäsittelylaitteiden tuottaman datan tiedonsiirtoon. LoRa on teollisen internetin sovelluksia varten kehitetty pitkän kantaman radiotekniikka. Tavoitteena oli löytää käyttötapauksia, joihin LoRa-tekniikka soveltuu etsittäessä kustannustehokasta radiotekniikkaa erityisesti käytettyihin lastinkäsittelylaitteisiin. Työn toimeksiantaja oli Cargotec Finland Oy:n Kalmar-liiketoimintayksikkö. Työn tutkimusmenetelmänä käyte...
Kouvonen, Anne; Kivimäki, Mika; Virtanen, Marianna; Heponiemi, Tarja; Elovainio, Marko; Pentti, Jaana; Linna, Anne; Vahtera, Jussi
2006-01-01
Background In occupational life, a mismatch between high expenditure of effort and receiving few rewards may promote the co-occurrence of lifestyle risk factors, however, there is insufficient evidence to support or refute this hypothesis. The aim of this study is to examine the extent to which the dimensions of the Effort-Reward Imbalance (ERI) model – effort, rewards and ERI – are associated with the co-occurrence of lifestyle risk factors. Methods Based on data from the Finnish Public Sector Study, cross-sectional analyses were performed for 28,894 women and 7233 men. ERI was conceptualized as a ratio of effort and rewards. To control for individual differences in response styles, such as a personal disposition to answer negatively to questionnaires, occupational and organizational -level ecological ERI scores were constructed in addition to individual-level ERI scores. Risk factors included current smoking, heavy drinking, body mass index ≥25 kg/m2, and physical inactivity. Multinomial logistic regression models were used to estimate the likelihood of having one risk factor, two risk factors, and three or four risk factors. The associations between ERI and single risk factors were explored using binary logistic regression models. Results After adjustment for age, socioeconomic position, marital status, and type of job contract, women and men with high ecological ERI were 40% more likely to have simultaneously ≥3 lifestyle risk factors (vs. 0 risk factors) compared with their counterparts with low ERI. When examined separately, both low ecological effort and low ecological rewards were also associated with an elevated prevalence of risk factor co-occurrence. The results obtained with the individual-level scores were in the same direction. The associations of ecological ERI with single risk factors were generally less marked than the associations with the co-occurrence of risk factors. Conclusion This study suggests that a high ratio of occupational
Directory of Open Access Journals (Sweden)
Elovainio Marko
2006-02-01
Full Text Available Abstract Background In occupational life, a mismatch between high expenditure of effort and receiving few rewards may promote the co-occurrence of lifestyle risk factors, however, there is insufficient evidence to support or refute this hypothesis. The aim of this study is to examine the extent to which the dimensions of the Effort-Reward Imbalance (ERI model – effort, rewards and ERI – are associated with the co-occurrence of lifestyle risk factors. Methods Based on data from the Finnish Public Sector Study, cross-sectional analyses were performed for 28,894 women and 7233 men. ERI was conceptualized as a ratio of effort and rewards. To control for individual differences in response styles, such as a personal disposition to answer negatively to questionnaires, occupational and organizational -level ecological ERI scores were constructed in addition to individual-level ERI scores. Risk factors included current smoking, heavy drinking, body mass index ≥25 kg/m2, and physical inactivity. Multinomial logistic regression models were used to estimate the likelihood of having one risk factor, two risk factors, and three or four risk factors. The associations between ERI and single risk factors were explored using binary logistic regression models. Results After adjustment for age, socioeconomic position, marital status, and type of job contract, women and men with high ecological ERI were 40% more likely to have simultaneously ≥3 lifestyle risk factors (vs. 0 risk factors compared with their counterparts with low ERI. When examined separately, both low ecological effort and low ecological rewards were also associated with an elevated prevalence of risk factor co-occurrence. The results obtained with the individual-level scores were in the same direction. The associations of ecological ERI with single risk factors were generally less marked than the associations with the co-occurrence of risk factors. Conclusion This study suggests that a high
Pritt, Jeremy J.; DuFour, Mark R.; Mayer, Christine M.; Roseman, Edward F.; DeBruyne, Robin L.
2014-01-01
Larval fish are frequently sampled in coastal tributaries to determine factors affecting recruitment, evaluate spawning success, and estimate production from spawning habitats. Imperfect detection of larvae is common, because larval fish are small and unevenly distributed in space and time, and coastal tributaries are often large and heterogeneous. We estimated detection probabilities of larval fish from several taxa in the Maumee and Detroit rivers, the two largest tributaries of Lake Erie. We then demonstrated how accounting for imperfect detection influenced (1) the probability of observing taxa as present relative to sampling effort and (2) abundance indices for larval fish of two Detroit River species. We found that detection probabilities ranged from 0.09 to 0.91 but were always less than 1.0, indicating that imperfect detection is common among taxa and between systems. In general, taxa with high fecundities, small larval length at hatching, and no nesting behaviors had the highest detection probabilities. Also, detection probabilities were higher in the Maumee River than in the Detroit River. Accounting for imperfect detection produced up to fourfold increases in abundance indices for Lake Whitefish Coregonus clupeaformis and Gizzard Shad Dorosoma cepedianum. The effect of accounting for imperfect detection in abundance indices was greatest during periods of low abundance for both species. Detection information can be used to determine the appropriate level of sampling effort for larval fishes and may improve management and conservation decisions based on larval fish data.
Halonen, Jaana I; Virtanen, Marianna; Leineweber, Constanze; Rod, Naja H; Westerlund, Hugo; Magnusson Hanson, Linda L
2018-03-27
Existing evidence of an association between effort-reward imbalance (ERI) at work and musculoskeletal pain is limited, preventing reliable conclusions about the magnitude and direction of the relation. In a large longitudinal study, we examined whether the onset of ERI is associated with subsequent onset of musculoskeletal pain among those free of pain at baseline, and vice versa, whether onset of pain leads to onset of ERI. Data were from the Swedish Longitudinal Occupational Survey of Health (SLOSH) study. We used responses from 3 consecutive study phases to examine whether exposure onset between the first and second phases predicts onset of the outcome in the third phase (N = 4079). Effort-reward imbalance was assessed with a short form of the ERI model. Having neck-shoulder and low back pain affecting life to some degree in the past 3 months was also assessed in all study phases. As covariates, we included age, sex, marital status, occupational status, and physically strenuous work. In the adjusted models, onset of ERI was associated with onset of neck-shoulder pain (relative risk [RR] 1.51, 95% confidence interval [CI] 1.21-1.89) and low back pain (RR 1.21, 95% CI 0.97-1.50). The opposite was also observed, as onset of neck-shoulder pain increased the risk of subsequent onset of ERI (RR 1.36, 95% CI 1.05-1.74). Our findings suggest that when accounting for the temporal order, the associations between ERI and musculoskeletal pain that affects life are bidirectional, implying that interventions to both ERI and pain may be worthwhile to prevent a vicious cycle.
Xu, Weixian; Yu, Haiyi; Hang, Juan; Gao, Wei; Zhao, Yiming; Guo, Lijun
2013-12-01
No previous studies investigated the interaction of effort-reward imbalance (ERI) and overcommitment on blood pressure. Our aim was to investigate associations of ERI and overcommitment (and their interaction) with blood pressure and hypertension within a Chinese population. Seven hundred thirty-four participants from the Stress and Health in Shenzhen Workers study completed a demographics, job stressor and risk factor questionnaire, and their blood pressure was measured by mercury sphygmomanometers. Risk factors for blood pressure were analyzed by multiple linear regression and risk factors for hypertension by Poisson regression. Overcommitment was associated with diastolic blood pressure after adjustment for confounders and ERI among men (β = 0.17, P controlling for overcommitment, ERI remained significantly associated with hypertension risk (PR = 2.38, 95% CI 1.53-3.71). When high overcommitment and high ERI was combined, hypertension risk was highest (adjusted PR = 2.99, 95% CI 1.82-4.91, adjusted synergy index 5.85). The interaction was significant when it was tested by an interaction term in the regression (P < 0.001). The interaction effect of overcommitment and ERI on hypertension was independent and synergistic. © 2013 Wiley Periodicals, Inc.
A new mixed self-consistent field procedure
Alvarez-Ibarra, A.; Köster, A. M.
2015-10-01
A new approach for the calculation of three-centre electronic repulsion integrals (ERIs) is developed, implemented and benchmarked in the framework of auxiliary density functional theory (ADFT). The so-called mixed self-consistent field (mixed SCF) divides the computationally costly ERIs in two sets: far-field and near-field. Far-field ERIs are calculated using the newly developed double asymptotic expansion as in the direct SCF scheme. Near-field ERIs are calculated only once prior to the SCF procedure and stored in memory, as in the conventional SCF scheme. Hence the name, mixed SCF. The implementation is particularly powerful when used in parallel architectures, since all RAM available are used for near-field ERI storage. In addition, the efficient distribution algorithm performs minimal intercommunication operations between processors, avoiding a potential bottleneck. One-, two- and three-dimensional systems are used for benchmarking, showing substantial time reduction in the ERI calculation for all of them. A Born-Oppenheimer molecular dynamics calculation for the Na+55 cluster is also shown in order to demonstrate the speed-up for small systems achievable with the mixed SCF. Dedicated to Sourav Pal on the occasion of his 60th birthday.
Pneumatiikan opintomateriaalin tutkimus
Leskinen, Juho
2011-01-01
Tämä opinnäytetyö tehtiin tutkimalla nykyistä pneumatiikan opintomateriaalia eri ammattikorkeakouluissa ja ammattioppilaitoksissa. Tutkimuksella kartoitettiin pneumatiikan eri aihealueiden laajuutta ja tasoa opetuksessa. Samalla tutkittiin verkkopohjaisen materiaalin soveltuvuutta uudeksi opintomateriaaliksi. Tutkimuksen pääasiallinen tavoite oli määrittää uuden opintomateriaalin tarve myytäväksi oppilaitoksille. Tutkimuksessa haastateltiin eri oppilaitosten pneumatiikan opettajia sähköis...
International Nuclear Information System (INIS)
Hnatowich, M.; LaBella, F.S.
1982-01-01
Erythrosine (ERY) (FD and C red no. 3) inhibited specific binding of [ 3 H]ouabain to rat brain homogenates with an IC50 of 23 microM in the dark and 1 microM in ordinary fluorescent light. Competition studies demonstrated the presence of two components, only one of which was affected by light. Lineweaver-Burk analysis indicated that ERY preferentially antagonizes [ 3 H]ouabain binding at a high-affinity site in the light, whereas in the dark the dye inhibits binding in a manner qualitatively similar to inhibition by ouabain. Light enhancement of ERY potency occurred only when dye and tissue were present together in the incubation medium, pointing to participation of transient molecular species. However, neither superoxide dismutase nor catalase altered the effects of ERY in the light or dark, suggesting the absence of oxygen free radicals. When oxygen levels were raised, there was enhancement of inhibition by ERY at a high-affinity receptor accompanied by disappearance of [ 3 H]ouabain binding at one of lower affinity. In contrast to brain, membranes from guinea pig heart showed only one binding site for [ 3 H]ouabain, and antagonism by ERY at this site was markedly enhanced by light. Structural differences between classes of ouabain binding regions probably accounts for the discrimination exhibited by ERY in the presence of light and oxygen. Our findings also caution that metabolic transformation of this common food dye, light decomposition, or photoreaction with foodstuff may yield more toxic derivatives
Steffensen, Scott C; Lee, Rong-Sheng; Henriksen, Steven J; Packer, Thomas L; Cook, Daniel R
2002-04-15
Here we describe a mathematical and statistical signal processing strategy termed event resolution imaging (ERI). Our principal objective was to determine if the acute intoxicating effects of ethanol on spontaneous EEG activity could be discriminated from those of other sedative/hypnotics. We employed ERI to combine and integrate standard analysis methods to learn multiple signal features of time-varying EEG signals. We recorded cortical EEG, electromyographic activity, and motor activity during intravenous administration of saline, ethanol (1.0 g/kg), chlordiazepoxide (10 mg/kg), pentobarbital (6 mg/kg), heroin (0.3 mg/kg), and methamphetamine (2 mg/kg) administered on separate days in six rats. A blind treatment of one of the drugs was readministered to validate the efficacy of ERI analysis. Significant changes in spontaneous EEG activity produced by all five drugs were detected by ERI analysis with a time resolution of 5-10 s. ERI analysis of spontaneous EEG activity also discriminated, with 90-95% accuracy, an ataxic dose of ethanol versus equivalent ataxic doses of chlordiazepoxide or pentobarbital, as well as the effects of saline, a reinforcing dose of heroin, or a locomotor activating dose of methamphetamine. ERI correctly matched the 'blind drug' as ethanol. These findings indicate that ERI analysis can detect the central nervous system effects of various psychoactive drugs and accurately discriminate the electrocortical effects of select sedative/hypnotics, with similar behavioral endpoints, but with dissimilar mechanisms of action.
Effort-reward imbalance at work and self-rated health of Las Vegas hotel room cleaners.
Krause, Niklas; Rugulies, Reiner; Maslach, Christina
2010-04-01
This study investigates the relationship between effort-reward-imbalance (ERI) at work and self-rated health (SF-36) among 941 Las Vegas hotel room cleaners (99% female, 84% immigrant). Logistic regression models adjust for age, health behaviors, physical workload and other potential confounders. 50% reported ERI and 60% poor or fair general health. Significant associations were found between ERI and all SF-36 health measures. Workers in the upper quartile of the efforts/rewards ratio were 2-5 times more likely to experience poor or fair general health, low physical function, high levels of pain, fatigue, and role limitations due to physical and mental health problems. The cross-sectional design limits causal interpretation of these associations. However, the development of interventions to reduce ERI and to improve general health among room cleaners deserves high priority considering that both high ERI and low self-rated health have predicted chronic diseases and mortality in prospective studies. (c) 2009 Wiley-Liss, Inc.
Evidence for predatory control of the invasive round goby
Madenjian, C.P.; Stapanian, M.A.; Witzel, L.D.; Einhouse, D.W.; Pothoven, S.A.; Whitford, H.L.
2011-01-01
We coupled bioenergetics modeling with bottom trawl survey results to evaluate the capacity of piscivorous fish in eastern Lake Erie to exert predatory control of the invading population of round goby Neogobius melanostomus. In the offshore (>20 m deep) waters of eastern Lake Erie, burbot Lota lota is a native top predator, feeding on a suite of prey fishes. The round goby invaded eastern Lake Erie during the late 1990s, and round goby population size increased dramatically during 1999–2004. According to annual bottom trawl survey results, round goby abundance in offshore waters peaked in 2004, but then declined during 2004–2008. Coincidentally, round goby became an important component of burbot diet beginning in 2003. Using bottom trawling and gill netting, we estimated adult burbot abundance and age structure in eastern Lake Erie during 2007. Diet composition and energy density of eastern Lake Erie burbot were also determined during 2007. This information, along with estimates of burbot growth, burbot mortality, burbot water temperature regime, and energy densities of prey fish from the literature, were incorporated into a bioenergetics model application to estimate annual consumption of round goby by the adult burbot population. Results indicated that the adult burbot population in eastern Lake Erie annually consumed 1,361 metric tons of round goby. Based on the results of bottom trawling, we estimated the biomass of yearling and older round goby in offshore waters eastern Lake Erie during 2007–2008 to be 2,232 metric tons. Thus, the adult burbot population was feeding on round goby at an annual rate equal to 61% of the estimated round goby standing stock. We concluded that the burbot population had high potential to exert predatory control on round goby in offshore waters of eastern Lake Erie.
1H NMR-based serum metabolomics reveals erythromycin-induced liver toxicity in albino Wistar rats
Directory of Open Access Journals (Sweden)
Atul Rawat
2016-01-01
Full Text Available Introduction: Erythromycin (ERY is known to induce hepatic toxicity which mimics other liver diseases. Thus, ERY is often used to produce experimental models of drug-induced liver-toxicity. The serum metabolic profiles can be used to evaluate the liver-toxicity and to further improve the understanding of underlying mechanism. Objective: To establish the serum metabolic patterns of Erythromycin induced hepatotoxicity in albino wistar rats using 1H NMR based serum metabolomics. Experimental: Fourteen male rats were randomly divided into two groups (n = 7 in each group: control and ERY treated. After 28 days of intervention, the metabolic profiles of sera obtained from ERY and control groups were analyzed using high-resolution 1D 1H CPMG and diffusion-edited nuclear magnetic resonance (NMR spectra. The histopathological and SEM examinations were employed to evaluate the liver toxicity in ERY treated group. Results: The serum metabolic profiles of control and ERY treated rats were compared using multivariate statistical analysis and the metabolic patterns specific to ERY-induced liver toxicity were established. The toxic response of ERY was characterized with: (a increased serum levels of Glucose, glutamine, dimethylamine, malonate, choline, phosphocholine and phospholipids and (b decreased levels of isoleucine, leucine, valine, alanine, glutamate, citrate, glycerol, lactate, threonine, circulating lipoproteins, N-acetyl glycoproteins, and poly-unsaturated lipids. These metabolic alterations were found to be associated with (a decreased TCA cycle activity and enhanced fatty acid oxidation, (b dysfunction of lipid and amino acid metabolism and (c oxidative stress. Conclusion and Recommendations: Erythromycin is often used to produce experimental models of liver toxicity; therefore, the established NMR-based metabolic patterns will form the basis for future studies aiming to evaluate the efficacy of anti-hepatotoxic agents or the hepatotoxicity of new
International Nuclear Information System (INIS)
Hnatowich, M.; LaBella, F.S.
1982-01-01
Erythrosine (ERY) (FD and C red no. 3) inhibited specific binding of [ 3 H]ouabain to rat brain homogenates with an IC50 of 23 mM in the dark and 1 mM in ordinary fluorescent light. Competition studies demonstrated the presence of two components, only one of which was affected by light. Lineweaver-Burk analysis indicated that ERY preferentially antagonizes [ 3 H]ouabain binding at a high-affinity site in the light, whereas in the dark the dye inhibits binding in a manner qualitatively similar to inhibition by ouabain. Light enhancement of ERY potency occurred only when dye and tissue were present together in the incubation medium, pointing to participation of transient molecular species. However, neither superoxide dismutase nor catalase altered the effects of ERY in the light or dark, suggesting the absence of oxygen free radicals. In contrast to brain, membranes from guinea pig heart showed only one binding site for [ 3 H]ouabain, and antagonism by ERY at this site was markedly enhanced by light. Structural differences between classes of ouabain binding regions probably accounts for the discrimination exhibited by ERY in the presence of light and oxygen. Our findings also caution that metabolic transformation of this common food dye, light decomposition, or photoreaction with foodstuff may yield more toxic derivatives
Ou, Hongxiang; Chen, Qunhui; Pan, Jianming; Zhang, Yunlei; Huang, Yong; Qi, Xueyong
2015-05-30
Magnetic imprinted polymers (MIPs) were synthesized by Pickering emulsion polymerization and used to adsorb erythromycin (ERY) from aqueous solution. The oil-in-water Pickering emulsion was stabilized by chitosan nanoparticles with hydrophobic Fe3O4 nanoparticles as magnetic carrier. The imprinting system was fabricated by radical polymerization with functional and crosslinked monomer in the oil phase. Batches of static and dynamic adsorption experiments were conducted to analyze the adsorption performance on ERY. Isotherm data of MIPs well fitted the Freundlich model (from 15 °C to 35 °C), which indicated heterogeneous adsorption for ERY. The ERY adsorption capacity of MIPs was about 52.32 μmol/g at 15 °C. The adsorption kinetics was well described by the pseudo-first-order model, which suggested that physical interactions were primarily responsible for ERY adsorption. The Thomas model used in the fixed-bed adsorption design provided a better fit to the experimental data. Meanwhile, ERY exhibited higher affinity during adsorption on the MIPs compared with the adsorption capacity of azithromycin and chloramphenicol. The MIPs also exhibited excellent regeneration capacity with only about 5.04% adsorption efficiency loss in at least three repeated adsorption-desorption cycles. Copyright © 2015 Elsevier B.V. All rights reserved.
Rey Sanchez, C.; Morin, T. H.; Stefanik, K. C.; Angle, J.; Wrighton, K. C.; Bohrer, G.
2017-12-01
Wetland soils store a great amount of carbon, but also accumulate and emit methane (CH4), a powerful greenhouse gas. To better understand the vertical and horizontal spatial variability of CH4 emissions, we monitored production and fluxes of CH4 in Old Woman Creek, an estuarine wetland of Lake Erie, Ohio, during the growing seasons of 2015 and 2016. Our combined observation methods targeted three different scales: 1) the eddy covariance technique provided continuous high frequency observations integrated over a large spatial footprint; 2) monthly chamber measurements provided sparse point measurements of fluxes in four distinct land-cover types in the wetland: open water, emergent vegetation (Typha spp.), floating vegetation (Nelumbo spp.) and mud flats; and 3) in-situ porewater dialysis samplers, "peepers", provided vertical CH4 concentration data in the soil at the same locations and temporal time steps as the chambers. In addition, we studied gene transcripts to quantify methanogenesis activity along the vertical soil profile. Using integrated chamber and EC measurements, we found an average surface emission rate from Typha, the most abundant vegetated land cover, of 219.4 g CH4-C m-2 y-1, which was much higher than rates reported in similar emergent vegetation types in other wetlands. There was large spatial variation of flux rates, with mud flats having the highest rates of CH4 emission, followed by Nelumbo and Typha patches, and with open water having the lowest emissions. Within the soil column, we applied a numerical model to convert soil methane concentrations to emissions rates. We found that, contrary to current ideas of methane production, most methane was being produced in the well-oxygenated surface soils, probably in anoxic microsites within the oxic layer. Our metatranscriptomic data supported these findings, clearly showing nine times greater methanogenic activity in oxic surface soils relative to deeper anoxic soils. Combined, our results provide
Richter, Jutta G; Muth, Thomas; Li, Jian; Brinks, Ralph; Chehab, Gamal; Koch, Tobias; Siegrist, Johannes; Angerer, Peter; Huscher, Dörte; Schneider, Matthias
2018-02-01
Psychosocial stress at work not only affects the healthy working population, but also workers with chronic diseases. We aimed to investigate the psychosocial work stress levels in patients with systemic lupus erythematosus (SLE) and rheumatoid arthritis (RA). A cross-sectional study applied the Effort-Reward Imbalance (ERI) questionnaire - an internationally established instrument that measures work stress - to patients with SLE and RA who were capable of work and to a group of controls without these diseases. Participants were recruited through rheumatologists in private practices, hospitals, and from self-help groups by personal communication, paper-based flyers, and online advertisements. Because very few studies tested the ERI's applicability in patient groups, with a lack of evidence in patients with inflammatory rheumatic diseases, internal consistency and construct validity of the ERI measure were evaluated. Data came from 270 patients with RA and 247 with SLE, and 178 controls. Patients showed elevated psychosocial stress at work compared to controls. Across the total sample and all groups, satisfactory internal consistencies of the scales effort, reward, and overcommitment were obtained (Cronbach's alpha coefficients > 0.70), and confirmatory factor analysis replicated the theoretical structure of the ERI model (goodness-of-fit index > 0.80). We found elevated psychosocial stress at work in patients with SLE and RA compared to controls by applying the ERI model. Despite some heterogeneity in the sample, we achieved satisfactory psychometric properties of the ERI questionnaire. Our results suggest that the ERI questionnaire is a psychometrically useful tool to be implemented in epidemiological studies of employed patients with SLE and RA.
Loerbroks, Adrian; Meng, Heng; Chen, Min-Li; Herr, Raphael; Angerer, Peter; Li, Jian
2014-01-01
We examined associations of organizational justice (OJ) and effort-reward imbalance (ERI) with burnout and intentions to leave the teaching profession (ILTP) among primary school teachers in China. Six primary schools located in Wuhan, China, were randomly selected from three different socioeconomic areas in 2010. In total, these schools employed 533 teachers, and 436 of these (82 %) participated in a cross-sectional survey. OJ and ERI were assessed by 13-item and 10-item questionnaires, respectively. Burnout was measured using the emotional exhaustion subscale of the Chinese Maslach Burnout Inventory. ILTP were operationalized based on the frequency of thoughts about turnover during the past year. Logistic regression-based odds ratios (ORs) with 95 % confidence intervals (CIs) were estimated separately for OJ and ERI. In a second step, these work stress scales were entered into the same regression model. Separate regression models suggested moderate to strong associations of OJ and ERI with burnout and ILTP. After simultaneous adjustment, the overall OJ score remained associated with burnout and ILTP, but ERI appeared to be the stronger and more consistent determinant of both outcomes. For instance, an increase of 1 standard deviation of the ERI score was associated with an OR of 2.60 (95 % CI 1.97-3.43) for burnout and with an OR of 2.26 (95 % CI 1.66-3.08) for ILTP. Organizational justice and in particular ERI appeared to be determinants of burnout and ILTP among primary school teachers in China.
Earth Radiation Imbalance from a Constellation of 66 Iridium Satellites: Climate Science Aspects
Wiscombe, W.; Chiu, CJ. Y.
2012-01-01
The "global warming hiatus" since the 1998 El Nino, highlighted by Meehl et al., and the resulting "missing energy" problem highlighted by Trenberth et al., has opened the door to a more fundamental view of climate change than mere surface air temperature. That new view is based on two variables which are strongly correlated: the rate of change of ocean heat content d(OHC)/dt; and Earth Radiation Imbalance (ERI) at the top of the atmosphere, whose guesstimated range is 0.4 to 0.9 Watts per square meters (this imbalance being mainly due to increasing CO2). The Argo float array is making better and better measurements of OHC. But existing satellite systems cannot measure ERI to even one significant digit. So, climate model predictions of ERI are used in place of real measurements of it, and the satellite data are tuned to the climate model predictions. Some oceanographers say "just depend on Argo for understanding the global warming hiatus and the missing energy", but we don't think this is a good idea because d(OHC)/dt and ERI have different time scales and are never perfectly correlated. We think the ERB community needs to step up to measuring ERI correctly, just as oceanographers have deployed Argo to measure OHC correctly. This talk will overview a proposed constellation of 66 Earth radiation budget instruments, hosted on Iridium satellites, that will actually be able to measure ERI to at least one significant digit, thus enabling a crucial test of climate models. This constellation will also be able to provide ERI at two-hourly time scales and 500-km spatial scales without extrapolations from uncalibrated narrowband geostationary instruments, using the highly successful methods of GRACE to obtain spatial resolution. This high time resolution would make ERI a synoptic variable like temperature, and allow studies of ERI's response to fast-evolving phenomena like dust storms and hurricanes and even brief excursions of Total Solar Irradiance. Time permitting, we
Sperlich, Stefanie; Geyer, Siegfried
2015-03-01
This study explores the contribution of social and family-related factors to women's experience of an effort-reward imbalance (ERI) in household and family work. Using a population-based sample of German mothers (n = 3,129), we performed stepwise logistic regression analysis in order to determine the relative impact of social and family-related factors on ERI. All factors investigated showed a significant association with at least one ERI component. Considering all predictors simultaneously in the multivariate analysis resulted in a decrease in significance of socioeconomic status in explaining the effort-reward ratio while the impact on low reward partly remained significant. In addition, age of youngest child, number of children, lower levels of perceived social support, domestic work inequity and negative work-to-family spillover, irrespective of being half- or full-time employed, revealed to be important in predicting ERI. The experience of ERI in domestic work is influenced by the social and family environment. Particularly among socially disadvantaged mothers, lack of social recognition for household and family work proved to be a relevant source of psychosocial stress.
[Development of a questionnaire for measuring effort-reward imbalance in household and family work].
Sperlich, Stefanie; Arnhold-Kerri, Sonja; Engelke, Sonja; Noeres, Dorothee; Collatz, Jürgen; Geyer, Siegfried
2009-05-01
Siegrists concept of effort-reward imbalance (ERI) had been shown to be associated with a broad range of health impairments, in particular cardiovascular diseases and depression. The original questionnaire was designed to assess ERI in the field of occupational work. This paper reports on a newly developed questionnaire for the assessment of ERI in household and family work. Analogous to the original version, it is divided into two components: (i) dysbalance of effort and reward (extrinsic component), and (ii) over-commitment (intrinsic components). The questionnaire was tested with data drawn from a clinical sample of mothers (n = 567) in rehabilitation clinics. Factor analyses have reproduced the two main dimensions "effort" and "reward". Relevant aspects of reward at home were (i) meaningfulness, (ii) social gratification, (iii) appreciation from the spouse, and (iv) affection for the child. Finally a 19-item questionnaire for assessing ERI in household and family work (ERI-M) and a four-item measure for measuring parental over-commitment (Over-M) are available. The psychometric properties of both instruments are good to satisfactory.
Gürsoy, Ayşe; Şenel, Ebru; Gürsel, Asuman; Deveci, Organ; Karademir, Ebru; Yaman, Şenay
2001-01-01
Bu çalışmada, yağ içeriği azaltılmış Beyaz peynir örneklerinde, proteolizi teşvik ederek olgunlaşmayı hızlandırmak ve böylece yapı ve tadı iyileştirmek amacıyla, isti işlem uygulanan L.helveticus ve L. bulgaricus kültürlerinden yararlanılmıştır. Bunun için kurumaddede %20 yağ içerecek şekilde peynir üretimi gerçekleştirilmiş, ayrıca karşılaştırma amacıyla yağlı peynir örneği (kurumaddede %40 yağ) de üretilmiştir. Peynirler 7±1 °C'de olgunlaşmaya bırakılarak 0, 7, 15, 30, 60 ve 90. gü...
Directory of Open Access Journals (Sweden)
Korhan USTA
2014-02-01
Full Text Available Eskişehir-Alpu havzasında GB-KD uzanımlı iki horizon halinde kalınlıkları 0,55 ila 31,60 m arasında değişen linyit oluşumlarının varlığı saptanmıştır. Görünür rezerv miktarı yaklaşık 1500 milyon tondur. Üst horizonun ortalama kül içeriği % 36, kükürt içeriği % 1,87, nem ihtivası % 36 ve ortalama kalorifik değeri 1950 kcal/kg’dır. Alt horizonun ortalama kül içeriği % 28, kükürt içeriği % 1,13, nem ihtivası % 32 ve ortalama kalorifik değeri 2150 kcal/kg’dır. Türkiye’nin en büyük üçüncü linyit havzası olan Eskişehir-Alpu linyitlerinin fiziksel ve kimyasal özelliklerinin Türkiye’deki benzer linyit oluşumları ile karşılaştırılması Alpu linyitlerinin önemli ekonomik değere sahip olduğunu gösterir
Mainostoimistojen verkkomainonnan tutkiminen
Vares, Topi
2015-01-01
Tämän opinnäytetyön tarkoituksena oli tutkia kolmea eri mainosalan yritystä, kahta pienempää kokkolalaista sekä yhtä iso helsinkiläistä mainostoimistoa. Työssä selvitettiin, minkälaisia palveluita kyseiset mainostoimistot tarjoavat asiakkaillensa ja kuinka he itse ovat esillä verkossa. Työn teoriaosuudessa käsiteltiin verkkomainontaa ja sen eri muotoja sekä sosiaalisen median eri kanavia ja niiden markkinointimahdollisuuksia. Tutkimusosuudessa käsiteltiin tutkimuksen kohteena olevia maino...
Rantala, Lauri
2011-01-01
Tämän insinöörityön tavoitteena oli tutkia suomalaisen ja venäläisen normiston mukaista tietomallipohjaista rakenne- ja elementtisuunnitteluprosessia sekä Tekla Structures –ohjelmiston soveltuvuutta venäläiseen elementtisuunnitteluun. Insinöörityössä tutkittiin, miten mallinnustyö onnistuu ja onko mallintaminen taloudellisesti kannattavaa. Lisäksi Tekla Structures –ohjelmistoa kehitettiin Rakennesuunnittelutoimisto Sormunen & Timonen Oy:n tarpeiden mukaiseksi. Aluksi työssä per...
2011-12-30
... stormwater management facilities. As such, a drainage easement will be required for PennDOT to maintain... airport to tie into Asbury Road. Parcel 5 is also temporarily impacted while Stormwater Management... constructed outside the limits of the pavement of the widened Asbury Road. This easement will [[Page 82348...
Ehl-i Sünnet Açısından Bilgi ve DeğeriKnowledge and its Value in Terms of the Ahl As-Sunnah
Directory of Open Access Journals (Sweden)
ismail yücedağ
2014-06-01
Full Text Available Kelâm ilmînin amacı, dinî inançları kesin deliller kullanarak ispat etmektir. Bu nedenle kelâmcılar Kur’an’ı ve iki kısma ayırdıkları Sünnet’in ilk kısmında yer alan mütevâtir haberleri esas almışlardır. Kelâm ilminde üç bilgi edinme yolu olduğu kabul edilmiştir. Bunlar, beş duyu, akıl ve haber-i sâdık’tır. Bilgi edinme yollarından ilk ikisini oluşturan beş duyu ve akıl ile elde edilen bilgiler ile Sünnet’in ilk kısmında yer alan mütevâtir haberin değeri konusunda İslâm âlimleri arasında bir ihtilâf söz konusu değildir. Hicretin II. asrından itibaren, sünnetin ikinci kısmını oluşturan haber-i vahid’in değeri ve itikâdî konularda delil teşkil edip etmeyeceği konusunda âlimler tarihsel süreç içinde birbirinden farklı görüşler ortaya koymuşlardır. Böylelikle problem günümüze kadar devam etmiştir. Konu hakkında fikir yürüten âlimler, Kelâmcılar ve Selefiyye olmak üzere iki ana gruba ayrılmışlardır. Bu çalışmanın amacı, haber-i vâhid hakkındaki fikir ayrılıklarının nedenlerini, kelâmcılar tarafından bilgi edinme yollarından biri olarak kabul edilen haber-i sâdıkı dikkate alarak araştırmaktır. Abstract The purpose of the Kalam science is to prove the religious beliefs by using definitive evidences. For this reason, the Kalam scholars are inclined to Koran and the mutawatir reports which are included in the first part of Ahl As-Sunnah divided into two parts. In the Kalam science, it has been accepted that there are three ways of attaining knowledge. These are the five senses, intelligence, and precise reports. It is not the case that Islamic scholars have a disagreement on not only knowledges obtained through the five senses and intelligence but the value of mutawatir reports included in the first part of Ahl As-Sunnah. As of the second century of Hegira, the scholars have put forward different opinions about whether the value of
Energy Technology Data Exchange (ETDEWEB)
Barreto, L.; Kypreos, S.
1999-09-01
Understanding technology dynamics, a fundamental driving factor of the evolution of energy systems, is essential for sound policy formulation and decision making. Technological change is not an autonomous process, but evolves from a number of endogenous interactions within the social system. Technologies evolve and improve only if experience with them is possible. Efforts must be devoted to improve our analytical tools concerning the treatment given to the technological variable, recognising the cumulative and gradual nature of technological change and the important role played by learning processes. This report presents a collection of works developed by the authors concerning the endogenisation of technological change in energy optimisation models, as a contribution to the Energy Technology Dynamics andAdvanced Energy System Modelling Project (TEEM), developed in the framework of the Non Nuclear Energy Programme JOULE III of the European Union (DGXII). Here, learning curves, an empirically observed manifestation of the cumulative technological learning processes, are endogenised in two energy optimisation models. MARKAL, a widely used bottom-up model developed by the ETSAP programme of the IEA and ERIS, a model prototype, developed within the TEEM project for assessing different concepts and approaches. The methodological approach is described and some results and insights derived from the model analyses are presented. The incorporation of learning curves results in significantly different model outcomes than those obtained with traditional approaches. New, innovative technologies, hardly considered by the standard models, are introduced to the solution when endogenous learning is present. Up-front investments in initially expensive, but promising, technologies allow the necessary accumulation of experience to render them cost-effective. When uncertainty in emission reduction commitments is considered, the results point also in the direction of undertaking early
International Nuclear Information System (INIS)
Barreto, L.; Kypreos, S.
1999-09-01
Understanding technology dynamics, a fundamental driving factor of the evolution of energy systems, is essential for sound policy formulation and decision making. Technological change is not an autonomous process, but evolves from a number of endogenous interactions within the social system. Technologies evolve and improve only if experience with them is possible. Efforts must be devoted to improve our analytical tools concerning the treatment given to the technological variable, recognising the cumulative and gradual nature of technological change and the important role played by learning processes. This report presents a collection of works developed by the authors concerning the endogenisation of technological change in energy optimisation models, as a contribution to the Energy Technology Dynamics and Advanced Energy System Modelling Project (TEEM), developed in the framework of the Non Nuclear Energy Programme JOULE III of the European Union (DGXII). Here, learning curves, an empirically observed manifestation of the cumulative technological learning processes, are endogenised in two energy optimisation models. MARKAL, a widely used bottom-up model developed by the ETSAP programme of the IEA and ERIS, a model prototype, developed within the TEEM project for assessing different concepts and approaches. The methodological approach is described and some results and insights derived from the model analyses are presented. The incorporation of learning curves results in significantly different model outcomes than those obtained with traditional approaches. New, innovative technologies, hardly considered by the standard models, are introduced to the solution when endogenous learning is present. Up-front investments in initially expensive, but promising, technologies allow the necessary accumulation of experience to render them cost-effective. When uncertainty in emission reduction commitments is considered, the results point also in the direction of undertaking early
Meie riigi imelised muutumised : ¡[luuletused] / Valeria Ränik
Ränik, Valeria, 1964-
2007-01-01
Sisu: Meie riigi imelised muutumised ; "Nad ütlevad..." ; Konna-eri? Eri-konnad? ; "Kõik huvitav on juba toimunud..." ; "Üks väike Berliinike..." ; "Toomemäel karjuvad linnud..." ; (H)unt ja susi ; "Kartulid..." ; Sind kardan, Tallinn
Raamist välja linnaruum. Fotokonkurss 2015 / Kristel Schwede
Schwede, Kristel, 1963-
2015-01-01
Tallinna noortenädala fotokonkursist "Raamist välja linnaruum 2015". I koht: Samuel Markovich "Rahu". II koht: Anna Kuriljonok "A short history". III koht: Maarika Roosi "Eri lugu - eri raames". Positiivi eriauhind: Vladislava Snurnikova "Trepp"
Energy Technology Data Exchange (ETDEWEB)
Kippler, M. [Institute of Environmental Medicine, Karolinska Institutet, Box 210, SE-171 77 Stockholm (Sweden); Goessler, W. [Institut fuer Chemie-Analytische Chemie, Karl-Franzens-Universitaet, Universitaetsplatz 1, 8010 Graz (Austria); Nermell, B. [Institute of Environmental Medicine, Karolinska Institutet, Box 210, SE-171 77 Stockholm (Sweden); Ekstroem, E.C. [Department of Women' s and Children' s Health, International Maternal and Child Health, Uppsala University, SE-751 85 Uppsala (Sweden); Loennerdal, B. [Department of Nutrition, University of California, Davis, CA 95616 (United States); El Arifeen, S. [International Centre for Diarrhoeal Disease Research, Bangladesh (ICDDR,B), GPO Box 128, Dhaka 100 (Bangladesh); Vahter, M., E-mail: Marie.Vahter@ki.se [Institute of Environmental Medicine, Karolinska Institutet, Box 210, SE-171 77 Stockholm (Sweden)
2009-10-15
Experimental studies indicate that zinc (Zn) and calcium (Ca) status, in addition to iron (Fe) status, affect gastrointestinal absorption of cadmium (Cd), an environmental pollutant that is toxic to kidneys, bone and endocrine systems. The aim of this study was to evaluate how various nutritional factors influence the uptake of Cd in women, particularly during pregnancy. The study was carried out in a rural area of Bangladesh, where malnutrition is prevalent and exposure to Cd via food appears elevated. The uptake of Cd was evaluated by associations between erythrocyte Cd concentrations (Ery-Cd), a marker of ongoing Cd exposure, and concentrations of nutritional markers. Blood samples, collected in early pregnancy and 6 months postpartum, were analyzed by inductively coupled plasma mass spectrometry (ICPMS). Ery-Cd varied considerably (range: 0.31-5.4 {mu}g/kg) with a median of 1.1 {mu}g/kg (approximately 0.5 {mu}g/L in whole blood) in early pregnancy. Ery-Cd was associated with erythrocyte manganese (Ery-Mn; positively), plasma ferritin (p-Ft; negatively), and erythrocyte Ca (Ery-Ca; negatively) in decreasing order, indicating common transporters for Cd, Fe and Mn. There was no evidence of Cd uptake via Zn transporters, but the association between Ery-Cd and p-Ft seemed to be dependent on adequate Zn status. On average, Ery-Cd increased significantly by 0.2 {mu}g/kg from early pregnancy to 6 months postpartum, apparently due to up-regulated divalent metal transporter 1 (DMT1). In conclusion, intestinal uptake of Cd appears to be influenced either directly or indirectly by several micronutrients, in particular Fe, Mn and Zn. The negative association with Ca may suggest that Cd inhibits the transport of Ca to blood.
International Nuclear Information System (INIS)
Kippler, M.; Goessler, W.; Nermell, B.; Ekstroem, E.C.; Loennerdal, B.; El Arifeen, S.; Vahter, M.
2009-01-01
Experimental studies indicate that zinc (Zn) and calcium (Ca) status, in addition to iron (Fe) status, affect gastrointestinal absorption of cadmium (Cd), an environmental pollutant that is toxic to kidneys, bone and endocrine systems. The aim of this study was to evaluate how various nutritional factors influence the uptake of Cd in women, particularly during pregnancy. The study was carried out in a rural area of Bangladesh, where malnutrition is prevalent and exposure to Cd via food appears elevated. The uptake of Cd was evaluated by associations between erythrocyte Cd concentrations (Ery-Cd), a marker of ongoing Cd exposure, and concentrations of nutritional markers. Blood samples, collected in early pregnancy and 6 months postpartum, were analyzed by inductively coupled plasma mass spectrometry (ICPMS). Ery-Cd varied considerably (range: 0.31-5.4 μg/kg) with a median of 1.1 μg/kg (approximately 0.5 μg/L in whole blood) in early pregnancy. Ery-Cd was associated with erythrocyte manganese (Ery-Mn; positively), plasma ferritin (p-Ft; negatively), and erythrocyte Ca (Ery-Ca; negatively) in decreasing order, indicating common transporters for Cd, Fe and Mn. There was no evidence of Cd uptake via Zn transporters, but the association between Ery-Cd and p-Ft seemed to be dependent on adequate Zn status. On average, Ery-Cd increased significantly by 0.2 μg/kg from early pregnancy to 6 months postpartum, apparently due to up-regulated divalent metal transporter 1 (DMT1). In conclusion, intestinal uptake of Cd appears to be influenced either directly or indirectly by several micronutrients, in particular Fe, Mn and Zn. The negative association with Ca may suggest that Cd inhibits the transport of Ca to blood.
An ELMO2-RhoG-ILK network modulates microtubule dynamics.
Jackson, Bradley C; Ivanova, Iordanka A; Dagnino, Lina
2015-07-15
ELMO2 belongs to a family of scaffold proteins involved in phagocytosis and cell motility. ELMO2 can simultaneously bind integrin-linked kinase (ILK) and RhoG, forming tripartite ERI complexes. These complexes are involved in promoting β1 integrin-dependent directional migration in undifferentiated epidermal keratinocytes. ELMO2 and ILK have also separately been implicated in microtubule regulation at integrin-containing focal adhesions. During differentiation, epidermal keratinocytes cease to express integrins, but ERI complexes persist. Here we show an integrin-independent role of ERI complexes in modulation of microtubule dynamics in differentiated keratinocytes. Depletion of ERI complexes by inactivating the Ilk gene in these cells reduces microtubule growth and increases the frequency of catastrophe. Reciprocally, exogenous expression of ELMO2 or RhoG stabilizes microtubules, but only if ILK is also present. Mechanistically, activation of Rac1 downstream from ERI complexes mediates their effects on microtubule stability. In this pathway, Rac1 serves as a hub to modulate microtubule dynamics through two different routes: 1) phosphorylation and inactivation of the microtubule-destabilizing protein stathmin and 2) phosphorylation and inactivation of GSK-3β, which leads to the activation of CRMP2, promoting microtubule growth. At the cellular level, the absence of ERI species impairs Ca(2+)-mediated formation of adherens junctions, critical to maintaining mechanical integrity in the epidermis. Our findings support a key role for ERI species in integrin-independent stabilization of the microtubule network in differentiated keratinocytes. © 2015 Jackson et al. This article is distributed by The American Society for Cell Biology under license from the author(s). Two months after publication it is available to the public under an Attribution–Noncommercial–Share Alike 3.0 Unported Creative Commons License (http://creativecommons.org/licenses/by-nc-sa/3.0).
Around the Way: Testing ΛCDM with Milky Way Stellar Stream Constraints
Dai, Biwei; Robertson, Brant E.; Madau, Piero
2018-05-01
Recent analyses of the Pal 5 and GD-1 tidal streams suggest that the inner dark matter halo of the Milky Way is close to spherical, in tension with predictions from collisionless N-body simulations of cosmological structure formation. We use the Eris simulation to test whether the combination of dissipative physics and hierarchical structure formation can produce Milky Way–like galaxies whose dark matter halos match the tidal stream constraints from the GD-1 and Pal 5 clusters. We use a dynamical model of the simulated Eris galaxy to generate many realizations of the GD-1 and Pal 5 tidal streams, marginalize over observational uncertainties in the cluster galactocentric positions and velocities, and compare with the observational constraints. We find that the total density and potential of Eris contributed by baryons and dark matter satisfies constraints from the existing Milky Way stellar stream data, as the baryons both round and redistribute the dark matter during the dissipative formation of the galaxy, and provide a centrally concentrated mass distribution that rounds the inner potential. The Eris dark matter halo or a spherical Navarro–Frenk–White dark matter work comparably well in modeling the stream data. In contrast, the equivalent dark matter–only ErisDark simulation produces a prolate halo that cannot reproduce the observed stream data. The ongoing Gaia mission will provide decisive tests of the consistency between {{Λ }}{CDM} and Milky Way streams, and should distinguish between models like Eris and more spherical halos.
ÇEVRESEL FAKTÖRLERiN SİYAH-ALACA SIĞIRDA SÜTÜN PROTEİN KOMPOZİYONUNA ETKİLERİ
ÇARDAK, Ayşe Deniz
2008-01-01
Çalışmada Siyah-Alaca sığırlarda sütün protein içeriği ve komposizyonuna mevsim, laktasyon sayısı, laktasyon dönemi ve somatik hücre sayısının (SHS) etkileri araştırılmıştır. Laktasyon boyunca toplanan süt örneklerinde protein fraksiyonları Poliakrilamid-Jel-Elektroforezi’nde ayrılmış ve densitometre yardımıyla her bir protein fraksiyonunun içeriği belirlenmiştir. Sütün protein içeriğine mevsim, laktasyon dönemi ve SHS’nın etkileri önemli bulunmuştur. αS1-kazein (-Cn) içeriğine mevsim, laktas...
KURU YONCANIN RUMENDEKİ SİLİALI PROTOZOONLAR ÜZERİNDEKİ ETKİSİ
KOCABATMAZ, Mehmet; DURGUN, Zafer; EKSEN., Mursayettin
1987-01-01
Bu araştırma kuru yoncanın rumen içeriği pH'sı ve silialı protozoonların sayıları üzerindeki etkisini incelemek için yapıldı.Araştırmada biri rumen fistüllü diğeri rumen kanüllü iki Akkaraman koyun kullanıldı. Hayvanlar kuru yonca ve su ile ad. libitum olarak beslendi.Rumen içeriği örnekleri plastik hortum ile fistül ve kanülden girilerek alındı. Rumen içeriği pH'sı elektrometrik yolla hemen ölçüldü. Rumeniçerikli Formalin de tespit edildikten sonra, silialı protozoonların sayıları ...
Effort-reward imbalance at work and the risk of antidepressant treatment in the Danish workforce
DEFF Research Database (Denmark)
Nielsen, Maj Britt D.; Madsen, Ida E. H.; Aust, Birgit
2016-01-01
Background: Previous studies have shown that high effort-reward imbalance (ERI) at work is a risk factor for the onset of self-reported depressive symptoms. In this study, we examined whether ERI predicts risk of treatment with antidepressant medication in a representative sample of the Danish...... workforce. Methods: We linked survey data on ERI and covariates of 4541 participants from the Danish Work Environment Cohort Study 2000 with the Danish National Prescription Registry that includes all legally purchased prescription drugs at pharmacies in Denmark since 1995. Participants with a history....... Results: A total of 309 (6.8%) participants started antidepressant treatment during follow-up. Exposure to ERI at baseline was not related to risk of antidepressant treatment (hazard ratio: 0.91, 95% CI=0.81–1.03 after adjustment for potential confounders). Limitations: The use of antidepressant treatment...
Aineenkoetuskoneen kehittäminen tutkimus- ja opetuskäyttöön
Lassila, Mika
2016-01-01
Tässä opinnäytetyössä tutustuttiin Centria-ammattikorkeakoulun konelaboratoriossa käytössä olevaan aineenkoetuskoneeseen ja sen käyttöön. Työssä käytiin lyhyesti läpi eri tyyliset aineenkoetuskoneet ja perehdyttiin tarkasti vetokokeeseen. Vetokoe on olennainen osa materiaalitekniikkaa ja sen avulla saadaan hyvin paljon tietoa eri materiaaleista ja kappaleista. Työssä käytiin läpi vetokokeen eri arvojen määrittäminen ja tutustuttiin vetokokeessa käytettäviin koesauvoihin. Aineenkoetuskonee...
Lõugas, Anne, 1951-
1998-01-01
Eestiga seotud vanema kunsti kogu on kujunenud välja eri ajaetappidel ja eri allikatest. Käsitletakse 1939-1944 Eestist väljaviidud kunstiteoseid, kirjandust baltisakslaste ümberasumisest. Poznani Rahvusmuuseumis asuvate Eestiga seotud baltisaksa maalide nimekiri lk. 205-219
DEFPOS Tayfölçeri ve Bazı İyonize Olmuş Kaynakların Hα Tayfları
Directory of Open Access Journals (Sweden)
Muhittin ŞAHAN
2017-08-01
Full Text Available Bu çalışma, DEFPOS tayfölçeri, veri indirgeme teknikleri, parlaklık kalibrasyonu ve gökadamızın dört farklı iyonize olmuş bölgesinden (NGC6530, NGC1973, NGC1501, NGC6514 alınan Hα (6563Å tayfları hakkında detaylı bilgi vermektedir. Gözlemlerde 600s ile 3600s arasında değişen uzun poz süreleri kullanılmıştır. Tayflar, kaynakların çizgi genişlikleri, LSR hızları ve parlaklıkları hakkında bilgi sağlamaktadır. Bu tayflardan, yapıların LSR’a göre hızları ve parlaklıkları sırasıyla, NGC6530 için 11.80±0.2 km/s ve 24409.70±16.8 R, NGC1973 (Sh2-279 için 13.65±0.7 km/s ve 477.87±3.2 R, NGC1501 için -26.26±2.6 km/s ve 255.13±4.5 R ve NGC6514 için 14.43±0.2 km/s ve 1856.71±0.6 R olarak bulunmuştur. Ayrıca, her salma kaynağı için parlaklık değerleri kullanarak salma ölçüleri hesaplanmıştır. Bazı sonuçlar, literatürden elde edilen değerlerle karşılaştırılmıştır. Literatürde düşük açısal genişliğe sahip olan bu tür kaynakların parlaklık ve LSR hızları hakkında yeterli bilgi bulunmadığından, DEFPOS ile elde edilen verilerinin literatüre katkı sağlayacağını düşünmekteyiz.
Mahtras saab näha ja kuulda "Mahtra sõda" / Tõnu Tamm
Tamm, Tõnu
2008-01-01
30. mail Raplamaal Juurus ajaloolise Atla-Eeru kõrtsi ees toimuvast "Mahtra sõja" ettelugemisest. Mahtra sõja 150. aastapäevale pühendatud lugemisetendust lavastab Ago-Endrik Kerge. Loevad näitlejad koos eri vanuses ja eri paigust vabatahtlikega
2013-08-30
... Environmental Health Risks and Safety Risks. This rule is not an economically significant rule and does not create an environmental risk to health or risk to safety that may disproportionately affect children. 11... mitigate the dangers presented by this event, the Captain of the Port Detroit has determined that a safety...
A short generic measure of work stress in the era of globalization: effort-reward imbalance.
Siegrist, Johannes; Wege, Natalia; Pühlhofer, Frank; Wahrendorf, Morten
2009-08-01
We evaluate psychometric properties of a short version of the original effort-reward imbalance (ERI) questionnaire. This measure is of interest in the context of assessing stressful work conditions in the era of economic globalization. In a representative sample of 10,698 employed men and women participating in the longitudinal Socio-Economic Panel (SOEP) in Germany, a short version of the ERI questionnaire was included in the 2006 panel wave. Structural equation modeling and logistic regression analysis were applied. In addition to satisfactory internal consistency of scales, a model representing the theoretical structure of the scales provided the best data fit in a competitive test (RMSEA = 0.059, CAIC = 4124.19). Scoring high on the ERI scales was associated with elevated risks of poor self-rated health. This short version of the ERI questionnaire reveals satisfactory psychometric properties, and can be recommended for further use in research and practice.
Energy Technology Data Exchange (ETDEWEB)
Lauhanen, R.; Suojaranta, J.; Raety, H.; Petaeinen, J.
2009-07-01
There were at least 327 heating entrepreneurs responsible for fuel procurement and heating production in Finland at the end of 2007 according to TTS Research. Recently, the expansion of bio energy business has become a large one. This new business, however, may contain many risks, too. There have been discussions on the well-being and work safety of heating entrepreneurs and farmers in the South Ostrobothnia. In order to avoid the occupational risks and accidents of farmers and heating entrepreneurs, this study aimed at finding out the occupational risks and work safety of this target group. The study was funded by the Work safety funds of the Finnish Mela organization (http://www.mela.fi) and by Seinaejoki University of Applied Sciences /http://seamk.fi). A questionnaire for 328 farmers and heating entrepreneurs was carried out in the spring 2008. In addition, study visits to ten sampled heating plants in South Ostrobothnia were carried out. The farmers and heating entrepreneurs were interviewed and the work conditions were measured and determined on the heating plants with the maximal effectiveness of 1 MW. Domestic renewable forest energy is a possibility in the rural areas of Finland. The heating entrepreneurs and farmers used to be in a hurry according to questionnaires. The weak profitability and the changing bio energy policies were problems in the heating entrepreneurship. The occupational accidents had occured, especially, in energy-wood logging operations and when fuel wood was prepared mechanically. Occupational accidents had also occured in the repairing of forest machines, chippers and trucks, and in the repairing of the heating plant facilities. The passageways of the heating plants should be planned more carefully according to the interviews. The loud of 64-81 dB, the mean temperature of 28,3 Celsius degrees and mean air humidity of 26% were measured in the investigated heating plants. Especially, advice and training in safe energy wood logging will be needed by the heating entrepreneurs and farms. In addition, the target group is in the need of advice in the fire safety of heating plants. (orig.)
Li, Jian; Weigl, Matthias; Glaser, Jürgen; Petru, Raluca; Siegrist, Johannes; Angerer, Peter
2013-12-01
We examined the impact of changes in the psychosocial work environment on depressive symptoms in a sample of junior physicians, a high risk group for stress and mental disorders. This is a three-wave prospective study in 417 junior physicians during their residency in German hospitals. The psychosocial work environment was measured by the Effort-Reward Imbalance (ERI) Questionnaire at Waves 1 and 2, and the depressive symptoms were assessed with the State-Trait Depression Scales at all three waves. Multivariate linear regression was applied for prospective associations between ERI across Waves 1 and 2, and baseline-adjusted depressive symptoms at Wave 3. Compared with the ERI scores at Wave 1, at Wave 2, and mean scores between the two waves, the baseline-adjusted ERI change scores between the two waves showed slightly better statistical power, predicting depressive symptoms at Wave 3 (β = 0.78, 95% CI = 0.38-1.18 for increased ERI per SD, β = 0.64, 95% CI = 0.22-1.06 for increased effort per SD, β = -0.65, 95% CI = -1.06 to -0.24 for increased reward per SD, and β = 0.68, 95% CI = 0.27-1.09 for increased overcommitment per SD). Negative changes in the psychosocial work environment, specifically increased ERI, are associated with depressive symptoms in German junior physicians. Reducing the non-reciprocity of working life, particularly improving reward at work, may have beneficial effects on prevention of mental health problems in the hospital workplace. © 2013 Wiley Periodicals, Inc.
Rasmussen, Victoria; Turnell, Adrienne; Butow, Phyllis; Juraskova, Ilona; Kirsten, Laura; Wiener, Lori; Patenaude, Andrea; Hoekstra-Weebers, Josette; Grassi, Luigi
2016-01-01
Objectives Burnout is a significant problem among healthcare professionals working within the oncology setting. This study aimed to investigate predictors of emotional exhaustion (EE) and depersonalisation (DP) in psychosocial oncologists, through the application of the effort–reward imbalance (ERI) model with an additional focus on the role of meaningful work in the burnout process. Methods Psychosocial oncology clinicians (n = 417) in direct patient contact who were proficient in English were recruited from 10 international psychosocial oncology societies. Participants completed an online questionnaire, which included measures of demographic and work characteristics, EE and DP subscales of the Maslach Burnout Inventory-Human Services Survey, the Short Version ERI Questionnaire and the Work and Meaning Inventory. Results Higher effort and lower reward were both significantly associated with greater EE, although not DP. The interaction of higher effort and lower reward did not predict greater EE or DP. Overcommitment predicted both EE and DP but did not moderate the impact of effort and reward on burnout. Overall, the ERI model accounted for 33% of the variance in EE. Meaningful work significantly predicted both EE and DP but accounted for only 2% more of the variance in EE above and beyond the ERI model. Conclusions The ERI was only partially supported as a useful framework for investigating burnout in psychosocial oncology professionals. Meaningful work may be a viable extension of the ERI model. Burnout among health professionals may be reduced by interventions aimed at increasing self-efficacy and changes to the supportive work environment. PMID:26239424
4-center STO interelectron repulsion integrals with Coulomb Sturmians
DEFF Research Database (Denmark)
Avery, James Emil; Avery, John Scales
2018-01-01
Abstract We present a method for evaluating 4-center electron repulsion integrals (ERI) for Slater-type orbitals by way of expansions in terms of Coulomb Sturmians. The ERIs can then be evaluated using our previously published methods for rapid evaluation of Coulomb Sturmians through hyperspherical...
Effort-Reward Imbalance at Work and Risk of Long-Term Sickness Absence in the Danish Workforce
Nielsen, Maj Britt D.; Madsen, Ida E. H.; Bultmann, Ute; Aust, Birgit; Burr, Hermann; Rugulies, Reiner
Objective: To examine whether effort-reward imbalance (ERI) at work predicts onset of register-based long-term sickness absence (LTSA) in a representative sample of the Danish workforce. Methods: We measured effort, reward, ERI, and covariates with self-administered questionnaires in a sample of
Verkuyten, Maykel
2016-01-01
This article proposes a further conceptualization of ethnic and racial identity (ERI) as a fundamental topic in developmental research. Adding to important recent efforts to conceptually integrate and synthesize this field, it is argued that ERI research will be enhanced by more fully considering
Kotiautomaatiojärjestelmien vertailu : KNX, Delta Dore, EBTS ja Ouman Plus
Kylliäinen, Juho
2013-01-01
Opinnäytetyön tavoitteena oli tutustua eri kotiautomaatiojärjestelmiin ja sitä kautta saada apua omaan myyntiin. Kotiautomaatiojärjestelmät ovat yleistymässä ja on hyvä tietää, mitä tarjota asentajille, kun on perehtynyt eri kotiautomaatiojärjestelmiin. Asentajan on helppoa päättää tekstin perusteella mitä järjestelmää kannattaa alkaa tutkia tarkemmin. Apua tekstistä löytyy myös normaaleille kuluttajille. Opinnäytetyössä perehdyin neljään eri kotiautomaatiojärjestelmään lukemalla järjestel...
Directory of Open Access Journals (Sweden)
Takahiro Kuragano
Full Text Available It has been reported that hyporesponsiveness to erythropoiesis-stimulating agent (ESA is associated with adverse events in patients on maintenance hemodialysis (MHD. However, it has not been determined whether higher iron storage is associated with an improved response, including better survival, to ESA.We measured serum ferritin, hemoglobin (Hb, and transferrin saturation (TSAT levels every three months for two years in 1,095 MHD patients. The weekly dose of ESA to Hb ratio was also calculated as an index of ESA responsiveness (ERI.A significant correlation (p280; however, serum ferritin and TSAT levels did not predict a higher ERI. In the time-dependent Cox hazard model, the risk for a composite event in the patients with a high ERI (≥280 and a high ferritin level (≥100 ng/mL was significantly greater (hazard ratio [HR], 2.09, P = 0.033 than that for patients with a high ERI and a low ferritin (<100 ng/mL level.Hb was dependent upon ferritin levels in patients with ferritin levels <50 ng/mL but not in patients with ferritin levels ≥50 ng/mL. Patients with hyporesponsiveness to ESA had a greater risk of composite events, but ERI was unrelated to iron storage.
Scenario Evaluator for Electrical Resistivity survey pre-modeling tool
Terry, Neil; Day-Lewis, Frederick D.; Robinson, Judith L.; Slater, Lee D.; Halford, Keith J.; Binley, Andrew; Lane, John W.; Werkema, Dale D.
2017-01-01
Geophysical tools have much to offer users in environmental, water resource, and geotechnical fields; however, techniques such as electrical resistivity imaging (ERI) are often oversold and/or overinterpreted due to a lack of understanding of the limitations of the techniques, such as the appropriate depth intervals or resolution of the methods. The relationship between ERI data and resistivity is nonlinear; therefore, these limitations depend on site conditions and survey design and are best assessed through forward and inverse modeling exercises prior to field investigations. In this approach, proposed field surveys are first numerically simulated given the expected electrical properties of the site, and the resulting hypothetical data are then analyzed using inverse models. Performing ERI forward/inverse modeling, however, requires substantial expertise and can take many hours to implement. We present a new spreadsheet-based tool, the Scenario Evaluator for Electrical Resistivity (SEER), which features a graphical user interface that allows users to manipulate a resistivity model and instantly view how that model would likely be interpreted by an ERI survey. The SEER tool is intended for use by those who wish to determine the value of including ERI to achieve project goals, and is designed to have broad utility in industry, teaching, and research.
Using Multi-media Modeling to Investigate Conditions Leading to Harmful Algal Blooms
Lake Erie is the twelfth largest lake in the world and provides drinking water to over 11 million people in the United States. 22,720 square miles of varying landcover (e.g., urban, agriculture) drain directly into Lake Erie. Harmful algal blooms (HABs) have historically been an ...
Directory of Open Access Journals (Sweden)
Krstić Milena
2016-01-01
Full Text Available Background/Aim. The first case of human Lyme borreliosis (LB in Serbia was recorded in 1987. The number of reported LB cases has increased in the past decade. The aim of this study was to estimate the density of Ixodes ricinus (I. ricinus ticks, the prevalence of Borrelia burgdorferi sensu lato (B. burgdorferi in them, and entomological risk index (ERI at 19 Belgrade localities which were grouped into three categories (forests, parkforests, parks. The values of ERI were compared with the number of tick bites in humans. Methods. Ticks were collected monthly by using the flag hours method and the infection rate was determined by using dark field microscopy. The ERI value was calculated for each locality where the ticks were collected. The related data about tick bites was obtained from the patient protocol of the Institute of Epidemiology, Military Medical Academy, Belgrade. Results. The total number of collected ticks, the number of nymphs and the infection rates of the nymphs were significantly higher in forests (p < 0.05 than park-forests and parks. Statistically, the ERI value was significantly higher in forests than parks of Belgrade (χ2 = 7.78, p < 0.01. In March and July, the ERI value was also significantly higher in forests, than park-forests (p < 0.01 and parks (p < 0.01. May was the month with the highest ERI value in each ecological category (forests p < 0.05; park-forests p < 0.01; parks p < 0.001. However, the number of tick bites in humans did not correlate with ERI values. Conclusion. The obtained results indicate that the risk of tick bite and human exposure to B. burgdorferi sensu lato is present at all selected localities in Belgrade. For a more comprehensive Lyme disease risk assessment the method of entomological risk index assessment should be combined with other methods, taking into consideration all tick stages and the behaviour and habits of people who may get infected B. burgdorferi sensu lato.
Effort reward imbalance, and salivary cortisol in the morning
DEFF Research Database (Denmark)
Eller, Nanna Hurwitz; Nielsen, Søren Feodor; Blønd, Morten
2012-01-01
Effort reward imbalance (ERI) is suggested to increase risk for stress and is hypothesized to increase cortisol levels, especially the awakening cortisol response, ACR.......Effort reward imbalance (ERI) is suggested to increase risk for stress and is hypothesized to increase cortisol levels, especially the awakening cortisol response, ACR....
Reviewing the effort-reward imbalance model: drawing up the balance of 45 empirical studies
Vegchel, van N.; Jonge, de J.; Bosma, H.; Schaufeli, W.B.
2005-01-01
The present paper provides a review of 45 studies on the Effort–Reward Imbalance (ERI) Model published from 1986 to 2003 (inclusive). In 1986, the ERI Model was introduced by Siegrist et al. (Biological and Psychological Factors in Cardiovascular Disease, Springer, Berlin, 1986, pp. 104–126; Social
Self-Interest and the Common Good in Book I of Homer's Iliad
Directory of Open Access Journals (Sweden)
Humphrey, J. Fred
2009-03-01
Full Text Available If you recall Homer's Iliad, you will remember that the poem, as we are often told, is the story of the Trojan War. The mythological background of the war is tied to a most unlikely source - namely, "the judgment of Paris." All the gods and goddesses, according to the poets, with the exception Eris (the goddess of strife or discord, were invited to the wedding of Thetis and Peleus. When Eris tried to attend the celebration, she was turned away. To spite those who had denied her entrance, Eris tossed a golden apple inscribed with the words, "To the Fairest," amongst the goddesses attending the wedding festivities.
Kadõrov haarab Tšetšeeniat täielikult enda kontrolli alla / Igor Taro
Taro, Igor
2008-01-01
Tšetšeenia presidendi Ramzan Kadõrovi ja Venemaa võimude vaheline konflikt tekkis, kui Gudermesi linna lähedal puhkenud tulevahetuses Vene eriüksuse ja kadõrovlaste vahel hukkus kaks eriüksuse võitlejat. Kadõrovi soovist lahti saada Venemaa kaitseministeeriumile alluvatest Vene vägedest
Directory of Open Access Journals (Sweden)
Adrian Loerbroks
2016-04-01
Full Text Available Abstract Background Work stress may impair physicians’ ability to provide high quality patient care. Prior research remains however sparse and has insufficiently explored explanations for this relationship. It has been suggested that physicians’ poor mental health is one potential explanatory factor. We drew on a well-established model to measure work stress (the effort-reward imbalance [ERI] model in order to test this hypothesis. Further, to address another research gap and to potentially inform the development of better-targeted interventions, we aimed to examine associations of individual ERI constructs with the quality of care. Methods We used cross-sectional data, which had been collected in 2014 among 416 physicians in Germany. ERI constructs (i.e. effort, reward, the ERI ratio, and overcommitment were measured by the established 23-item questionnaire. Physicians’ perceptions of quality of care were assessed by a six-item instrument inquiring after poor care practices or attitudes. Physicians’ mental health was operationalized by the state scale of the Spielberger's State-Trait Depression Scales. We used both continuous and categorized dependent and independent variables in multivariable linear and logistic regression analyses. Results Both an increasing ERI ratio and increasing effort were associated with poorer quality of care while increasing rewards were related to better care. Physicians’ depressive symptoms did not affect these associations substantially. Associations with overcommitment were weak and attenuated to non-significant levels by correction for depressive symptoms. The level of overcommitment did not modify associations between the ERI ratio and quality of care. Conclusions Our study suggests that high work-related efforts and low rewards are associated with reports of poorer patient care among physicians, irrespectively of physicians’ depressive symptoms. Quality of patient care may thus be improved by
Sommar, Johan Nilsson; Pettersson-Kymmer, Ulrika; Lundh, Thomas; Svensson, Olle; Hallmans, Göran; Bergdahl, Ingvar A
2014-02-01
Several studies have investigated the relation between bone mass density and cadmium exposure, but only few studies have been performed on fractures and biomarkers of cadmium. This study analyzed the association between hip fracture risk and cadmium in erythrocytes (Ery-Cd). Prospective samples from the Northern Sweden Health and Disease Study's biobank were used for 109 individuals who later in life had sustained a low-trauma hip fracture, matched with two controls of the same age and gender. The mean concentration of Ery-Cd (±SD) in case samples was 1.3 ± 1.4 versus 0.9 ± 1.0 μg/L in controls. The odds ratio (OR) was 1.63 [95% confidence interval (CI) 1.10-2.42] for suffering a hip fracture for each microgram per liter increase in Ery-Cd. However, when taking smoking into consideration (never, former, or current), neither Ery-Cd nor smoking showed a statistically significant increase in fracture risk. Using multiple conditional logistic regression with BMI, height, and smoking, the estimated OR for a 1-μg/L increase in Ery-Cd was 1.52 (95% CI 0.77-2.97). Subgroup analysis showed an increased fracture risk among women (OR = 1.94, 95% CI 1.18-3.20, for a 1 μg/L increase), which also remained in the multiple analysis (OR = 3.33, 95% CI 1.29-8.56). This study shows that fracture risk is associated with Ery-Cd. It is, however, not possible to draw firm conclusions on whether cadmium is the causal factor or whether other smoking-related factors cause this association. Subgroup analysis shows that cadmium is a risk factor for hip fracture among women.
Probing dark matter with star clusters: a dark matter core in the ultra-faint dwarf Eridanus II
Contenta, Filippo; Balbinot, Eduardo; Petts, James A.; Read, Justin I.; Gieles, Mark; Collins, Michelle L. M.; Peñarrubia, Jorge; Delorme, Maxime; Gualandris, Alessia
2018-05-01
We present a new technique to probe the central dark matter (DM) density profile of galaxies that harnesses both the survival and observed properties of star clusters. As a first application, we apply our method to the `ultra-faint' dwarf Eridanus II (Eri II) that has a lone star cluster ˜45 pc from its centre. Using a grid of collisional N-body simulations, incorporating the effects of stellar evolution, external tides and dynamical friction, we show that a DM core for Eri II naturally reproduces the size and the projected position of its star cluster. By contrast, a dense cusped galaxy requires the cluster to lie implausibly far from the centre of Eri II (>1 kpc), with a high inclination orbit that must be observed at a particular orbital phase. Our results, therefore, favour a DM core. This implies that either a cold DM cusp was `heated up' at the centre of Eri II by bursty star formation or we are seeing an evidence for physics beyond cold DM.
Li, Jian; Yang, Wenjie; Cheng, Yawen; Siegrist, Johannes; Cho, Sung-Il
2005-04-01
The aim of this study was to test the reliability and validity of the Chinese version of the 23-item effort-reward imbalance (ERI) questionnaire and to analyze its association with job dissatisfaction in a sample of Chinese healthcare workers. A self-reported survey was conducted, in university hospitals of China, among 192 male and 608 female healthcare workers. Appropriate internal consistencies of the three scales: effort, reward, and overcommitment, were obtained. Exploratory factor analysis replicated the theoretically assumed structure of the ERI construct in men and women. Evidence of criterion validity was obtained from cross-correlations of the scales and from their correlations with gender, education and job dissatisfaction. Finally, all three scales were associated with an elevated odds ratio of job dissatisfaction, and the effect was strongest for the ERI ratio as predicted by theory. Based on the results of this study the Chinese version of the ERI questionnaire is considered a reliable and valid instrument for measuring psychosocial stress at work. It is applicable to Chinese working populations and, in particular, to the healthcare sector.
Peer Influence on Ethnic-Racial Identity Development: A Multi-Site Investigation.
Santos, Carlos E; Kornienko, Olga; Rivas-Drake, Deborah
2017-05-01
The peer context features prominently in theory, and increasingly in empirical research, about ethnic-racial identity (ERI) development, but no studies have assessed peer influence on ERI using methods designed to properly assess peer influence. We examined peer influence on ERI centrality, private, and public regard using longitudinal social network analysis. Data were drawn from two sites: a predominantly Latina/o Southwestern (SW) school (N = 1034; Mage = 12.10) and a diverse Midwestern (MW) school (N = 513; Mage = 11.99). Findings showed that peers influenced each other's public regard over time at both sites. However, peer influence on centrality was evident in the SW site, whereas peer influence on private regard was evident in the MW site. Importantly, peer influence was evident after controlling for selection effects. Our integration of developmental, contextual, and social network perspectives offers a fruitful approach to explicate how ERI content may shift in early adolescence as a function of peer influence. © 2017 The Authors. Child Development © 2017 Society for Research in Child Development, Inc.
Madonna : Ray of light. Princessa / Koit Raudsepp
Raudsepp, Koit
1998-01-01
Plaadiarvustused. : Princessa. Yngvie Malmsteen : Facing the animal. Usher : My way. Cornershop : When I was born for the 7th time. Haddaway : Lets do it now. Black Grape : Stupid stupid stupid. Guano Apes : Proud like a God. Propellerheads : Decksandrumsandrockandroll. Delinquent Habits : Here come the horns. Two : Voyeurs. Eri esitajad : I know what you did last summer. Eri esitajad
Õunpuu ränk heitlus elu ja kunsti nimel / Jaan Ruus
Ruus, Jaan, 1938-2017
2009-01-01
Eesti mängufilm "Püha Tõnu kiusamine", režissöör Veiko Õunpuu. Lisaks "Räägitakse: Püha Tõnu eri", milles tsiteeritakse eri väljaannetes ilmunut. Oma paarilauselise arvamuse ütlevad Valle-Sten Maiste, Kristiina Davidjants, Lauri Kärk, Taavi Eelmaa, Andres Laasik, Maris Meiessaar, Veiko Õunpuu, Berk Vaher, Trash
Sperlich, Stefanie; Barre, Felix; Otto, Friederike
2016-02-01
Recently, the concept of effort-reward imbalance (ERI) developed by Siegrist had been applied to unpaid household and family work (ERI-HF). Evidence suggests that the imbalance between effort spent and reward received in family and domestic labor is associated with poor mental and physical health. However, so far, the adopted questionnaire ERI-HF was exclusively used among women in childcare responsibility. This paper reports on the application of the model to men in childcare responsibility using data from a clinical sample of fathers in rehabilitation clinics (N=415). Analogous to the original version, ERI-HF is divided into 2 components: (i) dysbalance of effort and reward, and (ii) overcommitment. For both components, confirmatory factor analyses revealed good to satisfactory properties. Overall, 13.4% of men in childcare responsibility showed a dysbalance between high effort and low reward of household and family work. High levels of effort were more frequently reported than high levels of low reward. With percentages ranging between 24.3 and 59.6%, a significant proportion of fathers reported difficulties to withdraw from household and family work obligations. Analyses of construct validity revealed significant associations between ERI and socio-demographic factors (number of children, employment status, single fatherhood, work-family-conflict) as well as subjective health. Taken together, our findings suggest that the instrument is applicable to men in childcare responsibility. © Georg Thieme Verlag KG Stuttgart · New York.
Dicty_cDB: Contig-U16126-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available gariensis ... 52 0.090 1 ( FD694085 ) CBHY4909.fwd CBHY Mycosphaerella fijiensis ...eri f. nagariensis ... 50 0.35 1 ( FD674561 ) CBHU3431.fwd CBHU Mycosphaerella fijiensis MfEST3... 50 0.35 1...eri f. nagariensis i... 48 1.4 1 ( FD689804 ) CBHY2454.fwd CBHY Mycosphaerella fijiensis MfEST5... 48 1.4 1
33 CFR 100.901 - Great Lakes annual marine events.
2010-07-01
... Table 1 must still submit an application each year in accordance with 33 CFR 100.15. (a) The Coast Guard...°37′45″ W, thence along the shoreline to the West Pier Head Light (LLNR 2080). We Love Erie Days Fireworks Sponsor: We Love Erie Days Festival, Inc. Date: 3rd weekend of August. Location: That portion of...
Maailmakülas kõlab talvemuusika
2006-01-01
Kontsertidest Maailmaküla muusikafestivali raames: Johansonid 15. nov. Eesti eri paikades, ansambel Metsatöll 6. dets.Tartus Vanemuise kontserdimajas ning Metsatöll ja Rahvusmeeskoor 7. dets. Tallinnas Rock Cafés, ansamblid Oort, Vägilased ja Svjata Vatra 8. dets. Rock Cafés, segakoor Noorus alustab kontserte 9. detsembril kavaga "Lapsemeelsed jõulud" Eesti eri paikades
Söylemez, Meshude Akbulut; Barsbay, Murat; Güven, Olgun
2018-01-01
Radiation-induced RAFT polymerization technique was applied to synthesize well-defined molecularly imprinted polymers (MIPs) of erythromycin (ERY). Methacrylic acid (MAA) was grafted onto porous polyethylene (PE)/polypropylene (PP) nonwoven fabrics, under γ-irradiation by employing 2-pheny-2-propyl benzodithioate as the RAFT agent and ethylene glycol dimethacrylate (EGDMA) as the crosslinker. MAA/erythromycin ratios of 2/1, 4/1, 6/1 were tested to optimize the synthesis of MIPs. The highest binding capacity was encountered at a MAA/ERY ratio of 4/1. Non-imprinted polymers (NIPs) were also synthesized in the absence of ERY. The MIPs synthesized by RAFT method presented a better binding capacity compared to those prepared by conventional method where no RAFT agent was employed.
Kowalski, Kurt P.; Wiley, Michael J.; Wilcox, Douglas A.
2014-01-01
Fish and plant assemblages in the highly modified Crane Creek coastal wetland complex of Lake Erie were sampled to characterize their spatial and seasonal patterns and to examine the implications of the hydrologic connection of diked wetland units to Lake Erie. Fyke netting captured 52 species and an abundance of fish in the Lake Erie–connected wetlands, but fewer than half of those species and much lower numbers and total masses of fish were captured in diked wetland units. Although all wetland units were immediately adjacent to Lake Erie, there were also pronounced differences in water quality and wetland vegetation between the hydrologically isolated and lake-connected wetlands. Large seasonal variations in fish assemblage composition and biomass were observed in connected wetland units but not in disconnected units. Reestablishment of hydrologic connectivity in diked wetland units would allow coastal Lake Erie fish to use these vegetated habitats seasonally, although connectivity does appear to pose some risks, such as the expansion of invasive plants and localized reductions in water quality. Periodic isolation and drawdown of the diked units could still be used to mimic intermediate levels of disturbance and manage invasive wetland vegetation.
Krause, Niklas; Burgel, Barbara; Rempel, David
2010-01-01
The literature on psychosocial job factors and musculoskeletal pain is inconclusive in part due to insufficient control for confounding by biomechanical factors. The aim of this study was to investigate prospectively the independent effects of effort-reward imbalance (ERI) at work on regional musculoskeletal pain of the neck and upper extremities of call center operators after controlling for (i) duration of computer use both at work and at home, (ii) ergonomic workstation design, (iii) physical activities during leisure time, and (iv) other individual worker characteristics. This was a one-year prospective study among 165 call center operators who participated in a randomized ergonomic intervention trial that has been described previously. Over an approximate four-week period, we measured ERI and 28 potential confounders via a questionnaire at baseline. Regional upper-body pain and computer use was measured by weekly surveys for up to 12 months following the implementation of ergonomic interventions. Regional pain change scores were calculated as the difference between average weekly pain scores pre- and post intervention. A significant relationship was found between high average ERI ratios and one-year increases in right upper-extremity pain after adjustment for pre-intervention regional mean pain score, current and past physical workload, ergonomic workstation design, and anthropometric, sociodemographic, and behavioral risk factors. No significant associations were found with change in neck-shoulder or left upper-extremity pain. This study suggests that ERI predicts regional upper-extremity pain in -computer operators working >or=20 hours per week. Control for physical workload and ergonomic workstation design was essential for identifying ERI as a risk factor.
Hämmig, Oliver; Brauchli, Rebecca; Bauer, Georg F
2012-05-31
Effort-reward imbalance (ERI) and work-life imbalance (WLI) are recognised risk factors for work stress and burnout but have not been investigated conjointly so far and compared with each other in this regard. The present cross-sectional study provides initial evidence by studying associations of ERI and WLI with general stress and burnout simultaneously. The study was based on survey data collected in 2007 among the personnel of a large public hospital in the canton of Zurich covering a random sample of 502 employees of all professions and positions. Prevalence rates, correlation coefficients, standardised regression coefficients and odds ratios were calculated as measures of association. Concerning the main research question and relating to the entire study sample, WLI was found to be more strongly associated with general stress and burnout than ERI. As stratified analyses with regard to burnout have shown, this applied especially to nursing, technical care and emergency staffs who account for more than three fifths of the study population. But for other professional categories like physicians, therapists and medical-technical personnel the opposite of a stronger association of ERI with burnout was found. Results also suggested that general stress plays a (rather minor) mediating role in the relationships between ERI and burnout and particularly between WLI and burnout. For the prevention of chronic stress and burnout one should consider both high efforts put into work as well as all job demands that are competing and interfering with family responsibilities or other private activities should be considered.
Time trends in burdens of cadmium, lead, and mercury in the population of northern Sweden
International Nuclear Information System (INIS)
Wennberg, Maria; Lundh, Thomas; Bergdahl, Ingvar A.; Hallmans, Goeran; Jansson, Jan-Hakan; Stegmayr, Birgitta; Custodio, Hipolito M.; Skerfving, Staffan
2006-01-01
The time trends of exposure to heavy metals are not adequately known. This is a worldwide problem with regard to the basis for preventive actions and evaluation of their effects. This study addresses time trends for the three toxic elements cadmium (Cd), mercury (Hg), and lead (Pb). Concentrations in erythrocytes (Ery) were determined in a subsample of the population-based MONICA surveys from 1990, 1994, and 1999 in a total of 600 men and women aged 25-74 years. The study took place in the two northernmost counties in Sweden. To assess the effect of changes in the environment, adjustments were made for life-style factors that are determinants of exposure. Annual decreases of 5-6% were seen for Ery-Pb levels (adjusted for age and changes in alcohol intake) and Ery-Hg levels (adjusted for age and changes in fish intake). Ery-Cd levels (adjusted for age) showed a similar significant decrease in smoking men. It is concluded that for Pb and maybe also Hg the actions against pollution during recent decades have caused a rapid decrease of exposure; for Hg the decreased use of dental amalgam may also have had an influence. For Cd, the decline in Ery-Cd was seen only in smokers, indicating that Cd exposure from tobacco has decreased, while other environmental sources of Cd have not changed significantly. To further improve the health status in Sweden, it is important to decrease the pollution of Cd, and actions against smoking in the community are important
Doersen, C J; Stanbridge, E J
1981-04-01
HeLa cells sensitive to the mitochondrial protein synthesis inhibitors erythromycin (ERY) and chloramphenicol (CAP) and HeLa variants resistant to the effects of these drugs were purposefully infected with drug-sensitive and -resistant mycoplasma strains. Mycoplasma hyorhinis and the ERY-resistant strain of Mycoplasma orale, MO-ERYr, did not influence the growth of HeLa and ERY-resistant ERY2301 cells in the presence or absence of ERY. M. hyorhinis also did not affect the growth of HeLa and CAP-resistant Cap-2 cells in the presence or absence of CAP. However, both HeLa and Cap-2 cells infected with the CAP-resistant strain of M. hyorhinis, MH-CAPr, were more sensitive to the cytotoxic effect of CAP. This may be due to the glucose dependence of the cells, which was compromised by the increased utilization of glucose by MH-CAPr in these infected cell cultures. In vitro protein synthesis by isolated mitochondria was significantly altered by mycoplasma infection of the various cell lines. A substantial number of mycoplasmas copurified with the mitochondria, resulting in up to a sevenfold increase in the incorporation of [3H]leucine into the trichloroacetic acid-insoluble material. More importantly, the apparent drug sensitivity or resistance of mitochondrial preparations from mycoplasma-infected cells reflected the drug sensitivity or resistance of the contaminating mycoplasmas. These results illustrate the hazards in interpreting mitochondrial protein synthesis data derived from mycoplasma-infected cell lines, particularly putative mitochondrially encoded mutants resistant to inhibitors of mitochondrial protein synthesis.
n kursus vir akademiese doeleindes
African Journals Online (AJOL)
TIle first semester I ullderstalld almost lIothillg from lecture. TIwt is first time I heard Ellglish like that. Professors were I'ery hard to ullderstand. Mostly I read Ihe book ... After aile year 1I0W I call understalld 11I0St of lecture. Bill I still wrile bad notes. Teachers ill Ellglish classes speak I'ery clear. TIJe)' walll us to ullderstalld.
A tale of two exhibitions / Jana Belugina
Belugina, Jana
2009-01-01
Kevadistest näitustest Tallinnas Kumu Kunstimuuseumis: "Floromaania" (eksponeeritakse lillemotiive Eesti Kunstimuuseumi kogust, mis pärit eri ajastutest ning eri kunstialadelt) ja 2008. aasta Ars Fennica kunstiauhinna kandidaatide tööde näitusest "Ars Fennica 2008 auhind". Auhinnast ja Läti kunstniku Katrina Neiburga, soomlase Tea Mäkipää ning Mark Raidpere näitusel eksponeeritavatest töödest
Veskitammi kortermajad = The Veskitammi Apartment Buildings / Urmas Oja
Oja, Urmas, 1981-2012
2004-01-01
Üks ühe trepikojaga ja kaks kolme trepikojaga kolmekordset puidust korterelamut ümber sisehoovi Laagris. Hoonete puitfassaadid on kujundatud nelja eri pikkusega ja nelja eri värvi laudadest. Projekteerija, maastikukujundus: AB Kosmos. Autorid Ott Kadarik, Villem Tomiste, Mihkel Tüür. Konstruktor: Randväli ja Karema. Projekt ja valmis 2003. Ill.: 6 korruste plaani, 5 värv. välisvaadet
Lidwall, Ulrik
2016-11-18
To investigate if effort-reward imbalance (ERI) and overcommitment (OC) are associated with all-cause and mental disorder long-term sick leave (LS), and to identify differences in associations between genders, private versus public sector employees and socioeconomic status groups. The study uses a cross-sectional case-control design with a sample of 3477 persons on long-term sick leave of more than 59 days and a control group of 2078 in employment. Data on sick leave originate from social insurance registers, while data on health, working and living conditions were gathered through a survey. The binary logistic regression was used to test the multivariate associations. Effort-reward imbalance was associated with all-cause LS among the women (odds ratio (OR) = 1.58, 95% CI: 1.2-2.08), but not among the men. Associations for mental disorder LS were evident for both ERI and OC among both genders (ERI/OC: women OR = 2.76/2.82; men OR = 2.18/2.92). For the men these associations were driven by high effort, while for the women it was low job esteem in public sector and low job security in private sector. Among the highly educated women, ERI was strongly related to mental disorder LS (OR = 6.94, 95% CI: 3.2-15.04), while the highly educated men seemed to be strongly affected by OC for the same outcome (OR = 5.79, 95% CI: 1.48-22.57). The study confirmed the independent roles of ERI and OC for LS, with stronger associations among the women and for mental disorders. The ERI model is a promising tool that can contribute to understanding the prevailing gender gap in sick leave and increasing sick leave due to mental disorders. Int J Occup Med Environ Health 2016;29(6):973-989. This work is available in Open Access model and licensed under a CC BY-NC 3.0 PL license.
Directory of Open Access Journals (Sweden)
Ulrik Lidwall
2016-12-01
Full Text Available Objectives: To investigate if effort–reward imbalance (ERI and overcommitment (OC are associated with all-cause and mental disorder long-term sick leave (LS, and to identify differences in associations between genders, private versus public sector employees and socioeconomic status groups. Material and Methods: The study uses a cross-sectional case-control design with a sample of 3477 persons on long-term sick leave of more than 59 days and a control group of 2078 in employment. Data on sick leave originate from social insurance registers, while data on health, working and living conditions were gathered through a survey. The binary logistic regression was used to test the multivariate associations. Results: Effort–reward imbalance was associated with all-cause LS among the women (odds ratio (OR = 1.58, 95% CI: 1.2–2.08, but not among the men. Associations for mental disorder LS were evident for both ERI and OC among both genders (ERI/OC: women OR = 2.76/2.82; men OR = 2.18/2.92. For the men these associations were driven by high effort, while for the women it was low job esteem in public sector and low job security in private sector. Among the highly educated women, ERI was strongly related to mental disorder LS (OR = 6.94, 95% CI: 3.2–15.04, while the highly educated men seemed to be strongly affected by OC for the same outcome (OR = 5.79, 95% CI: 1.48–22.57. Conclusions: The study confirmed the independent roles of ERI and OC for LS, with stronger associations among the women and for mental disorders. The ERI model is a promising tool that can contribute to understanding the prevailing gender gap in sick leave and increasing sick leave due to mental disorders. Int J Occup Med Environ Health 2016;29(6:973–989
Endoscopic-retrograde ileography (ERI)
International Nuclear Information System (INIS)
Higer, H.P.; Eichmann, B.; Allgemeines Krankenhaus St. Georg, Hamburg
1983-01-01
Following high colonoscopy, a catheter was introduced into the caecum in 16 patients and contrast material and air were injected. In ten patients it proved possible to obtain selective double contrast demonstration of the terminal ileum and, in two patients, a single contrast examination was obtained. In four patients there was no reflux, but two of these had severe and extensive stenoses of the terminal ileum. (orig.) [de
Verkuyten, Maykel
2016-11-01
This article proposes a further conceptualization of ethnic and racial identity (ERI) as a fundamental topic in developmental research. Adding to important recent efforts to conceptually integrate and synthesize this field, it is argued that ERI research will be enhanced by more fully considering the implications of the social identity approach. These implications include (a) the conceptualization of social identity, (b) the importance of identity motives, (c) systematic ways for theorizing and examining the critical role of situational and societal contexts, and (d) a dynamic model of the relation between ERI and context. These implications have not been fully considered in the developmental literature but offer important possibilities for moving the field forward in new directions. © 2016 The Author. Child Development © 2016 Society for Research in Child Development, Inc.
Directory of Open Access Journals (Sweden)
Zeynep Gülçin ÖZKİŞİ
2012-09-01
Full Text Available Expectations and attitudes related to gender roles are important factors in accessing education, career choices and careers of women and men. Throughout the music history literature, musical creativity has been always accounted to male artists, whereas women are mostly accepted as prominent and talented music performers. The scarcity of women composers in musical canon is caused by several social, cultural and economic factors. The myth of female incapacity for musical creativity, which was rather a strong prejudice until the mid of 20th century and women’s limited access to musical education in the area of composition were among these factors. Although to a lesser extent, gender and gender-based inequality in educational and professional guidance, continues today, as well. Women’s access to composition education and, affects of gender and gender roles to choice of career in the case of composition; profiles of students in the context of gender in general music and composition schools which offer undergraduate composition programmes on Europian academic music are analysed. The lists of students who graduated from these institutions since their foundations are examined on the basis of gender and the numbers of graduate girls/boys are obtained and comprised. The gender profile of age to start composition education in the institutions of undergraduate composition education and academicians who born in 1960-1977 and received an undergraduate education of composition are observed. Cinsiyet rollerine ilişkin beklenti ve tutumlar, kadınlar ve erkeklerin eğitime erişimleri, meslek seçimleri ve kariyerlerinde önemli birer faktördür. Müzik tarihi literatüründe kadınlar, önemli müzik icracıları olarak kabul görürken, bestecilik ve müzikal yaratıcılık, daha çok erkeklerle ilişkilendirilen bir alan olarak karşımıza çıkmaktadır. Bestecilik özelinde, kadınların müzikal kanonda erkeklere oranla daha az yer buluyor olmalar
Ndjaboué, R; Brisson, C; Vézina, M; Blanchette, C; Bourbonnais, R
2014-01-01
Little is known about the effects of psychosocial work factors on objectively assessed mental health problems leading to medically certified absence. Only one study has evaluated the prospective effects of effort-reward imbalance (ERI) at work with regards to this outcome. The present study aimed to evaluate the effects of ERI on the incidence of medically certified absence for mental health problems. The study included 2086 white-collar workers (63.3% women) employed in public organisations in Quebec city. Participants were followed over a 9-year period. Medical absences from work were collected from employers' files and psychosocial factors were measured using the ERI questionnaire. Cox regression models were used to estimate the incidence of certified sickness absence due to mental health problems that lasted 5 workdays or more, while controlling for confounders. Workers exposed to ERI had a higher risk of a first spell of medically certified absence for mental health problems (HR=1.38, 95% CI 1.08 to 1.76) compared with unexposed workers. Low reward was significantly associated with a high risk among men (HR=2.80, 95% CI 1.34 to 5.89) but not in women. (HR=1.24, 95% CI 0.90 to 1.73). Effort at work had no effect on certified absence. All these effects were adjusted for potential confounders. ERI and low reward at work were prospectively associated with medically certified absence for mental health problems. These effects seem to differ by gender. Primary prevention that is aimed at reducing these stressors should be considered to help reduce the incidence of such severe mental health problems.
Herr, Raphael M; Li, Jian; Loerbroks, Adrian; Angerer, Peter; Siegrist, Johannes; Fischer, Joachim E
2017-07-01
Ample evidence documented the adverse health effects of work stressors, and recent research has increasingly focused on somatic symptoms which are very common and costly. Prospective evidence is however sparse and yielded mixed findings. Furthermore, there is reason to assume that depression and anxiety might mediate the effects of adverse psychosocial work conditions on somatic symptoms. This study aimed to investigate longitudinal effects of work stressors on somatic symptoms and the potential mediation by anxiety and/or depression. Six year follow-up data from 352 individuals - free of potentially stress-related chronic disease - were utilized. Somatic symptoms were assessed by 19 items of an established list of complaints at baseline and follow-up. The effort-reward-imbalance (ERI) model measured adverse psychosocial work conditions and over-commitment (OC). Linear regressions adjusted for socio-demographics, social status, lifestyle, and baseline symptoms estimated the effects of the ERI ratio, effort, reward, OC, and the ERI ratio×OC interaction on somatic symptoms six years later. Furthermore, single and multiple mediation by anxiety and/or depression was investigated. There was a strong longitudinal effect of the ERI ratio, as well as of its subcomponents, and OC on somatic symptoms (all Bs≥|0.49|; p-values ≤0.004). Moreover, the ERI ratio×OC interaction was significant (p-value=0.047). Multiple mediation analyses revealed especially anxiety to mediate the effect of work stressors on somatic symptoms (Sobel test=0.007). Adverse psychosocial work conditions seem to longitudinally affect somatic symptoms, potentially moderated by OC, and mediated by anxiety. Copyright © 2017 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Sandra Giustini
2014-09-01
Full Text Available Skin cancer is common in xeroderma pigmentosum (XP due to a DNA repair mechanisms genetic defect. Ultraviolet (UV exposure is the main cause of increased incidence of actinic keratosis (AK, basal cell carcinoma (BCC and squamous cell carcinoma (SCC observed in XP subjects. Photoprotection is therefore a mandatory strategy in order to reduce skin damage. A topical DNA repair enzyme has been shown to slow down the development of skin lesions in XP. However, there are no data regarding the effects of photoprotection combined with DNA repair strategies in this clinical setting. A film-forming medical device containing the DNA repair enzyme photolyase and very high-protection UV filters (Eryfotona AK-NMSC, Ery is currently available. We report retrospective data regarding the use of Ery in 8 patients (5 women, 3 men with a diagnosis of XP treated for at least 12 consecutive months, comparing the rate of new skin lesions (AK, BCC and SCC during active treatment with Ery and during 12 months just before the use of the product. New AK, BCC and SCC mean lesion numbers during the 1-year Ery treatment were 5, 3 and 0, respectively in comparison with 14, 6.8 and 3 lesions, respectively during the 1-year pre-treatment period. Ery use was associated with a 65% reduction in appearance of new AK lesions and with 56 and 100% reductions in the incidence of new BCC and SCC lesions, respectively. These data suggest that topical use of photoprotection and DNA repair enzyme could help lower skin cancer lesions in XP. Control prospective trials are advisable in this clinical setting.
Peter, Richard; March, Stefanie; du Prel, Jean-Baptist
2016-02-01
Depressive symptoms are common and economically relevant. Women suffer more often than men do. We analyze associations between social status inconsistency, psychosocial factors, and depressive symptoms stratified by gender. In the present study, 3340 employees of two age cohorts (1959, 1965) working in two waves (2011, 2014) of the prospective German lidA-study and who gave written consent to link register data regarding their employment histories were included. Gender-specific influences of social status inconsistency (deviation of observed income from expected average income based on acquired education) on depressive symptoms and mediation of these associations by work stress in terms of effort-reward-imbalance (ERI) and work-family-conflict (WFC) were analyzed with confirmatory cross-lagged path models. Among men, consistent status (i.e., average income in a specific educational group) increased the frequency of depressive symptoms. No association between negative SSI (i.e., income below the average income given a specific educational attainment) or positive SSI (i.e., income above the average income given a specific educational attainment) and depressive symptoms was observed among men or women. ERI and WFC were longitudinally associated with the outcome and differed slightly regarding gender, i.e., showing stronger effects of ERI for women and of WFC for men. Mediation of the association between social status and depressive symptoms was observed for men and for consistent status (path: consistent status → ERI → depressive symptoms) but not for SSI. ERI and WFC increase the risk of future episodes with depressive symptoms in men and in women irrespective of SSI, occupational position, full- or part-time work, regional factors or individual characteristics. Copyright © 2016. Published by Elsevier Ltd.
Using Multi-media Modeling to Investigate Conditions Leading to Harmful Algal Blooms
Garcia, V.; Nowakowski, C.; Astitha, M.; Vlahos, P.; Cooter, E. J.; Tang, C.
2017-12-01
Lake Erie is the twelfth largest lake in the world and provides drinking water to over 11 million people in the United States. 22,720 square miles of varying landcover (e.g., urban, agriculture) drain directly into Lake Erie. Harmful algal blooms (HABs) have historically been an issue in Lake Erie, with events peaking in the late 1960's to early 1970's. Several studies have shown that these events were the result of excess phosphorus draining predominantly into the western portion of the lake from agricultural practices occurring in the surrounding watersheds. Phosphorus controls led to recovery of the lake by 1990, but since the mid-1990's, there has been a resurgence of HAB events, with the largest event on record occurring in 2015. We used linked and coupled physical models to examine relationships among environmental variables across multiple sources and pathways. Because these models link emission sources with meteorology and the pollutant concentrations found in the environment, they shed new light on the complex interactions of these chemicals and chemical mixtures. We used the broad range of variables available from these models, representing meteorology, hydrology, atmospheric processes, landscape characteristics, and agriculture management practices, to examine relationships with available dissolved oxygen and chlorophyll α concentrations measured in Lake Erie. We found that inorganic nitrogen (N) fertilizer applied to crops and atmospheric N deposition were the strongest nutrient loading predictors of dissolved oxygen and chlorophyll α concentrations measured in Lake Erie. Further, we were able to examine the relationships of oxidized and reduced forms of N deposition, and dry and wet N deposition. The results of this analysis will be presented at the conference.
Middleton, Elizabeth M.; Smith, David E. (Technical Monitor)
2000-01-01
Many amphibian species have experienced substantial population declines, or have disappeared altogether, during the last several decades at a number of amphibian census sites in Central and South America. This study addresses the use of satellite-derived trends in solar ultraviolet-B (UV-B; 280-320 nm) radiation exposures at these sites over the last two decades, and is intended to demonstrate a role for satellite observations in determining whether UV-B radiation is a contributing factor in amphibian declines. UV-B radiation levels at the Earth's surface were derived from the Total Ozone Mapping Spectrometer (TOMS) satellite data, typically acquired daily since 1979. These data were used to calculate the daily erythemal (sunburning) UV-B, or UV-B(sub ery), exposures at the latitude, longitude, and elevation of each of 20 census sites. The annually averaged UV-B(sub ery) dose, as well as the maximum values, have been increasing in both Central and South America, with higher levels received at the Central American sites. The annually averaged UV-B(sub ery) exposures increased significantly from 1979-1998 at all 11 Central American sites examined (r(exp 2) = 0.60 - 0.79; P= 6750 J/sq m*d) to the annual UV-B(sub ery) total has increased from approx. 5% to approx. 15% in Central America over the 19 year period, but actual daily exposures for each species are unknown. Synergy among UV-B radiation and other factors, especially those associated with alterations of water chemistry (e.g., acidification) in aqueous habitats is discussed. These findings justify further research concerning whether UV-B(sub ery) radiation plays a role in amphibian population declines and extinctions.
Ota, Atsuhiko; Mase, Junji; Howteerakul, Nopporn; Rajatanun, Thitipat; Suwannapong, Nawarat; Yatsuya, Hiroshi; Ono, Yuichiro
2014-09-17
We examined the influence of work-related effort-reward imbalance and overcommitment to work (OC), as derived from Siegrist's Effort-Reward Imbalance (ERI) model, on the hypothalamic-pituitary-adrenocortical (HPA) axis. We hypothesized that, among healthy workers, both cortisol and dehydroepiandrosterone (DHEA) secretion would be increased by effort-reward imbalance and OC and, as a result, cortisol-to-DHEA ratio (C/D ratio) would not differ by effort-reward imbalance or OC. The subjects were 115 healthy female nursery school teachers. Salivary cortisol, DHEA, and C/D ratio were used as indexes of HPA activity. Mixed-model analyses of variance revealed that neither the interaction between the ERI model indicators (i.e., effort, reward, effort-to-reward ratio, and OC) and the series of measurement times (9:00, 12:00, and 15:00) nor the main effect of the ERI model indicators was significant for daytime salivary cortisol, DHEA, or C/D ratio. Multiple linear regression analyses indicated that none of the ERI model indicators was significantly associated with area under the curve of daytime salivary cortisol, DHEA, or C/D ratio. We found that effort, reward, effort-reward imbalance, and OC had little influence on daytime variation patterns, levels, or amounts of salivary HPA-axis-related hormones. Thus, our hypotheses were not supported.
Imaging rainfall infiltration processes with the time-lapse electrical resistivity imaging method
Jia, Zhengyuan; Jiang, Guoming; Zhang, Guibin; Zhang, Gang
2017-04-01
Electrical Resistivity Imaging (ERI) was carried out continuously for ten days to map the subsurface resistivity distribution along a potentially hazardous hillslope at the Jieshou Junior High School in Taoyuan, Taiwan. The inversions confirm the viability of ERI in tracking the movement of groundwater flow and rainfall infiltration by recording the variation of subsurface resistivity distribution. Meanwhile, relative-water-saturation (RWS) maps can be obtained from ERI images via Archie's Law, which provide a more intuitive reflection of the variation of subsurface rainfall infiltration and a more capable means of estimating the stability of a landslide body. What is more, we then found that the averaged RWS is significantly correlated with daily precipitation. Our observations indicate that real-time ERI is effective in monitoring subterraneous rainfall infiltration, and thereby in estimating the stability of a potential landslide body. When the agglomerate rainfall in the landslide slippage surface was infiltrated quickly without sustaining hydraulic pressure along the landslide slippage surface, the probability of landslides occurring was very low. On the contrary, the probability of landslides occurring could be increased due to the overpressure of pore fluids. Keywords Electrical Resistivity Imaging; Depth-of-Investigation; Archie's Law; Landslide Monitoring; Rainfall Infiltration; Preferential Path
Neri, Luca; Rocca Rey, Luisa A; Gallieni, Maurizio; Brancaccio, Diego; Cozzolino, Mario; Colombi, Antonio; Burroughs, Thomas E
2009-05-01
About 300,000 patients in the United States with Chronic Kidney Failure (CKF) are of working age, but up to 70% lose their job within the first year of renal replacement therapy .No study has examined how work ability and perceived health are influenced by the subjects' adjustment to their job. We assessed the association of occupational stress (Effort-Reward Imbalance, ERI),work ability (WAI) and health-related quality of life (QoL) in hemodialysis. 40 employed hemodialysis patients completed a self-administered questionnaire. Associations between ERI, short Form 12 (sF-12), short Form - 6 Dimensions (sF-6D), Kidney Disease QOL- 36 (KDQOL-36) and WAI were tested with partial Spearman's correlation adjusted for age, income, and comorbidity burden. Study subjects were mainly low-income (82%), african-american (73%), men (75%); 16 were manual laborers and 9 worked in the industrial sector. Study subjects reported low levels of Occupational Stress: ERI scores indicated an imbalance between Job Efforts and Rewards in only 3 subjects. Nevertheless, ERI scores were inversely and strongly associated with WAI (rho=-0.41, pworking. The causal relationship between Occupational stress, perceived health, and work ability should be further investigated. Occupational Health professionals and nephrologists should closely collaborate to meet the needs of occupationally active hemodialysis patients.
Food habits of diving ducks in the Great Lakes after the zebra mussel invasion
Custer, Christine M.; Custer, T.W.
1996-01-01
Zebra mussels (Dreissena polymorpha) invaded the Great Lakes in the mid-1980s and quickly reached high densities. The objective of this study was to determine current consumption of zebra mussels by waterfowl in the Great Lakes region. Feeding Lesser Scaups (Aythya affinis), Greater Scaups (A. marila), Canvasbacks (A. valisineria), Redheads (A. americana), Buffleheads (Bucephala albeola) and Common Goldeneyes (B. clangula) were collected in western Lake Erie and in Lake St. Clair between fall and spring, 1992-1993 to determine food habits. All 10 Redheads, 97% of Lesser Scaups, 83% of Goldeneyes, 60% of Buffleheads and 9% of Canvasbacks contained one or more zebra mussels in their upper gastrointestinal tracts. The aggregate percent of zebra mussels in the diet of Lesser Scaups was higher in Lake Erie (98.6%) than in Lake St. Clair (54.4%). Zebra mussels (aggregate percent) dominated the diet of Common Goldeneyes (79.2%) but not in Buffleheads (23.5%), Redheads (21%) or Canvasbacks (9%). Lesser Scaups from Lake Erie fed on larger zebra mussels ( = 10.7 i?? 0.66 mm SE) than did Lesser Scaups from Lake St. Clair ( = 4.4 i?? 0.22 mm). Lesser Scaups, Buffleheads and Common Goldeneyes from Lake Erie consumed zebra mussels of similar size.
Integration of process computer systems to Cofrentes NPP
International Nuclear Information System (INIS)
Saettone Justo, A.; Pindado Andres, R.; Buedo Jimenez, J.L.; Jimenez Fernandez-Sesma, A.; Delgado Muelas, J.A.
1997-01-01
The existence of three different process computer systems in Cofrentes NPP and the ageing of two of them have led to the need for their integration into a single real time computer system, known as Integrated ERIS-Computer System (SIEC), which covers the functionality of the three systems: Process Computer (PC), Emergency Response Information System (ERIS) and Nuclear Calculation Computer (OCN). The paper describes the integration project developed, which has essentially consisted in the integration of PC, ERIS and OCN databases into a single database, the migration of programs from the old process computer into the new SIEC hardware-software platform and the installation of a communications programme to transmit all necessary data for OCN programs from the SIEC computer, which in the new configuration is responsible for managing the databases of the whole system. (Author)
Beaufort Sea Coastal Fish Studies Overview and Bibliography
1993-06-01
from the mainland of Cahn, A.R. (1936) Observations on the breeding of the British Columbia. Journal of the Fisheries Research lawyer, Lota maculosa ... maculosa (LeSueur) in Lake Erie. Transactions of the Hoop traps as a means to capture burbot. North Ameri- American Fisheries Society, 80: 56-66. can...Iota maculosa (LeSueur) in Lake Erie. Transactions of imental study of the ling, Lota maculosa (LeSueur), in the American Fisheries Society. 80:163
Kawaharada, Mariko; Saijo, Yasuaki; Yoshioka, Eiji; Sato, Tetsuro; Sato, Hirokazu; Kishi, Reiko
2007-01-01
The aim of the present study was to identify relations between occupational stress and occupational class in Japanese civil servants, using two occupational stress models – the Effort-Reward Imbalance (ERI) Model and the Job Demand-Control (JDC) Model. The subjects were employees of three local public organizations. We distributed self-administered questionnaires and assessed occupational stress by ERI and JDC. We used seven occupational categories based on the Standard Occupational Classific...
Energy Technology Data Exchange (ETDEWEB)
Nikku, P [ed.
1997-12-01
The aim of the programme is to increase the use of economically profitable and environmentally sound bioenergy by improving the competitiveness of present peat and wood fuels. Research and development projects will also develop new economically competitive biofuels, new equipment and methods for production, handling and utilisation of biofuels. The total funding for 1996 was 27.3 million FIM and the number of projects 63. The number of projects concerning wood fuels production was 36. The main goals of the research are to develop new production methods for wood fuels in order to decrease the production costs to the level of imported fuels (100 km distance). The second goal is to decrease the small scale production costs by 20 % as compared with the 1992 technology level. Also, new harvesting technology and new work methods will be developed for forest owners and small-entrepreneurs in the course of the programme. Results of the projects carried out in 1996 in this programme are presented in this publication. The integrated harvesting methods, which supply both raw material to wood products industry and wood fuel for energy production, have been chosen the main research areas because they seem to be most promising. Most of the projects are focused in the wood fuel production from first thinnings and from final fellings. The projects broadly covered the research area focusing from material flows, productivity studies, basic wood properties to several case studies. The follow up project of Evaluation-drum chipper was completed with good fuel quality and productivity results. Also the large Forest Energy Project of Central Finland was completed. The project was a significant technology transfer and information dissemination project. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Heikkilae, K. [Vapo Oy, Jyvaeskylae (Finland)
1996-12-31
The objective of the project was to clarify the large-scale production possibilities and the construction of the costs for bioenergy, and to develop the operational manners so that smaller volumes of biomasses are integrated to prevailing peat production and delivered so that peat ensures the quality of the fuel supply, as well as the prices and the reliability of deliveries. Hence it is possible to utilize the same organisation, machinery and volumes. The operation will be designed to be all-year-round so that the profitability can be improved. Another aim is to get the non-utilizeable wood-wastes into use, which would serve also the silvicultural purposes. The utilizeable municipal and other wastes and sludges could be used within biomass, and to make, using proper mixing ratios, biofuels precisely suitable for the purposes of the customer. At the grain growing areas it is possible to utilize the straw and at the seaside the reed grass
Energy Technology Data Exchange (ETDEWEB)
Alakangas, E [ed.
1997-12-31
Bioenergy Research Programme is one of the energy technology research programmes of the Technology Development Center TEKES. The aim of the Bioenergy Research Programme is to increase, by using technical research and development, the economically profitable and environmentally sound utilisation of bioenergy, to improve the competitiveness of present peat and wood fuels, and to develop new competitive fuels and equipment related to bioenergy. The funding for 1995 was nearly 52 million FIM and the number of projects 66. The main goal of the wood fuels research area is to develop new production methods in order to decrease the production costs to the level of imported fuels. The total potential of the wood fuel use should be at least 1.0 million toe/a (5.5 million m{sup 3}). During the year 1995 There were over 30 projects concerning the production of wood derived fuels going on. Nearly half of them focused on integrated production of pulp wood and wood fuel. About ten projects was carried out to promote the wood fuel production from logging residues. Other topics were firewood production, production logistics and wood fuel resources. For production of fuel chips from logging residues, a new chipper truck, MOHA-SISU, was introduced. The new machine gives a new logistic solution resulting in high productivity and reasonable operating costs. In Mikkeli region three years of active work promoted the usage of wood fuel in a district power plant to the level of over 110 000 m{sup 3} of fuel chips. The production costs tend to be a little high in average, and the production chain still needs to be improved
Energy Technology Data Exchange (ETDEWEB)
Alakangas, E. [ed.
1996-12-31
Bioenergy Research Programme is one of the energy technology research programmes of the Technology Development Center TEKES. The aim of the Bioenergy Research Programme is to increase, by using technical research and development, the economically profitable and environmentally sound utilisation of bioenergy, to improve the competitiveness of present peat and wood fuels, and to develop new competitive fuels and equipment related to bioenergy. The funding for 1995 was nearly 52 million FIM and the number of projects 66. The main goal of the wood fuels research area is to develop new production methods in order to decrease the production costs to the level of imported fuels. The total potential of the wood fuel use should be at least 1.0 million toe/a (5.5 million m{sup 3}). During the year 1995 There were over 30 projects concerning the production of wood derived fuels going on. Nearly half of them focused on integrated production of pulp wood and wood fuel. About ten projects was carried out to promote the wood fuel production from logging residues. Other topics were firewood production, production logistics and wood fuel resources. For production of fuel chips from logging residues, a new chipper truck, MOHA-SISU, was introduced. The new machine gives a new logistic solution resulting in high productivity and reasonable operating costs. In Mikkeli region three years of active work promoted the usage of wood fuel in a district power plant to the level of over 110 000 m{sup 3} of fuel chips. The production costs tend to be a little high in average, and the production chain still needs to be improved
Jackson, P. Ryan
2013-01-01
Villa Angela Beach, on the Lake Erie lakeshore near Cleveland, Ohio, is adjacent to the mouth of Euclid Creek, a small, flashy stream draining approximately 23 square miles and susceptible to periodic contamination from combined sewer overflows (CSOs) (97 and 163 CSO events in 2010 and 2011, respectively). Concerns over high concentrations of Escherichia coli (E. coli) in water samples taken along this beach and frequent beach closures led to the collection of synoptic data in the nearshore area in an attempt to gain insights into mixing processes, circulation, and the potential for transport of bacteria and other CSO-related pollutants from various sources in Euclid Creek and along the lakefront. An integrated synoptic survey was completed by the U.S. Geological Survey on September 11–12, 2012, during low-flow conditions on Euclid Creek, which followed rain-induced high flows in the creek on September 8–9, 2012. Data-collection methods included deployment of an autonomous underwater vehicle and use of a manned boat equipped with an acoustic Doppler current profiler. Spatial distributions of water-quality measures and nearshore currents indicated that the mixing zone encompassing the mouth of Euclid Creek and Villa Angela Beach is dynamic and highly variable in extent, but can exhibit a large zone of recirculation that can, at times, be decoupled from local wind forcing. Observed circulation patterns during September 2012 indicated that pollutants from CSOs in Euclid Creek and water discharged from three shoreline CSO points within 2,000 feet of the beach could be trapped along Villa Angela Beach by interaction of nearshore currents and shoreline structures. In spite of observed coastal downwelling, denser water from Euclid Creek is shown to mix to the surface via offshore turbulent structures that span the full depth of flow. While the southwesterly longshore currents driving the recirculation pattern along the beach front were observed during the 2011–12
Bentanzo, Elin A.; Choquette, Anne F.; Reckhow, Kenneth H.; Hayes, Laura; Hagan, Erik R; Argue, Denise M.; Cangelosi, A.A.
2015-01-01
Throughout its history, the United States has made major investments in assessing natural resources, such as soils, timber, oil and gas, and water. These investments allow policy makers, the private sector and the American public to make informed decisions about cultivating, harvesting or conserving these resources to maximize their value for public welfare, environmental conservation and the economy. As policy issues evolve, new priorities and challenges arise for natural resource assessment, and new approaches to monitoring are needed. For example, informed conservation and use of the nation’s finite fresh water resources in the context of increasingly intensive land development is a priority for today’s policy decisionmakers. There is a need to evaluate whether today’s water monitoring programs are generating the information needed to answer questions surrounding these new policy priorities. The Northeast-Midwest Institute (NEMWI), in cooperation with the U.S. Geological Survey (USGS) National Water-Quality Assessment (NAWQA) Program, initiated this project to explore the types and amounts of water data needed to address water-quality related policy questions of critical concern to today’s policy makers. The collaborating entities identified two urgent water policy questions and conducted case studies in the Northeast-Midwest region to determine the water data needed, water data available, and the best ways to fill the data gaps relative to those questions. This report details the output from one case study and focuses on the Lake Erie drainage basin, a data-rich area expected to be a best-case scenario in terms of water data availability.
Lane, Tyler J; Gray, Shannon; Hassani-Mahmooei, Behrooz; Collie, Alex
2018-01-05
Early intervention following occupational injury can improve health outcomes and reduce the duration and cost of workers' compensation claims. Financial early reporting incentives (ERIs) for employers may shorten the time between injury and access to compensation benefits and services. We examined ERI effect on time spent in the claim lodgement process in two Australian states: South Australia (SA), which introduced them in January 2009, and Tasmania (TAS), which introduced them in July 2010. Using administrative records of 1.47 million claims lodged between July 2006 and June 2012, we conducted an interrupted time series study of ERI impact on monthly median days in the claim lodgement process. Time periods included claim reporting, insurer decision, and total time. The 18-month gap in implementation between the states allowed for a multiple baseline design. In SA, we analysed periods within claim reporting: worker and employer reporting times (similar data were not available in TAS). To account for external threats to validity, we examined impact in reference to a comparator of other Australian workers' compensation jurisdictions. Total time in the process did not immediately change, though trend significantly decreased in both jurisdictions (SA: -0.36 days per month, 95% CI -0.63 to -0.09; TAS: 0.35, -0.50 to -0.20). Claim reporting time also decreased in both (SA: -1.6 days, -2.4 to -0.8; TAS: -5.4, -7.4 to -3.3). In TAS, there was a significant increase in insurer decision time (4.6, 3.9 to 5.4) and a similar but non-significant pattern in SA. In SA, worker reporting time significantly decreased (-4.7, -5.8 to -3.5), but employer reporting time did not (-0.3, -0.8 to 0.2). The results suggest that ERIs reduced claim lodgement time and, in the long-term, reduced total time in the claim lodgement process. However, only worker reporting time significantly decreased in SA, indicating that ERIs may not have shortened the process through the intended target of
Cordia Sebestena Tohumunun ve Tohum Yağının Besinsel Özellikleri ve Potansiyel Değeri (İngilizce
Directory of Open Access Journals (Sweden)
Foluso O. Agunbiade
2015-02-01
Full Text Available Az kullanılan hammaddelerin geliştirilmesinin ivme kazanması ile iyi bilinen tohum ve tohum yağlarına olan aşırı bağımlılıktan ve bunun sonucundaki yüksek maliyetten dolayı geleneksel ve endüstriyel uygulamalar için az bilinen tohum ve tohum yağları türetilmiştir. Bu nedenle Cordia sebestena tohum ve tohum yağının kullanım potansiyeli bakımından besinsel özelliklerinin değerlendirilmesine yönelik bu çalışma yapılmıştır. Tohum yağında literatürde rapor edilen çeşitli analizler kullanılarak yağ asidi profili incelenmiş ve karakterize edilmişken, tohumda ise genel bileşim, mineral bileşenler ve anti-besinsel faktörler araştırılmıştır. Sonuçlar tohumun iyi bir yağ (%40.3 ± 0.8 ve protein (%11.5 ± 0.6 kaynağı olabileceğini göstermektedir. Tohum aynı zamanda Mg, Ca ve Na benzeri bazı makro-elementler ile esansiyel bir mikro-element olan Zn kaynağı olabilir. Anti-besinlerden fitat, tanen ve oksalat içeriği yüksektir ve gıdalarda tohumun kullanımı sakıncalı olabilir. Bu maddeler belki geleneksel gıda işleme yöntemleri ile giderilebilir. Tohum yağının özellikleri onun alkid reçine sentezinde, biyodizel ve sabun üretiminde kullanışlı olabileceğini göstermektedir. Yağ asidi profili toplam yağın %71.1 oranında insan tüketimi için iyi bir yağ asidi olan oleik asiti (C18:1 ağırlıklı olarak bulundurduğunu göstermektedir. Cordia sebestena tohumu ve tohum yağının önemli kullanım alanları olabileceği görülmüştür, ancak tohum yağının aminoasit profili ve anti-besinler üzerine geleneksel işlemlerin etkileri konularında daha fazla çalışmaya ihtiyaç vardır.
Verkkokauppa myynnin edistämisvälineenä: Case yritys X
Viljakainen, Markus
2016-01-01
Opinnäytetyön tarkoituksena on tutustua verkkokaupan eri ominaisuuksiin, joiden avulla yritys X pystyisi nostamaan omia myyntejään uuden myyntikanavan avulla. Opinnäytetyössä tutustutaan verkkokaupan toimivuuden kannalta oleellisiin ominaisuuksiin sekä tutustutaan verkkokaupan eri muotoihin. Opinnäytetyössä tarjotaan yritykselle ehdo-tuksia verkkokaupan kautta oleellisiin asioihin, joita sen tulee ottaa huomioon siirryttäessä sille uuteen myyntikana-vaan. Työn teoriaosuudessa perehdytään...
Hämmig, Oliver; Brauchli, Rebecca; Bauer, Georg F
2012-01-01
INTRODUCTION: Effort-reward imbalance (ERI) and work-life imbalance (WLI) are recognised risk factors for work stress and burnout but have not been investigated conjointly so far and compared with each other in this regard. The present cross-sectional study provides initial evidence by studying associations of ERI and WLI with general stress and burnout simultaneously. METHODS: The study was based on survey data collected in 2007 among the personnel of a large public hospital in the canton...
Eriksson, Johanna
2014-01-01
Opinnäytetyön tarkoituksena oli tutkia aktivoiko pilates-harjoittelu lantionpohjan lihaksia, sekä verrata kahta eri pilates-harjoittelumuotoa, laitepilatesta ja mattopilatesta. Lantionpohjan lihasten toimintakyky on avainasemassa lantionpohjan toimintahäiriöiden kuntoutuksessa, ja siksi on tärkeätä tutkia eri harjoitusmuotoja. Opinnäytetyön tutkimus koostui kahdesta tutkimuspäivästä, joissa tutkittiin yhdeksän koehenkilön lantionpohjan lihasten aktivoituminen kuudessa pilates-liikkeessä; ...
Uusi viinilista Ravintola Kaislaan kesäksi 2012
Yli-Kyyny, Henna
2012-01-01
Opinnäytetyön aiheena on suunnitella uusi viinilista Tamperelaiseen à la carte -ravintolaan. Ravintola Kaisla on keskikokoinen kesäravintola, jonka ruokalista koostuu eri ruoista ja raaka-aineista eri puolelta maailmaa. Viinilistan rakenteen suunnittelussa käytettiin pääasiallisesti ruoan ja viinin yhdistämisen teoriaan perustuvaa ruokalistan analyysia. Tärkein tekijä viinien valinnassa oli, että listalta löytyisi ainakin yksi sopiva viini kullekin ruokalistan annokselle. Tärkeää oli kuit...
Laivalipun matka asiakkaalle : prosessin kuvaus ja kehittäminen
Piikkilä, Krista
2016-01-01
Tämän opinnäytetyön tarkoituksena oli selvittää laivalipun varausprosessia asiakkaan varatessa matkan Ikaalisten Matkatoimistosta aina siihen saakka, kunnes asiakas saa valmiin laivalipun. Tarkoituksena oli selvittää matkan varaukseen liittyviä eri vaiheita. Selvityksessä on käytetty laadullista tutkimusmenetelmää, joka havainnoi sekä selvittää saatujen haastattelujen perusteella laivalipun varausprosessia. Selvityksessä on käytetty kirjallisuutta avaamaan eri käsitteitä liittyen laivalipun v...
Suomalaisyritysten puuteollisuuden vientimahdollisuudet Tunisiaan
Malin, Tomi
2017-01-01
Opinnäytetyön tavoitteena on tukea yritystä Malin & Co Oy sen kansainvälistymisprosessissaan Tunisiaan luomalla teoriapohja vientitoiminnan menettelytavoista ja siihen liittyvistä eri liiketoimintamuoto vaihtoehdoista. Opinnäytetyön tiedoista voivat hyötyä myös muut suomalaisyritykset, jotka tavoittelevat kansainvälistä liiketoimintaa tai ovat kiinnostuneet viennistä Tunisiaan. Opinnäytetyössä tarkastellaan vienti käsitettä sekä siihen liittyviä eri liiketoimintamuotoja, kuten franchi...
Wilms' tumor in New York State: epidemiology and survivorship.
Griffel, M
1977-12-01
The outcomes during the period 1950--1972 were compared for Wilms' tumor patients in Erie County, New York (Buffalo and environs) and in a random selection of 23 counties having much smaller populations. For the Erie cohorts of 1967 to 1972 an 87 per cent 7-year survival rate was found as compared with a 50 per cent survival for the corresponding cohorts of the less populous couties. For the years 1960--1966 the 5-year survival rates were respectively 67 and 25 per cent and for the decade 1950--1959, 26 and 23 per cent. The principal conclusion is that within the last 15 years the Erie residents have fared better than residents of the smaller counties. The difference is attributed to the better treatment and care available at some of the hospitals in Buffalo. Data on incidence, age at diagnosis, male/female ratio, and laterality are presented.
Panuje rovnováha mezi pracovním úsilím a odměnami u profesionálů v dlouhodobé péči?
Directory of Open Access Journals (Sweden)
Blanka Jirkovská
2016-09-01
Full Text Available Model Effort Reward Imbalance (ERI belongs to the basic concepts of mapping workplace stress. It examines the relationship between the long-term subjectively perceived level of workers’ effort and rewards and analyses the physical and psychosocial consequences of the (imbalance. We conducted verification of the ERI model on a sample of Czech professionals caring for the elderly in 2014 (N = 265. The survey included 12 facilities providing health and social services for the elderly. It was divided into 4 groups according to two criteria: facilities providing residential/field services and “medical” / “social workers”. We found that the majority of professional caregivers suffer from imbalance between higher effort and lower rewards and this discrepancy is reflected in the reduction of their well-being. The level of imbalance differs among defined groups. The outputs correspond to foreign studies and confirm the validity of the ERI model.
Freddo, Rafael Augusto; Kapczinski, Myriam Pereira; Kinast, Eder Julio; de Souza Junior, Oswaldo Baptista; Rivaldo, Elken Gomes; da Fontoura Frasca, Luis Carlos
2016-10-01
To evaluate, by means of pin-on-disk testing, the wear potential of different dental ceramic systems as it relates to friction parameters, surface finish, and microhardness. Three groups of different ceramic systems (Noritake EX3, Eris, Empress II) with 20 disks each (10 glazed, 10 polished) were used. Vickers microhardness (Hv) was determined with a 200-g load for 30 seconds. Friction coefficients (μ) were determined by pin-on-disk testing (5 N load, 600 seconds, and 120 rpm). Wear patterns were assessed by scanning electron microscopy (SEM). The results were analyzed using one-way ANOVA and Tukey's test, with the significance level set at α = 0.05. The coefficients of friction were as follows: Noritake EX3 0.28 ± 0.12 (polished), 0.33 ± 0.08 (glazed); Empress II 0.38 ± 0.08 (polished), 0.45 ± 0.05 (glazed); Eris 0.49 ± 0.05 (polished), 0.49 ± 0.06 (glazed). Microhardness measurements were as follows: Noritake EX3 530.7 ± 8.7 (polished), 525.9 ± 6.2 (glazed); Empress II 534.1 ± 8 (polished), 534.7 ± 4.5 (glazed); Eris, 511.7 ± 6.5 (polished), 519.5 ± 4.1 (glazed). The polished and glazed Noritake EX3 and polished and glazed Eris specimens showed statistically different friction coefficients. SEM image analysis revealed more surface changes, such as small cracks and grains peeling off, in glazed ceramics. Wear potential may be related to the coefficient of friction in Noritake ceramics, which had a lower coefficient than Eris ceramics. Within-group analysis showed no differences in polished or glazed specimens. The differences observed were not associated with microhardness. © 2015 by the American College of Prosthodontists.
Directory of Open Access Journals (Sweden)
Hiroki Kobayashi
2015-05-01
Full Text Available Background: In hemodialysis (HD patients, zinc depletion caused by inadequate intake, malabsorption, and removal by HD treatment leads to erythropoiesis-stimulating agent (ESA hyporesponsiveness. This study investigated the effects of zinc supplementation in HD patients with zinc deficiency on changes in the erythropoietin responsiveness index (ERI. Methods: Patients on HD with low serum zinc levels (<65 μg/dL were randomly assigned to two groups: The polaprezinc group (who received daily polaprezinc, containing 34 mg/day of zinc (n = 35 and the control group (no supplementation (n = 35 for 12 months. All the 70 patients had been taking epoetin alpha as treatment for renal anemia. ERI was measured with the following equation: Weekly ESA dose (units/dry weight (kg/hemoglobin (g/dL. Results: There were no significant changes in hemoglobin levels within groups or between the control and polaprezinc groups during the study period. Although reticulocyte counts were increased immediately after zinc supplementation, this change was transient. Serum zinc levels were significantly increased and serum copper levels were significantly decreased in the polaprezinc group after three months; this persisted throughout the study period. Although there was no significant change in the serum iron or transferrin saturation levels in the polaprezinc group during the study period, serum ferritin levels significantly decreased following polaprezinc treatment. Further, in the polaprezinc group, ESA dosage and ERI were significantly decreased at 10 months and nine months, respectively, as compared with the baseline value. Multiple stepwise regression analysis revealed that the change in the serum zinc level was an independent predictor of lowered ERI. Conclusions: Zinc supplementation reduces ERI in patients undergoing HD and may be a novel therapeutic strategy for patients with renal anemia and low serum zinc levels.
On the Nature of Ultra-faint Dwarf Galaxy Candidates. I. DES1, Eridanus III, and Tucana V
Conn, Blair C.; Jerjen, Helmut; Kim, Dongwon; Schirmer, Mischa
2018-01-01
We use deep Gemini/GMOS-S g, r photometry to study the three ultra-faint dwarf galaxy candidates DES1, Eridanus III (Eri III), and Tucana V (Tuc V). Their total luminosities, M V (DES1) = ‑1.42 ± 0.50 and M V (Eri III) = ‑2.07 ± 0.50, and mean metallicities, [{Fe}/{{H}}]=-{2.38}-0.19+0.21 and [{Fe}/{{H}}]=-{2.40}-0.12+0.19, are consistent with them being ultra-faint dwarf galaxies, as they fall just outside the 1σ confidence band of the luminosity–metallicity relation for Milky Way satellite galaxies. However, their positions in the size–luminosity relation suggest that they are star clusters. Interestingly, DES1 and Eri III are at relatively large Galactocentric distances, with DES1 located at {D}{GC}=74+/- 4 {kpc} and Eri III at {D}{GC}=91+/- 4 {kpc}. In projection, both objects are in the tail of gaseous filaments trailing the Magellanic Clouds and have similar 3D separations from the Small Magellanic Cloud (SMC): {{Δ }}{D}{SMC,{DES}1}=31.7 kpc and {{Δ }}{D}{SMC,{Eri}{III}}=41.0 kpc, respectively. It is plausible that these stellar systems are metal-poor SMC satellites. Tuc V represents an interesting phenomenon in its own right. Our deep photometry at the nominal position of Tuc V reveals a low-level excess of stars at various locations across the GMOS field without a well-defined center. An SMC Northern Overdensity–like isochrone would be an adequate match to the Tuc V color–magnitude diagram, and the proximity to the SMC (12.°1 {{Δ }}{D}{SMC,{Tuc}{{V}}}=13 kpc) suggests that Tuc V is either a chance grouping of stars related to the SMC halo or a star cluster in an advanced stage of dissolution.
Improved Geologic Interpretation of Non-invasive Electrical Resistivity Imaging from In-situ Samples
Mucelli, A.; Aborn, L.; Jacob, R.; Malusis, M.; Evans, J.
2016-12-01
Non-invasive geophysical techniques are useful in characterizing the subsurface geology without disturbing the environment, however, the ability to interpret the subsurface is enhanced by invasive work. Since geologic materials have electrical resistivity values it allows for a geologic interpretation to be made based on variations of electrical resistivity measured by electrical resistivity imaging (ERI). This study focuses on the pre-characterization of the geologic subsurface from ERI collected adjacent to the Montandon Marsh, a wetland located near Lewisburg, PA within the West Branch of the Susquehanna River watershed. The previous invasive data, boreholes, indicate that the subsurface consists of limestone and shale bedrock overlain with sand and gravel deposits from glacial outwash and aeolian processes. The objective is to improve our understanding of the subsurface at this long-term hydrologic research site by using excavation results, specifically observed variations in geologic materials and electrical resistivity laboratory testing of subsurface samples. The pre-excavation ERI indicated that the shallow-most geologic material had a resistivity value of 100-500 ohm-m. In comparison, the laboratory testing indicated the shallow-most material had the same range of electrical resistivity values depending on saturation levels. The ERI also showed that there was an electrically conductive material, 7 to 70 ohm-m, that was interpreted to be clay and agreed with borehole data, however, the excavation revealed that at this depth range the geologic material varied from stratified clay to clay with cobbles to weathered residual clay. Excavation revealed that the subtle variations in the electrical conductive material corresponded well with the variations in the geologic material. We will use these results to reinterpret previously collected ERI data from the entire long-term research site.
Effort-reward imbalance and its association with health among permanent and fixed-term workers
Directory of Open Access Journals (Sweden)
Nishikitani Mariko
2010-11-01
Full Text Available Abstract Background In the past decade, the changing labor market seems to have rejected the traditional standards employment and has begun to support a variety of non-standard forms of work in their place. The purpose of our study was to compare the degree of job stress, sources of job stress, and association of high job stress with health among permanent and fixed-term workers. Methods Our study subjects were 709 male workers aged 30 to 49 years in a suburb of Tokyo, Japan. In 2008, we conducted a cross-sectional study to compare job stress using an effort-reward imbalance (ERI model questionnaire. Lifestyles, subjective symptoms, and body mass index were also observed from the 2008 health check-up data. Results The rate of job stress of the high-risk group measured by ERI questionnaire was not different between permanent and fixed-term workers. However, the content of the ERI components differed. Permanent workers were distressed more by effort, overwork, or job demand, while fixed-term workers were distressed more by their job insecurity. Moreover, higher ERI was associated with existence of subjective symptoms (OR = 2.07, 95% CI: 1.42-3.03 and obesity (OR = 2.84, 95% CI:1.78-4.53 in fixed-term workers while this tendency was not found in permanent workers. Conclusions Our study showed that workers with different employment types, permanent and fixed-term, have dissimilar sources of job stress even though their degree of job stress seems to be the same. High ERI was associated with existing subjective symptoms and obesity in fixed-term workers. Therefore, understanding different sources of job stress and their association with health among permanent and fixed-term workers should be considered to prevent further health problems.
Future Climate Impacts on Harmful Algal Blooms in an Agriculturally Dominated Ecosystem
Aloysius, N. R.; Martin, J.; Ludsin, S.; Stumpf, R. P.
2015-12-01
Cyanobacteria blooms have become a major problem worldwide in aquatic ecosystems that receive excessive runoff of limiting nutrients from terrestrial drainage. Such blooms often are considered harmful because they degrade ecosystem services, threaten public health, and burden local economies. Owing to changing agricultural land-use practices, Lake Erie, the most biologically productive of the North American Great Lakes, has begun to undergo a re-eutrophication in which the frequency and extent of harmful algal blooms (HABs) has increased. Continued climate change has been hypothesized to magnify the HAB problem in Lake Erie in the absence of new agricultural management practices, although this hypothesis has yet to be formally tested empirically. Herein, we tested this hypothesis by predicting how the frequency and extent of potentially harmful cyanobacteria blooms will change in Lake Erie during the 21st century under the Intergovernmental Panel on Climate Change Fifth Assessment climate projections in the region. To do so, we used 80 ensembles of climate projections from 20 Global Climate Models (GCMs) and two greenhouse gas emission scenarios (moderate reduction, RCP4.5; business-as-usual, RCP8.5) to drive a spatiotemporally explicit watershed-hydrology model that was linked to several statistical predictive models of annual cyanobacteria blooms in Lake Erie. Owing to anticipated increases in precipitation during spring and warmer temperatures during summer, our ensemble of predictions revealed that, if current land-management practices continue, the frequency of severe HABs in Lake Erie will increase during the 21st century. These findings identify a real need to consider future climate projections when developing nutrient reduction strategies in the short term, with adaptation also needing to be encouraged under both greenhouse gas emissions scenarios in the absence of effective nutrient mitigation strategies.
Directory of Open Access Journals (Sweden)
Ramazan UYKUR
2012-12-01
Full Text Available Today, there are a great many of small scaled masjıds in oldBaku, which is called today İçeri Şeher (The Inland City. In this paper,the earliest two cultural material samples of Seljuks in Azerbajcan aswell as Anatolia are depicted. In the study, the main aim is theinvestigation of these two works, which are little known in Turkishworld, in some points of view such as their history, contractors,designs, architectures and ornament. For this reason, in a number ofbuildings in Bakuand around it, some procedures were performed suchas required measures, technical drawings, and photographing. Afterthat, the study was completed with source inquiries in the Archives ofBaku Berpa, Ahundov Library along with a number of Turkish libaries.Consequently, in their new homelands too, Turks tended to apply theaesthetical values, architectural approach and artistic motives whichthey brought in their mind togetheras well as remarkable politicalachievements which they obtained by housing Anatolia. Therefore, it ishighly probable to come accross such samples of pre-Anatolian culturalheritage in the cities they built or on the routes they passed throughduring this mobility.Both of the buildings are considered remarkable in that they arethe earliest samples from Seljuks which have remained until today,making it available us to track down the developments in Turkisharchitecture. Sınıg Gala Masjid, the first small built after Turks' arrivingin Baku, is still found remarkable since it has statical problems as wellas its slipshod appearance and its huge minarets that is independentlybuilt from the main building. As for the Ashur Masjids, with its twostorey facade and embellished supporting arch seperating the inside, itis undoubtedly a work of a less-developed architectural styleestablishment of the period. However, the most considerable drawbackin both of the vaulted buildings is the practise of gloomy, dim andfailedlocations. As a result, even though they are
[Ecological risk evaluation of heavy metals of the typical dredged mud in Shanghai].
Tang, Qing-Li; Cheng, Jin-Ping; Gao, Hao-Min; Yao, Lei; Jiang, Zhen-Yi; Wu, Yang; Xie, Cui-Song; Liang, Hai; Wang, He; Pi, Shuai-Shuai; Yu, Zhao-Yi
2013-04-01
In order to discuss the potential ecological risk of heavy metals of the typical dredged mud in Shanghai, the Hakanson potential ecological risks method was used to analyse and assess the potential ecological risks of heavy metals, including Hg, Cd, Cu, Pb, As,Cr and Zn in dredged mud from the following three areas-the dock apron of Huangpu River, the mouth of the Yangtze River and inland waterways. The results showed that the mean values of ecological risk index (Er(i)) of the seven heavy metals are 20.05, 17.49, 8.82, 5.71, 4.68, 1.74 and 1.13, respectively, all of which belonged to the low ecological risk; Cd (one location in inland waterways) and Hg (three locations in the mouth of the Yangtze River and one location in inland waterways) are the most hazardous elements, with the Er(i) > 40, which belonged to the medium ecological risk or the high ecological risk, and other elements belonged to the low ecological risk. From the results of ecological risk indices(ERI) of the heavy metals in Shanghai dredged mud, the risk of the heavy metals belonged to the low ecological risk. The ERI of inland waterways, the mouth of the Yangtze River and the dock apron of the Huangpu River were 81.4, 57.7 and 52.5, respectively, which all belong to the low ecological risk.
Ota, Atsuhiko; Mase, Junji; Howteerakul, Nopporn; Rajatanun, Thitipat; Suwannapong, Nawarat; Yatsuya, Hiroshi; Ono, Yuichiro
2014-01-01
We examined the influence of work-related effort–reward imbalance and overcommitment to work (OC), as derived from Siegrist's Effort–Reward Imbalance (ERI) model, on the hypothalamic–pituitary–adrenocortical (HPA) axis. We hypothesized that, among healthy workers, both cortisol and dehydroepiandrosterone (DHEA) secretion would be increased by effort–reward imbalance and OC and, as a result, cortisol-to-DHEA ratio (C/D ratio) would not differ by effort–reward imbalance or OC. The subjects were 115 healthy female nursery school teachers. Salivary cortisol, DHEA, and C/D ratio were used as indexes of HPA activity. Mixed-model analyses of variance revealed that neither the interaction between the ERI model indicators (i.e., effort, reward, effort-to-reward ratio, and OC) and the series of measurement times (9:00, 12:00, and 15:00) nor the main effect of the ERI model indicators was significant for daytime salivary cortisol, DHEA, or C/D ratio. Multiple linear regression analyses indicated that none of the ERI model indicators was significantly associated with area under the curve of daytime salivary cortisol, DHEA, or C/D ratio. We found that effort, reward, effort–reward imbalance, and OC had little influence on daytime variation patterns, levels, or amounts of salivary HPA-axis-related hormones. Thus, our hypotheses were not supported. PMID:25228138
The Determinants of Visitor’s Revisit Intention: A Lesson from Ijen Car Free Day
Directory of Open Access Journals (Sweden)
Cesya Rizkika Parahiyanti
2015-09-01
Full Text Available Event industry currently is considered as one of interesting business opportunity in contributing major positive economic impact. Event could be categorized into some activities conducted by an event management or event organizer in the case of achieving some specific outcomes. An event is also recognized as an essential marketing tool in branding of particular destination. It has a powerful function to make a differentiation between one destination and others. This study aims to establish a theoretical event brand equity for which the key components of the brand equity were evaluated from visitor perspective in the tourism context. Brand equity is constructed by four multidimensions which are event brand awareness (EBA, event brand image (EBI, event brand quality (EBQ, and event revisit intention (ERI. By using convenience sampling, 205 visitors of Ijen Car Free Day (ICFD as the event object were used as respondents to obtain the data. This study uses Partial Least Square (PLS to analyze the data both in outer model and inner model measurements. The finding of this study indicate that EBA has positive and significant influence to EBI, EBQ, and ERI. Then, EBI is also proven giving positive and significant influence to EBQ and ERI. In contrary, EBQ does not show significant influence to ERI. The significance movement of this study could be useful measurement in assessing event brand equity management in the future.
Organisational justice and mental health: a systematic review of prospective studies.
Ndjaboué, Ruth; Brisson, Chantal; Vézina, Michel
2012-10-01
The models most commonly used, to study the effects of psychosocial work factors on workers' health, are the demand-control-support (DCS) model and Effort-Reward Imbalance (ERI) model. An emerging body of research has identified Organisational Justice as another model that can help to explain deleterious health effects. This review aimed: (1) to identify prospective studies of the associations between organisational justice and mental health in industrialised countries from 1990 to 2010; (2) to evaluate the extent to which organisational justice has an effect on mental health independently of the DCS and ERI models; and (3) to discuss theoretical and empirical overlap and differences with previous models. The studies had to present associations between organisational justice and a mental health outcome, be prospective, and be entirely available in English or in French. Duplicated papers were excluded. Eleven prospective studies were selected for this review. They provide evidence that procedural justice and relational justice are associated with mental health. These associations remained significant even after controlling for the DCS and ERI models. There is a lack of prospective studies on distributive and informational justice. In conclusion, procedural and relational justice can be considered a different and complementary model to the DCS and ERI models. Future studies should evaluate the effect of change in exposure to organisational justice on employees' mental health over time.
Aeron, Abhinav; Khare, Ekta; Kumar Arora, Naveen; Kumar Maheshwari, Dinesh
2012-01-01
In many parts of the world Mucuna pruriens is used as an important medicinal, forage and green manure crop. In the present investigation the effect of the addition of CMC in carrier during development of bioformulation on shelflife, plant growth promotive and biocontrol activity against Macrophomina phaseolina was screened taking M. pruriens as a test crop. Ensifer meliloti RMP6(Ery+Kan+) and Bradyrhizobium sp. BMP7(Tet+Kan+) (kanamycin resistance engineered by Tn5 transposon mutagenesis) used in the study showed production of siderophore, IAA, solubilizing phosphate and biocontrol of M. phaseolina. RMP6(Ery+Kan+) also showed ACC deaminase activity. The survival of both the strains in sawdust-based bioformulation was enhanced with an increase in the concentration of CMC from 0 to 1%. At 0% CMC Bradyrhizobium sp. BMP7(Tet+Kan+) showed more increase in nodule number/plant (500.00%) than E. meliloti RMP6(Ery+Kan+) (52.38%), over the control in M. phaseolina-infested soil. There was 185.94% and 59.52% enhancement in nodule number/plant by RMP6(Ery+Kan+) and BMP7(Tet+Kan+) with an increase in the concentration of CMC from 0% to 1% in the bioformulations. However further increase in concentration of CMC did not result in enhancement in survival of either the strains or nodule number/plant.
Neli eri ökomajaprojekti, neli eri lähenemist / Kristel Ader, Aivar Õepa
Ader, Kristel
2002-01-01
Säästvalt remonditud saja-aastane puumaja Haapsalus, looduslähedane kinnisvaraarendusprojekt Tallinna lähedal Leppneemes, Saksa riikliku keskkonnafondi DBU peamaja Osnabrückis, Kabli linnurõngastuskeskuse hoone Nigula kaitsealal
Wagner, Tyler; Vandergoot, Christopher S.; Tyson, Jeff
2009-01-01
Fishery-independent (FI) surveys provide critical information used for the sustainable management and conservation of fish populations. Because fisheries management often requires the effects of management actions to be evaluated and detected within a relatively short time frame, it is important that research be directed toward FI survey evaluation, especially with respect to the ability to detect temporal trends. Using annual FI gill-net survey data for Lake Erie walleyes Sander vitreus collected from 1978 to 2006 as a case study, our goals were to (1) highlight the usefulness of hierarchical models for estimating spatial and temporal sources of variation in catch per effort (CPE); (2) demonstrate how the resulting variance estimates can be used to examine the statistical power to detect temporal trends in CPE in relation to sample size, duration of sampling, and decisions regarding what data are most appropriate for analysis; and (3) discuss recommendations for evaluating FI surveys and analyzing the resulting data to support fisheries management. This case study illustrated that the statistical power to detect temporal trends was low over relatively short sampling periods (e.g., 5–10 years) unless the annual decline in CPE reached 10–20%. For example, if 50 sites were sampled each year, a 10% annual decline in CPE would not be detected with more than 0.80 power until 15 years of sampling, and a 5% annual decline would not be detected with more than 0.8 power for approximately 22 years. Because the evaluation of FI surveys is essential for ensuring that trends in fish populations can be detected over management-relevant time periods, we suggest using a meta-analysis–type approach across systems to quantify sources of spatial and temporal variation. This approach can be used to evaluate and identify sampling designs that increase the ability of managers to make inferences about trends in fish stocks.
”Mitä tänään on tarjolla?” : opiskelijaruokailu laadusta mielikuviin
Partanen, Elina
2008-01-01
Työn tavoitteena oli selvittää, mitä opiskelijat yleensä syövät lounaalla opiskelijaravintolassa ja mitä mieltä he olivat tarjotusta lounasruuasta. Jyväskylän ammattikorkeakoululla on viisi eri ruokapalveluiden tarjoajaa, ja jokaisella on hieman toisistaan poikkeava liikekonsepti. Tutkimus toteutettiin sähköpostikyselynä Digium-ohjelman avulla ammattikorkeakoulun eri alojen opiskelijoille. Kyselyyn oli mahdollista vastata 8.4.2008 – 22.4.2008 välisenä aikana. Kyselyyn vastasi 341. Kyselyn tul...
Kouvonen, Anne; Kivimäki, Mika; Elovainio, Marko; Pentti, Jaana; Linna, Anne; Virtanen, Marianna; Vahtera, Jussi
2006-01-01
Objectives: To investigate the association between effort-reward imbalance (ERI) at work and sedentary lifestyle.\\ud Methods: Cross-sectional data from the ongoing Finnish Public Sector Study related to 30 433 women and 7718 men aged 17-64 were used (n = 35 918 after exclusion of participants with missing values in covariates). From the responses to a questionnaire, an aggregated mean score for ERI in a work unit was assigned to each participant. The outcome was sedentary lifestyle defined as
Kouvonen, Anne; Kivimäki, Mika; Virtanen, Marianna; Heponiemi, Tarja; Elovainio, Marko; Pentti, Jaana; Linna, Anne; Vahtera, Jussi
2006-01-01
Abstract Background In occupational life, a mismatch between high expenditure of effort and receiving few rewards may promote the co-occurrence of lifestyle risk factors, however, there is insufficient evidence to support or refute this hypothesis. The aim of this study is to examine the extent to which the dimensions of the Effort-Reward Imbalance (ERI) model – effort, rewards and ERI – are associated with the co-occurrence of lifestyle risk factors. Methods Based on data from the Finnish Pu...
Effort reward imbalance is associated with vagal withdrawal in Danish public sector employees
DEFF Research Database (Denmark)
Eller, Nanna Hurwitz; Blønd, Morten; Nielsen, Martin
2011-01-01
The current study analyzed the relationship between psychosocial work environment assessed by the Effort Reward Imbalance Model (ERI-model) and heart rate variability (HRV) measured at baseline and again, two years later, as this relationship is scarcely covered by the literature.......The current study analyzed the relationship between psychosocial work environment assessed by the Effort Reward Imbalance Model (ERI-model) and heart rate variability (HRV) measured at baseline and again, two years later, as this relationship is scarcely covered by the literature....
Tuotesijoittelu elokuvissa ja tv-sarjoissa
Kujala, Toni
2017-01-01
Tämä opinnäytetyö käsittelee tuotesijoittelua ja miten se ilmenee elokuvissa ja tv-sarjoissa. Opinnäytetyön tarkoituksena oli selvittää mitä tuotesijoittelu on, miten se vaikuttaa katsojiin ja miten sitä voi hyödyntää eri toimijoiden markkinointiviestinnässä. Tuotesijoittelun vaikutuksia katsojiin on selvitetty kvalitatiivisella menetelmällä haastattelemalla viittä ihmistä ja tutkimalla tuotesijoittelusta käytyä keskustelua eri keskustelupalstoilla ja sosiaalisessa mediassa. Haastattelussa ol...
Directory of Open Access Journals (Sweden)
Korhan Levent Ertürk
2014-12-01
Full Text Available Fiziksel veya zihinsel nedenlerle bazı hareketleri, duyuları veya işlevleri kısıtlı olan bireyler toplumun bir grubunu oluşturmaktadır. Türkiye’de bu bireyler ve/veya çevreleri toplumda doğrudan ya da dolaylı olarak çeşitli sorunlarla karşı karşıya kalmaktadırlar. Günümüzde eğitim, sağlık, adalet, sosyal güvenlik gibi alanlarda bu durum sıklıkla görülebilmektedir. Söz konusu bireyler sorunlarıyla ilgilenilmesini ve çözüme kavuşturulmasını istemektedirler. Bir ülkenin gelişmişlik düzeyi anılan sorunların çözümüne yönelik çalışmalar ile doğrudan ilişkilidir. Çalışmamız, bazı hareketleri, duyuları veya işlevleri kısıtlı olan bireylerin ortak bir terimle ifade edilmesi, engelli birey farkındalığının ortaya konulması ve bu bağlamda ilgili bazı web sitelerinin bu bireyler açısından yeterliliğinin sorgulanmasına yöneliktir. Bunlar ve benzeri web sitelerinin olabildiğince erişilebilir yapılması engelli kullanıcılara diğer bireyler ile eşit hakların sağlanmasına katkı sağlayabilecek, bilgi ve iletişim kaynaklarını çeşitlendirebilecektir. / The people who have physical or mental disabilities which limit their movements, senses, activities or both of them are one of the groups in society. Those people have various problems in social life directly or indirectly in Turkey. Nowadays, they face many problems in accessibility on many fields such as education, healthcare, justice, social security, etc. Those individuals are willing to draw attention and resolve their problems. The level of development of countries is directly related with the solution of the aforementined problems. In this study we focused on the common terms about the people who have limited movements, senses, activities or both; and focused on the awereness of disabled people and we investigated the the accessibility of the web sites about the justice by disabled people. Making accessible of web
ORF Alignment: NC_006510 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ery: 123 ARPNVTVDAASLCLKTGNAVLLRGSTSALHSNKALVAVMKEALRTTAIPETAIELLEDTS 182 ... ... ... ARPNVTVDAASLCLKTGNAVLLRGSTSALHSNKALVAVMKEALRTTAIPETAIELLEDTS Sbjct: 121 ARPNVTVDAASLCLKTGNAVLLRGSTSALHSNKALVAVMKEALRTTAIPE
ORF Alignment: NC_003070 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ery: 127 VVALGPLTNLALAVQLDPEFSKNVGQIVLLGGAFAVNGNVNPASEANIFGDPEAADIVFT 186 ... ... ... VVALGPLTNLALAVQLDPEFSKNVGQIVLLGGAFAVNGNVNPASEANIFGDPEAADIVFT Sbjct: 121 VVALGPLTNLALAVQLDPEFSKNVGQIVLLGGAFAVNGNVNPASEAN
A New Method of 3D Facial Expression Animation
Directory of Open Access Journals (Sweden)
Shuo Sun
2014-01-01
Full Text Available Animating expressive facial animation is a very challenging topic within the graphics community. In this paper, we introduce a novel ERI (expression ratio image driving framework based on SVR and MPEG-4 for automatic 3D facial expression animation. Through using the method of support vector regression (SVR, the framework can learn and forecast the regression relationship between the facial animation parameters (FAPs and the parameters of expression ratio image. Firstly, we build a 3D face animation system driven by FAP. Secondly, through using the method of principle component analysis (PCA, we generate the parameter sets of eigen-ERI space, which will rebuild reasonable expression ratio image. Then we learn a model with the support vector regression mapping, and facial animation parameters can be synthesized quickly with the parameters of eigen-ERI. Finally, we implement our 3D face animation system driving by the result of FAP and it works effectively.
ORF Alignment: NC_000961 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ery: 121 PVLPFKPAGSVELAQQVSEAMKDYDAVILERHGIVTVGRSLREAFYRAELVEEVARLWYQ 180 ... ... ... PVLPFKPAGSVELAQQVSEAMKDYDAVILERHGIVTVGRSLREAFYRAELVEEVARLWYQ Sbjct: 121 PVLPFKPAGSVELAQQVSEAMKDYDAVILERHGIVTVGRSLREAFYRAELVEEVARLWYQ 180
ORF Alignment: NT_033778 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ery: 4 ... EFAGNLSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIV 63 ... EFAGNLSHPLEFGHVLEVVAKTID...GAARFHINLCTAKSTVDPNADIGLRFSCYFRNDVIV Sbjct: 1 ... EFAGNLSHPLEFGHVLEVVAKTIDGAARFHINLCTAKSTVDPNADIGLRFSCYFRNDV
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ery: 18 ... LDPVEQAVADIAAGRPXXXXXXENRENEGDLVIAAEKATEEIVAFMMTECRGLICAPMEG 77 ... ... ... LDPVEQAVADIAAGRP ... ENRENEGDLVIAAEKATEEIVAFMMTECRGLICAPMEG Sbjct: 1 ... LDPVEQAVADIAAGRPVVVVDDENRENEGDLVIAAEKATEEIVAFMMTECRGLICAPM
ORF Alignment: NC_006322 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ery: 3 ... YFVDRHKIENTLNFLEEELRLYQMQEEWTSDVEKKALERIGHTLIECILDIGNDMIDGFI 62 ... YFVDRHKIENTLNFLEEELRLYQMQEEWTSDVEKKALERIGHT...LIECILDIGNDMIDGFI Sbjct: 1 ... YFVDRHKIENTLNFLEEELRLYQMQEEWTSDVEKKALERIGHTLIECILDIGNDMIDGFI
ORF Alignment: NC_006270 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ery: 3 ... YFVDRHKIENTLNFLEEELRLYQMQEEWTSDVEKKALERIGHTLIECILDIGNDMIDGFI 62 ... YFVDRHKIENTLNFLEEELRLYQMQEEWTSDVEKKALERIGHT...LIECILDIGNDMIDGFI Sbjct: 1 ... YFVDRHKIENTLNFLEEELRLYQMQEEWTSDVEKKALERIGHTLIECILDIGNDMIDGFI
ORF Alignment: NC_002655 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ery: 34 ... QAGVVVGGTRFIFPADRESISILLTNTSQESWLINRKINRPTRWAGGEASTVXXXXXXXX 93 ... QAGVVVGGTRFIFPADRESISILLTNTSQESWL...INRKINRPTRWAGGEASTV ... Sbjct: 1 ... QAGVVVGGTRFIFPADRESISILLTNTSQESWL
Sähkösuunnittelu osana suunnitteluprojektia
Grönroos, Roope
2016-01-01
Insinöörityö tehtiin Sweco Industry Oy:n automaatio-osastolle. Työssä tutkittiin, kuinka teollisuuden sähkösuunnittelu liittyy suunnitteluprojekteissa muihin suunnittelualoihin isomman suunnittelukonsernin näkökulmasta. Alussa perehdytään muihin suunnittelualoihin ja siihen, kuinka ne ovat sidoksissa teollisuuden sähkösuunnitteluun. Alussa käydään läpi suunnitteluprojektin eri vaiheita ja mitä niihin sisältyy. Työtä varten haastateltiin eri suunnittelualojen kokeneita ammattil...
Kaupallista estetiikkaa : mainosvalokuva sosiaalisessa mediassa
Vuorinen, Terri
2017-01-01
Opinnäytetyössä tutkitaan sosiaalisen median mainosvalokuvia kahdessa eri sosiaalisen median alustassa: Instagramissa ja blogeissa, joissa valokuvat ja visuaalisuus ovat keskeisessä osassa sisältöä. Opinnäytetyön teoria pohjautuu painettuihin ja verkkolähteisiin brändistä ja sosiaalisesta mediasta. Lisäksi on haastateltu alan asiantuntijoita kolmesta eri näkökulmasta: brändin, bloggaajan ja sosiaalisen median strategistin perspektiivistä. Opinnäytetyö käsittelee aluksi Instagramissa esiin...
DEFF Research Database (Denmark)
Rugulies, Reiner; Norborg, Malene; Sørensen, Tilde Sand
2009-01-01
OBJECTIVES: This study aimed to analyze if adverse psychosocial working conditions, defined by the model of effort-reward imbalance (ERI), increase the risk of sleep disturbances in the Danish workforce. METHODS: Analyses were conducted both cross-sectionally and prospectively in a representative...... disturbances in the Danish workforce. Among women, an association between ERI and sleep disturbances was restricted to the cross-sectional sample. Improving psychosocial working conditions might reduce the risk of sleep disturbances and subsequently also help to prevent clinical disorders related to sleep...
Portfolio optimization for heavy-tailed assets: Extreme Risk Index vs. Markowitz
Mainik, Georg; Mitov, Georgi; Rüschendorf, Ludger
2015-01-01
Using daily returns of the S&P 500 stocks from 2001 to 2011, we perform a backtesting study of the portfolio optimization strategy based on the extreme risk index (ERI). This method uses multivariate extreme value theory to minimize the probability of large portfolio losses. With more than 400 stocks to choose from, our study seems to be the first application of extreme value techniques in portfolio management on a large scale. The primary aim of our investigation is the potential of ERI in p...
Directory of Open Access Journals (Sweden)
Ayşe Gürsoy
2015-02-01
Full Text Available Bu çalışmada, yağ içeriği azaltılmış Beyaz peynir örneklerinde, proteolizi teşvik ederek olgunlaşmayı hızlandırmak ve böylece yapı ve tadı iyileştirmek amacıyla, isti işlem uygulanan L.helveticus ve L. bulgaricus kültürlerinden yararlanılmıştır. Bunun için kurumaddede %20 yağ içerecek şekilde peynir üretimi gerçekleştirilmiş, ayrıca karşılaştırma amacıyla yağlı peynir örneği (kurumaddede %40 yağ de üretilmiştir. Peynirler 7±1 °C'de olgunlaşmaya bırakılarak 0, 7, 15, 30, 60 ve 90. günlerde fiziksel, kimyasal ve duyusal nitelikleri yönünden analiz edilmiştir. Isıl işlem uygulamasıyla yardımcı kültür haline getirilen L.helveticus ve L. bulgaricus kullanımı az yağlı beyaz peynir örneklerinin genel bileşimini etkilememiş olgunlaşmanın hızlandırılmasında da fazla etkili olmamıştır.
ORF Alignment: NC_003280 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ery: 35 ... PVAQLNEYAQKFYKKYPTFEFVKEQAVGKHRVFIIQATFEDKTLEGRGPSKMIAKRAAAE 94 ... PVAQLNEYAQKFYKKYPTFE...FVKEQAVGKHRVFIIQATFEDKTLEGRGPSKMIAKRAAAE Sbjct: 1 ... PVAQLNEYAQKFYKKYPTFEFVKEQAVGKHRVFIIQATFEDKTLEGRGPSKMIAKRAAAE 60 ...
ORF Alignment: NC_004459 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ery: 4 ... YNGKQIETDAQGYLLDHTQWEEGMIEILAEQEGIELTDAHLEVIHFVRDFYEEFNTSPAV 63 ... YNGKQIETDAQGYLLDHTQWEEGMIEILAEQEGIELTDAH...LEVIHFVRDFYEEFNTSPAV Sbjct: 1 ... YNGKQIETDAQGYLLDHTQWEEGMIEILAEQEGIELTDAHLEVIHFVRDFYEEFNTSPAV 60 ...
ORF Alignment: NC_005783 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ery: 3 ... LRDQLKVLLDGVFDLKEENGIEILPIFYTLPLRKDYPDYYRIIKKPLSLATVKKKLNHYK 62 ... LRDQLKVLLDGVFDLKEENGIEIL...PIFYTLPLRKDYPDYYRIIKKPLSLATVKKKLNHYK Sbjct: 1 ... LRDQLKVLLDGVFDLKEENGIEILPIFYTLPLRKDYPDYYRIIKKPLSLATVKKKLNHYK 60 ...
ORF Alignment: NC_002696 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ery: 121 NARAEDLKLKVDIVTARACAPMTKLLGFAEPYLRNGAVGLFLKGQDVETELSEARKAWTF 180 ... NARAEDLKLKVDIVTARACAPMT...KLLGFAEPYLRNGAVGLFLKGQDVETELSEARKAWTF Sbjct: 121 NARAEDLKLKVDIVTARACAPMTKLLGFAEPYLRNGAVGLFLKGQDVETELSEARKAWTF 180 ...
ORF Alignment: NC_006370 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ery: 155 GIALGAEDYVRDLRTQRSPEGTELLFARCSILQAARSAGIMAFDTVYSDANNEEGFIREA 214 ... GIALGAEDYVRDLRTQRSPEGTELLFARC...SILQAARSAGIMAFDTVYSDANNEEGFIREA Sbjct: 121 GIALGAEDYVRDLRTQRSPEGTELLFARCSILQAARSAGIMAFDTVYSDANNEEGFIREA 180 ...
ORF Alignment: NT_037436 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ery: 851 DDSVTRCICELTHDDGYMICCDKCSAWQHVDCMGIDRQNIPEEYMCELCQPRAVD 905 ... DDSVTRCICELTHDDGYMICCDKCSAWQHVDC...MGIDRQNIPEEYMCELCQPRAVD Sbjct: 5 ... DDSVTRCICELTHDDGYMICCDKCSAWQHVDCMGIDRQNIPEEYMCELCQPRAVD 59
ORF Alignment: NC_006814 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ery: 146 EERAIEKSKDELITNVSHDIRTPLTSIIGYLGLLKTGISSKEDQQKYVDIAYTKAEQMKS 205 ... EERAIEKSKDELITNVSHDIR...TPLTSIIGYLGLLKTGISSKEDQQKYVDIAYTKAEQMKS Sbjct: 1 ... EERAIEKSKDELITNVSHDIRTPLTSIIGYLGLLKTGISSKEDQQKYVDIAYTKAEQMKS 60 ...
Work stress, poor recovery and burnout in teachers.
Gluschkoff, K; Elovainio, M; Kinnunen, U; Mullola, S; Hintsanen, M; Keltikangas-Järvinen, L; Hintsa, T
2016-10-01
Both work stress and poor recovery have been shown to contribute to the development of burnout. However, the role of recovery as a mediating mechanism that links work stress to burnout has not been sufficiently addressed in research. To examine recovery as a mediator in the relationship between work stress and burnout among teachers. A cross-sectional study of Finnish primary school teachers, in whom burnout was measured with the Maslach Burnout Inventory-General Survey and work stress was conceptualized using the effort-reward imbalance (ERI) model. Recovery was measured with the Recovery Experience Questionnaire and the Jenkins Sleep Problems Scale. Multiple linear regression analyses and bootstrap mediation analyses adjusted for age, gender and total working hours were performed. Among the 76 study subjects, high ERI was associated with burnout and its dimensions of exhaustion, cynicism and reduced professional efficacy. Poor recovery experiences, in terms of low relaxation during leisure time, partially mediated the relationship between ERI and reduced professional efficacy. Sleep problems, in the form of non-restorative sleep, partially mediated the relationship between ERI and both burnout and exhaustion. Supporting a balance between effort and reward at work may enhance leisure time recovery and improve sleep quality, as well as help to reduce burnout rates. © The Author 2016. Published by Oxford University Press on behalf of the Society of Occupational Medicine. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Tzeng Dong-Sheng
2012-09-01
Full Text Available Abstract Background Taiwan’s National Defense Bureau has been merging its hospitals and adjusting hospital accreditation levels since the beginning of 2006. These changes have introduced many stressors to the healthcare workers in these hospitals. This study investigates the association between job stress, psychological morbidity and quality of life in healthcare workers in three military hospitals. Methods We posted surveys to 1269 healthcare workers in three military hospitals located in southern Taiwan. The surveys included the General Health Questionnaire (GHQ, the World Health Organization Quality of Life Questionnaire (WHOQOL-BREF, and the Effort-Reward Imbalance (ERI Questionnaire. High effort-reward (ER ratio and overcommitment were defined when scores fell into the upper tertile of the total distribution. Results The survey was completed by 791 healthcare workers. On average, women reported a higher ERI than men. High ERI was associated with younger age, higher psychological morbidity, and poor physical and psychological QOL domains in this population. High ER ratio and high overcommitment were associated with psychological morbidity and poor QOL in both sexes. However, high ER ratio was not significantly associated with the social QOL domain in either sexes or the physical QOL domain in males. Conclusions There was a clear association between ERI and QOL in the healthcare workers in the military hospitals under reorganization and accreditation in this study. We found ER ratio and overcommitment to be suitable indicators of job stress.
The Effort and Reward of Teaching Medical Psychology in Germany: an Online Survey.
Kendel, Friederike; Rockenbauch, Katrin; Deubner, Rolf; Philipp, Swetlana; Fabry, Götz
2016-01-01
Background: The increasing significance of university teaching also leads to higher demands for academic teachers. Against this background this study inquires how teachers in the field of medical pychology experience and evaluate their various activities and how their efforts on the one hand and gratifications on the other hand relate to each other (as conceptualized by the effort-reward-imbalance, ERI). Methods: A cross-sectional online survey was conducted in 2012 among the academic staff of departments of medical psychology in Germany. The questionnaire was answered by 188 participants (return rate: 39.2%), of whom 62% were women. Work stress was measured according to Siegrist's effort-reward-imbalance (ERI) model. Further questions referred to the distribution of academic activities and meaningfulness. Results: Among all participants, 67.3% were satisfied with the portion of their workload devoted to teaching, while 63% wanted more time for research. The ERI-coefficient was on average M=0.76 (SD=0.45), thus indicating a shift towards reward. There were no associations with gender, age, or fixed-term work contracts. Meaningfulness was associated negatively with the ERI (r=-.21, p=.012), and positively with overcommitment (r=.52, pTeaching medical psychology is evaluated as positive and meaningful by a majority of respondents. In general, the rewarding aspects seem to outweigh the stressful factors. Thus, teaching might be a protective factor with regard to coping with work related burden.
Trudel, Xavier; Milot, Alain; Gilbert-Ouimet, Mahée; Duchaine, Caroline; Guénette, Line; Dalens, Violaine; Brisson, Chantal
2017-08-15
We examined the association between effort-reward imbalance (ERI) exposure at work and unsuccessfully treated hypertension among white-collar workers from a large cohort in Quebec City, Canada. The study used a repeated cross-sectional design involving 3 waves of data collection (2000-2009). The study sample was composed of 474 workers treated for hypertension, accounting for 739 observations. At each observation, ERI was measured using validated scales, and ambulatory blood pressure (BP) was measured every 15 minutes during the working day. Unsuccessfully treated hypertension was defined as daytime ambulatory BP of at least 135/85 mm Hg and was further divided into masked and sustained hypertension. Adjusted prevalence ratios and 95% confidence intervals were estimated. Participants in the highest tertile of ERI exposure had a higher prevalence of unsuccessfully treated hypertension (prevalence ratio = 1.45, 95% confidence interval: 1.16, 1.81) after adjustment for gender, age, education, family history of cardiovascular diseases, body mass index, diabetes, smoking, sedentary behaviors, and alcohol intake. The present study supports the effect of adverse psychosocial work factors from the ERI model on BP control in treated workers. Reducing these frequent exposures at work might lead to substantial benefits on BP control at the population level. © The Author(s) 2017. Published by Oxford University Press on behalf of the Johns Hopkins Bloomberg School of Public Health. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Biological decolorization of xanthene dyes by anaerobic granular biomass.
Apostol, Laura Carmen; Pereira, Luciana; Pereira, Raquel; Gavrilescu, Maria; Alves, Maria Madalena
2012-09-01
Biodegradation of a xanthene dyes was investigated for the first time using anaerobic granular sludge. On a first screening, biomass was able to decolorize, at different extents, six azo dye solutions: acid orange 7, direct black 19, direct blue 71, mordant yellow 10, reactive red 2 and reactive red 120 and two xanthene dyes--Erythrosine B and Eosin Y. Biomass concentration, type of electron donor, induction of biomass with dye and mediation with activated carbon (AC) were variables studied for Erythrosine B (Ery) as model dye. Maximum color removal efficiency was achieved with 4.71 g VSS L⁻¹, while the process rates were independent of the biomass concentration above 1.89 g VSS L⁻¹. No considerable effects were observed when different substrates were used as electron donors (VFA, glucose or lactose). Addition of Ery in the incubation period of biomass led to a fivefold increase of the decolorization rate. The rate of Ery decolorization almost duplicated in the presence of commercial AC (0.1 g L⁻¹ AC₀). Using different modified AC samples (from the treatment of AC₀), a threefold higher rate was obtained with the most basic one, AC(H₂), as compared with non-mediated reaction. Higher rates were obtained at pH 6.0. Chemical reduction using Na₂S confirmed the recalcitrant nature of this dye. The results attest that decolorization of Ery is essentially due to enzymatic and adsorption phenomena.
Laidunruohon kemiallinen koostumus eri typpilannoitustasoilla
Directory of Open Access Journals (Sweden)
Kalle Rinne
1976-07-01
Full Text Available Vuosina 1965—68 Maatalouden tutkimuskeskuksen tekemissä laitumen typpilannoituskokeissa Hämeen, Etelä-Savon ja Pohjois-Savon koeasemilla saatiin seuraavia tuloksia: 1. Typpilannoituksen nostaminen 100 kg:sta 300 kg:an hehtaarille lisäsi erittäin merkitsevästi ruohon raakavalkuaispitoisuutta, vähensi erittäin merkitsevästi typettömien uuteaineiden ja Hämeen koeasemalla myös raakakuidun osuutta, vaikutti karjan ravitsemuksen kannalta edullisesti ruohon kalsium-, magnesium- ja natriumpitoisuuksiin eli kohotti niiden osuutta, vaikutti negatiivisesti ruohon fosfori-, kalium- ja nitraattipitoisuuksiin eli alensi fosforipitoisuutta ja kohotti kalium- ja nitraattipitoisuuksia. 2. Kausivaihteluista selvimmät olivat raakavalkuaispitoisuuden kohoaminen syksyä kohden, alhaisimmat fosforipitoisuudet ja korkeimmat kalsium- ja nitraattipitoisuudet keskikesällä. 3. Nurmen iän lisääntyessä ruohon raakakuitupitoisuus ja typettömien uuteaineiden osuus kas voivat, nitraatti- ja kivennäisainepitoisuudet sekä raakavalkuaispitoisuus alenivat.
Floodplain, Erie County, PA, USA
Federal Emergency Management Agency, Department of Homeland Security — This Floodplain Mapping Submission includes a new countywide FIS report, but no digital flood hazard data. GG3 was not contracted to prepare digital flood data, only...
TERRAIN, ERIE COUNTY, OHIO, USA
Federal Emergency Management Agency, Department of Homeland Security — The 2006 OSIP bare-earth Digital Elevation Model (DEM) was derived from digital LiDAR data was collected during the months of March and May (leaf-off conditions)....
Effort–reward imbalance at work and risk of depressive disorders
DEFF Research Database (Denmark)
Rugulies, Reiner; Aust, Birgit; H. Madsen, Ida E.
2017-01-01
Objective: The aim of this review was to determine whether employees exposed to effort–reward imbalance (ERI) at work have a higher risk of depressive disorders than non-exposed employees. Methods: We conducted a systematic review and meta-analysis of published prospective cohort studies examining...... the association of ERI at baseline with onset of depressive disorders at follow-up. The work was conducted in accordance with the Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA) statement and a detailed study protocol was registered before literature search commenced (Registration...
Pääkaupunkiseudulla asuvien naisten tuoksutottumuksia
Lehtonen, Susanna
2010-01-01
Tämän opinnäytetyön tarkoituksena on pohtia tuoksuja ja niiden merkitystä. Työn alussa käy-dään läpi tuoksujen perusasioita. Näitä asioita ovat muun muassa tuoksujen luomisprosessiin perehtyminen, tuoksussa erotettavat eri vaiheet sekä eri tuoksukategoriat. Tuoksujen historia on erittäin kiehtova. Ihmiset ovat käyttäneet tuoksuja jo vuosituhansia. Alkujaan tuoksuja käytettiin uskonnollisissa rituaaleissa, mutta vähiten niistä muodostui osa hygieniaa ja kauneusrutiineja. Tästä syystä tuok...
Onnistu sosiaalisessa mediassa : case: Espanja.Com
Heiskanen, Nina-Maria
2016-01-01
Opinnäytetyö toteutettiin toimeksiantona Espanja.Com kiinteistönvälitys- ja infosivustolle. Toimeksiantaja on B2B-yritys, joka käyttää sosiaalista mediaa erityisesti tunnettuuden lisäämiseen ja brändin rakentamiseen. Työn tavoitteena oli selvittää, miten toimeksiantajan kannattaa hyödyntää eri sosiaalisen median kanavia yritystoiminnassaan. Tavoitteena oli myös tutkia, miten yrityksen tulee toimia eri sosiaalisen median ympäristöissä, jotta niistä saadaan suurin hyöty irti. Kohdeyri...
Komulainen, Jaakko
2016-01-01
Ohjelmistokehityksessä integraatio voidaan määritellä prosessiksi, jonka tuloksena kaksi tai useampi sovellus saadaan jakamaan tietoa keskenään. Ohjelmistointegraatioita tarvitaan usein tilanteissa, joissa yritys on siirtymässä uuteen järjestelmään. Siirtymävaiheessa on yleistä, että täytyy ylläpitää samaa tietoa kahdessa eri järjestelmässä. Ohjelmistointegraatiot voidaan jakaa karkeasti kolmeen eri kategoriaan: data-, viesti- tai prosessitason integraatioihin. Tässä työssä tehdään viestitaso...
Energy Technology Data Exchange (ETDEWEB)
Wissemann, Chris [Freshwater Wind I, LLC, Youngstown, OH (United States); White, Stanley M [Stanley White Engineering LLC, Noank, CT (United States)
2014-02-28
The primary objective of the project was to develop a innovative Gravity Base Foundation (GBF) concepts, including fabrication yards, launching systems and installation equipment, for a 500MW utility scale project in the Great Lakes (Lake Erie). The goal was to lower the LCOE by 25%. The project was the first to investigate an offshore wind project in the Great Lakes and it has furthered the body of knowledge for foundations and installation methods within Lake Erie. The project collected historical geotechnical information for Lake Erie and also used recently obtained data from the LEEDCo Icebreaker Project (FOA DE-EE0005989) geotechnical program to develop the conceptual designs. Using these data-sets, the project developed design wind and wave conditions from actual buoy data in order to develop a concept that would de-risk a project using a GBF. These wind and wave conditions were then utilized to create reference designs for various foundations specific to installation in Lake Erie. A project partner on the project (Weeks Marine) provided input for construction and costing the GBF fabrication and installation. By having a marine contractor with experience with large marine projects as part of the team provides credibility to the LCOE developed by NREL. NREL then utilized the design and construction costing information as part of the LCOE model. The report summarizes the findings of the project; Developed a cost model and “baseline” LCOE; Documented Site Conditions within Lake Erie; Developed Fabrication, Installation and Foundations Innovative Concept Designs; Evaluated LCOE Impact of Innovations; Developed Assembly line “Rail System” for GBF Construction and Staging; Developed Transit-Inspired Foundation Designs which incorporated: Semi-Floating Transit with Supplemental Pontoons Barge mounted Winch System; Developed GBF with “Penetration Skirt”; Developed Integrated GBF with Turbine Tower; Developed Turbine, Plant Layout and O&M Strategies. The
Projections of UV radiation changes in the 21st century: impact of ozone recovery and cloud effects
Directory of Open Access Journals (Sweden)
A. F. Bais
2011-08-01
Full Text Available Monthly averaged surface erythemal solar irradiance (UV-Ery for local noon from 1960 to 2100 has been derived using radiative transfer calculations and projections of ozone, temperature and cloud change from 14 chemistry climate models (CCM, as part of the CCMVal-2 activity of SPARC. Our calculations show the influence of ozone depletion and recovery on erythemal irradiance. In addition, we investigate UV-Ery changes caused by climate change due to increasing greenhouse gas concentrations. The latter include effects of both stratospheric ozone and cloud changes. The derived estimates provide a global picture of the likely changes in erythemal irradiance during the 21st century. Uncertainties arise from the assumed scenarios, different parameterizations – particularly of cloud effects on UV-Ery – and the spread in the CCM projections. The calculations suggest that relative to 1980, annually mean UV-Ery in the 2090s will be on average ~12 % lower at high latitudes in both hemispheres, ~3 % lower at mid latitudes, and marginally higher (~1 % in the tropics. The largest reduction (~16 % is projected for Antarctica in October. Cloud effects are responsible for 2–3 % of the reduction in UV-Ery at high latitudes, but they slightly moderate it at mid-latitudes (~1 %. The year of return of erythemal irradiance to values of certain milestones (1965 and 1980 depends largely on the return of column ozone to the corresponding levels and is associated with large uncertainties mainly due to the spread of the model projections. The inclusion of cloud effects in the calculations has only a small effect of the return years. At mid and high latitudes, changes in clouds and stratospheric ozone transport by global circulation changes due to greenhouse gases will sustain the erythemal irradiance at levels below those in 1965, despite the removal of ozone depleting substances. At northern high latitudes (60°–90°, the projected decreases in cloud
Musculoskeletal pain and effort-reward imbalance--a systematic review.
Koch, Peter; Schablon, Anja; Latza, Ute; Nienhaus, Albert
2014-01-15
Musculoskeletal pain may be triggered by physical strains and psychosocial risk factors. The effort-reward imbalance model (ERI model) is a stress model which measures psychosocial factors in the working world. The question is whether workers with an effort-reward imbalance report musculoskeletal pain more frequently than those with no effort-reward imbalance. A systematic review using a best evidence synthesis approach was conducted to answer this question. A literature search was conducted for the period from 1996 to 2012, using three databases (Pubmed, Embase and PsycINFO). The research criteria related to psychosocial, work-related stress as per the ERI model and to musculoskeletal pain. A quality score was developed using various quality criteria to assess the standard of the studies. The level of evidence was graded as in (Am J Ind Med 39:180-193, 2001). After applying the inclusion criteria, a total of 19 studies were included in the review: 15 cross-sectional studies, three prospective studies and one case-control study. 74% of all studies exhibited good methodological quality, 53% collected data using the original ERI questionnaire, and in 42% of the studies, there was adequate control for physical working conditions. Furthermore, different cut-off points were used to classify exposed and non-exposed individuals. On the basis of 13 studies with a positive, statistically significant association, a moderate level of evidence was inferred for the association between effort-reward imbalance and musculoskeletal pain. The evidence for a role of over-commitment and for its interaction with effort-reward imbalance was rated as inconclusive - on the basis of eight and five studies, respectively. On the basis of the available evidence, no reliable conclusion may be drawn about any association between the psychosocial factors ascertained using the ERI model and musculoskeletal pain. Before a reliable statement can be made on the association between ERI and
Wagner, Tyler; Vandergoot, Christopher S.; Tyson, Jeff
2011-01-01
Fishery-independent (FI) surveys provide critical information used for the sustainable management and conservation of fish populations. Because fisheries management often requires the effects of management actions to be evaluated and detected within a relatively short time frame, it is important that research be directed toward FI survey evaluation, especially with respect to the ability to detect temporal trends. Using annual FI gill-net survey data for Lake Erie walleyes Sander vitreus collected from 1978 to 2006 as a case study, our goals were to (1) highlight the usefulness of hierarchical models for estimating spatial and temporal sources of variation in catch per effort (CPE); (2) demonstrate how the resulting variance estimates can be used to examine the statistical power to detect temporal trends in CPE in relation to sample size, duration of sampling, and decisions regarding what data are most appropriate for analysis; and (3) discuss recommendations for evaluating FI surveys and analyzing the resulting data to support fisheries management. This case study illustrated that the statistical power to detect temporal trends was low over relatively short sampling periods (e.g., 5–10 years) unless the annual decline in CPE reached 10–20%. For example, if 50 sites were sampled each year, a 10% annual decline in CPE would not be detected with more than 0.80 power until 15 years of sampling, and a 5% annual decline would not be detected with more than 0.8 power for approximately 22 years. Because the evaluation of FI surveys is essential for ensuring that trends in fish populations can be detected over management-relevant time periods, we suggest using a meta-analysis–type approach across systems to quantify sources of spatial and temporal variation. This approach can be used to evaluate and identify sampling designs that increase the ability of managers to make inferences about trends in fish stocks.
CD71(high) population represents primitive erythroblasts derived from mouse embryonic stem cells.
Chao, Ruihua; Gong, Xueping; Wang, Libo; Wang, Pengxiang; Wang, Yuan
2015-01-01
The CD71/Ter119 combination has been widely used to reflect dynamic maturation of erythrocytes in vivo. However, because CD71 is expressed on all proliferating cells, it is unclear whether it can be utilized as an erythrocyte-specific marker during differentiation of embryonic stem cells (ESCs). In this study, we revealed that a population expressing high level of CD71 (CD71(high)) during mouse ESC differentiation represented an in vitro counterpart of yolk sac-derived primitive erythroblasts (EryPs) isolated at 8.5days post coitum. In addition, these CD71(high) cells went through "maturational globin switching" and enucleated during terminal differentiation in vitro that were similar to the yolk sac-derived EryPs in vivo. We further demonstrated that the formation of CD71(high) population was regulated differentially by key factors including Scl, HoxB4, Eaf1, and Klf1. Taken together, our study provides a technical advance that allows efficient segregation of EryPs from differentiated ESCs in vitro for further understanding molecular regulation during primitive erythropoiesis. Copyright © 2014. Published by Elsevier B.V.
Stadin, Magdalena; Nordin, Maria; Broström, Anders; Magnusson Hanson, Linda L; Westerlund, Hugo; Fransson, Eleonor I
2016-10-01
The use of information and communication technology (ICT) is common in modern working life. ICT demands may give rise to experience of work-related stress. Knowledge about ICT demands in relation to other types of work-related stress and to self-rated health is limited. Consequently, the aim of this study was to examine the association between ICT demands and two types of work-related stress [job strain and effort-reward imbalance (ERI)] and to evaluate the association between these work-related stress measures and self-rated health, in general and in different SES strata. This study is based on cross-sectional data from the Swedish Longitudinal Occupational Survey of Health collected in 2014, from 14,873 gainfully employed people. ICT demands, job strain, ERI and self-rated health were analysed as the main measures. Sex, age, SES, lifestyle factors and BMI were used as covariates. ICT demands correlated significantly with the dimensions of the job strain and ERI models, especially with the demands (r = 0.42; p work-related stress in modern working life.
Chronic work stress and decreased vagal tone impairs decision making and reaction time in jockeys.
Landolt, Kathleen; Maruff, Paul; Horan, Ben; Kingsley, Michael; Kinsella, Glynda; O'Halloran, Paul D; Hale, Matthew W; Wright, Bradley J
2017-10-01
The inverse relationship between acute stress and decision-making is well documented, but few studies have investigated the impact of chronic stress. Jockeys work exhaustive schedules and have extremely dangerous occupations, with safe performance requiring quick reaction time and accurate decision-making. We used the effort reward imbalance (ERI) occupational stress model to assess the relationship of work stress with indices of stress physiology and decision-making and reaction time. Jockeys (N=32) completed computerised cognitive tasks (Cogstate) on two occasions; September and November (naturally occurring lower and higher stress periods), either side of an acute stress test. Higher ERI was correlated with the cortisol awakening responses (high stress r=-0.37; low stress r=0.36), and with decrements in decision-making comparable to having a blood alcohol concentration of 0.08 in the high stress period (pdecision-making. Potentially, this may be attributed to a 'tipping point' whereby the higher ERI reported by jockeys in the high stress period decreases vagal tone, which may contribute to reduced decision-making abilities. Copyright © 2017 Elsevier Ltd. All rights reserved.
Bethge, Matthias; Radoschewski, Friedrich Michael
2012-10-01
The aim of this paper was to analyse the longitudinal effects of effort-reward imbalance (ERI) on work ability, mental health and physical functioning. A total of 603 men and women aged 30-59 years participating in the first two waves of the German Sociomedical Panel of Employees were included in the analyses. Work ability was assessed using the Work Ability Index. Mental health and physical functioning were assessed using scales of the Medical Outcomes Study 36-item Short-Form Health Survey. Our longitudinal analysis showed that high ERI-related work stress exposure at baseline was associated with a decrease in work ability, mental health and physical functioning over time. In case of work ability (b=-0.512; 95% CI -1.018 to -0.006) and mental health (b=-2.026; 95% CI -3.483 to -0.568), this also held true after adjusting for other factors of the work environment (physical demands, job control and psychological job demands). Work stress by ERI has an impact on work ability independent of and above that of other known explanatory variables.
Xu, Weixian; Hang, Juan; Gao, Wei; Zhao, Yiming; Li, Weihong; Wang, Xinyu; Li, Zhaoping; Guo, Lijun
2012-02-01
The studies focusing on effort-reward imbalance and diabetes mellitus (DM)/glycosylated hemoglobin (HbA1c) are rare. We sought to examine the association between job stress evaluated by effort-reward imbalance (ERI) model and HbA1c in a Chinese population. We analyzed 680 subjects (465 men and 215 women) without DM or impaired glucose tolerance from the stress and health in Shenzhen workers (SHISO) study. Job stress was evaluated by effort-reward imbalance (ERI) model. HbA1c was measured by an automatic analyzer by means of high-performance liquid chromatography. The association between job stress and HbA1c was explored by variance analysis, partial correlations and multiple linear regression analysis. For women, effort, and ERI were positively associated with HbA1c (r = 0.22, p = 0,003; r = 0.21, p = 0.006, respectively), in contrast, reward was negatively associated with HbA1c (r = -0.17, p = 0.021), after controlling age, BMI and physical exercise in the partial correlation analysis; the similar results were confirmed in the multiple linear regression. No significant correlations between job stress and HbA1c were found for men. Effort and ERI are positively associated with HbA1c, and reward is inversely related to HbA1c among Chinese women. The association is not accounted for by age, BMI, and physical exercise. More efforts should be made to improve the job stress status of Chinese working women for the purpose of DM prevention.
The Effort and Reward of Teaching Medical Psychology in Germany: an Online Survey
Directory of Open Access Journals (Sweden)
Kendel, Friederike
2016-11-01
Full Text Available Background: The increasing significance of university teaching also leads to higher demands for academic teachers. Against this background this study inquires how teachers in the field of medical pychology experience and evaluate their various activities and how their efforts on the one hand and gratifications on the other hand relate to each other (as conceptualized by the effort-reward-imbalance, ERI.Methods: A cross-sectional online survey was conducted in 2012 among the academic staff of departments of medical psychology in Germany. The questionnaire was answered by 188 participants (return rate: 39.2%, of whom 62% were women. Work stress was measured according to Siegrist’s effort–reward-imbalance (ERI model. Further questions referred to the distribution of academic activities and meaningfulness. Results: Among all participants, 67.3% were satisfied with the portion of their workload devoted to teaching, while 63% wanted more time for research. The ERI-coefficient was on average M=0.76 (SD=0.45, thus indicating a shift towards reward. There were no associations with gender, age, or fixed-term work contracts. Meaningfulness was associated negatively with the ERI (r=-.21, p=.012, and positively with overcommitment (r=.52, p<.001 and the desire for less administrative tasks (r=.24, p=.017.Conclusions: Teaching medical psychology is evaluated as positive and meaningful by a majority of respondents. In general, the rewarding aspects seem to outweigh the stressful factors. Thus, teaching might be a protective factor with regard to coping with work related burden.
Changes in the dreissenid community in the lower Great Lakes with emphasis on southern Lake Ontario
Mills, Edward L.; Chrisman, Jana R.; Baldwin, Brad; Owens, Randall W.; O'Gorman, Robert; Howell, Todd; Roseman, Edward F.; Raths, Melinda K.
1999-01-01
A field study was conducted in the lower Great Lakes to assess changes in spatial distribution and population structure of dreissenid mussel populations. More specifically, the westward range expansion of quagga mussel into western Lake Erie and toward Lake Huron was investigated and the shell size, density, and biomass of zebra and quagga mussel with depth in southern Lake Ontario in 1992 and 1995 were compared. In Lake Erie, quagga mussel dominated the dreissenid community in the eastern basin and zebra mussel dominated in the western basin. In southern Lake Ontario, an east to west gradient was observed with the quagga mussel dominant at western sites and zebra mussel dominant at eastern locations. Mean shell size of quagga mussel was generally larger than that of zebra mussel except in western Lake Erie and one site in eastern Lake Erie. Although mean shell size and our index of numbers and biomass of both dreissenid species increased sharply in southern Lake Ontario between 1992 and 1995, the increase in density and biomass was much greater for quagga mussels over the 3-year period. In 1995, zebra mussels were most abundant at 15 to 25 m whereas the highest numbers and biomass of quagga mussel were at 35 to 45 m. The quagga mussel is now the most abundant dreissenid in areas of southern Lake Ontario where the zebra mussel was once the most abundant dreissenid; this trend parallels that observed for dreissenid populations in the Dneiper River basin in the Ukraine.
Tomy, Chitra; Ramesh, Naveen; Fathima, Farah N; D'cunha, Rodney L; Chakravathi, Kote A
2017-01-01
Work-related stress is associated with cardiovascular diseases, musculoskeletal disorders, psychological ailments, and work-related injuries. Imbalance between high effort and low reward at work can lead to work stress among plantation workers. To assess the effort-reward imbalance (ERI) among pluckers in tea plantations in South India and its association on chronic health problems, substance abuses, and workplace injuries. A cross-sectional study was conducted among 346 tea pluckers from May to June 2015 in six selected tea plantations in Anamalai, South India. A short version of ERI questionnaire was used to assess the work-related stress among them. Along with ERI questionnaire, sociodemographic details, chronic diseases, substance abuses, and workplace injuries were ascertained. Sociodemographic variables were described as frequency and measures of central tendency. Tests of association, such as Chi-square test, were applied. Among the study population, 322 (93.1%) reported more effort, 23 (6.6%) reported more reward, and one (0.3%) had no imbalance between effort and reward. Those in older age group (≥51 years) experienced more effort compared to those in younger age group (≤50 years) (Fisher's exact = 21.905, P = 0.001). Educational status (Fisher's exact = 15.639, P = 0.027) and work experience (Fisher's exact = 23.122, P = 0.003) increased the effort rather than increasing the reward associated with work. No significant association was found between ERI and any chronic diseases, substance abuses, or injuries. Majority of pluckers in tea plantation experienced more effort compared to reward.
Inoue, Mariko; Tsurugano, Shinobu; Yano, Eiji
2011-01-01
The number of workers with precarious employment has increased globally; however, few studies have used validated measures to investigate the relationship of job status to stress and mental health. Thus, we conducted a study to compare differential job stress experienced by permanent and fixed-term workers using an effort-reward imbalance (ERI) model questionnaire, and by evaluating depressive complaints and clinic utilization. Subjects were permanent or fixed-term male workers at a Japanese research institute (n=756). Baseline data on job stress and depressive complaints were collected in 2007. We followed up with the same population over a 1-year period to assess their utilization of the company clinic for mental health concerns. The ERI ratio was higher among permanent workers than among fixed-term workers. More permanent workers presented with more than two depressive complaints, which is the standard used for the diagnosis of depression. ERI scores indicated that the effort component of permanent work was associated with distress, whereas distress in fixed-term work was related to job promotion and job insecurity. Moreover, over the one-year follow-up period, fixed-term workers visited the on-site clinic for mental concerns 4.04 times more often than permanent workers even after adjusting for age, lifestyle, ERI, and depressive complaints. These contrasting findings reflect the differential workloads and working conditions encountered by permanent and fixed-term workers. The occupational setting where employment status was intermingled, may have contributed to the high numbers of mental health-related issues experienced by workers with different employment status.
Directory of Open Access Journals (Sweden)
Söderberg Mia
2012-12-01
Full Text Available Abstract Background This cross-sectional study explored relationships between psychosocial work environment, captured by job demand-control (JDC and effort-reward imbalance (ERI, and seven cardiovascular heart disease (CHD risk factors in a general population. Method The sampled consists of randomly-selected men and women from Gothenburg, Sweden and the city’s surrounding metropolitan areas. Associations between psychosocial variables and biomarkers were analysed with multiple linear regression adjusted for age, smoking, education and occupational status. Results The study included 638 men and 668 women aged 24–71. Analysis between JDC and CHD risk factors illustrated that, for men, JDC was associated with impaired scores in several biomarkers, especially among those in high strain jobs. For women, there were no relationships between JDC and biomarkers. In the analysis of links between ERI and CHD risk factors, most associations tested null. The only findings were raised triglycerides and BMI among men in the fourth quartile of the ERI-ratio distribution, and lowered LDL-cholesterol for women. An complementary ERI analysis, combining high/low effort and reward into categories, illustrated lowered triglycerides and elevated HDL-cholesterol values among women reporting high efforts and high rewards, compared to women experiencing low effort and high reward. Conclusions There were some associations between psychosocial stressors and CHD risk factors. The cross-sectional design did not allow conclusions about causality but some results indicated gender differences regarding sensitivity to work stressors and also how the models might capture different psychosocial dimensions.
Ji, Y Q; Li, S; Wang, C; Wang, J; Liu, X M
2016-10-20
Objective: To investigate occupational stress in assembly line workers in electronics manu-facturing service (EMS) and related influencing factors. Methods: From June to October, 2015, a cross-sectional survey was performed for 5 944 assembly line workers in EMS (observation group) and 6 270 workers from other posts (non-assembly line workers and management personnel; control group) using the self-made questionnaire for basic information, job demand-control (JDC) model questionnaire, and effort-reward imbalance (ERI) model questionnaire to collect respondents' basic information and occupational stress. Results: The observation group had significantly lower work autonomy, social support, and work reward scores than the control group (2.72 ± 0.63/3.64 ± 0.68/4.06 ± 0.80 vs 3.00 ± 0.67/3.83 ± 0.68/4.24 ± 0.75, t =23.53, 15.41, and 12.70, all P occupational stress determined by JDC and ERI models than the control group (64.5%/12.7% vs 52.6%/9.9%, χ 2 =182.26 and 23.41, both P 60 hours/week, and sleeping time occupational stress in JDC model; education background of Bachelor's degree or above, working time >60 hours/week, and sleeping timeoccupational stress in ERI model, while female sex and a high monthly income reduced the risk of occupational stress in ERI model. Conclusion: Assembly line workers in EMS are a relatively vulnerable group and have a high degree of occupational stress. Working time >60 hours/week and sleeping time occupational stress.
3D-mainosvideo teollisuusyritykselle : Case: Leppäkosken Lämpö
Utriainen, Sari
2015-01-01
Toimeksiantajana opinnäytetyölle toimi biolämmitysjärjestelmiä valmistava ja markkinoiva Ariterm Oy. Tavoitteena oli tuottaa messu- ja markkinointikäyttöön 3D-mainosvideo Ariterm Oy:n toimittamasta, elokuussa 2014 käyttöönotetusta Leppäkosken Lämpö Oy:n pellettilämpölaitoksesta. Opinnäytetyössä käsiteltiin 3D-mallien hyödyntämistä eri teollisuuden aloilla sekä tutustuttiin 3D-mainosvideoprojektissa käytettyihin ohjelmistoihin ja teollisuuden 3D-suunnitteluohjelmien eri tiedostomuotoihin se...
Suomen McDonald’s-ketjun ravintolahenkilöstön sisäisen koulutuspolun mallintaminen
Baikov, Anne; Malaska, Mari; Räty, Isa
2015-01-01
Tämän opinnäytetyön tavoitteena on mallintaa Suomen McDonald’s-ketjun ravintolahenkilöstön sisäinen koulutuspolku. Koulutuspolku sisältää ravintolahenkilöstön koulutusohjelmat ravintolatyöntekijästä ravintolapäällikköön asti. Mallintamisprosessin lopputuote on produkti, Koulutuspolku-opas, joka avaa Suomen McDonald’s-ketjun eri koulutusohjelmien sisältöä sekä eri työtehtävissä edellytettävää osaamista. Produktin avainkohderyhmänä on Suomen McDonald’s-ketjun ravintolajohto. Työn toimeksian...
Liiketoiminnan kehittäminen 3D-tulostuksen avulla
Rissanen, Pauli; Pekkanen, Matti-Juhani
2014-01-01
Työn lähtökohtana oli liiketoiminnan kehittäminen 3d-tulostuksen avulla. Tätä ajatusta lähestyttiin kahdesta eri näkökulmasta, eli siitä miten tekijöiden oma yritys saisi rakennettua liiketoimintaa 3d-tulostuksen ympärille, ja siitä miten tekijät voisivat auttaa eri alojen toimijoita hyötymään 3d-tulostuksen mahdollisuuksista. Keskeisessä osassa opinnäytetyötä oli myös 3D-tulostuksen prosessin havainnollistaminen. Työn perustavava tavoitteena oli luoda tukeva perusta yrityksen toiminnalle...
TULOS- JA BONUSPALKKIOIDEN VAIKUTUS HENKILÖKOHTAISEEN MYYNTITYÖHÖN YRITYS X:SSÄ
Biström, Mirko
2009-01-01
Tulos- ja bonuspalkkiojärjestelmät sekä sen eri osa-alueet ovat viime vuosina puhuttaneet yhä enemmän eri medioissa ja yritysmaailmassa. Yritykset ovat alkaneet käyttämään tulos- ja bonuspalkkioita yhä laajemmin perinteisen palkan lisänä, niin johtoa, kuin myös muita työntekijöitä palkittaessa. Globaalissa maailmassa yritykset kilpailevat osaavasta työvoimasta kes-kenään ja tulos- ja bonuspalkkiot ovat hyvä keino houkutella osaavaa työvoimaa. Tässä opinnäytetyössä tutkitaan Yritys X:n tul...
ORF Alignment: NC_006582 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ery: 529 IPEEDLPYVFERFYKADKARTRQHGGTGLGLAIAKHIIDAHQGKITVHSRLGEGTTFHFT 588 ... IPEEDLPYVFERFYKADKARTRQ...HGGTGLGLAIAKHIIDAHQGKITVHSRLGEGTTFHFT Sbjct: 121 IPEEDLPYVFERFYKADKARTRQHGGTGLGLAIAKHIIDAHQGKITVHSRLGEGTTFHFT 180 ... ...NLEEVDLDSYLERITRKFASFAREYDVTV Sbjct: 1 ... AQIIYDESLRMGRLVNELLDLARMEAGYIDLNLEEVDLDSYLERITRKFASFAREYDVTV 60 ... Qu
The MTA UXO Survey and Target Recovery on Lake Erie at the Former Erie Army Depot
2009-12-01
to-medium sandy material which extends approximately 150-300 m (500-1,000 ft) offshore to the 0.6- to 1.2-m (-2- to -44) ( LWD ) contour (Figure 7...shallow, flat bottom (slope less than 1:300) is covered with a soft silty-mud layer out to approximately the 3-m (-104) ( LWD ) contour. This muddy layer...to 1.2-m (-2- to -44) ( LWD ) contour (Figure 7). This underwater sand extension of the beach includes a series of well-defined two to four shore
78 FR 53677 - Safety Zone; Battle of Lake Erie Fireworks, Lake Erie, Put-In-Bay, OH
2013-08-30
... Environmental Health Risks and Safety Risks. This rule is not an economically significant rule and does not create an environmental risk to health or risk to safety that may disproportionately affect children. 11... of fireworks in the vicinity of Put-In-Bay, OH on September 1, 2013. The Captain of the Port Detroit...
Effects of psychosocial work characteristics on hair cortisol - findings from a post-trial study.
Herr, Raphael M; Barrech, Amira; Gündel, Harald; Lang, Jessica; Quinete, Natalia Soares; Angerer, Peter; Li, Jian
2017-07-01
Prolonged work stress, as indicated by the effort-reward imbalance (ERI) model, jeopardizes health. Cortisol represents a candidate mechanism connecting stress to ill health. However, previous findings appear inconclusive, and recommendations were made to assess work stress at multiple time points and also to investigate ERI (sub-)components. This study therefore examines the effects of two single time points, as well as the mean and change scores between time points of ERI and its components on hair cortisol concentration (HCC), a long-term cortisol measurement. Participants were 66 male factory workers (age: 40.68 ± 6.74 years; HCC: 9.00 ± 7.11 pg/mg), who were followed up after a stress management intervention (2006-2008). In 2008 (T1) and 2015 (T2), participants completed a 23-item ERI questionnaire, assessing effort, the three reward components (esteem, job security, job promotion) and over-commitment. In 2015, participants also provided a 3-cm hair segment close to the scalp for HCC analysis, as well as information on relevant confounders (i.e. medication intake, age, work characteristics, socioeconomic and lifestyle factors, number of stressful life events). Linear regressions revealed hardly any cross-sectional or longitudinal effect of ERI and its components on HCC. Only the change scores between T1 and T2 of job security were negatively associated with lower HCC in unadjusted (β = -.320; p = .009) and adjusted (β = -.288; p = .044) models. In this study, only a decrease of perceived job security over time was significantly associated with higher HCC, and other predictors were not related to this outcome. Especially after correction for multiple testing, this study revealed just a weak association of different psychosocial work measurements with HCC. Lay summary This study showed that an increase in perceived job insecurity is correlated with higher levels of the stress hormone cortisol. The higher levels of cortisol might
Astrophysical Implications of a New Dynamical Mass for the Nearby White Dwarf 40 Eridani B
Bond, Howard E.; Bergeron, P.; Bédard, A.
2017-10-01
The bright, nearby DA-type white dwarf (WD) 40 Eridani B is orbited by the M dwarf 40 Eri C, allowing determination of the WD’s mass. Until recently, however, the mass depended on orbital elements determined four decades ago, and that mass was so low that it created several astrophysical puzzles. Using new astrometric measurements, the binary-star group at the U.S. Naval Observatory has revised the dynamical mass upward, to 0.573 ± 0.018 M ⊙. In this paper, we use model-atmosphere analysis to update other parameters of the WD, including effective temperature, surface gravity, radius, and luminosity. We then compare these results with WD interior models. Within the observational uncertainties, theoretical cooling tracks for CO-core WDs of its measured mass are consistent with the position of 40 Eri B in the H-R diagram; equivalently, the theoretical mass-radius relation (MRR) is consistent with the star’s location in the mass-radius plane. This consistency is, however, achieved only if we assume a “thin” outer hydrogen layer, with q H = M H/M WD ≃ 10-10. We discuss other evidence that a significant fraction of DA WDs have such thin H layers, in spite of the expectation from canonical stellar-evolution theory of “thick” H layers with q H ≃ 10-4. The cooling age of 40 Eri B is ˜122 Myr, and its total age is ˜1.8 Gyr. We present the MRRs for 40 Eri B and three other nearby WDs in visual binaries with precise mass determinations, and show that the agreement of current theory with observations is excellent in all cases.
Wege, Natalia; Li, Jian; Siegrist, Johannes
2018-05-01
Cohort studies established elevated risks of depression among employees experiencing psychosocial stress at work, defined by 'job strain' or 'effort-reward imbalance' (ERI). Yet, conflicting evidence exists on whether the strength of these associations varies by gender. We explore this question in a nationally representative sample of working women and men where work stress (ERI) was related to reported depression over a 2-year follow-up. Data were derived from the panel waves 2011 and 2013 of the German Socio-Economic Panel. Work stress was assessed by validated short scales of the ERI questionnaire, and doctor-diagnosed depression reported in 2013 (after excluding cases reported in 2011) was used as outcome variable. The sample with full data in 2013 consisted of 6693 participants (49.4% women). In 2011, men scored significantly higher than women on the scale 'effort' and on the 'effort-reward ratio', whereas no significant gender differences for 'reward' and 'over-commitment' were observed. Women reported a diagnosed depression almost twice as often as men (4.2 vs. 2.6%). Associations of all ERI scales with depression were statistically significant, with no noticeable differences in the strength of associations between women and men. Risk of depression was higher among men and women with effort-reward imbalance [RR (risk ratio) of 1.82; 95% CI (confidence interval) 1.36-2.44 and RR of 1.88; 95% CI 1.51-2.33, respectively]. Despite higher effort and slightly higher effort-reward ratio among men interaction terms between gender, work stress and depression were generally not significant. While gender inequities in the labour market are persisting stress-reducing worksite health promotion programs should apply equally for men and women.
Zurlo, Maria Clelia; Pes, Daniela; Siegrist, Johannes
2010-08-01
This study explores the explicative potential of effort-reward imbalance Model to unveil the dimensions involved in teacher stress process and analyses the psychometric characteristics of the Italian version of the ERI Questionnaire (Siegrist, J Occup Health Psychol 1:27-43, 1996) with respect to a homogeneous occupational group: Italian school teachers. The Italian version of the ERI Questionnaire was submitted to 673 teachers randomly drawn from a cross-section of school types. Internal consistency, reliability, discriminative validity, and factorial structure were evaluated. Predictive validity was explored with respect to a measure of perceived strain, the Crown-Crisp Experiential Index. Discriminative validity was explored with respect to age, gender, education, type of school, the presence/absence of physical pains in the last 12 months before the survey, and teachers' intention to leave the profession. Item-total correlations are for all items included between 0.30 and 0.80 (p teachers, which reported to suffer for physical pains. Higher efforts (T = -5.26, p teachers inclined to give up the job. Multiple regression analyses have highlighted that higher efforts, higher overcommitment, and lower rewards are significantly predictive of higher levels of free-floating and somatic anxiety as well as depression and global psychological strain. This preliminary analysis of the reliability and validity of the Italian version of the ERI Questionnaire reveals that it constitutes a useful and reliable measure to analyse work-related stress with respect to the school setting. The validity of the ERI model to describe the dimensions involved in teacher's stress and to highlight those associated to leaving intentions and to several physical and psychological strain outcomes in Italian school teachers has been confirmed.
Liu, Ying; Wang, Siyao; McDonough, Carrie A; Khairy, Mohammed; Muir, Derek C G; Helm, Paul A; Lohmann, Rainer
2016-05-17
Polyethylene passive sampling was performed to quantify gaseous and freely dissolved polychlorinated biphenyls (PCBs) in the air and water of Lakes Erie and Ontario during 2011-2012. In view of differing physical characteristics and the impacts of historical contamination by PCBs within these lakes, spatial variation of PCB concentrations and air-water exchange across these lakes may be expected. Both lakes displayed statistically similar aqueous and atmospheric PCB concentrations. Total aqueous concentrations of 29 PCBs ranged from 1.5 pg L(-1) in the open lake of Lake Erie (site E02) in 2011 spring to 105 pg L(-1) in Niagara (site On05) in 2012 summer, while total atmospheric concentrations were 7.7-634 pg m(-3) across both lakes. A west-to-east gradient was observed for aqueous PCBs in Lake Erie. River discharge and localized influences (e.g., sediment resuspension and regional alongshore transport) likely dominated spatial trends of aqueous PCBs in both lakes. Air-water exchange fluxes of Σ7PCBs ranged from -2.4 (±1.9) ng m(-2) day(-1) (deposition) in Sheffield (site E03) to 9.0 (±3.1) ng m(-2) day(-1) (volatilization) in Niagara (site On05). Net volatilization of PCBs was the primary trend across most sites and periods. Almost half of variation in air-water exchange fluxes was attributed to the difference in aqueous concentrations of PCBs. Uncertainty analysis in fugacity ratios and mass fluxes in air-water exchange of PCBs indicated that PCBs have reached or approached equilibrium only at the eastern Lake Erie and along the Canadian shore of Lake Ontario sites, where air-water exchange fluxes dominated atmospheric concentrations.
Satellite remote sensing for modeling and monitoring of water quality in the Great Lakes
Coffield, S. R.; Crosson, W. L.; Al-Hamdan, M. Z.; Barik, M. G.
2017-12-01
Consistent and accurate monitoring of the Great Lakes is critical for protecting the freshwater ecosystems, quantifying the impacts of climate change, understanding harmful algal blooms, and safeguarding public health for the millions who rely on the Lakes for drinking water. While ground-based monitoring is often hampered by limited sampling resolution, satellite data provide surface reflectance measurements at much more complete spatial and temporal scales. In this study, we implemented NASA data from the Moderate Resolution Imaging Spectroradiometer (MODIS) onboard the Aqua satellite to build robust water quality models. We developed and validated models for chlorophyll-a, nitrogen, phosphorus, and turbidity based on combinations of the six MODIS Ocean Color bands (412, 443, 488, 531, 547, and 667nm) for 2003-2016. Second, we applied these models to quantify trends in water quality through time and in relation to changing land cover, runoff, and climate for six selected coastal areas in Lakes Michigan and Erie. We found strongest models for chlorophyll-a in Lake Huron (R2 = 0.75), nitrogen in Lake Ontario (R2=0.66), phosphorus in Lake Erie (R2=0.60), and turbidity in Lake Erie (R2=0.86). These offer improvements over previous efforts to model chlorophyll-a while adding nitrogen, phosphorus, and turbidity. Mapped water quality parameters showed high spatial variability, with nitrogen concentrated largely in Superior and coastal Michigan and high turbidity, phosphorus, and chlorophyll near urban and agricultural areas of Erie. Temporal analysis also showed concurrence of high runoff or precipitation and nitrogen in Lake Michigan offshore of wetlands, suggesting that water quality in these areas is sensitive to changes in climate.
Guo, Haiqiang; Guo, Huifang; Yang, Yilong; Sun, Baozhi
2015-01-01
Burnout is a syndrome of emotional exhaustion, cynicism and reduced professional efficacy, which can result from long-term work stress. Although the burnout level is high among iron and steel workers, little is known concerning burnout among iron and steel worker. This study aimed to evaluate the burnout and to explore its associated internal and external factors in iron and steel workers. A cross-sectional survey was conducted in iron and steel workers at the Anshan iron-steel complex in Anshan, northeast China. Self-administered questionnaires were distributed to 1,600 workers, and finally 1,300 questionnaires were returned. Burnout was measured using the Chinese version of the Maslach Burnout Inventory-General Survey (MBI-GS). Effort-reward imbalance (ERI), perceived organizational support (POS), and psychological capital (PsyCap) were measured anonymously. A hierarchical regression model was applied to explore the internal and external factors associated with burnout. Mean MBI-GS scores were 13.11±8.06 for emotional exhaustion, 6.64±6.44 for cynicism, and 28.96±10.39 for professional efficacy. Hierarchical linear regression analysis showed that ERI and POS were the most powerful predictors for emotional exhaustion and cynicism, and PsyCap was the most robust predictor for high professional efficacy. Chinese iron and steel workers have a high level of burnout. Burnout might be associated with internal and external factors, including ERI, POS, and PsyCap. Further studies are recommended to develop an integrated model including both internal and external factors, to reduce the level of ERI, and improve POS and workers' PsyCap, thereby alleviating the level of burnout among iron and steel workers.
Directory of Open Access Journals (Sweden)
Haiqiang Guo
Full Text Available Burnout is a syndrome of emotional exhaustion, cynicism and reduced professional efficacy, which can result from long-term work stress. Although the burnout level is high among iron and steel workers, little is known concerning burnout among iron and steel worker. This study aimed to evaluate the burnout and to explore its associated internal and external factors in iron and steel workers.A cross-sectional survey was conducted in iron and steel workers at the Anshan iron-steel complex in Anshan, northeast China. Self-administered questionnaires were distributed to 1,600 workers, and finally 1,300 questionnaires were returned. Burnout was measured using the Chinese version of the Maslach Burnout Inventory-General Survey (MBI-GS. Effort-reward imbalance (ERI, perceived organizational support (POS, and psychological capital (PsyCap were measured anonymously. A hierarchical regression model was applied to explore the internal and external factors associated with burnout.Mean MBI-GS scores were 13.11±8.06 for emotional exhaustion, 6.64±6.44 for cynicism, and 28.96±10.39 for professional efficacy. Hierarchical linear regression analysis showed that ERI and POS were the most powerful predictors for emotional exhaustion and cynicism, and PsyCap was the most robust predictor for high professional efficacy.Chinese iron and steel workers have a high level of burnout. Burnout might be associated with internal and external factors, including ERI, POS, and PsyCap. Further studies are recommended to develop an integrated model including both internal and external factors, to reduce the level of ERI, and improve POS and workers' PsyCap, thereby alleviating the level of burnout among iron and steel workers.
Energy Technology Data Exchange (ETDEWEB)
Nikku, P [ed.
1997-12-01
The aim of the programme is to increase the use of economically profitable and environmentally sound bioenergy by improving the competitiveness of present peat and wood fuels. Research and development projects will also develop new economically competitive biofuels, new equipment and methods for production, handling and utilisation of biofuels. The total funding for 1996 was 27.3 million FIM and the number of projects 63. The number of projects concerning peat production was 7 and that of field biomass projects 4. Results of the projects carried out in 1996 are presented in this publication. The development target in the research area of peat production is to improve the competitiveness of peat by reducing the production costs by 20 % (by 5-6 FIM/MWh) from the level of 1992, and to reduce the environmental impacts. The target of the research area of peat production is possible to achieve if the sub-targets are achieved. The production costs are reduced by 5 % if the width of the production field is increased from 20 m to 60 m, by 8 % if the degree of utilisation of solar energy is increased from 30 % to 40 %, by 6.5 % if the value of peat remaining on the cutover field is reduced from 3 000 MWh to 1 500 MWh, by 3 % if light and fireproof machines are developed, and by 3 % if combined peat and wood harvesting is applied. The production costs will be reduced by 24 % if the different sub-targets are achieved. In this programme no common target for the field biomass projects was set. Field biomass projects are mainly funded by the Finnish Ministry of Agriculture and Forestry. Most of the research projects were completed in 1996. (orig.)
Tang, Jessica Janice; Leka, Stavroula; MacLennan, Sara
2013-08-01
There is limited research on teachers' psychosocial work environment and mental health, and most has been conducted in predominantly Western countries that share a number of important common characteristics that distinguish them from countries in many other regions of the world. Within the framework of the effort-reward imbalance (ERI) theoretical model, the relationship between the psychosocial work environment and mental health of teachers in the United Kingdom (UK) and Hong Kong (HK) was investigated. Full-time qualified teachers from both the UK and HK (N = 259) participated in the research. They were asked to fill in a set of questionnaires that measured their perceived stress, mental health, psychosocial work environment and demographic information. Perceived stress was found to predict teachers' mental health. Overcommitment, the intrinsic component of the ERI model, predicted mental health among HK teachers. There were significant differences in the psychosocial variables between UK and HK teachers. The results showed support for the ERI model and in particular for the relationship between stress and mental health and demonstrated the role of overcommitment in the teaching profession. Some implications are discussed for combating cultural differences in managing the psychosocial work environment of teachers.
Directory of Open Access Journals (Sweden)
Nicola Magnavita
2012-01-01
Full Text Available Purpose. To perform a parsimonious measurement of workplace psychosocial stress in routine occupational health surveillance, this study tests the psychometric properties of a short version of the original Italian effort-reward imbalance (ERI questionnaire. Methods. 1,803 employees (63 percent women from 19 service companies in the Italian region of Latium participated in a cross-sectional survey containing the short version of the ERI questionnaire (16 items and questions related to self-reported health, musculoskeletal complaints and job satisfaction. Exploratory factor analysis, internal consistency of scales and criterion validity were utilized. Results. The internal consistency of scales was satisfactory. Principal component analysis enabled to identify the model’s main factors. Significant associations with health and job satisfaction in the majority of cases support the notion of criterion validity. A high score on the effort-reward ratio was associated with an elevated odds ratio (OR = 2.71; 95% CI 1.86–3.95 of musculoskeletal complaints in the upper arm. Conclusions. The short form of the Italian ERI questionnaire provides a psychometrically useful tool for routine occupational health surveillance, although further validation is recommended.
Comparative Study of Silk-Silk Alloy Materials
Xue, Ye; Jao, Dave; Hu, Wenbing; Wolf, Nathan; Rocks, Eva-Marie; Hu, Xiao
Silk fibroin materials can be used for various kinds of biomedical applications. We report a comparative study of silk-silk blend materials using thermal analysis and infrared spectroscopy. Four groups of silk-silk blend films: Mori-Tussah, Mori-Muga, Mori-Eri and Mori-Thai, were fabricated from aqueous solutions and blended at different weight ratios, respectively. These silk-silk blend systems exploit the beneficial material properties of both silks. DSC and temperature-modulated DSC were used to measure the transition temperatures and heat capacity of these water-based silk-silk blend films. Fourier transform infrared spectrometer was used to characterize secondary structures of silk-silk blends. This study demonstrates that Mori silk are fully miscible with Tussah, Muga, Eri and Thai silk at different weight ratios without phase separation. Glass transition temperatures, degradation temperatures and the contents of alpha-helix and random coils of those silk-silk blend films can be controlled by changing the contents of different silks in the blend system. The features of Mori silk combined with the attributes of Tussah, Muga, Eri and Thai silk offer a useful suite of materials for a variety of applications in the future.
Kouvonen, A; Kivimäki, M; Elovainio, M; Pentti, J; Linna, A; Virtanen, M; Vahtera, J
2006-01-01
Objectives To investigate the association between effort/reward imbalance (ERI) at work and sedentary lifestyle. Methods Cross sectional data from the ongoing Finnish Public Sector Study related to 30 433 women and 7718 men aged 17–64 were used (n = 35 918 after exclusion of participants with missing values in covariates). From the responses to a questionnaire, an aggregated mean score for ERI in a work unit was assigned to each participant. The outcome was sedentary lifestyle defined as sedentary lifestyle. High individual level ERI was associated with a higher likelihood of sedentary lifestyle both among women (odds ratio (OR) = 1.08, 95% CI 1.01 to 1.16) and men (OR = 1.17, 95% CI 1.02 to 1.33). These associations were not explained by relevant confounders and they were also independent of work unit level job strain measured as a ratio of job demands and control. Conclusions A mismatch between high occupational effort spent and low reward received in turn seems to be associated with an increased risk of sedentary lifestyle, although this association is relatively weak. PMID:16497854
Late spring ultraviolet levels over the United Kingdom and the link to ozone
Directory of Open Access Journals (Sweden)
J. Austin
Full Text Available Erythemally-weighted ultraviolet (UVery levels measured over southern England, during anticyclonic weather between 30 April and 2 May, 1997, were almost 50 higher than normally expected for clear skies and were similar to mid-summer values for the first time since measurements began in 1990. Investigation of this episode suggests that a combination of both meteorological and chemical effects were responsible for generating record low ozone amounts for the time of year. Further, comparisons between the A band ultraviolet (315 to 400 nm wavelength amounts, and radiative calculations confirm that the high UVery was primarily due to the reduction in total ozone. These results are contrasted with a similar period for 1998, in which near climatological ozone amounts were measured. The prospects for enhanced UVery levels in future years are briefly reviewed in the light of expected increases in stratospheric halogen levels and greenhouse gases.
Key words. Atmospheric composition and structure (middle atmosphere · composition and chemistry · Meterology and atmospheric dynamics (middle atmosphere dynamics; radiative processes
Teder, Juhan, 1960-
2004-01-01
Ettevõtete struktuurist suurusgrupiti eri riikides; teguritest, mis nimetatud struktuuri mõjutavad; riikliku ettevõtluspoliitika rollist; soovitusi ettevõtlusalase aktiivsuse stimuleerimiseks. Tabelid
ORF Alignment: NC_006576 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ery: 1 ... MRLLHTMLRVGDLERSLQFYCEILGMQLLRRKDYPGGEFTLAFVGYGEEADHTVLELTYN 60 ... MRLLHTMLRVGDLERSLQFYCEIL...GMQLLRRKDYPGGEFTLAFVGYGEEADHTVLELTYN Sbjct: 1 ... MRLLHTMLRVGDLERSLQFYCEILGMQLLRRKDYPGGEFTLAFVGYGEEADHTVLELTYN 60 ... Query: 121 VELIQTG 127 ... VELIQTG Sbjct: 121 VELIQTG 127
CRM UYGULAMALARININ VERİMLİLiGİNİ ARTlRMAK İÇİN KURUMSAL VERİ AMBARLARININ KULLANILMASI
Directory of Open Access Journals (Sweden)
Özcan Asilkan
2002-09-01
Full Text Available Bu çalışmada, yeni ekonominin en güçlü rekabet stratejisi haline gelen CRM (Customer • Relationship Management = Müşteri Ilişkileri Yönetimi uygulamalarında, V eri Ambarlarımn yeri ve önemi incelenmiştir. Bu amaçla hem CRM, hem de veri ambarları incelendikten sonra, CRM uygulamalarının verimliliğini artırmak için V eri ambarlarından nasıl faydalanabileceği anlatılnıaya çalışılmıştır.
Aktivnosti i društvene mreže u slobodnom vremenu mlađih tinejdžera
Rattinger, Marija
2017-01-01
Slobodno vrijeme učenika je ono vrijeme koje im preostaje nakon svih školskih i obiteljskih obveza. Postoje različite mogućnosti njegovog provođenja i različite mogućnosti utjecaja na način njegovog provođenja ( Byrne i dr., 2006). Ovim se radom istražilo koliko mlađi tinejdžeri imaju slobodnog vremena, na koji način ga koriste, te koliko su online društvene mreže i na koji način zastupljene u slobodnom vremenu ispitivane populacije. Rezultati pokazuju da mlađi tinejdžeri imaju prosječno oko ...
Talousveden pH-säädön optimointi
Elo, Hanne
2009-01-01
Tämän opinnäytetyön aiheena oli Talousveden pH-säädön optimointi. Työn tarkoituksena oli tutkia Forssan Vesihuoltolaitoksella raakaveden pH:n säätöä ja tutustua STEL-80A vedenkäsittelylaitteen toimintaan. Raakaveden pH:n säätökokeita tehtiin eri vahvuisilla lipeä- ja soodaliuoksilla. STEL-80A vedenkäsittelylaite tuottaa ruokasuolasta klooria ja lipeää, joita voidaan käyttää veden desinfiointiin ja pH-säätöön. STEL-80A vedenkäsittelylaitteella tehtiin kokeita eri virran voimakkuuksilla, joiden...
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-12-01
Based on the amendment of the Nuclear Energy Act the spent nuclear fuel of Imatran Voima Oy (IVO) will be disposed of in Finland instead of returning it to Russia. After Teollisuuden Voima Oy (TVO) and IVO had founded a joint company Posiva Oy the work IVO started in 1995 was brought together with the ongoing research programme for final disposal of spent fuel and extended to a feasibility study. The feasibility study was launched in the beginning of 1996. The geological evaluation was mainly based on the previous investigations at the island. For this study the complementary geological mapping has been carried out at the Haestholmen and on the surrounding area with a radius of 20 km. (49 refs.).
Innovatsiooni mõõtmine = Measurement of innovation / Aavo Heinlo
Heinlo, Aavo
2005-01-01
Innovatsiooni mõistest, innovatsiooni eri liikidest, Euroopa Liidus korraldatavast ühtsest innovatsiooniuuringust Community Innovation Survey (CIS) ja esimesest innovatsiooniuuringust Eestis 2001. aastal. Skeem. Diagrammid
1999-01-01
Ricardo Legoretta kujundatud kujutava kunsti keskus Santa Fe kolledzhile. Tomatipunane hoone, ehitatud eri tasapindadele. Hoones on ruumi tudengitele joonistamiseks ja maalimiseks, kunstiajaloo keskusele, fotokunstikeskusele.
Erythrocytes as Carriers for Drugs and Contrast Agents
Directory of Open Access Journals (Sweden)
Mauro Magnani
2014-01-01
Full Text Available Erythrocytes, also known as Red Blood Cells (RBC, are typically used in transfusion medicine to replace lost blood in patients who underwent different kinds of medical treatments as well as those involved in accidents resulting in blood loss. In addition to these common uses, RBC are being used for a variety of new applications either as therapeutics or as diagnostics. Most of these novel approaches are made possible due to the peculiar properties of these cells. We have invented a technology that allows cells to be opened and resealed without affecting their main physiological characteristics with a minimal amount of patient blood. Uses of processed RBCs in biomedical engineering include work with drugs, biomedical compounds and/or nanomaterials. These constructs are a new armamentarium available to the physicians for the release of drugs in circulation, for targeting drugs to selected sites in the body, or for in vivo diagnostic procedures based on magnetic and/or optical methods. Autologous human RBC loaded with dexamethasone (EryDex, a common corticosteroid, have been used in the treatment of Cystic Fibrosis, Crohn’s Disease, and other severe inflammatory conditions. Benefits and safety of this technology have been documented in over 2,500 treatments. EryDel SpA is a company focused on developing and commercializing innovative therapies and diagnostics based on the use of autologous RBCs as agent carriers. More recently, EryDel SpA completed a Phase II Proof of Concept study in patients with Ataxia Telangiectasia (AT, a rare progressive neurological autosomal recessive disorder that leads to mortality in most patients at an early age, with significant benefit seen on primary and secondary end-points. EryDex treatment has received Orphan Drug Designation by EMA for the treatment of Cystic Fibrosis and both by EMA and FDA for the treatment of AT. The encapsulation of superparamagnetic nanoparticles within RBC has lead to the generation
Nad pakuvad eri lahendusi / Monica Raud
Raud, Monica, 1981-
2004-01-01
Ajakirjade Kirjastuse müügijuht Kristiina Anvelt, TV3 müügidirektor Meelis Järvela, Eesti Päevalehe müügijuht Krista Liiv ja vanem projektijuht Olari Raig, Delfi müügi- ja marketingijuht Allan Sombri ja Eesti Raadio müügijuht Ave Vahemets selgitavad, miks reklaamida jogurtit, spordiklubi ning pesupublit just nende kanali vahendusel
Erie Harbor, Pennsylvania, Channel Shoaling Analysis
2011-07-01
to assist in this effort. Note that there are usually several xyz files to cover the channel survey for a given year. ERDC TR-11-4 3 Table 1...at one time numbering about 100 families and numerous Indians. Fields were cleared and cultivated with corn being the principal crop . A grist mill...of stone being placed. To hold sand fill, 20,400 small poplar trees and 1,900 small willow trees were planted, and 21 bushels of rye and 6 bushels
Piiratud ressurssidega high-tech-firmad otsivad välisturgu / Indrek Kald
Kald, Indrek, 1974-
2002-01-01
Eesti kõrgtehnoloogiafirmade suurimaks probleemiks on teadus- ja arendustegevuse piiratud ressursid, edu saavutamiseks tuleb murda välisturgudele. Diagramm: Kulutused teadus- ja arendustegevusele eri riikides
Sepp, Jüri, 1952-
2011-01-01
Artikli eesmärgiks on süstematiseerida ja hinnata erandvaldkondade reguleerimise majanduspoliitilisi meetmeid, kõrvutatakse eri valdkondade lahendusi omavahel ja normatiivse teooria seisukohtadega. Tabel
DeLorenzo, M E; Brooker, J; Chung, K W; Kelly, M; Martinez, J; Moore, J G; Thomas, M
2016-04-01
Antimicrobial compounds are widespread, emerging contaminants in the aquatic environment and may threaten ecosystem and human health. This study characterized effects of antimicrobial compounds common to human and veterinary medicine, aquaculture, and consumer personal care products [erythromycin (ERY), sulfamethoxazole (SMX), oxytetracycline (OTC), and triclosan (TCS)] in the grass shrimp Palaemonetes pugio. The effects of antimicrobial treatments on grass shrimp mortality and lipid peroxidation activity were measured. The effects of antimicrobial treatments on the bacterial community of the shrimp were then assessed by measuring Vibrio density and testing bacterial isolates for antibiotic resistance. TCS (0.33 mg/L) increased shrimp mortality by 37% and increased lipid peroxidation activity by 63%. A mixture of 0.33 mg/L TCS and 60 mg/L SMX caused a 47% increase in shrimp mortality and an 88% increase in lipid peroxidation activity. Exposure to SMX (30 mg/L or 60 mg/L) alone and to a mixture of SMX/ERY/OTC did not significantly affect shrimp survival or lipid peroxidation activity. Shrimp exposure to 0.33 mg/L TCS increased Vibrio density 350% as compared to the control whereas SMX, the SMX/TCS mixture, and the mixture of SMX/ERY/OTC decreased Vibrio density 78-94%. Increased Vibrio antibiotic resistance was observed for all shrimp antimicrobial treatments except for the mixture of SMX/ERY/OTC. Approximately 87% of grass shrimp Vibrio isolates displayed resistance to TCS in the control treatment suggesting a high level of TCS resistance in environmental Vibrio populations. The presence of TCS in coastal waters may preferentially increase the resistance and abundance of pathogenic bacteria. These results indicate the need for further study into the potential interactions between antimicrobials, aquatic organisms, and associated bacterial communities. © 2014 Wiley Periodicals, Inc.
Kelley, N.; Mount, G.; Terry, N.; Herndon, E.; Singer, D. M.
2017-12-01
The Critical Zone represents the surficial and shallow layer of rock, air, water, and soil where most interactions between living organisms and the Earth occur. Acid mine drainage (AMD) resulting from coal extraction can influence both biological and geochemical processes across this zone. Conservative estimates suggest that more than 300 million gallons of AMD are released daily, making this acidic solution of water and contaminants a common issue in areas with legacy or current coal extraction. Electrical resistivity imaging (ERI) provides a rapid and minimally invasive method to identify and monitor contaminant pathways from AMD remediation systems in the subsurface of the Critical Zone. The technique yields spatially continuous data of subsurface resistivity that can be inverted to determine electrical conductivity as a function of depth. Since elevated concentrations of heavy metals can directly influence soil conductivity, ERI data can be used to trace the flow pathways or perhaps unknown mine conduits and transport of heavy metals through the subsurface near acid mine drainage sources. This study aims to examine preferential contaminant migration from those sources through substrate pores, fractures, and shallow mine workings in the near subsurface surrounding AMD sites in eastern Ohio and western Pennsylvania. We utilize time lapse ERI measures during different hydrologic conditions to better understand the variability of preferential flow pathways in relation to changes in stage and discharge within the remediation systems. To confirm ERI findings, and provide constraint to geochemical reactions occurring in the shallow subsurface, we conducted Inductively Coupled Plasma (ICP) spectrometry analysis of groundwater samples from boreholes along the survey transects. Through these combined methods, we can provide insight into the ability of engineered systems to contain and isolate metals in passive acid mine drainage treatment systems.
Astrophysical Implications of a New Dynamical Mass for the Nearby White Dwarf 40 Eridani B
Energy Technology Data Exchange (ETDEWEB)
Bond, Howard E. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Bergeron, P.; Bédard, A., E-mail: heb11@psu.edu [Département de Physique, Université de Montréal, C.P. 6128, Succ. Centre-Ville, Montréal, QC H3C 3J7 (Canada)
2017-10-10
The bright, nearby DA-type white dwarf (WD) 40 Eridani B is orbited by the M dwarf 40 Eri C, allowing determination of the WD’s mass. Until recently, however, the mass depended on orbital elements determined four decades ago, and that mass was so low that it created several astrophysical puzzles. Using new astrometric measurements, the binary-star group at the U.S. Naval Observatory has revised the dynamical mass upward, to 0.573 ± 0.018 M {sub ☉}. In this paper, we use model-atmosphere analysis to update other parameters of the WD, including effective temperature, surface gravity, radius, and luminosity. We then compare these results with WD interior models. Within the observational uncertainties, theoretical cooling tracks for CO-core WDs of its measured mass are consistent with the position of 40 Eri B in the H-R diagram; equivalently, the theoretical mass–radius relation (MRR) is consistent with the star’s location in the mass–radius plane. This consistency is, however, achieved only if we assume a “thin” outer hydrogen layer, with q {sub H} = M {sub H}/ M {sub WD} ≃ 10{sup −10}. We discuss other evidence that a significant fraction of DA WDs have such thin H layers, in spite of the expectation from canonical stellar-evolution theory of “thick” H layers with q {sub H} ≃ 10{sup −4}. The cooling age of 40 Eri B is ∼122 Myr, and its total age is ∼1.8 Gyr. We present the MRRs for 40 Eri B and three other nearby WDs in visual binaries with precise mass determinations, and show that the agreement of current theory with observations is excellent in all cases.
2011-01-14
... Thomson Reuters (Tax & Accounting), Inc., Rochester, NY.... November 22, 2009. Professional Division...,841 PSB Industries, Inc., Leased Workers from Erie, PA......... November 3, 2009. Career Concepts...
Rüütel, Risto, 1976-
1999-01-01
Geograafiliste tähiste olemus ja jagunemine, päritolukohanimede rahvusvaheline kaitse, rahvusvahelised konventsioonid, geograafiliste tähiste kaitse eri riikides - Saksamaal, Prantsusmaal, USA-s, Austraalias
Poltora milliona za "Maugli" namerena polutshit naslednitsa odnogo iz sozdatelei multfilma
2004-01-01
Stsenarist Leonid Belokurovi abikaasa nõuab filmistuudio "Sojuzmultifilm" õigusjärgsetelt omanikelt kohtu kaudu poolteist miljonit rubla multifilmi "Mowgli" näitamise eest Venemaa eri telekanalitel
Työelämäosaaminen: kvalifikaatioiden luokitusjärjestelmän konstruointi
Hanhinen, Taina
2010-01-01
YTM Taina Hanhinen käsittelee ammattikasvatustieteen väitöstutkimuksessaan työelämäosaamisen ilmiötä eri näkökulmista ja eri tasoilla. Tutkimuksen tuloksena esitetään työelämäosaamisen teoreettinen malli. Se kuvaa jatkuvassa muutoksessa olevaa työelämän kenttää, jossa työorganisaatiot ja niiden jäsenet aktiivisesti kehittävät omaa osaamistaan, toimintaansa sekä toimintaympäristöään. Tutkimuksessa työelämäosaamisen keskeisiksi osatekijöiksi jäsentyivät kvalifikaatiot ja kompetenssi sekä am...
Dabrowska, H; Fisher, S W; Estenik, J; Kidekhel, R; Stromberg, P
2006-08-01
Concentrations and profiles of polychlorinated biphenyls (PCBs) were determined in three tissues of adult snapping turtles (Chelydra serpentina serpentina) from six locations in the Ohio Basin of Lake Erie to characterize tissue variation and geographic trends. The locations included the Ohio Areas of Concern, i.e., the Ashtabula, Black, and Maumee Rivers; the Ottawa River near Toledo; and two reference sites. Mean total PCBs were greatest in turtles from the Ottawa River followed by the Maumee, Ashtabula, and Black Rivers. All three types of samples-fat tissue (FT), eggs, and plasma-showed the same geographic trend in PCB levels. On a wet-weight basis, mean concentrations ranged from 2,148 to 18,669 ng/g in FT, from 183 to 3,683 ng/g in eggs, and from 18 to 201 ng/g in plasma. Across all sites, total PCB concentrations between the tissues were significantly correlated (0.001 40 congeners (0.001 < p < 0.05). The distribution ratios determined for these congeners from the slope of the regression lines averaged 1.235 +/- 0.279, 0.430 +/- 0.170, and 0.387 +/- 0.115, respectively. The plasma wet weight-FT lipid-normalized concentration ratios for these congeners averaged 0.012 +/- 0.006. Both egg-FT and plasma wet weight-FT lipid-normalized ratios regressed against log K(ow) showed significant decreases, with increasing log K(ow), indicating greater accumulation of highly chlorinated congeners in FT than in other compartments. The estimated 2,3,7,8-tetrachlorodibenzo-p-dioxin toxic equivalents ranged from 0.007 ng/g at reference sites to 0.060 ng/g at contaminated sites and from 0.099 to 1.992 ng/g in plasma and eggs, respectively. In both plasma and eggs, coplanar-CBs were the major contributors to total toxic equivalents (TEQs). Eggs from all contaminated sites had TEQs that exceeded the lowest observed effect level TEQs proposed for bald eagle chicks, in addition to high SigmaPCB levels at some of these sites, especially the Ottawa and Maumee River sites, indicate
Eesti matemaatikaõpetajate tööstiil TIMSSi andmetel / Madis Lepik
Lepik, Madis
2005-01-01
Tutvustatakse 4-aastase tsükliga toimuva koolimatemaatika rahvusvahelise võrdlusuuringu TIMSS (Trends in International Mathematics and Science Style) tulemusi. Uuringu keskmes on eri riikide õpilaste matemaatikateadmised
Liseiski, Triin
2010-01-01
Prokuratuuri ja uurimisasutuste õiguslikust olemusest ja koostööst taasiseseisvunud Eestis, olukorrast kehtivas kriminaalmenetluses. Eri riikide (Itaalia, Saksa) mõjudest Eestile. Soome ja Inglismaa kohtueelsest menetlusest
Pierre Huyghe' lavastatud pidustused äärelinnas, Antarktikas ja arhitektuuris / Margit Säde
Säde, Margit
2007-01-01
Reykjaviki Kunstimuuseumis Hafnarhusis olevast Pierre Huyghe' näitusest "Live show as exhibition", kus ta multidistsiplinaarse kunstnikuna kasutab eri meediume vastavalt nende sobivusele töö kontseptsiooniga
Bellingrath, Silja; Rohleder, Nicolas; Kudielka, Brigitte M
2013-02-01
According to the effort-reward-imbalance (ERI) model, a lack of reciprocity between costs and gains at work increases the risk for adverse health outcomes. Inflammation has been shown to play a crucial role in a variety of stress-related diseases and alterations in immune system glucocorticoid sensitivity may help to explain the increased risk for cardiovascular disease (CVD) and depression related to chronic work stress. Changes in lipopolysaccharide (LPS)-induced interleukin (IL)-6 production and inhibition of IL-6 production by dexamethasone in reaction to the Trier Social Stress Test (TSST) were assessed in forty-six healthy school teachers to test whether chronic work stress is accompanied by alterations in inflammatory activity and glucocorticoid sensitivity of the innate immune system. High ERI was associated with an increase in pro-inflammatory potential, reflected in elevated IL-6 production before and after stress and with a lower capacity of dexamethasone to suppress IL-6 production in vitro over all measurement time points. ERI was not associated with stress-related changes in GC sensitivity. The present findings suggest a less effective anti-inflammatory regulation by glucocorticoids in teachers suffering from chronic work stress. Copyright © 2012 Elsevier B.V. All rights reserved.
Bathman, Lauren Marjorie; Almond, Jacinta; Hazi, Agnes; Wright, Bradley James
2013-10-01
Physiological indices of stress and ill-health (cortisol and salivary immunoglobulin A) were assessed to determine if they were predicted by Siegrist's effort-reward imbalance model (ERI) with an aim of identifying employees at risk of illness. Male Australian dairy farmers (N=66) completed the Perceived Stress Scale, Work related Questions II & III, Eysenck Personality Questionnaire Revised--Short and demographic questions and provided morning saliva samples (at awakening and 30 min post awakening) on a working day, which were subsequently analysed for cortisol and salivary immunoglobulin A (sIgA) concentration levels. A high percentage (45.5%) of the sample reported an imbalance between efforts and rewards in the workplace that may place them 'at risk' for ill-health. After controlling for disposition, sIgA scores were more successfully predicted by the ERI than the cortisol assessments. Although both efforts and rewards were significantly associated with sIgA, efforts were most strongly associated. The dispositional trait overcommitment, did not moderate the experience of stress on the physiologic indices. The current investigation supports the continued use of sIgA in studies that use biomarkers to assess occupational stress. ERI ratio scores >1 aligned with previous findings that suggest elevated risk of illness for these employees. Copyright © 2013 Elsevier Inc. All rights reserved.
Kouvonen, A; Kivimäki, M; Elovainio, M; Pentti, J; Linna, A; Virtanen, M; Vahtera, J
2006-06-01
To investigate the association between effort/reward imbalance (ERI) at work and sedentary lifestyle. Cross sectional data from the ongoing Finnish Public Sector Study related to 30,433 women and 7718 men aged 17-64 were used (n = 35,918 after exclusion of participants with missing values in covariates). From the responses to a questionnaire, an aggregated mean score for ERI in a work unit was assigned to each participant. The outcome was sedentary lifestyle defined as work unit level predictors in the models. Adjustments were made for age, marital status, occupational status, job contract, smoking, and heavy drinking. Twenty five per cent of women and 27% of men had a sedentary lifestyle. High individual level ERI was associated with a higher likelihood of sedentary lifestyle both among women (odds ratio (OR) = 1.08, 95% CI 1.01 to 1.16) and men (OR = 1.17, 95% CI 1.02 to 1.33). These associations were not explained by relevant confounders and they were also independent of work unit level job strain measured as a ratio of job demands and control. A mismatch between high occupational effort spent and low reward received in turn seems to be associated with an increased risk of sedentary lifestyle, although this association is relatively weak.
The influence of different salting processes on protein loss of cuttlefish (Sepia officinalis.
Directory of Open Access Journals (Sweden)
Mustafa Ünlüsayın
2015-12-01
Full Text Available Sübye (Sepia officinalis’nin protein kayıpları üzerine farklı tuzlama yöntemlerinin etkileri. Bu çalışmanın amacı; farklı tuzlama metotlarıyla tuzlanan sübye (Sepia officinalis L., 1758’nin protein kayıplarını araştırmaktır. %8 ve %20 konsantrasyonlarında NaCl içeren iki farklı tuz solüsyonu çalışılmıştır. Üçüncü yöntem olan kuru tuzlama yöntemi ise balık yüzeyinin tamamı tuz ile kaplanarak yapılmıştır. Taze ve %8’lik solüsyonla tuzlanan sübyelerin nem içeriğindeki değişimler önemsizdi (P>0,05. %8 ve %20’lik konsantrasyonlarla tuzlanan sübyelerin protein içeriğindeki (kuru ağırlık üzerinden değişimler önemsiz (P>0,05 olarak belirlenmiştir. Tuzlamadan sonra tüm gruplarda sübyelerin toplam protein içeriği azalmıştır (P
Directory of Open Access Journals (Sweden)
Xiao-Hui Yan
2017-08-01
Full Text Available Objective: To study the correlation of erythropoietin (EPO resistance with oxidative stress response and inflammatory response in patients with maintenance hemodialysis. Methods: A total of 184 patients with end-stage renal disease who received maintenance hemodialysis in Shaanxi Provincial People’s Hospital between March 2015 and October 2016 were selected as dialysis group, 102 volunteers who received physical examination in Shaanxi Provincial People’s Hospital during the same period were selected as control group, the EPO resistance index was assessed, the median was calculated, and serum oxidative stress and inflammatory response indexes were detected. Results: Serum T-AOC, SOD and CAT levels in dialysis group were significantly lower than those in control group while MDA, AOPP, IFN-γ, HMGB-1, ICAM-1, IL-4 and IL-10 levels were significantly higher than those in control group; serum T-AOC, SOD and CAT levels in patients with high ERI were significantly lower than those in patients with low ERI while MDA, AOPP, IFN-γ, HMGB-1, ICAM-1, IL-4 and IL-10 levels were significantly higher than those in patients with low ERI. Conclusion: The degree of EPO resistance in patients with maintenance hemodialysis is closely related to the activation of oxidative stress response and inflammatory response.
Directory of Open Access Journals (Sweden)
Jian Li
2017-01-01
Full Text Available Objective. Short- and medium-term effectiveness (up to 3 years of individual level stress management interventions (SMI at work were demonstrated, yet long-term effectiveness remains unexplored. We therefore aimed to address this research gap. Methods. 94 male middle managers participated in a randomized wait-list controlled trial between 2006 and 2008 and in a post-trial-follow-up survey in 2015. During the first two years, all received an 18-hour psychotherapeutic SMI intervention which was based on the Effort-Reward Imbalance (ERI model: tackling stressor on mismatch between effort and reward and promoting recovery on overcommitment. Work stress (i.e., ERI indicators was the primary outcome, and the secondary outcome was depressive symptoms. The long-term effectiveness of the SMI was examined by mixed modeling, using an external control group (n=94. Results. Effort and reward were substantially improved with significant intervention ⁎ time interaction effects (p<0.001 compared to the external control group; effects on overcommitment and depressive symptoms were also significant (p<0.05 and p<0.01, resp., though their trajectories in the intervention group were less sustainable. Conclusions. The effectiveness of this psychotherapeutic SMI at work based on the ERI model was observed over a 9-year period, particularly on the effort-reward ratio.
Prevalence and Associated Factors of Depressive Symptoms among Chinese Underground Coal Miners
Directory of Open Access Journals (Sweden)
Li Liu
2014-01-01
Full Text Available Although underground coal miners are quite susceptible to depressive symptoms due to a highly risky and stressful working environment, few studies have focused on this issue. The purpose of the study was to evaluate the prevalence of depressive symptoms and to explore its associated factors in this population. A cross-sectional survey was conducted in a coal-mining population in northeast China. A set of self-administered questionnaires was distributed to 2500 underground coal miners (1,936 effective respondents. Depressive symptoms, effort-reward imbalance (ERI, overcommitment (OC, perceived physical environment (PPE, work-family conflict (WFC, and some demographic and working characteristics were measured anonymously. The prevalence of depressive symptoms was 62.8%, and the mean level was 20.00 (9.99. Hierarchical linear regression showed that marital status, education, monthly income, and weekly working time were significantly associated with depressive symptoms. A high level of depressive symptoms was significantly associated with high ERI, PPE, WFC, and OC. Accordingly, most Chinese underground coal miners probably have depressive symptoms that are mainly predicted by some occupational psychosocial factors. Efforts should be made to develop strategies to reduce ERI and OC, improve physical working environment, and care for workers’ family well-being, thereby mitigating the risk of depression among Chinese underground coal miners.
Rehbein, S; Baggott, D G; Johnson, E G; Kunkle, B N; Yazwinski, T A; Yoon, S; Cramer, L G; Soll, M D
2013-03-01
The efficacy of eprinomectin in an extended-release injection (ERI) formulation was evaluated against infections with third-stage larvae or eggs of gastrointestinal and pulmonary nematodes in cattle under 120-day natural challenge conditions in a series of five studies conducted in the USA (three studies) and in Europe (two studies). For each study, 30 nematode-free (four studies) or 30 cattle harboring naturally acquired nematode infections (one study) were included. The cattle were of various breeds or crosses, weighed 107.5-273 kg prior to treatment and aged approximately 4-11 months. For each study, animals were blocked based on pre-treatment bodyweight and then randomly allocated to treatment: ERI vehicle (control) at 1 mL/50 kg bodyweight or Eprinomectin 5% (w/v) ERI at 1 mL/50 kg bodyweight (1.0 mg eprinomectin/kg) for a total of 15 and 15 animals in each group. Treatments were administered once on Day 0 by subcutaneous injection in front of the shoulder. In each study, all animals grazed one naturally contaminated pasture for 120 days. At regular intervals during the studies, fecal samples from all cattle were examined for nematode egg and larval counts. In four studies pairs of tracer cattle were used to monitor pasture infectivity at 28-day intervals before and/or during the grazing period. All calves were weighed before turnout onto pasture and at regular intervals until housing on Day 120. For parasite recovery, all study animals were humanely euthanized 27-30 days after removal from pasture. Cattle treated with Eprinomectin ERI had significantly (p92%: Dictyocaulus viviparus (adults and fourth-stage larvae (L4), Bunostomum phlebotomum, Cooperia curticei, Cooperia oncophora, Cooperia punctata, Cooperia surnabada, Cooperia spp. inhibited L4, Haemonchus contortus, Haemonchus placei, Haemonchus spp. inhibited L4, Nematodirus helvetianus, Nematodirus spp. inhibited L4, Oesophagostomum radiatum, Oesophagostomum spp. inhibited L4, Ostertagia leptospicularis
Sotsiaalkapitali mõõtmine / Anneli Kaasa
Kaasa, Anneli, 1975-
2006-01-01
Ülevaade sotsiaalkapitali eri aspekte kirjeldavatest näitajatest, võimalikest meetoditest andmete kogumiseks, töötlemiseks ja üldistamiseks, sotsiaalkapitali mõõtmisega seotud probleemidest. Tabel
Fagerland Kroknes, Veronica
2015-01-01
Artiklis käsitletakse majandusliku olukorra (konkreetselt 2007-2008. aasta majanduskriisi) ja poliitilise usalduse seoseid Euroopa eri riikides (sh Eesti), aluseks Euroopa sotsiaaluuringu, Maailmapanga ja Rahvusvahelise Valuutafondi andmed
77 FR 15123 - Foundry Coke From China; Scheduling of an Expedited Five-Year Review
2012-03-14
... submitted by ABC Coke, Erie Coke, Tonawanda Coke Corporation, and Walter Coke Co. to be individually... Analyst... Cynthia Foreso (205-3348). Attorney Charles St. Charles (205-2782). Supervisory Investigator...
"Alfa" i "Võmpel" bez maski / Andrei Sharov
Sharov, Andrei
2004-01-01
Venemaa FSB keskuse, mille koosseisu kuuluvad ka eriüksused Alfa ja Võmpel, töötajad osalevad terroristide neutraliseerimise ja pantvangide vabastamise erioperatsioonides. Intervjuu keskuse staabi uue juhiga
Sedamoodi 2005 : moda ot shkolnikov / Marina Poltavtseva
Poltavtseva, Marina
2005-01-01
Tallinna koolide õpilaste moekonkursist "Sedamoodi" räägib konkursi organisaator Tallinna Kanutiaia Noortemaja direktor Mari Velleste. Sedamoodi 2005 eri vanusegruppide võitjad. Rändauhinnaks on Tauno Kangro skulptuur
The size of second chambers and European assemblies / Rein Taagepera, Steven P Recchia
Taagepera, Rein, 1933-
2002-01-01
Autorid võrdlevad eri maade esinduskogude kodade suurust ja elanike arvu neis maades ning arutlevad, kui suur kohtade arv peaks olema Euroopa Liidu Nõukogus ja Euroopa Parlamendis. Tabelid, diagrammid
Sõjapidamine XIII : Eesti kaitsmisest sõjas ja rahus 5 / Rene Toomse
Toomse, Rene
2011-01-01
Eriüksused (erioperatsioonide grupp EOG, Kaitseliidu erioperatsioonide grupp KL EOG, Küberkaitseliit) ning strateegilise, operatsioonilise ja taktikalise tasandi toetussüsteemid. Võimaliku tsiviilkaitsesüsteemi toimimine ja otstarbekus
Luiga, Juhan, 1873-1927
1995-01-01
Koguteose "Soumen suvu uskonnot" ettevalmistamisest, soome-ugri rahvausundite tunnusjoontest. Eesti rahvaluule ja muistne kultuur, taoismi põhitõed ja seosed eesti muinasusundiga, rahvausundi psühholoogilised sugemed eri rahvastel
Energy Technology Data Exchange (ETDEWEB)
Ryynaenen, S; Tuomi, S
1997-12-31
The objective of the research focusing on the small-scale production of fuelwood within the scope of the National Bioenergy research programme (1993-1998) under way in Finland is to promote the use of fuelwood. In addition to the Work Efficiency Institute (TTS-Institute), several manufacturers and organisations have participated in this work. New technology and work methods for the harvesting of fuelwood have been developed for application by the forest owners. Machines and devices intended for the harvesting and chopping into fuelwood of small-diameter trees have been developed to prototype and series production stages. Recyclable handling and distribution units have been developed for the purpose of distributing chopped fuelwood. A computer-based calculation model has been developed for calculating and analysing the costs of producing chipped and chopped fuelwood. A handbook serving the needs of entrepreneurs has been written on the basis of the results of a study focusing on heat entrepreneurship. The aim of the fuelwood use study, carried out under the leadership of VTT, was to eliminate technical obstacle to using fuelwood in detached houses and the category of small buildings. An other aim was to reduce emissions of the flue gases. This was achieved through the development of fireplace structures, catalyzer assisted combustion and heating methods. An automated stoker-assisted burner and a series of boilers designed for biofuels were developed for small buildings. (3 refs.)
Energy Technology Data Exchange (ETDEWEB)
Alakangas, E. [ed.
1996-12-31
Bioenergy Research Programme is one of the energy technology research programmes of the Technology Development Center TEKES. The aim of the bioenergy Research Programme is to increase, by using technical research and development, the economically profitable and environmentally sound utilisation of bioenergy, to improve the competitiveness of present peat and wood fuels, and to develop new competitive fuels and equipment related to bioenergy. The funding for 1995 was nearly 52 million FIM and the number of projects 66. The development target for peat production technology is to improve the competitiveness of peat by reducing the production costs by 20 % from the level of 1992 (5-6 FIM/MWh) and to reduce the environmental load. In addition to this, the main parts of the production methods will be demonstrated. In 1995 there were 10 projects going on in the field of peat production. The results of 1995 projects will be presented in this publication. Field biomass research started in the Bioenergy Research Programme in 1994. The number of projects was three, funded mainly by the Finnish Ministry of Agriculture and Forestry. The results of previous researches show that economically most promising possibilities are in the utilization of straw and reed canary grass
Argielu ja "rahvakultuur" : sajandialguse Saaremaa Eesti Rahva Muuseumi välipäevikus / Heiki Pärdi
Pärdi, Heiki, 1951-
1995-01-01
Eesti Rahva Muuseumis säilitatavad matka- e. välipäevikud etnoloogia allikatena. Ülevaade sajandialguse Saaremaa elamiskultuurist, tähelepanekuid ja hinnanguid eesti eri paikkondade inimeste kohta
2012-04-18
.... Solutions, USA, Inc., Oncology Care Systems (Radiation Oncology), Source Right Solutions. 81,297 Samsung... Berkman LLC WV. 81,344 Creditron Financial Erie, PA. Corporation, d/b/a Telatron Marketing Group...
The building blocks of electronic records and information ...
African Journals Online (AJOL)
Journal of Fundamental and Applied Sciences ... Electronic Records and Information Management (e-RIM) framework is paramount for ... formulating strategies for managing, use, maintain and protect electronic records and information (e-RI).
Kirsipuu, Liina
2000-01-01
Riigikogu Kantselei poolt tellitud avaliku arvamuse uuringust "Riik ja rahvas" (oktoober 1999) kodanike rahulolu Eesti poliitilise korralduse eri aspektidega analüüs. Summary: Political Support and legitimacy of the power
Carter : Iisraelil on 150 või enam tuumapommi / Kaivo Kopli
Kopli, Kaivo
2008-01-01
USA endine president Jimmy Carter väitis, et Iisraelil on 150 tuumapommi või rohkemgi. Eri hinnangutest Iisraeli tuumapommide arvu kohta, n.-ö. tunnustatud tuumariigid maailmas. Lisa: Tuumakatsetus 1979. aastal?
Lamp, Marku
2008-01-01
Vestlus keskkonnaministeeriumi metsaosakonna juhatajaga metsade heaperemehelikust majandamisest, puidu aktiivsemast kasutuselevõtust eri majandusharudes ning raiutud metsade asendamisest uutega, mis tagab kasvuhoonegaaside piisava sidumise atmosfäärist, pidurdades nii ka kliimamuutusi
Eestis katsetatakse suurfirmade klaasi / Mikk Salu
Salu, Mikk, 1975-
2008-01-01
TTÜ juurde loodud spin-off firma Glasstress mõõdab eri firmade klaasitoodangu taset ning valmistab klaasi kvaliteedi mõõtmiseks mõeldud aparaate maailma suurimatele klaasitootjatele Saint-Cobain ja Pilkington
Protein (Cyanobacteria): 86604772 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available YP_473535.1 NC_007775 1117:6436 ... 1118:902 1301283:25411 ... 1129:1600 321327:64 ... bacteriochlorophyll deliv...ery (BCD) family transporter Synechococcus sp. JA-3-3Ab MANIQRDPEVNGSAATALSSQPQPSAP
Любимцы любимчиков / Сергей Трофимов
Трофимов, Сергей
2009-01-01
Fotograaf Indrek Galetini heategevuslik fotonäitus "Amour - Lemmikloomade eri" Rotermanni Aatriumis Tallinnas. Pildistatud on Eesti tuntud inimesi alasti koos lemmikloomadega. Oksjoni müügitulu läheb kodutute loomade heaks
Elfriede Lenderi Fond toetab noori õpetajaid / Toivo Toomemets
Toomemets, Toivo
2001-01-01
27. sept.̀2001 kirjutas sihtasutuse Eesti Rahvakultuuri Fond nõukogu esimees Eri Klas alla lepingud kahe uue nimelise allfondi - Elfriede Lenderi Fondi ja Renate Jõesaare Stipendiumifondi loomiseks Eesti Rahvakultuuri Fondi juurde
Inimhääle lummus ja topeltverism / Tiiu Levald
Levald, Tiiu, 1940-
2008-01-01
Birgitta festivali raames 10. ja 11. VIII Pirita kloostris toimunud etendustest - Mascagni "Talupoja au", Leoncavallo "Pajatsid" ja Donizetti "Maria Stuart" Moskva Novaja Opera esituses, dirigendid: Eri Klas, Valeri Kritskov ja Sergei Lõssenko
Kui kirjandus jäi aega kinni: sõjast ja kirjandusest Johannes Semperi loomingus / Marit Karelson
Karelson, Marit
2015-01-01
Artiklis keskendutakse muutustele, mida Esimene maailmasõda tõi kaasa Johannes Semperi arusaamades kirjanduse ja aja koostoimimisest ning käsitletakse kirjaniku ideed ilukirjanduse rütmist, mis on eri perioodidel erinev
Kahu, Tõnis, 1962-
2006-01-01
Heliplaatidest: "Spring Odyssey", Rättö ja Lehtisalo "Ed Bentonin briljantti stabilismi tai taivaallinen kylpysaipua", Eri esinejad "Pataphysics", KT Tunstall "Eye to the Telescope", Black to Comm "Rückwärts Backwards"
Roos, Irene
2008-01-01
Tallinnas Lutheri kvartalis läbi kahe korruse paiknevast näidiskorterist. Sisustajad Irene Roos ja Ester Penjam. Paekiviseina kasutati sisustuselemendina, Philipsi valgustid jagasid ruumi eri tsoonideks. 9 värv. ill
Võõrkeeleoskuse sertifikaat koolist kaasa / Nora Mals, Oleg Kravtšenko
Mals, Nora
2006-01-01
Tallinna Reaalkooli ja Keelekeskuse Puškin koostööst, mis annab võimaluse abiturientidele sooritada eri tasemega rahvusvahelisi teste, mille alusel keelekeskus väljastab riiklikud sertifikaadid, mida rahvusvaheliselt tunnustatakse
Chelsea Flower Show 2007 / Merilen Mentaal
Mentaal, Merilen, 1972-
2007-01-01
Uusimaid aiatrende Londonist. Enimkasutatud materjalid puit, eri vormi ja struktuuriga kivid ning vesi. Võiduaiaks kivifirma Bradstone'i aed "600 päeva Bradstone'iga", disainer Sarah Eberle. 15 värv. ill
MAGNETIC ACTIVITY CYCLES IN THE EXOPLANET HOST STAR ε ERIDANI
International Nuclear Information System (INIS)
Metcalfe, T. S.; Mathur, S.; Buccino, A. P.; Mauas, P. J. D.; Petrucci, R.; Brown, B. P.; Soderblom, D. R.; Henry, T. J.; Hall, J. C.; Basu, S.
2013-01-01
The active K2 dwarf ε Eri has been extensively characterized both as a young solar analog and more recently as an exoplanet host star. As one of the nearest and brightest stars in the sky, it provides an unparalleled opportunity to constrain stellar dynamo theory beyond the Sun. We confirm and document the 3-year magnetic activity cycle in ε Eri originally reported by Hatzes and coworkers, and we examine the archival data from previous observations spanning 45 years. The data show coexisting 3-year and 13-year periods leading into a broad activity minimum that resembles a Maunder minimum-like state, followed by the resurgence of a coherent 3-year cycle. The nearly continuous activity record suggests the simultaneous operation of two stellar dynamos with cycle periods of 2.95 ± 0.03 years and 12.7 ± 0.3 years, which, by analogy with the solar case, suggests a revised identification of the dynamo mechanisms that are responsible for the so-called 'active' and 'inactive' sequences as proposed by Böhm-Vitense. Finally, based on the observed properties of ε Eri, we argue that the rotational history of the Sun is what makes it an outlier in the context of magnetic cycles observed in other stars (as also suggested by its Li depletion), and that a Jovian-mass companion cannot be the universal explanation for the solar peculiarities.
Omansky, Rachel; Eatough, Erin M; Fila, Marcus J
2016-01-01
The current work examines a contemporary workplace stressor that has only recently been introduced into the literature: illegitimate tasks. Illegitimate tasks are work tasks that violate identity role norms about what can reasonably be expected from an employee in a given position. Although illegitimate tasks have been linked to employee well-being in past work, we know little about the potential explanatory mechanisms linking illegitimate tasks to work-relevant negative psychological states. Using a sample of 213 US-based employees of mixed occupations and a cross-sectional design, the present study examines job satisfaction and intrinsic motivation as outcomes of illegitimate tasks. Additionally, we examine perception of effort-reward imbalance (ERI) as a potential mediating mechanism through which illegitimate tasks relate to job satisfaction and intrinsic motivation, highlighting a possible pathway by which these relationships are functioning. Finally, we explore gender as a socially constructed variable that could contribute to variation in responses to illegitimate tasks and moderate the mediated link between illegitimate tasks and outcomes. Results indicated that illegitimate tasks were significantly related to job satisfaction and intrinsic motivation both directly and indirectly through perceptions of ERI in the predicted directions. Moreover, a moderated-mediation effect was found such that male workers reacted more than female workers to illegitimate tasks through the mechanism of perceived ERI.
Roseman, Edward F.; Kennedy, Gregory W.; Manny, Bruce A.; Boase, James; McFee, James; Tallman, Ross F.; Howland, Kimberly L.; Rennie, Michael D.; Mills, Kenneth; Tallman, Ross F.; Howland, Kimberly L.; Rennie, Michael D.; Mills, Kenneth
2012-01-01
The Detroit River is part of a channel connecting Lakes Huron and Erie and was once a prolific spawning area for lake whitefish, Coregonus clupeaformis. Large numbers of lake whitefish migrated into the river to spawn where they were harvested by commercial fisheries and for fish culture operations. Prior to our study, the last lake whitefish was landed from the Detroit River in 1925. Loss of spawning habitat during shipping channel construction and over-fishing, likely reduced lake whitefish spawning runs. Because lake whitefish are recovering in Lake Erie, and spawning in the western basin, we suspected they may also be spawning in the Detroit River. We sampled in the Detroit River for lake whitefish adults and eggs in October–December 2005–07 and for larvae during March–May 2006–08. A total of 15 spawning-ready lake whitefish from 4 to 18 years old, were collected. Viable eggs were collected during mid-November 2006–07; highest egg densities were found mid-river. Sac-fry whitefish larvae were collected in the river and near the river mouth. No whitefish larvae were retained in the river. Because high numbers of larvae were collected from mid- and downstream river sites, reproduction of lake whitefish in the Detroit River could contribute substantially to the Lake Erie lake whitefish metapopulation.