WorldWideScience

Sample records for binghamton binghamton ny

  1. Searching for a New Way to Reach Patrons: A Search Engine Optimization Pilot Project at Binghamton University Libraries

    Science.gov (United States)

    Rushton, Erin E.; Kelehan, Martha Daisy; Strong, Marcy A.

    2008-01-01

    Search engine use is one of the most popular online activities. According to a recent OCLC report, nearly all students start their electronic research using a search engine instead of the library Web site. Instead of viewing search engines as competition, however, librarians at Binghamton University Libraries decided to employ search engine…

  2. Leveraging DMO’s Hi-Tech Simulation Against the F-16 Flying Training Gap

    Science.gov (United States)

    2005-04-01

    39-49. 6 United States Department of Transportation, Airplance Simulator Qualification, Report AC No.120-40B (Washington, DC: Federal Aviation...and Motion Simulation Conference. Binghamton, NY: Singer-Simulation Products Division, 1976. United States Department of Transportation. Airplance

  3. Processes of Skill Performance: A Foundation for the Design and Use of Training Equipment

    Science.gov (United States)

    1983-11-01

    the meeting of the American Association on Mental Deficiency , Southeastern Region, Columbia, SC, 1960. Spears, W. D. Experimental psychology and...Simulation Div. for Personnel Binghamton, NY 1390? Department of tK2 Army Washington, DC 20310 Librarian MAJ Bob CROACH Calspan Corp. HQ USAF/XOOTD P. 0. Box

  4. The "Pseudocommando" mass murderer: part II, the language of revenge.

    Science.gov (United States)

    Knoll, James L

    2010-01-01

    In Part I of this article, research on pseudocommandos was reviewed, and the important role that revenge fantasies play in motivating such persons to commit mass murder-suicide was discussed. Before carrying out their mass shootings, pseudocommandos may communicate some final message to the public or news media. These communications are rich sources of data about their motives and psychopathology. In Part II of this article, forensic psycholinguistic analysis is applied to clarify the primary motivations, detect the presence of mental illness, and discern important individual differences in the final communications of two recent pseudocommandos: Seung-Hui Cho (Virginia Tech) and Jiverly Wong (Binghamton, NY). Although both men committed offenses that qualify them as pseudocommandos, their final communications reveal striking differences in their psychopathology.

  5. 19 CFR 122.15 - User fee airports.

    Science.gov (United States)

    2010-04-01

    ... Airport. Egg Harbor Township, New Jersey Atlantic City International Airport. Englewood, Colorado... Airport. Hillsboro, Oregon Hillsboro Airport. Johnson City, New York Binghamton Regional Airport. Lansing..., California Southern California Logistics Airport. Waterford, Michigan Oakland County International Airport...

  6. 3D Printing of Personalized Organs and Tissues

    Science.gov (United States)

    Ye, Kaiming

    2015-03-01

    Authors: Kaiming Ye and Sha Jin, Department of Biomedical Engineering, Watson School of Engineering and Applied Science, Binghamton University, State University of New York, Binghamton, NY 13902-6000 Abstract: Creation of highly organized multicellular constructs, including tissues and organs or organoids, will revolutionize tissue engineering and regenerative medicine. The development of these technologies will enable the production of individualized organs or tissues for patient-tailored organ transplantation or cell-based therapy. For instance, a patient with damaged myocardial tissues due to an ischemic event can receive a myocardial transplant generated using the patient's own induced pluripotent stem cells (iPSCs). Likewise, a type-1 diabetic patient can be treated with lab-generated islets to restore his or her physiological insulin secretion capability. These lab-produced, high order tissues or organs can also serve as disease models for pathophysiological study and drug screening. The remarkable advances in stem cell biology, tissue engineering, microfabrication, and materials science in the last decade suggest the feasibility of generating these tissues and organoids in the laboratory. Nevertheless, major challenges still exist. One of the critical challenges that we still face today is the difficulty in constructing or fabricating multicellular assemblies that recapitulate in vivo microenvironments essential for controlling cell proliferation, migration, differentiation, maturation and assembly into a biologically functional tissue or organoid structure. These challenges can be addressed through developing 3D organ and tissue printing which enables organizing and assembling cells into desired tissue and organ structures. We have shown that human pluripotent stem cells differentiated in 3D environments are mature and possess high degree of biological function necessary for them to function in vivo.

  7. Examining the Moral Development of Emerging Adult Student-Athletes: The Connection to Engaged Leadership Practices

    Science.gov (United States)

    Bowers, Kristie M.

    2017-01-01

    With university mission statements focused on preparing emerging adult students for globally inclusive professional careers, moral and leadership development has become a central focus of many colleges and universities (Bass, 1991; Binghamton University, 2016; Zimmerman-Oster & Burkhardt, 1999). Colleges and universities utilize interactions…

  8. Actuarial Science.

    Science.gov (United States)

    Warren, Bette

    1982-01-01

    Details are provided of a program on actuarial training developed at the State University of New York (SUNY) at Binghamton through the Department of Mathematical Sciences. An outline of its operation, including a few statistics on students in the program, is included. (MP)

  9. Encephalitis treatment – a case report with long-term follow-up of EBV PCR in cerebrospinal fluid

    Directory of Open Access Journals (Sweden)

    Zarlasht F

    2017-10-01

    Full Text Available Fnu Zarlasht,1 Mashal Salehi,2 Mohammad Abu-Hishmeh,3 Muzammil Khan2 1Department of Medicine, Lourdes Hospital, Binghamton, NY, USA, 2Department of Medicine, NYC Health + Hospital/Harlem, Columbia University, NY, USA, 3Department of Medicine, Lincoln Medical and Mental Health Centre, Bronx NY, USA Background: Epstein–Barr virus (EBV has been found to cause infectious mononucleosis multiple times, but has been associated rarely with EBV encephalitis. Also, whenever it is diagnosed, it is always treated symptomatically.Case report: A case of confirmed EBV encephalitis is presented, which was treated with antiviral therapy resulting in complete clearance of the virus in cerebrospinal fluid and minimal neurologic symptoms after hospital discharge.Conclusion: The Infectious Diseases Society of America guidelines state that intravenous acyclovir is not recommended for EBV-related encephalitis. But we reviewed the literature and found similar cases, and we believe that antiviral therapy should be recommended for EBV encephalitis because it is a potentially fatal disease and if left untreated, can lead to raised intracranial pressure, craniotomy and even death. Keywords: Epstein–Barr virus, intravenous, human immune deficiency virus, HIV

  10. 78 FR 32682 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2013-05-31

    ...; asbestos, lead, & high level of radon; needs remediation Montana James F. Battin & Courthouse 316 North..., asbestos, & lead-based paint, significant renovations needed Portion of GSA Binghamton ``Hillcrest'' Depot...; total sf. 700; good to poor conditions; major renovations needed to make bldgs. ideal to occupy; lead...

  11. Languages Across the Curriculum. Translation Perspectives VII. 1994. Invited Essays on the Use of Foreign Languages throughout the Postsecondary Curriculum.

    Science.gov (United States)

    Straight, H. Stephen, Ed.

    The papers in this special issue provide both a general overview and detailed discussion of specific examples of the languages across the curriculum (LAC) movement that is currently gaining momentum in colleges and universities in the United States. Papers include: (1) "International Students as Resource Specialists: Binghamton's Languages…

  12. Service update

    Science.gov (United States)

    Zhang, Changjun

    2018-04-01

    Professor M Stanley Whittingham is a pioneering researcher in the development of lithium-ion batteries at Binghamton University and Kent Snyder leads battery research and development at Ford Motor Company. Nature Energy caught up with both during the Nature Conference on Materials Electrochemistry: Fundamentals and Applications held in China in January 2018.

  13. Transforming and enhancing metadata for enduser discovery: a case study

    Directory of Open Access Journals (Sweden)

    Edward M. Corrado

    2014-05-01

    The Libraries’ workflow and portions of code will be shared; issues and challenges involved will be discussed. While this case study is specific to Binghamton University Libraries, examples of strategies used at other institutions will also be introduced. This paper should be useful to anyone interested in describing large quantities of photographs or other materials with preexisting embedded metadata.

  14. 19 Tributes Mazrui Adem WEB 02.pmd

    African Journals Online (AJOL)

    Owner

    2014-10-20

    Oct 20, 2014 ... So, here was an Ethiopian Oromo in Japan, writing his first book, about a ... I first met Mazrui in the summer of 2002, in Binghamton, New York, when he ... 20, 2014: “Ali Mazrui, Scholar of Africa Who Divided U.S. Audiences, Dies at 81”. If ... therefore to write the following letter to The New York Times: ...

  15. Center for Autonomous Solar Power

    Science.gov (United States)

    2013-06-26

    manufactured by Corning . Corning has recently produced rolls of the glass and tested it on the Binghamton roll-to-roll line. Glass offers several...future. An example of the Willow Glass product from Corning Test fixture of bending and stretching using for coated flexible substrates for up...films Synthesized by Chemical Spray Pyrolysis for Application in Solar Cells", Ratheesh R. Thankalekshmi and A.C. Rastogi, Journal of Applied Physics

  16. Environmental conditions unexpectedly affect the long-term extent of cell death following an hypoxic episode.

    Science.gov (United States)

    Isaacson, Robert L; Fahey, Jeanne M; Mughairbi, Fadwa Al

    2003-05-01

    Previously we reported delayed cell death, defined by clear-cut cell loss 60 days after a nitrite-induced hypoxic episode. The loss of cells was not apparent two weeks after the treatment, although some changes in cellular appearance were observed at that time. A similar delayed loss of neurons in the hippocampus after hypoxia induced by blood vessel occlusion has also been found. In addition, we reported that the amount of methemoglobinemia induced by the sodium nitrite can be reduced by the stress produced by handling and the injection of saline 2 or 24 h before the nitrite administration. The degree of methemoglobin formed is directly related to cell death in certain areas of the brain, including regions within the hippocampus. Considering the many effects that can be produced by chronic and acute stress of several kinds and the length of time during which these effects manifest themselves, we undertook to determine the histologic effects of the stresses of transport on the neuroanatomic effects of sodium nitrite administration 60 days post administration. Comparisons were made of the effects of two methods of transport from the laboratory in which the animals (male CD-1 mice) were injected with the sodium nitrite or saline (Tufts Medical School) to the laboratory in which the histologic evaluations were made (Binghamton University). The animals began their travel several hours after the injections. One transport method was by commuter airline and the other was by automobile. All animals had the same transport from the supplier to the Boston location (truck). Thus, the stress of experimental interest occurred after the nitrite administration. Upon arrival at Binghamton University, the animals were housed at the University in their own colony room for 60 days before sacrifice. After sacrifice, sections from their brains were subjected to a number of histologic staining procedures, including PTAH, the Bielschowsky silver method, GFAP, and the standard Nissl

  17. Economics of access versus ownership the costs and benefits of access to scholarly articles via interlibrary loan and journal subscriptions

    CERN Document Server

    Kingma, Bruce

    2013-01-01

    The Economics of Access Versus Ownership offers library professionals a model economic analysis of providing access to journal articles through interlibrary loan as compared to library subscriptions to the journals. This model enables library directors to do an economic analysis of interlibrary loan and collection development in their own libraries and to then make cost-efficient decisions about the use of these services.This practical book's analysis and conclusions are based on 1994/95 academic year research conducted by the State University of New York libraries at Albany, Binghamton, Buffa

  18. Weathering and landscape evolution

    Science.gov (United States)

    Turkington, Alice V.; Phillips, Jonathan D.; Campbell, Sean W.

    2005-04-01

    In recognition of the fundamental control exerted by weathering on landscape evolution and topographic development, the 35th Binghamton Geomorphology Symposium was convened under the theme of Weathering and Landscape Evolution. The papers and posters presented at the conference imparted the state-of-the-art in weathering geomorphology, tackled the issue of scale linkage in geomorphic studies and offered a vehicle for interdisciplinary communication on research into weathering and landscape evolution. The papers included in this special issue are encapsulated here under the general themes of weathering mantles, weathering and relative dating, weathering and denudation, weathering processes and controls and the 'big picture'.

  19. Immanuel Wallerstein e o moderno sistema mundial

    Directory of Open Access Journals (Sweden)

    José Jobson de Andrade Arruda

    1983-12-01

    Full Text Available (primeiro parágrafo do texto Immanuel Wallerstein é diretor do Centro Fernand Braudel para o Estudo de Economias, Sistemas Históricos e Civilizacionais (Binghamton, N.Y. e editor da revista trimestral Review. Seu projeto mais amplo é a busca dos elementos determinantes do sistema mundial moderno. Para tanto, dividiu o seu trabalho em quatro partes principais, às quais con-sidera as quatro épocas fundamentais apresentadas pelo dito sistema até hoje. O primeiro volume, objeto desta resenha crítica, cobre o período de 1450 a 1640, correspondendo ao estudo das origens e condições primitivas do sistema mundial até então exclusivamente um sistema europeu. O segundo volume, já publicado, ocupar-se-ia da consolidação do sis-tema entre 1640 e 1815. O terceiro volume, referente ao período de 1815 a 1917, estará centrado na recriação do sistema decorrente das vertiginosas transformações resultantes do dinamismo tecnológico e do avanço do industrialismo no século XIX. O quarto volume cuidará da consolidação da economia — mundo capitalista, a partir de 1917 até a atualidade, e das tensões "revolucionárias" particulares que esta conso lidação tem provocado.

  20. Bio-geomorphology and resilience thinking: Common ground and challenges

    Science.gov (United States)

    Thoms, Martin C.; Meitzen, Kimberly M.; Julian, Jason P.; Butler, David R.

    2018-03-01

    Geomorphology plays a fundamental role in shaping and maintaining landscapes, as well as influencing the social and ecological systems that occupy and utilize these landscapes. In turn, social-ecological systems can have a profound influence on geomorphic forms and processes. These interactions highlight the tightly coupled nature of geomorphic systems. Over the past decade, there has been a proliferation of research at the interface of geomorphology and resilience thinking, and the 2017 Binghamton Symposium brought together leading researchers from both communities to address mutual concerns and challenges of these two disciplines. This paper reviews some of the key intersections between the disciplines of bio-geomorphology and resilience thinking, and the papers presented at the symposium. The papers in this volume illustrate the current status of the disciplines, the difficulties in bridging the disciplines, and the issues that are emerging as research priorities.

  1. 78 FR 11679 - Notice of Intent To Repatriate a Cultural Item: Binghamton University, State University of New...

    Science.gov (United States)

    2013-02-19

    ... with the appropriate Indian tribes, has determined that a cultural item meets the definition of sacred... the definition of sacred object under 25 U.S.C. 3001. This notice is published as part of the National... item described above is a specific ceremonial object needed by traditional Native American religious...

  2. Annual Symposium in Electronics Packaging

    CERN Document Server

    1991-01-01

    Each May, the Continuing Education Division of the T.J.Watson School of Engineering, Applied Science and Technology at the State University of New York at Binghamton sponsors an Annual Symposium in Electronics Packaging in cooperation with local professional societies (IEEE, ASME, SME, IEPS) and UnlPEG (the University-Industry Partnership for Economic Growth.) Each volume of this Electronics Packaging Forum series is based on the the preceding Symposium, with Volume Two based on the 1990 presentations. The Preface to Volume One included a brief definition of the broad scope of the electronics packaging field with some comments on why it has recently assumed such a more prominent priority for research and development. Those remarks will not be repeated here; at this point it is assumed that the reader is a professional in the packaging field, or possibly a student of one of the many academic disciplines which contribute to it. It is worthwhile repeating the series objectives, however, so the reader will be cle...

  3. NATO International Conference on Applied General Systems Research : Recent Developments and Trends

    CERN Document Server

    1978-01-01

    This volume consists of a selection of papers presented at the International Conference on Applied General Systems Research: Recent Developments and Trends which was held on the campus of the State University of New York at Binghamton in August 15-19, 1977, under the sponsorship of the Special Panel on Systems Science of the NATO Scientific Affairs Division. General systems research is a fairly new field which has been developing in the course of the last two or three decades. In my op~n10n, it can be best described as a movement which involves the study of all structural and context independent aspects of problem solving. As such, it is cross-disciplinary in nature and, in this sense, it might seem similar to mathematics. There is a consid­ erable difference, however, between the two. While pure mathe­ matics is basically oriented to the development of various axiomatic theories, regardless of whether or not they have any real world meaning, applied mathematics explores the applicability of some of these t...

  4. High performance low cost interconnections for flip chip attachment with electrically conductive adhesive. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-05-01

    This final report is a compilation of final reports from each of the groups participating in the program. The main three groups involved in this effort are the Thomas J. Watson Research Center of IBM Corporation in Yorktown Heights, New York, Assembly Process Design of IBM Corporation in Endicott, New York, and SMT Laboratory of Universal Instruments Corporation in Binghamton, New York. The group at the research center focused on the conductive adhesive materials development and characterization. The group in process development focused on processing of the Polymer-Metal-Solvent Paste (PMSP) to form conductive adhesive bumps, formation of the Polymer-Metal Composite (PMC) on semiconductor devices and study of the bonding process to circuitized organic carriers, and the long term durability and reliability of joints formed using the process. The group at Universal Instruments focused on development of an equipment set and bonding parameters for the equipment to produce bond assembly tooling. Reports of each of these individual groups are presented here reviewing their technical efforts and achievements.

  5. Facets of systems science

    CERN Document Server

    Klir, George J

    1991-01-01

    This book has a rather strange history. It began in Spring 1989, thirteen years after our Systems Science Department at SUNY -Binghamton was established, when I was asked by a group of students in our doctoral program to have a meeting with them. The spokesman of the group, Cliff Joslyn, opened our meeting by stating its purpose. I can closely paraphrase what he said: "We called this meeting to discuss with you, as Chairman of the Department, a fundamental problem with our systems science curriculum. In general, we consider it a good curriculum: we learn a lot of concepts, principles, and methodological tools, mathematical, computational, heuristic, which are fundamental to understanding and dealing with systems. And, yet, we learn virtually nothing about systems science itself. What is systems science? What are its historical roots? What are its aims? Where does it stand and where is it likely to go? These are pressing questions to us. After all, aren't we supposed to carry the systems science flag after we ...

  6. 49 CFR 372.235 - New York, NY.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false New York, NY. 372.235 Section 372.235... ZONES, AND TERMINAL AREAS Commercial Zones § 372.235 New York, NY. The zone adjacent to, and commercially a part of, New York, NY, within which transportation by motor vehicle, in interstate or foreign...

  7. Atmospheric Research in Ny-Aalesund. Proceedings from the Third NySMAC meeting. NILU, Kjeller, Norway, 9.-11. April 1997

    Energy Technology Data Exchange (ETDEWEB)

    Floeisand, Inga; Gernandt, Hartwig; Larsen, Elisabeth Stoltz; Stordal, Frode; Wada, Makoto

    1997-07-01

    Leading abstract. The Ny-Aalesund Seminar Series was conceived by NySMAC (Ny-Aalesund Science Managers Committee) as a means of bringing together research scientists involved in programmes running at Ny-Aalesund or having an interest in that area. The first Seminar was held in Potsdam in Germany in May 1995, and included talks which covered all current research disciplines; physical, atmospheric, earth and biological sciences. The Second Seminar was devoted to biological science and particularly to ecology. It was held in Cambridge in UK in February 1996. The subject of this Third Seminar, held in Kjeller in Norway in April 1997, is atmospheric research in Ny-Aalesund. Since the early 1980s a wide range of projects have been carried out on Svalbard and particularly at Ny-Aalesund. Prominent in this research have been several international research programmes with emphasis on topics of e.g. Arctic (Arctic Monitoring and Assessment Programme, AMAP), European (European Monitoring and Evaluation Programme, EMEP) or global (International Geosphere-Biosphere Programme, IGBP; World Climate Research Programme, WCRP) scales. Atmospheric observations have been carried out in Ny-Aalesund in Svalbard for several years. From the early 1980s, the long range transport of sulphur dioxide and sulphate aerosols leading to Arctic Haze, has been studied. As a consequence, EMEP included Ny-Aalesund in their network. In the following years the transport of ozone and chemical precursors were observed, and recently the naturally occurring phenomenon of rapid surface ozone loss has been given particular attention. From the late 1980s observations of the stratospheric ozone layer and related chemical species were undertaken, and the efforts have increased considerably since. Ny-Aalesund is now one of the primary Arctic sites of the NDSC (Network for Detection of Stratospheric Change) network. Important efforts have been undertaken to participate in the European campaigns as the European

  8. Inspiration fra NY-times

    DEFF Research Database (Denmark)

    Ejersbo, Lisser Rye

    2015-01-01

    NY-times har en ugentlig klumme med gode råd. For nogle uger siden var ugens inspiration henvendt til lærere/undervisere og drejede sig om, hvordan man skaber taletid til alle uden at have favoritter og overse de mere stille elever.......NY-times har en ugentlig klumme med gode råd. For nogle uger siden var ugens inspiration henvendt til lærere/undervisere og drejede sig om, hvordan man skaber taletid til alle uden at have favoritter og overse de mere stille elever....

  9. NY-BR-1 Antigen Expression and anti-NY-BR-1 IgG in Egyptian Breast Cancer Patients: Clinicopathological and Prognostic Significance.

    Science.gov (United States)

    Abu El-Nazar, Salma Y; Ghazy, Amany A; Ghoneim, Hossam E; Zoheir, Malak; Ahmed, Ahmed S; Sorour, Sally S; Abouelella, Amira M

    2015-01-01

    Breast cancer is the most common gynecological malignancy in the world. In Egypt, it ranks the first among female malignancies with incidence of 37.7%. Over the last decades, the integration of prognostic and predictive markers in treatment decisions has led to more individualized and optimized therapy. NY-BR-1 antigen has been shown to be frequently expressed in breast cancers. The study aimed to assess the tissue expression of NY-BR-1 antigen and serum IgG antibody to this antigen in Egyptian breast cancer females. The study was conducted on 60 females (10 healthy, 10 having benign breast lesions, 40 with malignant breast cancer). NY-BR-1 Ag expression was evaluated by immunohistochemistry and anti-NY-BR-1 IgG was assessed by ELISA. Results revealed a significant difference in NY-BR-1 Ag expression between benign and malignant breast cancer patients. There was a significant correlation between NY-BR-1 antigen expression and estrogen receptor's status (P = 0.019), stage of the disease (P = 0.008), menopausal status (P = 0.008), lymph node involvement (P = 0.022) and anti-NY-BR-1 IgG (P = 0.032) among the studied individuals. In addition, there was a statistically significant increase in anti-NY-BR-1 IgG O.D. results among malignant breast cancer group. It is correlated with tumor type (P < 0.001) and progesterone receptor status (P = 0.038). In conclusion, our work may represent a step towards identification of a new prognostic marker specific for breast cancer.

  10. Geothermal energy and district heating in Ny-Ålesund, Svalbard

    OpenAIRE

    Iversen, Julianne

    2013-01-01

    This thesis presents the possibilities for using shallow geothermal energy for heating purposes in Ny-Ålesund. The current energy supply in Ny-Ålesund is a diesel generator, which does not comply with the Norwegian government and Ny-Ålesund Science Managers Committee’s common goal to maintain the natural environment in Ny-Ålesund. Ny-Ålesund has a potential for replacing the heat from the current diesel based energy source with geothermal energy. Geothermal energy is considered to have low im...

  11. Vaccination with NY-ESO-1 overlapping peptides mixed with Picibanil OK-432 and montanide ISA-51 in patients with cancers expressing the NY-ESO-1 antigen.

    Science.gov (United States)

    Wada, Hisashi; Isobe, Midori; Kakimi, Kazuhiro; Mizote, Yu; Eikawa, Shingo; Sato, Eiichi; Takigawa, Nagio; Kiura, Katsuyuki; Tsuji, Kazuhide; Iwatsuki, Keiji; Yamasaki, Makoto; Miyata, Hiroshi; Matsushita, Hirokazu; Udono, Heiichiro; Seto, Yasuyuki; Yamada, Kazuhiro; Nishikawa, Hiroyoshi; Pan, Linda; Venhaus, Ralph; Oka, Mikio; Doki, Yuichiro; Nakayama, Eiichi

    2014-01-01

    We conducted a clinical trial of an NY-ESO-1 cancer vaccine using 4 synthetic overlapping long peptides (OLP; peptides #1, 79-108; #2, 100-129; #3, 121-150; and #4, 142-173) that include a highly immunogenic region of the NY-ESO-1 molecule. Nine patients were immunized with 0.25 mg each of three 30-mer and a 32-mer long NY-ESO-1 OLP mixed with 0.2 KE Picibanil OK-432 and 1.25 mL Montanide ISA-51. The primary endpoints of this study were safety and NY-ESO-1 immune responses. Five to 18 injections of the NY-ESO-1 OLP vaccine were well tolerated. Vaccine-related adverse events observed were fever and injection site reaction (grade 1 and 2). Two patients showed stable disease after vaccination. An NY-ESO-1-specific humoral immune response was observed in all patients and an antibody against peptide #3 (121-150) was detected firstly and strongly after vaccination. NY-ESO-1 CD4 and CD8 T-cell responses were elicited in these patients and their epitopes were identified. Using a multifunctional cytokine assay, the number of single or double cytokine-producing cells was increased in NY-ESO-1-specific CD4 and CD8 T cells after vaccination. Multiple cytokine-producing cells were observed in PD-1 (-) and PD-1 (+) CD4 T cells. In conclusion, our study indicated that the NY-ESO-1 OLP vaccine mixed with Picibanil OK-432 and Montanide ISA-51 was well tolerated and elicited NY-ESO-1-specific humoral and CD4 and CD8 T-cell responses in immunized patients.

  12. Urban metabolism in Syracuse, NY – introduction

    Science.gov (United States)

    David J. Nowak

    2016-01-01

    This special issue of Urban Ecosystems contains a series of papers related to assessing urban metabolism in Syracuse, NY. These papers were developed under the Urban Long-Term Research Area Exploratory Awards Program funded by the National Science Foundation. Objectives of this two-year project (2009–2011) in Syracuse, NY were to investigate: a)...

  13. NY-ESO-1 Based Immunotherapy of Cancer: Current Perspectives

    Directory of Open Access Journals (Sweden)

    Remy Thomas

    2018-05-01

    Full Text Available NY-ESO-1 or New York esophageal squamous cell carcinoma 1 is a well-known cancer-testis antigen (CTAs with re-expression in numerous cancer types. Its ability to elicit spontaneous humoral and cellular immune responses, together with its restricted expression pattern, have rendered it a good candidate target for cancer immunotherapy. In this review, we provide background information on NY-ESO-1 expression and function in normal and cancerous tissues. Furthermore, NY-ESO-1-specific immune responses have been observed in various cancer types; however, their utility as biomarkers are not well determined. Finally, we describe the immune-based therapeutic options targeting NY-ESO-1 that are currently in clinical trial. We will highlight the recent advancements made in NY-ESO-1 cancer vaccines, adoptive T cell therapy, and combinatorial treatment with checkpoint inhibitors and will discuss the current trends for future NY-ESO-1 based immunotherapy. Cancer treatment has been revolutionized over the last few decades with immunotherapy emerging at the forefront. Immune-based interventions have shown promising results, providing a new treatment avenue for durable clinical responses in various cancer types. The majority of successful immunotherapy studies have been reported in liquid cancers, whereas these approaches have met many challenges in solid cancers. Effective immunotherapy in solid cancers is hampered by the complex, dynamic tumor microenvironment that modulates the extent and phenotype of the antitumor immune response. Furthermore, many solid tumor-associated antigens are not private but can be found in normal somatic tissues, resulting in minor to detrimental off-target toxicities. Therefore, there is an ongoing effort to identify tumor-specific antigens to target using various immune-based modalities. CTAs are considered good candidate targets for immunotherapy as they are characterized by a restricted expression in normal somatic tissues

  14. 33 CFR 110.8 - Lake Champlain, N.Y. and Vt.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lake Champlain, N.Y. and Vt. 110... ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.8 Lake Champlain, N.Y. and Vt. (a) Ticonderoga, N.Y. An area shoreward of a line bearing 312° from Ticonderoga Light to the southeast corner of the...

  15. Ny rapport advarer

    DEFF Research Database (Denmark)

    Jex, Catherine; Seidenkrantz, Marit-Solveig; Colgan, William

    2017-01-01

    Ifølge forskerne bag en ny mellemstatslig rapport vil den globale opvarmning få endnu flere og meget drastiske konsekvenser for det arktiske klima end hidtil antaget. Men klimaaftalen fra Paris kan afværge nogle af de største forandringer efter år 2050. Hvis den bliver implementeret øjeblikkeligt...

  16. 33 CFR 110.208 - Buffalo Harbor, N.Y.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Buffalo Harbor, N.Y. 110.208 Section 110.208 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.208 Buffalo Harbor, N.Y. (a) The anchorage grounds—(1...

  17. 33 CFR 110.84b - Buffalo, N.Y.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Buffalo, N.Y. 110.84b Section 110... REGULATIONS Special Anchorage Areas § 110.84b Buffalo, N.Y. The area within the Port of Buffalo known as Port of Buffalo Small Boat Harbor commencing at a point on shore at latitude 42°51′05″ N., longitude 78°51...

  18. A phase I study of vaccination with NY-ESO-1f peptide mixed with Picibanil OK-432 and Montanide ISA-51 in patients with cancers expressing the NY-ESO-1 antigen.

    Science.gov (United States)

    Kakimi, Kazuhiro; Isobe, Midori; Uenaka, Akiko; Wada, Hisashi; Sato, Eiichi; Doki, Yuichiro; Nakajima, Jun; Seto, Yasuyuki; Yamatsuji, Tomoki; Naomoto, Yoshio; Shiraishi, Kenshiro; Takigawa, Nagio; Kiura, Katsuyuki; Tsuji, Kazuhide; Iwatsuki, Keiji; Oka, Mikio; Pan, Linda; Hoffman, Eric W; Old, Lloyd J; Nakayama, Eiichi

    2011-12-15

    We conducted a phase I clinical trial of a cancer vaccine using a 20-mer NY-ESO-1f peptide (NY-ESO-1 91-110) that includes multiple epitopes recognized by antibodies, and CD4 and CD8 T cells. Ten patients were immunized with 600 μg of NY-ESO-1f peptide mixed with 0.2 KE Picibanil OK-432 and 1.25 ml Montanide ISA-51. Primary end points of the study were safety and immune response. Subcutaneous injection of the NY-ESO-1f peptide vaccine was well tolerated. Vaccine-related adverse events observed were fever (Grade 1), injection-site reaction (Grade 1 or 2) and induration (Grade 2). Vaccination with the NY-ESO-1f peptide resulted in an increase or induction of NY-ESO-1 antibody responses in nine of ten patients. The sera reacted with recombinant NY-ESO-1 whole protein as well as the NY-ESO-1f peptide. An increase in CD4 and CD8 T cell responses was observed in nine of ten patients. Vaccine-induced CD4 and CD8 T cells responded to NY-ESO-1 91-108 in all patients with various HLA types with a less frequent response to neighboring peptides. The findings indicate that the 20-mer NY-ESO-1f peptide includes multiple epitopes recognized by CD4 and CD8 T cells with distinct specificity. Of ten patients, two with lung cancer and one with esophageal cancer showed stable disease. Our study shows that the NY-ESO-1f peptide vaccine was well tolerated and elicited humoral, CD4 and CD8 T cell responses in immunized patients. Copyright © 2011 UICC.

  19. Ny vaccine mod ledbetændelse er ikke effektiv

    DEFF Research Database (Denmark)

    Nielsen, Elisabeth Okholm; Lauritsen, Klara Tølbøll

    2013-01-01

    En ny mulighed for at vaccinere mod mykoplasma-ledbetændelse er undersøgt hos en slagtesvineproducent. Vaccinen kunne desværre ikke forebygge halthed eff ektivt.......En ny mulighed for at vaccinere mod mykoplasma-ledbetændelse er undersøgt hos en slagtesvineproducent. Vaccinen kunne desværre ikke forebygge halthed eff ektivt....

  20. 78 FR 56609 - Drawbridge Operation Regulations; Reynolds Channel, Lawrence, NY

    Science.gov (United States)

    2013-09-13

    ... Regulations; Reynolds Channel, Lawrence, NY AGENCY: Coast Guard, DHS. ACTION: Notice canceling temporary... Beach Bridge, mile 0.4, across Reynolds Channel, at Lawrence, New York. The owner of the bridge, Nassau... published a temporary deviation entitled ``Drawbridge Operation Regulations; Reynolds Channel, Lawrence, NY...

  1. 78 FR 36242 - Notice of Intent To Repatriate Cultural Items: New York State Museum, Albany, NY

    Science.gov (United States)

    2013-06-17

    ..., Rensselaer County, NY, by Reverend O.C. Auringer of Troy, NY. Museum records indicate that the cultural items..., and Saratoga Counties, NY, by Mr. Dwinel F. Thompson of Troy, NY. Museum records indicate that the... collections. From the former Laureate Grounds in Troy, Rensselaer County, NY, the 90 unassociated funerary...

  2. 33 CFR 110.87 - Henderson Harbor, N.Y.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Henderson Harbor, N.Y. 110.87... ANCHORAGE REGULATIONS Special Anchorage Areas § 110.87 Henderson Harbor, N.Y. (a) Area A. The area in the... latitude 43°51′08.8″ N, longitude 76°12′08.9″ W, thence to latitude 43°51′09.0″ N, longitude 76°12′19.0″ W...

  3. 33 CFR 110.85 - Niagara River, Youngstown, N.Y.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Niagara River, Youngstown, N.Y... ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.85 Niagara River, Youngstown, N.Y. (a) Area 1... of the Niagara River at latitude 43°14′33″ N, longitude 79°03′7.5″ W; thence westerly to a point at...

  4. NILU`s Atmospheric Research at Ny-Aalesund

    Energy Technology Data Exchange (ETDEWEB)

    Beine, H.J.

    1997-12-31

    At Ny-Aalesund, Spitsbergen, NILU is involved in many scientific projects that focus on global and regional atmospheric chemistry such as stratospheric ozone depletion, the greenhouse effect (from gases and aerosols), tropospheric ozone (in-situ production and depletion in the boundary layer), or the transport of pollutants from mid-latitudes (Arctic haze). This report presents a brief historical overview of NILU`s research activities at Ny-Aalesund since 1973. It also discusses the scientific results of the first years of operation of the Zeppelin station since 1989, and presents ongoing projects. 128 refs., 20 figs., 1 table

  5. 77 FR 22530 - Safety Zone; Fireworks, Hudson River, Rhinecliff, NY

    Science.gov (United States)

    2012-04-16

    ...-AA00 Safety Zone; Fireworks, Hudson River, Rhinecliff, NY AGENCY: Coast Guard, DHS. ACTION: Notice of... navigable waters of the Hudson River in the vicinity of Rhinecliff, NY for a fireworks display. This... fireworks displays. This rule is intended to restrict all vessels from a portion of the Hudson River before...

  6. 33 CFR 207.60 - Federal Dam, Hudson River, Troy, N.Y.; pool level.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Federal Dam, Hudson River, Troy, N.Y.; pool level. 207.60 Section 207.60 Navigation and Navigable Waters CORPS OF ENGINEERS..., N.Y.; pool level. (a) Whenever the elevation of the pool created by the Federal dam at Troy, N.Y...

  7. 33 CFR 110.150 - Block Island Sound, N.Y.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Block Island Sound, N.Y. 110.150... ANCHORAGE REGULATIONS Anchorage Grounds § 110.150 Block Island Sound, N.Y. (a) The anchorage ground. A 3/4... following coordinates: latitude 41°06′12″ N., longitude 72°00′05″ W., latitude 41°07′40″ N., longitude 72°01...

  8. 77 FR 41271 - Safety Zone; Newburgh to Beacon Swim, Newburgh, Hudson River, NY

    Science.gov (United States)

    2012-07-13

    ... 1625-AA00 Safety Zone; Newburgh to Beacon Swim, Newburgh, Hudson River, NY AGENCY: Coast Guard, DHS... navigable waters of the Hudson River, NY in the vicinity of Newburgh, NY for the annual Newburgh Beacon Swim... Beacon Swim is an annual recurring event that has a permanent safety zone found at 33 CFR 165.160. The...

  9. Ny industrialisering - et bedre produktmarked

    DEFF Research Database (Denmark)

    Beim, Anne

    2001-01-01

    for byggeriet med titlerne: 1. Bygherren som forandringsagent. 2. Tæt samarbejde i byggedelen. 3. Ny industrialisering. 4. Byg med kommunikation og innovation. Dette debathæfte er nummer tre i rækken og omhandler byggeriets industridel og mulighederne for at fremme en succesfuld industriel produktion....

  10. Increased NY-ESO-1 Expression and Reduced Infiltrating CD3+ T Cells in Cutaneous Melanoma

    Directory of Open Access Journals (Sweden)

    Mara Giavina-Bianchi

    2015-01-01

    Full Text Available NY-ESO-1 is a cancer-testis antigen aberrantly expressed in melanomas, which may serve as a robust and specific target in immunotherapy. NY-ESO-1 antigen expression, tumor features, and the immune profile of tumor infiltrating lymphocytes were assessed in primary cutaneous melanoma. NY-ESO-1 protein was detected in 20% of invasive melanomas (16/79, rarely in in situ melanoma (1/10 and not in benign nevi (0/20. Marked intratumoral heterogeneity of NY-ESO-1 protein expression was observed. NY-ESO-1 expression was associated with increased primary tumor thickness (P=0.007 and inversely correlated with superficial spreading melanoma (P<0.02. NY-ESO-1 expression was also associated with reduced numbers and density of CD3+ tumor infiltrating lymphocytes (P=0.017. When NY-ESO-1 protein was expressed, CD3+ T cells were less diffusely infiltrating the tumor and were more often arranged in small clusters (P=0.010 or as isolated cells (P=0.002 than in large clusters of more than five lymphocytes. No correlation of NY-ESO-1 expression with gender, age, tumor site, ulceration, lymph node sentinel status, or survival was observed. NY-ESO-1 expression in melanoma was associated with tumor progression, including increased tumor thickness, and with reduced tumor infiltrating lymphocytes.

  11. 33 CFR 110.156 - Randall Bay, Freeport, Long Island, N.Y.

    Science.gov (United States)

    2010-07-01

    ... Island, N.Y. 110.156 Section 110.156 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.156 Randall Bay, Freeport, Long Island, N.Y. (a) The anchorage grounds. Southward of a line 312 feet south of and parallel to the south side...

  12. Udlejers godkendelse af ny erhvervslejer

    DEFF Research Database (Denmark)

    Munk-Hansen, Carsten

    2009-01-01

    I artiklen er taget udgangspunkt i den »klassiske« afståelsessituation, hvor en lejer vil afhænde den i de lejede lokaler drevne virksomhed, og lejeren har afståelsesret til en af udlejer godkendt lejer, uden at kravene til den ny lejer er specificeret. På baggrund af Vestre Landsrets dom af 9/2 ...

  13. 76 FR 34865 - Safety Zone; Rochester Harbor Festival, Genesee River, Rochester, NY

    Science.gov (United States)

    2011-06-15

    ...-AA00 Safety Zone; Rochester Harbor Festival, Genesee River, Rochester, NY AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a temporary safety zone on the Genesee River, Rochester, NY for the Rochester Harbor Festival fireworks. This zone is intended to...

  14. EnviroAtlas - New York, NY - Block Groups

    Data.gov (United States)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset is the base layer for the New York, NY EnviroAtlas community. The block groups are from the US Census Bureau and are included/excluded based...

  15. 33 CFR 207.580 - Buffalo Harbor, N.Y.; use, administration, and navigation.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Buffalo Harbor, N.Y.; use, administration, and navigation. 207.580 Section 207.580 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.580 Buffalo Harbor, N.Y.; use...

  16. 33 CFR 162.15 - Manhasset Bay, N.Y.; seaplane restricted area.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Manhasset Bay, N.Y.; seaplane... Bay, N.Y.; seaplane restricted area. (a) The restricted area. An area in Manhasset Bay between the... line bearing 166°50′ true from latitude 40°50′17.337 N, longitude 73°43′03.877 W, which point is on the...

  17. 76 FR 20532 - Safety Zone; Boom Days, Niagara River, Niagara Falls, NY

    Science.gov (United States)

    2011-04-13

    ...-AA00 Safety Zone; Boom Days, Niagara River, Niagara Falls, NY AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a temporary safety zone on the Niagara River... Marina and a portion of the Niagara River, Niagara Falls, NY during the Boom Days Fireworks on April 16...

  18. 2008 FEMA Lidar: South Oneida County (NY)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — For Oneida County, NY, there were two types of elevation datasets. The first type is LiDAR and the second one is Auto-correlation DEM. Auto-correlation DEM data was...

  19. Strategy for monitoring T cell responses to NY-ESO-1 in patients with any HLA class I allele

    Science.gov (United States)

    Gnjatic, Sacha; Nagata, Yasuhiro; Jäger, Elke; Stockert, Elisabeth; Shankara, Srinivas; Roberts, Bruce L.; Mazzara, Gail P.; Lee, Sang Yull; Dunbar, P. Rod; Dupont, Bo; Cerundolo, Vincenzo; Ritter, Gerd; Chen, Yao-Tseng; Knuth, Alexander; Old, Lloyd J.

    2000-01-01

    NY-ESO-1 elicits frequent antibody responses in cancer patients, accompanied by strong CD8+ T cell responses against HLA-A2-restricted epitopes. To broaden the range of cancer patients who can be assessed for immunity to NY-ESO-1, a general method was devised to detect T cell reactivity independent of prior characterization of epitopes. A recombinant adenoviral vector encoding the full cDNA sequence of NY-ESO-1 was used to transduce CD8-depleted peripheral blood lymphocytes as antigen-presenting cells. These modified antigen-presenting cells were then used to restimulate memory effector cells against NY-ESO-1 from the peripheral blood of cancer patients. Specific CD8+ T cells thus sensitized were assayed on autologous B cell targets infected with a recombinant vaccinia virus encoding NY-ESO-1. Strong polyclonal responses were observed against NY-ESO-1 in antibody-positive patients, regardless of their HLA profile. Because the vectors do not cross-react immunologically, only responses to NY-ESO-1 were detected. The approach described here allows monitoring of CD8+ T cell responses to NY-ESO-1 in the context of various HLA alleles and has led to the definition of NY-ESO-1 peptides presented by HLA-Cw3 and HLA-Cw6 molecules. PMID:11005863

  20. 78 FR 35596 - Special Local Regulation; Long Beach Regatta, Powerboat Race, Atlantic Ocean, Long Beach, NY

    Science.gov (United States)

    2013-06-13

    ... 1625-AA08 Special Local Regulation; Long Beach Regatta, Powerboat Race, Atlantic Ocean, Long Beach, NY... temporary special local regulation on the navigable waters of the Atlantic Ocean off Long Beach, NY during... powerboat racing regatta. The event will be held on the Atlantic Ocean off Long Beach, NY and will feature...

  1. 33 CFR 207.50 - Hudson River Lock at Troy, N.Y.; navigation.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Hudson River Lock at Troy, N.Y..., DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.50 Hudson River Lock at Troy, N.Y.; navigation. (a...) [Reserved] (n) Trespass on U.S. property. Trespass on U.S. property, or willful injury to the banks, masonry...

  2. 76 FR 51885 - Safety Zone; Thunder on Niagara, Niagara River, North Tonawanda, NY

    Science.gov (United States)

    2011-08-19

    ... River, North Tonawanda, NY. This temporary safety zone is intended to restrict vessels from a portion of the Niagara River during the Thunder on Niagara powerboat races. This temporary safety zone is...-AA00 Safety Zone; Thunder on Niagara, Niagara River, North Tonawanda, NY AGENCY: Coast Guard, DHS...

  3. Spontaneous CD8 T cell responses against the melanocyte differentiation antigen RAB38/NY-MEL-1 in melanoma patients.

    Science.gov (United States)

    Walton, Senta M; Gerlinger, Marco; de la Rosa, Olga; Nuber, Natko; Knights, Ashley; Gati, Asma; Laumer, Monika; Strauss, Laura; Exner, Carolin; Schäfer, Niklaus; Urosevic, Mirjana; Dummer, Reinhard; Tiercy, Jean-Marie; Mackensen, Andreas; Jaeger, Elke; Lévy, Frédéric; Knuth, Alexander; Jäger, Dirk; Zippelius, Alfred

    2006-12-01

    The melanocyte differentiation Ag RAB38/NY-MEL-1 was identified by serological expression cloning (SEREX) and is expressed in the vast majority of melanoma lesions. The immunogenicity of RAB38/NY-MEL-1 has been corroborated previously by the frequent occurrence of specific Ab responses in melanoma patients. To elucidate potential CD8 T cell responses, we applied in vitro sensitization with overlapping peptides spanning the RAB38/NY-MEL-1 protein sequence and the reverse immunology approach. The identified peptide RAB38/NY-MEL-1(50-58) exhibited a marked response in ELISPOT assays after in vitro sensitization of CD8 T cells from HLA-A *0201(+) melanoma patients. In vitro digestion assays using purified proteasomes provided evidence of natural processing of RAB38/NY-MEL-1(50-58) peptide. Accordingly, monoclonal RAB38/NY-MEL-1(50-58)-specific T cell populations were capable of specifically recognizing HLA-A2(+) melanoma cell lines expressing RAB38/NY-MEL-1. Applying fluorescent HLA-A2/RAB38/NY-MEL-1(50-58) multimeric constructs, we were able to document a spontaneously developed memory/effector CD8 T cell response against this peptide in a melanoma patient. To elucidate the Ag-processing pathway, we demonstrate that RAB38/NY-MEL-1(50-58) is produced efficiently by the standard proteasome and the immunoproteasome. In addition to the identification of a RAB38/NY-MEL-1-derived immunogenic CD8 T cell epitope, this study is instrumental for both the onset and monitoring of future RAB38/NY-MEL-1-based vaccination trials.

  4. 33 CFR 207.600 - Rochester (Charlotte) Harbor, N.Y.; use, administration, and navigation.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Rochester (Charlotte) Harbor, N.Y.; use, administration, and navigation. 207.600 Section 207.600 Navigation and Navigable Waters CORPS OF... (Charlotte) Harbor, N.Y.; use, administration, and navigation. (a)-(b) [Reserved] (c) No vessel shall moor or...

  5. 77 FR 39406 - Safety Zone; Tom Graves Memorial Fireworks, Port Bay, Wolcott, NY

    Science.gov (United States)

    2012-07-03

    ...-AA00 Safety Zone; Tom Graves Memorial Fireworks, Port Bay, Wolcott, NY AGENCY: Coast Guard, DHS. ACTION..., NY. This safety zone is intended to restrict vessels from a portion of Port Bay during the Tom Graves... necessary to ensure the safety of spectators and vessels during the Tom Graves Memorial Fireworks. This zone...

  6. In silico SNP analysis of the breast cancer antigen NY-BR-1.

    Science.gov (United States)

    Kosaloglu, Zeynep; Bitzer, Julia; Halama, Niels; Huang, Zhiqin; Zapatka, Marc; Schneeweiss, Andreas; Jäger, Dirk; Zörnig, Inka

    2016-11-18

    Breast cancer is one of the most common malignancies with increasing incidences every year and a leading cause of death among women. Although early stage breast cancer can be effectively treated, there are limited numbers of treatment options available for patients with advanced and metastatic disease. The novel breast cancer associated antigen NY-BR-1 was identified by SEREX analysis and is expressed in the majority (>70%) of breast tumors as well as metastases, in normal breast tissue, in testis and occasionally in prostate tissue. The biological function and regulation of NY-BR-1 is up to date unknown. We performed an in silico analysis on the genetic variations of the NY-BR-1 gene using data available in public SNP databases and the tools SIFT, Polyphen and Provean to find possible functional SNPs. Additionally, we considered the allele frequency of the found damaging SNPs and also analyzed data from an in-house sequencing project of 55 breast cancer samples for recurring SNPs, recorded in dbSNP. Over 2800 SNPs are recorded in the dbSNP and NHLBI ESP databases for the NY-BR-1 gene. Of these, 65 (2.07%) are synonymous SNPs, 191 (6.09%) are non-synoymous SNPs, and 2430 (77.48%) are noncoding intronic SNPs. As a result, 69 non-synoymous SNPs were predicted to be damaging by at least two, and 16 SNPs were predicted as damaging by all three of the used tools. The SNPs rs200639888, rs367841401 and rs377750885 were categorized as highly damaging by all three tools. Eight damaging SNPs are located in the ankyrin repeat domain (ANK), a domain known for its frequent involvement in protein-protein interactions. No distinctive features could be observed in the allele frequency of the analyzed SNPs. Considering these results we expect to gain more insights into the variations of the NY-BR-1 gene and their possible impact on giving rise to splice variants and therefore influence the function of NY-BR-1 in healthy tissue as well as in breast cancer.

  7. 33 CFR 207.590 - Black Rock Canal and Lock at Buffalo, N.Y.; use, administration, and navigation.

    Science.gov (United States)

    2010-07-01

    ... Buffalo, N.Y.; use, administration, and navigation. 207.590 Section 207.590 Navigation and Navigable... Black Rock Canal and Lock at Buffalo, N.Y.; use, administration, and navigation. (a) The term “canal... immediately to the Black Rock Lock, foot of Bridge Street, Buffalo, N.Y., telephone 876-5454. (k) Ferry Street...

  8. Ejendomsordbogen fransk/dansk: ny integreret e-ordbog

    DEFF Research Database (Denmark)

    Leroyer, Patrick; Hansen, Liselotte Kruse

    2012-01-01

    fusionere med en praktisk guide. Til dette formål har vi udviklet konceptet til en ny type hybridordbog, der kan tilfredsstille de intenderede brugeres informationsbehov i kommunikative, kognitive og praktiske situationer. Udviklingen er sket i samarbejde med den førende udbyder af online ordbøger i Danmark...

  9. 75 FR 13454 - Special Local Regulation, Fran Schnarr Open Water Championships, Huntington Bay, NY

    Science.gov (United States)

    2010-03-22

    ...-AA08 Special Local Regulation, Fran Schnarr Open Water Championships, Huntington Bay, NY AGENCY: Coast... navigable waters of Huntington Bay, New York due to the annual Fran Schnarr Open Water Championships. The..., ``Special Local Regulation, Fran Schnarr Open Water Championships, Huntington Bay, NY'' (Docket number USCG...

  10. 75 FR 38710 - Special Local Regulation, Fran Schnarr Open Water Championships, Huntington Bay, NY

    Science.gov (United States)

    2010-07-06

    ...-AA08 Special Local Regulation, Fran Schnarr Open Water Championships, Huntington Bay, NY AGENCY: Coast... Regulation on the navigable waters of Huntington Bay, New York due to the annual Fran Schnarr Open Water... ``Special Local Regulation, Fran Schnarr Open Water Championships, Huntington Bay, NY'' in the Federal...

  11. Kapitalismens dna i ny oversættelse

    DEFF Research Database (Denmark)

    Schanz, Hans-Jørgen

    2013-01-01

    Adam Smiths klassiske storværk om kapitalismen ’Nationernes velstand’ havde stor indflydelse på socialfilosofien, på Hegel, på Marx og liberaløkonomerne. Ny oversættelse yder omsider værket fuld respekt på dansk. Anmeldelse af: Adam Smith: Nationernes velstand. 441+ 519 sider. 699,95 kr...

  12. Identification of NY-BR-1-specific CD4(+) T cell epitopes using HLA-transgenic mice.

    Science.gov (United States)

    Gardyan, Adriane; Osen, Wolfram; Zörnig, Inka; Podola, Lilli; Agarwal, Maria; Aulmann, Sebastian; Ruggiero, Eliana; Schmidt, Manfred; Halama, Niels; Leuchs, Barbara; von Kalle, Christof; Beckhove, Philipp; Schneeweiss, Andreas; Jäger, Dirk; Eichmüller, Stefan B

    2015-06-01

    Breast cancer represents the second most common cancer type worldwide and has remained the leading cause of cancer-related deaths among women. The differentiation antigen NY-BR-1 appears overexpressed in invasive mammary carcinomas compared to healthy breast tissue, thus representing a promising target antigen for T cell based tumor immunotherapy approaches. Since efficient immune attack of tumors depends on the activity of tumor antigen-specific CD4(+) effector T cells, NY-BR-1 was screened for the presence of HLA-restricted CD4(+) T cell epitopes that could be included in immunological treatment approaches. Upon NY-BR-1-specific DNA immunization of HLA-transgenic mice and functional ex vivo analysis, a panel of NY-BR-1-derived library peptides was determined that specifically stimulated IFNγ secretion among splenocytes of immunized mice. Following in silico analyses, four candidate epitopes were determined which were successfully used for peptide immunization to establish NY-BR-1-specific, HLA-DRB1*0301- or HLA-DRB1*0401-restricted CD4(+) T cell lines from splenocytes of peptide immunized HLA-transgenic mice. Notably, all four CD4(+) T cell lines recognized human HLA-DR-matched dendritic cells (DC) pulsed with lysates of NY-BR-1 expressing human tumor cells, demonstrating natural processing of these epitopes also within the human system. Finally, CD4(+) T cells specific for all four CD4(+) T cell epitopes were detectable among PBMC of breast cancer patients, showing that CD4(+) T cell responses against the new epitopes are not deleted nor inactivated by self-tolerance mechanisms. Our results present the first NY-BR-1-specific HLA-DRB1*0301- and HLA-DRB1*0401-restricted T cell epitopes that could be exploited for therapeutic intervention against breast cancer. © 2014 UICC.

  13. A novel murine T-cell receptor targeting NY-ESO-1.

    Science.gov (United States)

    Rosati, Shannon F; Parkhurst, Maria R; Hong, Young; Zheng, Zhili; Feldman, Steven A; Rao, Mahadev; Abate-Daga, Daniel; Beard, Rachel E; Xu, Hui; Black, Mary A; Robbins, Paul F; Schrump, David A; Rosenberg, Steven A; Morgan, Richard A

    2014-04-01

    Cancer testis antigens, such as NY-ESO-1, are expressed in a variety of prevalent tumors and represent potential targets for T-cell receptor (TCR) gene therapy. DNA encoding a murine anti-NY-ESO-1 TCR gene (mTCR) was isolated from immunized HLA-A*0201 transgenic mice and inserted into a γ-retroviral vector. Two mTCR vectors were produced and used to transduce human PBL. Transduced cells were cocultured with tumor target cell lines and T2 cells pulsed with the NY-ESO-1 peptide, and assayed for cytokine release and cell lysis activity. The most active TCR construct was selected for production of a master cell bank for clinical use. mTCR-transduced PBL maintained TCR expression in short-term and long-term culture, ranging from 50% to 90% efficiency 7-11 days after stimulation and 46%-82% 10-20 days after restimulation. High levels of interferon-γ secretion were observed (1000-12000 pg/mL), in tumor coculture assays and recognition of peptide-pulsed cells was observed at 0.1 ng/mL, suggesting that the new mTCR had high avidity for antigen recognition. mTCR-transduced T cells also specifically lysed human tumor targets. In all assays, the mTCR was equivalent or better than the comparable human TCR. As the functional activity of TCR-transduced cells may be affected by the formation of mixed dimers, mTCRs, which are less likely to form mixed dimers with endogenous hTCRs, may be more effective in vivo. This new mTCR targeted to NY-ESO-1 represents a novel potential therapeutic option for adoptive cell-transfer therapy for a variety of malignancies.

  14. From single-site tantalum complexes to nanoparticles of TaxNy and TaOxNy supported on silica: elucidation of synthesis chemistry by dynamic nuclear polarization surface enhanced NMR spectroscopy and X-ray absorption spectroscopy

    KAUST Repository

    Mohandas, Janet Chakkamadathil; Abou-Hamad, Edy; Callens, Emmanuel; Samantaray, Manoja; Gajan, David; Gurinov, Andrei; Ma, Tao; Ould-Chikh, Samy; Hoffman, Adam S.; Gates, Bruce C.; Basset, Jean-Marie

    2017-01-01

    Air-stable catalysts consisting of tantalum nitride nanoparticles represented as a mixture of TaxNy and TaOxNy with diameters in the range of 0.5 to 3 nm supported on highly dehydroxylated silica were synthesized from TaMe5 (Me = methyl) and dimeric

  15. 33 CFR 165.166 - Safety Zone: Macy's July 4th Fireworks, East River, NY.

    Science.gov (United States)

    2010-07-01

    ... Fireworks, East River, NY. 165.166 Section 165.166 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... § 165.166 Safety Zone: Macy's July 4th Fireworks, East River, NY. (a) Regulated area. The following area...) in length, carrying persons for the purpose of viewing the fireworks, may take position in an area...

  16. Cancer testis antigens and NY-BR-1 expression in primary breast cancer: prognostic and therapeutic implications.

    Science.gov (United States)

    Balafoutas, Dimitrios; zur Hausen, Axel; Mayer, Sebastian; Hirschfeld, Marc; Jaeger, Markus; Denschlag, Dominik; Gitsch, Gerald; Jungbluth, Achim; Stickeler, Elmar

    2013-06-03

    Cancer-testis antigens (CTA) comprise a family of proteins, which are physiologically expressed in adult human tissues solely in testicular germ cells and occasionally placenta. However, CTA expression has been reported in various malignancies. CTAs have been identified by their ability to elicit autologous cellular and or serological immune responses, and are considered potential targets for cancer immunotherapy. The breast differentiation antigen NY-BR-1, expressed specifically in normal and malignant breast tissue, has also immunogenic properties. Here we evaluated the expression patterns of CTAs and NY-BR-1 in breast cancer in correlation to clinico-pathological parameters in order to determine their possible impact as prognostic factors. The reactivity pattern of various mAbs (6C1, MA454, M3H67, 57B, E978, GAGE #26 and NY-BR-1 #5) were assessed by immunohistochemistry in a tissue micro array series of 210 randomly selected primary invasive breast cancers in order to study the diversity of different CTAs (e.g. MAGE-A, NY-ESO-1, GAGE) and NY-BR-1. These expression data were correlated to clinico-pathological parameters and outcome data including disease-free and overall survival. Expression of at least one CTA was detectable in the cytoplasm of tumor cells in 37.2% of the cases. NY-BR-1 expression was found in 46.6% of tumors, respectively. Overall, CTA expression seemed to be linked to adverse prognosis and M3H67 immunoreactivity specifically was significantly correlated to shorter overall and disease-free survival (p=0.000 and 0.024, respectively). Our findings suggest that M3H67 immunoreactivity could serve as potential prognostic marker in primary breast cancer patients. The exclusive expression of CTAs in tumor tissues as well as the frequent expression of NY-BR-1 could define new targets for specific breast cancer therapies.

  17. 33 CFR 162.20 - Flushing Bay near La Guardia Airport, Flushing, N.Y.; restricted area.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Flushing Bay near La Guardia Airport, Flushing, N.Y.; restricted area. 162.20 Section 162.20 Navigation and Navigable Waters COAST... NAVIGATION REGULATIONS § 162.20 Flushing Bay near La Guardia Airport, Flushing, N.Y.; restricted area. (a...

  18. Interoperability of Demand Response Resources Demonstration in NY

    Energy Technology Data Exchange (ETDEWEB)

    Wellington, Andre

    2014-03-31

    The Interoperability of Demand Response Resources Demonstration in NY (Interoperability Project) was awarded to Con Edison in 2009. The objective of the project was to develop and demonstrate methodologies to enhance the ability of customer sited Demand Response resources to integrate more effectively with electric delivery companies and regional transmission organizations.

  19. Evaluering af ny kokkeuddannelse for hørehandicappede

    DEFF Research Database (Denmark)

    Hansen, Niels-Henrik Møller

    2010-01-01

    Center for Ungdomsforskning har netop afsluttet en evaluering af en ny uddannelse indenfor madproduktion, rettet imod personer med et hørehandicap. Hensigten med uddannelsen er, at kunne tilbyde døve, døvblinde og hørehæmmede personer et uddannelsestilbud indenfor fremstilling af mad. Konkret han...

  20. 78 FR 24677 - Safety Zone; XA The Experimental Agency Fireworks, Pier 34, East River, NY

    Science.gov (United States)

    2013-04-26

    ... Final Rule This rule establishes a temporary safety zone on the navigable waters of the East River, in... Fireworks, Pier 34, East River, NY. (a) Regulated Area. The following area is a temporary safety zone: all... 1625-AA00 Safety Zone; XA The Experimental Agency Fireworks, Pier 34, East River, NY AGENCY: Coast...

  1. 33 CFR 110.84 - Black Rock Channel opposite foot of Porter Avenue, Buffalo, N.Y.

    Science.gov (United States)

    2010-07-01

    ... of Porter Avenue, Buffalo, N.Y. 110.84 Section 110.84 Navigation and Navigable Waters COAST GUARD... Channel opposite foot of Porter Avenue, Buffalo, N.Y. An area extending northwesterly between Black Rock... Triangulation Marker “N-5” on Bird Island Pier; thence southeasterly along the pier a distance of approximately...

  2. 75 FR 36110 - Notice of Inventory Completion: New York University College of Dentistry, New York, NY

    Science.gov (United States)

    2010-06-24

    ... University College of Dentistry, New York, NY AGENCY: National Park Service, Interior. ACTION: Notice. Notice... the New York University College of Dentistry, New York, NY. The human remains were removed from... College of Dentistry professional staff in consultation with representatives of the Alabama-Quassarte...

  3. Persistent deNOx Ability of CaAl2O4:(Eu, Nd/TiO2-xNy Luminescent Photocatalyst

    Directory of Open Access Journals (Sweden)

    Li Huihui

    2011-01-01

    Full Text Available Abstract CaAl2O4:(Eu, Nd/TiO2-xNy composite luminescent photocatalyst was successfully synthesized by a simple planetary ball milling process. Improvement of photocatalytic deNOx ability of TiO2-xNy, together with the persistent photocatalytic activity for the decomposition of NO after turning off the light were realized, by coupling TiO2-xNy with long afterglow phosphor, CaAl2O4:(Eu, Nd. The novel persistent photocatalytic behavior was related to the overlap between the absorption wavelength of TiO2-xNy and the emission wavelength of the CaAl2O4:(Eu, Nd. It was found that CaAl2O4:(Eu, Nd/TiO2-xNy composites provided the luminescence to persist photocatalytic reaction for more than 3 h after turning off the light. Graphical Abstract CaAl2O4:(Eu, Nd/TiO2-xNy composite luminescent photocatalyst with persistent deNOx activity after turning off the light was successfully synthesized by a simple planetary ball milling process. The novel persistent photocatalytic behavior was related to the overlap between the absorption wavelength of TiO2-xNy and the emission wavelength of the CaAl2O4:(Eu, Nd. Additional file 1 Click here for file

  4. 75 FR 52021 - Notice of Inventory Completion: New York University College of Dentistry, New York, NY

    Science.gov (United States)

    2010-08-24

    ... University College of Dentistry, New York, NY AGENCY: National Park Service, Interior. ACTION: Notice. Notice... University College of Dentistry, New York, NY. The human remains were removed from Port Clarence, Nome County... the human remains was made by New York University College of Dentistry professional staff in...

  5. 75 FR 33327 - Notice of Inventory Completion: New York University College of Dentistry, New York, NY

    Science.gov (United States)

    2010-06-11

    ... University College of Dentistry, New York, NY AGENCY: National Park Service, Interior. ACTION: Notice. Notice... the New York University College of Dentistry, New York, NY. The human remains were removed from the... College of Dentistry professional staff in consultation with representatives of the Caddo Nation of...

  6. Treatment with 5-Aza-2'-Deoxycytidine Induces Expression of NY-ESO-1 and Facilitates Cytotoxic T Lymphocyte-Mediated Tumor Cell Killing.

    Directory of Open Access Journals (Sweden)

    Agnes S Klar

    Full Text Available NY-ESO-1 belongs to the cancer/testis antigen (CTA family and represents an attractive target for cancer immunotherapy. Its expression is induced in a variety of solid tumors via DNA demethylation of the promoter of CpG islands. However, NY-ESO-1 expression is usually very low or absent in some tumors such as breast cancer or multiple myeloma. Therefore, we established an optimized in vitro treatment protocol for up-regulation of NY-ESO-1 expression by tumor cells using the hypomethylating agent 5-aza-2'-deoxycytidine (DAC.We demonstrated de novo induction of NY-ESO-1 in MCF7 breast cancer cells and significantly increased expression in U266 multiple myeloma cells. This effect was time- and dose-dependent with the highest expression of NY-ESO-1 mRNA achieved by the incubation of 10 μM DAC for 72 hours. NY-ESO-1 activation was also confirmed at the protein level as shown by Western blot, flow cytometry, and immunofluorescence staining. The detection and quantification of single NY-ESO-1 peptides presented at the tumor cell surface in the context of HLA-A*0201 molecules revealed an increase of 100% and 50% for MCF7 and U266 cells, respectively. Moreover, the enhanced expression of NY-ESO-1 derived peptides at the cell surface was accompanied by an increased specific lysis of MCF7 and U266 cells by HLA-A*0201/NY-ESO-1(157-165 peptide specific chimeric antigen receptor (CAR CD8+ T cells. In addition, the killing activity of CAR T cells correlated with the secretion of higher IFN-gamma levels.These results indicate that NY-ESO-1 directed immunotherapy with specific CAR T cells might benefit from concomitant DAC treatment.

  7. 75 FR 33329 - Notice of Inventory Completion: New York University College of Dentistry, New York, NY

    Science.gov (United States)

    2010-06-11

    ... University College of Dentistry, New York, NY AGENCY: National Park Service, Interior. ACTION: Notice. Notice... the New York University College of Dentistry, New York, NY. The human remains were removed from.... A detailed assessment of the human remains was made by the New York University College of Dentistry...

  8. Den fjerde vej: Trumps sejr skaber ny samfundsorden

    DEFF Research Database (Denmark)

    Rasmussen, Martin Møller Boje; Andersen, Torben K.; Kragh, Claus

    2016-01-01

    Bag Donald Trumps uempatiske retorik gemmer sig omridset af et politisk projekt, man kan kalde den fjerde vej. USA’s kommende præsident blander højre- og venstreorienterede mærkesager til et nyt nationalsocialt politisk koncept. Spørgsmålet er, om Trumps fjerde vej er et seriøst bud på en ny...

  9. Isolation of a halophilic bacterium, Bacillus sp. strain NY-6 for organic contaminants removal in saline wastewater on ship

    Science.gov (United States)

    Gao, Jie; Yu, Zhenjiang; Zhang, Xiaohui; Zhao, Dan; Zhao, Fangbo

    2013-06-01

    The objective of this research was to examine if certain strains of Bacillus bacteria, could survive in dry powder products and if so, could the bacteria degrade organic contaminants in saline wastewater on a ship. As part of the study, we isolated 7 domesticated strains named NY1, NY2,..., and NY7, the strain NY6 showed to have the best performance for organic matter degradation and could survive in dry powder more than 3 months. NY6 was identified as Bacillus aerius, based on the morphological and physic-chemical properties. Its optimal growth conditions were as follows: salinity was 2%; temperature was 37°C; pH was in 6.5-7.0; best ratio of C: N: P was 100:5:1. The capability of its dry powder for Chemical Oxygen Demand (COD) removal was 800mg COD/g in synthesized marine wastewater with 2% salinity. The spores in the dry powder were 1.972×108 g -1.

  10. 77 FR 42510 - Notice of Inventory Completion: New York University College of Dentistry, New York, NY; Correction

    Science.gov (United States)

    2012-07-19

    ... Inventory Completion: New York University College of Dentistry, New York, NY; Correction AGENCY: National... of human remains under the control of the New York University College of Dentistry, New York, NY. The... Dentistry professional staff in consultation with representatives of the Delaware Nation of Oklahoma...

  11. Ny forskning: Derfor virker ros ikke mod stress

    DEFF Research Database (Denmark)

    Pedersen, Pernille

    2015-01-01

    Ny forskning peger på, at stressede medarbejdere overhører din ros og anerkendelse, hvis de føler skam. Skam over ikke at kunne slå til på arbejdet. Vil du hjælpe en stresset medarbejder, skal du forebygge, at de føler sig skamfulde. Læs her anbefalinger til, hvordan du bedst hjælper din stressed...

  12. Evaluating Effectiveness of Modeling Motion System Feedback in the Enhanced Hess Structural Model of the Human Operator

    Science.gov (United States)

    Zaychik, Kirill; Cardullo, Frank; George, Gary; Kelly, Lon C.

    2009-01-01

    In order to use the Hess Structural Model to predict the need for certain cueing systems, George and Cardullo significantly expanded it by adding motion feedback to the model and incorporating models of the motion system dynamics, motion cueing algorithm and a vestibular system. This paper proposes a methodology to evaluate effectiveness of these innovations by performing a comparison analysis of the model performance with and without the expanded motion feedback. The proposed methodology is composed of two stages. The first stage involves fine-tuning parameters of the original Hess structural model in order to match the actual control behavior recorded during the experiments at NASA Visual Motion Simulator (VMS) facility. The parameter tuning procedure utilizes a new automated parameter identification technique, which was developed at the Man-Machine Systems Lab at SUNY Binghamton. In the second stage of the proposed methodology, an expanded motion feedback is added to the structural model. The resulting performance of the model is then compared to that of the original one. As proposed by Hess, metrics to evaluate the performance of the models include comparison against the crossover models standards imposed on the crossover frequency and phase margin of the overall man-machine system. Preliminary results indicate the advantage of having the model of the motion system and motion cueing incorporated into the model of the human operator. It is also demonstrated that the crossover frequency and the phase margin of the expanded model are well within the limits imposed by the crossover model.

  13. Preferential expression of NY-BR-1 and GATA-3 in male breast cancer.

    Science.gov (United States)

    Biserni, Giovanni Battista; Di Oto, Enrico; Moskovszky, Linda Eszter; Foschini, Maria Pia; Varga, Zsuzsanna

    2018-02-01

    Male breast cancer is an uncommon disease often discovered in advanced stage; thus, in the setting of metastatic adenocarcinoma, breast origin must be taken to account. Breast markers as NY-BR-1, GATA-3, mammaglobin, and BRST-2 are established tools for labelling primary and metastatic female breast cancer; however, none of them has been sufficiently studied in male breast cancer. The aim of this study was to analyze the expression of these markers in male breast cancer. Thirty consecutive cases of male breast cancer and eight loco-regional metastases were re-revaluated, assembled in tissue micro array (TMA), and stained with immunohistochemistry (IHC) for NY-BR-1, GATA-3, mammaglobin, and BRST-2. The IHC stains were scored either positive or negative. In addition, concordant expression patterns of primary tumors and matched metastasis were noted. 30 of 30 (100%) primary tumors and 8 of 8 (100%) metastases were positive for NY-BR-1. 30 of 30 (100%) primary tumors and 6 of 8 (75%) metastases were positive for GATA-3. 22 of 30 (73.3%) primary tumors and 6 of 8 (75%) metastases were positive for Mammaglobin. 18 of 30 (60%) primary tumors and 5 of 8 (62.5%) metastases were positive for BRST-2. Differences in staining percentage were not significant with Fisher's exact test. We found a high sensitivity for all the markers analyzed. Moreover, the expression of NY-BR-1 and GATA-3 seemed the most effective for labelling male breast cancer in primary and metastatic setting.

  14. Værktøjskasse til Agil Stage-Gate®: Ny model for udviklingsprojekter i mellemstore virksomheder

    DEFF Research Database (Denmark)

    Vedsmand, Tomas; Edwards, Kasper; Hvidt, Nicoline

    Denne værktøjskasse er et tillæg for guiden Agil Stage-Gate: Ny model for udviklingsprojekter i mellemstore virksomheder. (http://dx.doi.org/10.11581/DTU:00000028)......Denne værktøjskasse er et tillæg for guiden Agil Stage-Gate: Ny model for udviklingsprojekter i mellemstore virksomheder. (http://dx.doi.org/10.11581/DTU:00000028)...

  15. Immunohistochemical assessment of NY-ESO-1 expression in esophageal adenocarcinoma resection specimens.

    Science.gov (United States)

    Hayes, Stephen J; Hng, Keng Ngee; Clark, Peter; Thistlethwaite, Fiona; Hawkins, Robert E; Ang, Yeng

    2014-04-14

    To assess NY-ESO-1 expression in a cohort of esophageal adenocarcinomas. A retrospective search of our tissue archive for esophageal resection specimens containing esophageal adenocarcinoma was performed, for cases which had previously been reported for diagnostic purposes, using the systematised nomenclature of human and veterinary medicine coding system. Original haematoxylin and eosin stained sections were reviewed, using light microscopy, to confirm classification and tumour differentiation. A total of 27 adenocarcinoma resection specimens were then assessed using immunohistochemistry for NY-ESO-1 expression: 4 well differentiated, 14 moderately differentiated, 4 moderate-poorly differentiated, and 5 poorly differentiated. Four out of a total of 27 cases of esophageal adenocarcinoma examined (15%) displayed diffuse cytoplasmic and nuclear expression for NY-ESO-1. They displayed a heterogeneous and mosaic-type pattern of diffuse staining. Diffuse cytoplasmic staining was not identified in any of these structures: stroma, normal squamous epithelium, normal submucosal gland and duct, Barrett's esophagus (goblet cell), Barrett's esophagus (non-goblet cell) and high grade glandular dysplasia. All adenocarcinomas showed an unexpected dot-type pattern of staining at nuclear, paranuclear and cytoplasmic locations. Similar dot-type staining, with varying frequency and size of dots, was observed on examination of Barrett's metaplasia, esophageal submucosal gland acini and the large bowel negative control, predominantly at the crypt base. Furthermore, a prominent pattern of apical (luminal) cytoplasmic dot-type staining was observed in some cases of Barrett's metaplasia and also adenocarcinoma. A further morphological finding of interest was noted on examination of haematoxylin and eosin stained sections, as aggregates of lymphocytes were consistently noted to surround submucosal glands. We have demonstrated for the first time NY-ESO-1 expression by esophageal

  16. NOAA Office for Coastal Management Benthic Habitat Data, Long Island Sound, Jamaica Bay, and Lower Bay of NY/NJ Harbor, NY, 1994-2002 (NODC Accession 0089467)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — These data are a collection of benthic habitat data from studies conducted in the coastal Long Island Sound, NY region in GIS shapefile (.shp, .dbf, .shx, and .prj...

  17. 78 FR 62293 - Safety Zone, Oyster Festival 30th Anniversary Fireworks Display, Oyster Bay; Oyster Bay, NY

    Science.gov (United States)

    2013-10-15

    ... Safety Zone, Oyster Festival 30th Anniversary Fireworks Display, Oyster Bay; Oyster Bay, NY AGENCY: Coast... zone on the navigable waters of Oyster Bay near Oyster Bay, NY for the Oyster Festival 30th Anniversary... Oyster Festival 30th Anniversary Fireworks Display is scheduled for October 19, 2013 and is one of...

  18. From single-site tantalum complexes to nanoparticles of TaxNy and TaOxNy supported on silica: elucidation of synthesis chemistry by dynamic nuclear polarization surface enhanced NMR spectroscopy and X-ray absorption spectroscopy

    KAUST Repository

    Mohandas, Janet Chakkamadathil

    2017-06-08

    Air-stable catalysts consisting of tantalum nitride nanoparticles represented as a mixture of TaxNy and TaOxNy with diameters in the range of 0.5 to 3 nm supported on highly dehydroxylated silica were synthesized from TaMe5 (Me = methyl) and dimeric Ta-2(OMe)(10) with guidance by the principles of surface organometallic chemistry (SOMC). Characterization of the supported precursors and the supported nanoparticles formed from them was carried out by IR, NMR, UV-Vis, extended X-ray absorption fine structure, and X-ray photoelectron spectroscopies complemented with XRD and high-resolution TEM, with dynamic nuclear polarization surface enhanced NMR spectroscopy being especially helpful by providing enhanced intensities of the signals of H-1, C-13, Si-29, and N-15 at their natural abundances. The characterization data provide details of the synthesis chemistry, including evidence of (a) O-2 insertion into Ta-CH3 species on the support and (b) a binuclear to mononuclear transformation of species formed from Ta-2(OMe)(10) on the support. A catalytic test reaction, cyclooctene epoxidation, was used to probe the supported nanoparticles, with 30% H2O2 serving as the oxidant. The catalysts gave selectivities up to 98% for the epoxide at conversions as high as 99% with a 3.4 wt% loading of Ta present as TaxNy/TaOxNy.

  19. 78 FR 66265 - Drawbridge Operation Regulations; Reynolds Channel, Lawrence, NY

    Science.gov (United States)

    2013-11-05

    ... Regulations; Reynolds Channel, Lawrence, NY AGENCY: Coast Guard, DHS. ACTION: Notice of temporary deviation... from the regulations governing the operation of the Atlantic Beach Bridge, mile 0.4, across Reynolds.... SUPPLEMENTARY INFORMATION: The Atlantic Beach Bridge, across Reynolds Channel, mile 0.4, at Lawrence, New York...

  20. 78 FR 37456 - Drawbridge Operation Regulations; Reynolds Channel, Nassau, NY

    Science.gov (United States)

    2013-06-21

    ... Regulations; Reynolds Channel, Nassau, NY AGENCY: Coast Guard, DHS. ACTION: Notice of temporary deviation from... regulation governing the operation of the Long Beach Bridge, mile 4.7, across Reynolds Channel at Nassau, New... July 1, 2013. Reynolds Creek has commercial and recreational vessel traffic. No objections were...

  1. 78 FR 56610 - Drawbridge Operation Regulations; Reynolds Channel, Lawrence, NY

    Science.gov (United States)

    2013-09-13

    ... Regulations; Reynolds Channel, Lawrence, NY AGENCY: Coast Guard, DHS. ACTION: Notice of temporary deviation... from the regulations governing the operation of the Atlantic Beach Bridge, mile 0.4, across Reynolds.... SUPPLEMENTARY INFORMATION: The Atlantic Beach Bridge, across Reynolds Channel, mile 0.4, at Lawrence, New York...

  2. Factors Influencing Divergent Patterns of Phosphorus Availability in NY and PA Biogeochemical `Hotspots'

    Science.gov (United States)

    Saia, S. M.; Hofmeister, K.; Regan, J. M.; Buda, A. R.; Carrick, H. J.; Walter, M. T.

    2016-12-01

    Anthropogenic alteration of the soil phosphorus (P) cycle leads to subsequent water quality issues in agricultural dominated watersheds. In the humid Northeastern United States (NE US), variably saturated areas can generate surface runoff that transports P and stimulates biogeochemical processes; these hydrologically dynamic locations are often called biogeochemical `hotspots'. Many studies have evaluated nitrogen and carbon cycling in biogeochemical hot spots but few have focused on P. We hypothesized seasonally wet parts of the landscape (i.e., hotspots) have smaller biologically available P pools because runoff events frequently carry away nutrients like P. To test this hypothesis, we generated soil wetness index (SWI) maps from soil (SURRGO) and elevation (LiDAR rescaled to 3 m) data and used these maps to direct seasonal soil sampling near Klingerstown, Pennsylvania (PA) and Ithaca, New York (NY). We collected 5cm deep soil samples in PA (bimonthly) and NY (monthly) along soil moisture gradients for a range of land cover types (forest, fallow, and cropped) from May through October. We measured soil moisture in the field and percent organic matter (OM), pH, and three increasingly strong soil P extractions (dilute-salt-extractable P, oxalate-extractable P, and total-extractable P) in the laboratory. Our results indicated a negative relationship between dilute-salt-extractable P concentrations and SWI in PA and no relationship between these same variables in NY. We also found positive relationships between each of the three P extractions in PA but only a positive relationship between oxalate-extractable P and total-extractable P in NY. Our findings in PA support our hypothesis; namely, less biologically available P (i.e. dilute-salt-extractable P) is found in wetter areas of the landscape. However, divergent P availability patterns in NY point to further complexities and confounding variables in our understanding in soil P processes. Further studies will look

  3. Research Article. A new gravity laboratory in Ny-Ålesund, Svalbard

    Directory of Open Access Journals (Sweden)

    Breili K.

    2017-02-01

    Full Text Available The Norwegian Mapping Authority (NMA has recently established a new gravity laboratory in Ny-Ålesund at Svalbard, Norway. The laboratory consists of three independent pillars and is part of the geodetic core station that is presently under construction at Brandal, approximately 1.5 km north of NMA’s old station. In anticipation of future use of the new gravity laboratory, we present benchmark gravity values, gravity gradients, and final coordinates of all new pillars. Test measurements indicate a higher noise level at Brandal compared to the old station. The increased noise level is attributed to higher sensitivity to wind.We have also investigated possible consequences of moving to Brandal when it comes to the gravitational signal of present-day ice mass changes and ocean tide loading. Plausible models representing ice mass changes at the Svalbard archipelago indicate that the gravitational signal at Brandal may differ from that at the old site with a size detectable with modern gravimeters. Users of gravity data from Ny-Ålesund should, therefore, be cautious if future observations from the new observatory are used to extend the existing gravity record. Due to its lower elevation, Brandal is significantly less sensitive to gravitational ocean tide loading. In the future, Brandal will be the prime site for gravimetry in Ny-Ålesund. This ensures gravity measurements collocated with space geodetic techniques like VLBI, SLR, and GNSS.

  4. 77 FR 37316 - Drawbridge Operation Regulations; Reynolds Channel, Nassau, NY

    Science.gov (United States)

    2012-06-21

    ... Regulations; Reynolds Channel, Nassau, NY AGENCY: Coast Guard, DHS. ACTION: Notice of temporary deviation from... regulations governing the operation of the Long Beach Bridge, mile 4.7, across Reynolds Channel, at Nassau...: The Long Beach Bridge, across Reynolds Channel, mile 4.7, at Nassau, New York, has a vertical...

  5. 78 FR 26508 - Drawbridge Operation Regulations; Reynolds Channel, Nassau, NY

    Science.gov (United States)

    2013-05-07

    ... Regulations; Reynolds Channel, Nassau, NY AGENCY: Coast Guard, DHS. ACTION: Notice of temporary deviation from... regulation governing the operation of the Long Beach Bridge, mile 4.7, across Reynolds Channel at Nassau, New.... on July 12, 2013. Reynolds Creek has commercial and recreational vessel traffic. No objections were...

  6. 78 FR 34893 - Drawbridge Operation Regulations; Reynolds Channel, Lawrence, NY

    Science.gov (United States)

    2013-06-11

    ... Regulations; Reynolds Channel, Lawrence, NY AGENCY: Coast Guard, DHS. ACTION: Notice of temporary deviation... from the regulations governing the operation of the Atlantic Beach Bridge, mile 0.4, across Reynolds... Reynolds Channel, mile 0.4, at Lawrence, New York, has a vertical clearance in the closed position of 25...

  7. Measurement of serum antibodies against NY-ESO-1 by ELISA: A guide for the treatment of specific immunotherapy for patients with advanced colorectal cancer.

    Science.gov (United States)

    Long, Yan-Yan; Wang, Yu; Huang, Qian-Rong; Zheng, Guang-Shun; Jiao, Shun-Chang

    2014-10-01

    NY-ESO-1 has been identified as one of the most immunogenic antigens; thus, is a highly attractive target for cancer immunotherapy. The present study analyzed the expression of serum antibodies (Abs) against NY-ESO-1 in patients with advanced colorectal cancer (CRC), with the aim of guiding the treatment of NY-ESO-1-based specific-immunotherapy for these patients. Furthermore, the present study was the first to evaluate the kinetic expression of anti-NY-ESO-1 Abs and investigate the possible influencing factors. A total of 239 serum samples from 155 pathologically confirmed patients with advanced CRC (stages III and IV) were collected. The presence of spontaneous Abs against NY-ESO-1 was analyzed using an enzyme-linked immunosorbent assay (ELISA). The results demonstrated that 24.5% (38/155) of the investigated patients were positive for NY-ESO-1-specific Abs. No statistically significant correlations were identified between the expression of anti-NY-ESO-1 Abs and clinicopathological parameters, including age and gender, location, grading, local infiltration, lymph node status, metastatic status and K-ras mutation status (P>0.05). In 59 patients, the kinetic expression of anti-NY-ESO-1 Abs was analyzed, of which 14 patients were initially positive and 45 patients were initially negative. Notably, 16/59 (27.1%) patients changed their expression status during the study period, and the initially positive patients were more likely to change compared with the initially negative patients (85.7 vs. 8.8%; Pguide the treatment of NY-ESO-1-based specific immunotherapy for patients with advanced CRC.

  8. Sjøforsvaret i ny drakt

    DEFF Research Database (Denmark)

    Vestvik, Marit; Bjerck, Mari

    Denne rapporten formidler resultater fra undersøkelser som er gjort på to av Sjøforsvarets fartøy i 2010 og 2011, som omfatter utprøving av ny niformsmodell for utendørs bruk. Undersøkelsene er en del av forskningsprosjektet Uni-Form: Arbeidsbekledning for kvinner i mannsdominerte yrker. I...... prosjektet utvikles arbeidsklær for Sjøforsvarets personell som har bedre funksjonalitet og komfort enn eksisterende uniformer. En målsetning er å bedre trivselen for personellet gjennom å utvikle forbedrete uniformbekledning. At uniformsbekledningen er tilfredsstillende i funksjonalitet, passform og...... tilpasset snitt for kvinner. Dette gjelder også Forsvarets uniformer....

  9. Recombinant Lactobacillus plantarum induces immune responses to cancer testis antigen NY-ESO-1 and maturation of dendritic cells

    Science.gov (United States)

    Mobergslien, Anne; Vasovic, Vlada; Mathiesen, Geir; Fredriksen, Lasse; Westby, Phuong; Eijsink, Vincent GH; Peng, Qian; Sioud, Mouldy

    2015-01-01

    Given their safe use in humans and inherent adjuvanticity, Lactic Acid Bacteria may offer several advantages over other mucosal delivery strategies for cancer vaccines. The objective of this study is to evaluate the immune responses in mice after oral immunization with Lactobacillus (L) plantarum WCFS1 expressing a cell-wall anchored tumor antigen NY-ESO-1. And to investigate the immunostimulatory potency of this new candidate vaccine on human dendritic cells (DCs). L. plantarum displaying NY-ESO-1 induced NY-ESO-1 specific antibodies and T-cell responses in mice. By contrast, L. plantarum displaying conserved proteins such as heat shock protein-27 and galectin-1, did not induce immunity, suggesting that immune tolerance to self-proteins cannot be broken by oral administration of L. plantarum. With respect to immunomodulation, immature DCs incubated with wild type or L. plantarum-NY-ESO-1 upregulated the expression of co-stimulatory molecules and secreted a large amount of interleukin (IL)-12, TNF-α, but not IL-4. Moreover, they upregulated the expression of immunosuppressive factors such as IL-10 and indoleamine 2,3-dioxygenase. Although L. plantarum-matured DCs expressed inhibitory molecules, they stimulated allogeneic T cells in-vitro. Collectively, the data indicate that L. plantarum-NY-ESO-1 can evoke antigen-specific immunity upon oral administration and induce DC maturation, raising the potential of its use in cancer immunotherapies. PMID:26185907

  10. NOAA Digital Orthophotography for the Coasts of Connecticut and Long Island, NY

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Project: NOAA Digital Orthophotography for the Coasts of Main/New Hampshire, Massachusetts/Rhode Island/Connecticut, and Hudson River/Long Island /NY/NJ Contract No....

  11. 76 FR 4078 - Television Broadcasting Services; North Pole and Plattsburgh, NY

    Science.gov (United States)

    2011-01-24

    ... FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 [DA 10-2443; MM Docket No. 99-238; RM-9669] Television Broadcasting Services; North Pole and Plattsburgh, NY AGENCY: Federal Communications Commission... CFR Part 73 Television, Television broadcasting. For the reasons discussed in the preamble, the...

  12. Physical and Chemical Properties of TiOxNy Prepared by Low-Temperature Oxidation of Ultrathin Metal Nitride Directly Deposited on SiO2

    Institute of Scientific and Technical Information of China (English)

    HAN Yue-Ping; HAN Yan

    2009-01-01

    Physical and chemical properties of titanium oxynitride (TiOxNy) formed by low-temperature oxidation of titanium nitride (TIN) layer are investigated for advanced metal-oxide--semiconductor (MOS) gate dielectric application.TiOx Ny exhibits polycrystalline properties after the standard thermal process for MOS device fabrication,showing the preferred orientation at [200].Superior electrical properties of TiOxNy can be maintained before and after the annealing,probably due to the nitrogen incorporation in the oxide bulk and at the interface.Naturally formed transition layer between TiOxNy and SiO2 is also confirmed.

  13. AlGaN/GaN High Electron Mobility Transistors with Multi-MgxNy/GaN Buffer

    OpenAIRE

    Chang, P. C.; Lee, K. H.; Wang, Z. H.; Chang, S. J.

    2014-01-01

    We report the fabrication of AlGaN/GaN high electron mobility transistors with multi-MgxNy/GaN buffer. Compared with conventional HEMT devices with a low-temperature GaN buffer, smaller gate and source-drain leakage current could be achieved with this new buffer design. Consequently, the electron mobility was larger for the proposed device due to the reduction of defect density and the corresponding improvement of crystalline quality as result of using the multi-MgxNy/GaN buffer.

  14. Afprøvning af ny feedbackpraksis på UCN Pædagoguddannelsen

    DEFF Research Database (Denmark)

    Andersen, Eva; Rasmussen, Anna Ørnemose; Stenderup, Mogens Larsen

    2017-01-01

    I forbindelse med implementering af ny pædagoguddannelse (BEK nr 354 af 07/04/2017) har pædagoguddannelsens ledernetværk igangsat flere nationale sektorprojekter herunder projekt Feedbackformer i en kompetencestyret uddannelse. Alle projekternes formål er at understøtte udvikling og implementering...

  15. 76 FR 60733 - Drawbridge Operation Regulations; Narrow Bay, Smith Point, NY

    Science.gov (United States)

    2011-09-30

    ... Operation Regulations; Narrow Bay, Smith Point, NY AGENCY: Coast Guard, DHS. ACTION: Notice of temporary... deviation from the regulation governing the operation of the Smith Point Bridge, 6.1, across Narrow Bay, between Smith Point and Fire Island, New York. The deviation is necessary to facilitate bridge...

  16. 77 FR 30451 - Safety Zone; Olcott Fireworks, Lake Ontario, Olcott, NY

    Science.gov (United States)

    2012-05-23

    ... Lake Ontario, Olcott, NY. This proposed rule is intended to restrict vessels from a portion of Lake Ontario during the Olcott fireworks display. The safety zone established by this proposed rule is necessary to protect spectators, participants, and vessels from the hazards associated with firework display...

  17. 33 CFR 207.610 - St. Lawrence River, Cape Vincent Harbor, N.Y.; use, administration, and navigation of the harbor...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false St. Lawrence River, Cape Vincent Harbor, N.Y.; use, administration, and navigation of the harbor and U.S. breakwater. 207.610 Section 207... NAVIGATION REGULATIONS § 207.610 St. Lawrence River, Cape Vincent Harbor, N.Y.; use, administration, and...

  18. Climatology and time series of surface meteorology in Ny-Ålesund, Svalbard

    Directory of Open Access Journals (Sweden)

    M. Maturilli

    2013-04-01

    Full Text Available A consistent meteorological dataset of the Arctic site Ny-Ålesund (11.9° E, 78.9° N spanning the 18 yr-period 1 August 1993 to 31 July 2011 is presented. Instrumentation and data handling of temperature, humidity, wind and pressure measurements are described in detail. Monthly mean values are shown for all years to illustrate the interannual variability of the different parameters. Climatological mean values are given for temperature, humidity and pressure. From the climatological dataset, we also present the time series of annual mean temperature and humidity, revealing a temperature increase of +1.35 K per decade and an increase in water vapor mixing ratio of +0.22 g kg−1 per decade for the given time period, respectively. With the continuation of the presented measurements, the Ny-Ålesund high resolution time series will provide a reliable source to monitor Arctic change and retrieve trends in the future. The relevant data are provided in high temporal resolution as averages over 5 (1 min before (after 14 July 1998, respectively, placed on the PANGAEA repository (doi:10.1594/PANGAEA.793046. While 6 hourly synoptic observations in Ny-Ålesund by the Norwegian Meteorological Institute reach back to 1974 (Førland et al., 2011, the meteorological data presented here cover a shorter time period, but their high temporal resolution will be of value for atmospheric process studies on shorter time scales.

  19. 75 FR 42608 - Safety Zone; Lyme Community Days, Chaumont Bay, NY

    Science.gov (United States)

    2010-07-22

    ...-AA00 Safety Zone; Lyme Community Days, Chaumont Bay, NY AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a temporary safety zone for Lyme Community Days Fireworks on Chaumont Bay, Lyme, New York. All vessels are prohibited from transiting the zone except as...

  20. Contribution of Cultural Eutrophication to Marsh Loss in Jamaica Bay (NY)

    Science.gov (United States)

    Loss of salt marsh area in the Jamaica Bay Estuary (NY) has accelerated in recent years, with loss rates as high as 45 acres per year. A contributing factor to this acceleration is likely cultural eutrophication due to over 6 decades of sewage effluent inputs. We examined marsh...

  1. AlGaN/GaN High Electron Mobility Transistors with Multi-MgxNy/GaN Buffer

    Directory of Open Access Journals (Sweden)

    P. C. Chang

    2014-01-01

    Full Text Available We report the fabrication of AlGaN/GaN high electron mobility transistors with multi-MgxNy/GaN buffer. Compared with conventional HEMT devices with a low-temperature GaN buffer, smaller gate and source-drain leakage current could be achieved with this new buffer design. Consequently, the electron mobility was larger for the proposed device due to the reduction of defect density and the corresponding improvement of crystalline quality as result of using the multi-MgxNy/GaN buffer.

  2. EnviroAtlas - New York, NY - Meter-Scale Urban Land Cover (MULC) Data (2008)

    Data.gov (United States)

    U.S. Environmental Protection Agency — The New York, NY EnviroAtlas Meter-scale Urban Land Cover (MULC) Data were generated by the University of Vermont Spatial Analysis Laboratory (SAL) under the...

  3. 78 FR 23845 - Drawbridge Operation Regulations; Narrow Bay, Smith Point, NY

    Science.gov (United States)

    2013-04-23

    ... Operation Regulations; Narrow Bay, Smith Point, NY AGENCY: Coast Guard, DHS. ACTION: Notice of temporary... deviation from the regulation governing the operation of the Smith Point Bridge, mile 6.1, across Narrow Bay, between Smith Point and Fire Island, New York. The deviation is necessary to facilitate the Smith Point...

  4. Decadal Climate Change in Ny-Ålesund, Svalbard, A Representative Area of the Arctic

    Directory of Open Access Journals (Sweden)

    Minghu Ding

    2018-04-01

    Full Text Available In recent decades, global warming hiatus/slowdown has attracted considerable attention and has been strongly debated. Many studies suggested that the Arctic is undergoing rapid warming and significantly contributes to a continual global warming trend rather than a hiatus. In this study, we evaluated the climate changes of Ny-Ålesund, Svalbard, a representative location of the northern North Atlantic sector of the Arctic, based on observational records from 1975–2014. The results showed that the annual warming rate was four times higher than the global mean (+0.76 °C·decade−1 and was also much greater than Arctic average. Additionally, the warming trend of Ny-Ålesund started to slow down since 2005–2006, and our estimates showed that there is a 8–9 years-lagged, but significant, correlation between records of Ny-Ålesund and global HadCRUT4 datasets. This finding indicates that the Arctic was likely experiencing a hiatus pattern, which just appeared later than the low-mid latitudes due to transport processes of atmospheric circulations and ocean currents, heat storage effect of cryospheric components, multidecadal variability of Arctic cyclone activities, etc. This case study provides a new perspective on the global warming hiatus/slowdown debate.

  5. Analysis of GAGE, NY-ESO-1 and SP17 cancer/testis antigen expression in early stage non-small cell lung carcinoma

    International Nuclear Information System (INIS)

    Gjerstorff, Morten F; Pøhl, Mette; Olsen, Karen E; Ditzel, Henrik J

    2013-01-01

    The unique expression pattern and immunogenic properties of cancer/testis antigens make them ideal targets for immunotherapy of cancer. The MAGE-A3 cancer/testis antigen is frequently expressed in non-small cell lung cancer (NSCLC) and vaccination with MAGE-A3 in patients with MAGE-A3-positive NSCLC has shown promising results. However, little is known about the expression of other cancer/testis antigens in NSCLC. In the present study the expression of cancer/testis antigens GAGE, NY-ESO-1 and SP17 was investigated in patients with completely resected, early stage, primary NSCLC. Tumor biopsies from normal lung tissue and from a large cohort (n = 169) of NSCLC patients were examined for GAGE, NY-ESO-1 and SP17 protein expression by immunohistochemical analysis. The expression of these antigens was further matched to clinical and pathological features using univariate cox regression analysis. GAGE and NY-ESO-1 cancer/testis antigens were not expressed in normal lung tissue, while SP17 was expressed in ciliated lung epithelia. The frequency of GAGE, NY-ESO-1 and SP17 expression in NSCLC tumors were 26.0% (44/169), 11.8% (20/169) and 4.7% (8/169), respectively, and 33.1% (56/169) of the tumors expressed at least one of these antigens. In general, the expression of GAGE, NY-ESO-1 and SP17 was not significantly associated with a specific histotype (adenocarcinoma vs. squamous cell carcinoma), but high-level GAGE expression (>50%) was more frequent in squamous cell carcinoma (p = 0.02). Furthermore, the frequency of GAGE expression was demonstrated to be significantly higher in stage II-IIIa than stage I NSCLC (17.0% vs. 35.8%; p = 0.02). Analysis of the relation between tumor expression of GAGE and NY-ESO-1 and survival endpoints revealed no significant associations. Our study demonstrates that GAGE, NY-ESO-1 and SP17 cancer/testis antigens are candidate targets for immunotherapy of NSCLC and further suggest that multi-antigen vaccines may be beneficial

  6. A mutation in the envelope protein fusion loop attenuates mouse neuroinvasiveness of the NY99 strain of West Nile virus

    International Nuclear Information System (INIS)

    Zhang Shuliu; Li Li; Woodson, Sara E.; Huang, Claire Y.-H.; Kinney, Richard M.; Barrett, Alan D.T.; Beasley, David W.C.

    2006-01-01

    Substitutions were engineered individually and in combinations at the fusion loop, receptor-binding domain and a stem-helix structure of the envelope protein of a West Nile virus strain, NY99, and their effects on mouse virulence and presentation of epitopes recognized by monoclonal antibodies (MAbs) were assessed. A single substitution within the fusion loop (L107F) attenuated mouse neuroinvasiveness of NY99. No substitutions attenuated NY99 neurovirulence. The L107F mutation also abolished binding of a non-neutralizing MAb, 3D9, whose epitope had not been previously identified. MAb 3D9 was subsequently shown to be broadly cross-reactive with other flaviviruses, consistent with binding near the highly conserved fusion loop

  7. 77 FR 60901 - Safety Zone; Battle of Queenston Heights Bicentennial, Niagara River, Lewiston, NY

    Science.gov (United States)

    2012-10-05

    ..., Docket Operations, telephone 202-366-9826. SUPPLEMENTARY INFORMATION: Table of Acronyms DHS Department of... Lower Niagara River near the Silo Restaurant, Lewiston, NY. The Captain of the Port Buffalo has...

  8. Ny krigsførelse i informationsalderen? Om ‘Revolution in Military Affairs’ og Irakkrigen

    Directory of Open Access Journals (Sweden)

    Jens Claus Hansen

    2005-09-01

    Full Text Available Artiklen diskuterer, hvorvidt man efter Golfkrigen kan tale om en ‘Revolu- tion in Military Affairs’ – RMA – som nogle amerikanske krigsteoretikere hævder har fundet sted med anvendelsen af ny teknologi i moderne krigs- førelse. Forfatteren viser, hvordan moderne krigsstrategier har inkorpore- ret ny teknologi og mediebrug som bl.a. informationskrig, ‘Systems of Sys- tems’ og Network Centric Warfare. Forfatteren påpeger, at den strategiske anvendelse af informationsoperationer – herunder ‘embedded’ journalister – ikke har medført en demokratisering af nyhedsdækningen og heller ikke indebærer en øget sandhedsværdi. Afslutningsvis peger forfatteren på behovet for en ‘Revolution in Diplomatic Affairs’.

  9. Prompt Gamma Activation Analysis of the Nyírlugos obsidian core depot find

    Directory of Open Access Journals (Sweden)

    Zsolt Kasztovszky

    2014-03-01

    Full Text Available The Nyírlugos obsidian core depot find is one of the most important lithic assemblages in the collection of the Hungarian National Museum (HNM. The original set comprised 12 giant obsidian cores, of which 11 are currently on the permanent archaeological exhibition of the HNM. One of the cores is known to be inDebrecen. The first publication attributed the hoard, on the strength of giant (flint blades known from the Early and Middle Copper Age Tiszapolgár and Bodrogkeresztúr cultures, to the Copper Age. In the light of recent finds it is more likely to belong to the Middle Neolithic period. The source area was defined as Tokaj Mts., about100 kmto the NW from Nyírlugos. The size and beauty of the exceptional pieces exclude any invasive analysis. Using Prompt Gamma Activation Analysis (PGAA, we can measure major chemical components and some key trace elements of stone artefacts with adequate accuracy to successfully determine provenance of obsidian. Recent methodological development also facilitated the study of relatively large objects like the Nyírlugos cores. The cores were individually measured by PGAA. The results show that the cores originate from the Carpathian 1 sources, most probably the Viničky variety (C1b. The study of the hoard as a batch is an important contribution to the assessment of prehistoric trade and allows us to reconsider the so-called Carpathian, especially Carpathian 1 (Slovakian sources.

  10. En ny vej at gå for udsatte unge i USA

    DEFF Research Database (Denmark)

    Petersen, Karen Bjerg; Andersen, Frans Ørsted

    2018-01-01

    kommet forslag om en ny ungdomsuddannelse, der skal kunne løse nogle af problemerne. Samtidig er der stigende mangel på arbejdskraft indenfor det teknisk-naturvidenskabelige-IT- og håndværks-mæssige område. Et område, som i USA ofte omtales som STEM, dvs. Science, Technology, Engineering, Math. I denne...

  11. Agil Stage-Gate®: ny model for udviklingsprojekter i mellemstore virksomheder

    DEFF Research Database (Denmark)

    Vedsmand, Tomas; Edwards, Kasper; Hvidt, Nicoline

    Lær at udvikle nye produkter hurtigere og med større træfsikkerhed – ved at arbejde i sprint med agile metoder og træffe de rigtige beslutninger med Stage-Gate® Se også tilhørende: "Værktøjskasse til Agil Stage-Gate®: Ny model for udviklingsprojekter i mellemstore virksomheder" på http://dx.doi.org...

  12. Dynamics of snow-air mercury exchange at Ny Ålesund during springtime 2011

    Directory of Open Access Journals (Sweden)

    Manca G.

    2013-04-01

    Full Text Available Continuous time series of flux measurements were carried out in Ny Ålesund, Spitsbergen, during a springtime field campaign from 31 of March to 3 of May, 2011. Flux measurements were integrated with mercury speciation analysis in order to understand the fate of mercury during atmospheric elemental gaseous mercury depletion events (AMDEs. Moreover a methodology for quality assurance of flux measurements is presented. Measurements were made at Gruvebadet, 1 km west from the Ny-Ålesund village (78˚55' N, 11˚56' E at an elevation of 18 m above sea level. Ambient concentrations of gaseous elemental mercury, divalent reactive gaseous mercury and particulate phase mercury were semicontinuously measured using an integrated Tekran system. Mercury depletion events were observed during the month of April and were characterized by an incomplete mercury destruction. Indeed Hg0 concentration was never below 0.49 ng m−3.

  13. 78 FR 35756 - Drawbridge Operation Regulations; Harlem River, New York City, NY

    Science.gov (United States)

    2013-06-14

    ... Regulations; Harlem River, New York City, NY AGENCY: Coast Guard, DHS. ACTION: Notice of temporary deviation... from the regulation governing the operation of the Willis Avenue Bridge across the Harlem River, mile 1... found at 33 CFR 117.789(b)(2). The bridge owner, New York City Department of Transportation, requested a...

  14. 78 FR 50102 - Notice of Inventory Completion: Rochester Museum & Science Center, Rochester, NY

    Science.gov (United States)

    2013-08-16

    .... 3003, of the completion of an inventory of associated funerary objects under the control of the....R50000] Notice of Inventory Completion: Rochester Museum & Science Center, Rochester, NY AGENCY: National... inventory of associated funerary objects, in consultation with the appropriate Indian tribes or Native...

  15. Duration of US residence is associated with overweight risk in Filipino immigrants living in NY metro area

    Science.gov (United States)

    Afable, Aimee; Ursua, Rhodora; Wyatt, Laura C.; Aguilar, David; Kwon, Simona C.; Islam, Nadia S.; Trinh-Shevrin, Chau

    2015-01-01

    We examined the association between years living in the US and overweight risk among a community sample of Filipino adult immigrants living in the New York (NY) metropolitan area. We found a significant and adverse association between years living in the US and overweight risk. Compared to Filipinos who lived in the US less than 5 years, those who lived in the US 10 years or longer had a higher overweight risk; this association was only present among Filipinos who migrated to NY metropolitan area at 30 years or younger. Studies on causal mechanisms explaining this pattern are needed. PMID:26605951

  16. 76 FR 3516 - Drawbridge Operation Regulations; Harlem River, New York City, NY

    Science.gov (United States)

    2011-01-20

    ... Operation Regulations; Harlem River, New York City, NY AGENCY: Coast Guard, DHS. ACTION: Notice of temporary..., across the Harlem River, New York City, New York. The deviation is necessary to facilitate bridge... River at mile 0.0 has a vertical clearance in the closed position of 55 feet at mean high water and 60...

  17. 76 FR 40234 - Drawbridge Operation Regulations; Harlem River, New York City, NY

    Science.gov (United States)

    2011-07-08

    ...-AA09 Drawbridge Operation Regulations; Harlem River, New York City, NY AGENCY: Coast Guard, DHS. ACTION... at mile 0.0, across the Harlem River at New York City, New York. This interim rule is necessary to... The 103rd Street (Wards Island) Pedestrian Bridge, across the Harlem River, mile 0.0, at New York City...

  18. 78 FR 34582 - Safety Zone; Rochester Yacht Club Fireworks, Genesee River, Rochester, NY

    Science.gov (United States)

    2013-06-10

    ... 1625-AA00 Safety Zone; Rochester Yacht Club Fireworks, Genesee River, Rochester, NY AGENCY: Coast Guard... the Genesee River during the Rochester Yacht Club fireworks display. This temporary safety zone is... necessary to ensure the safety of spectators and vessels during the Rochester Yacht Club fireworks display...

  19. Modelling dune erosion, overwash and breaching at Fire Island (NY) during hurricane Sandy

    NARCIS (Netherlands)

    De Vet, P.L.M.; McCall, R.T.; Den Bieman, J.P.; Stive, M.J.F.; Van Ormondt, M.

    2015-01-01

    In 2012, Hurricane Sandy caused a breach at Fire Island (NY, USA), near Pelican Island. This paper aims at modelling dune erosion, overwash and breaching processes that occured during the hurricane event at this stretch of coast with the numerical model XBeach. By using the default settings, the

  20. Boulder Food Rescue: An Innovative Approach to Reducing Food Waste and Increasing Food Security.

    Science.gov (United States)

    Sewald, Craig A; Kuo, Elena S; Dansky, Hana

    2018-05-01

    Food waste and food insecurity are both significant issues in communities throughout the U.S., including Boulder, Colorado. As much as 40% of the food produced in the U.S. goes uneaten and ends up in landfills. Nearly 13% of people in the Boulder region experience some level of food insecurity. Founded in 2011, Boulder Food Rescue supports community members to create their own food security through a participatory approach to an emergency food system. The organization uses a web-application "robot" to manage a schedule of volunteers. They coordinate with individuals at low-income senior housing sites, individual housing sites, family housing sites, after-school programs, and pre-schools to set up no-cost grocery programs stocked with food from local markets and grocers that would otherwise go to waste. Each site coordinator makes decisions about how, when, and where food delivery and distribution will occur. The program also conducts robust, real-time data collection and analysis. Boulder Food Rescue is a member and manager of the Food Rescue Alliance, and its model has been replicated and adapted by other cities, including Denver, Colorado Springs, Seattle, Jackson Hole, Minneapolis, Binghamton, and in the Philippines. Information for this special article was collected through key informant interviews with current and former Boulder Food Rescue staff and document review of Boulder Food Rescue materials. Boulder Food Rescue's open source software is available to other communities; to date, 40 cities have used the tool to start their own food rescue organizations. Boulder Food Rescue hopes to continue spreading this model to other cities that are considering ways to reduce food waste and increase food security. This article is part of a supplement entitled Building Thriving Communities Through Comprehensive Community Health Initiatives, which is sponsored by Kaiser Permanente, Community Health. Copyright © 2018 American Journal of Preventive Medicine. Published by

  1. PENGARUH KOMPRES DINGIN TERHADAP PENURUNAN NYERI PERSALINAN KALA I FASE AKTIF DI BPS NY. MUJIYATI KABUPATEN LAMONGAN

    Directory of Open Access Journals (Sweden)

    Lilin Turlina

    2016-03-01

    Full Text Available The aim of research to determine the effect of cold pack on the decrese of pain childbirth at 1 active phase. The study design used Pre-Eksperiment Pratest-Postes Design. The population in this research where all women who give birth in BPS Ny.Mujiyati, Amd.Keb. Sample taken by simple random sampling. Data taken by observasion and analyzed using Wilcoxon Sign Rank Test significance 0,05. The result showed that cold pack was influence on the decrase of pain childbirth at 1 active phase in BPS Ny.Mujiyati, Amd.Keb. Joto Sanur village, Tikung SubDistrict, Lamongan District, year 2013.Keywords: cold pack, painful childbirth reduction

  2. 78 FR 31454 - Drawbridge Operation Regulation; Hudson River, Troy and Green Island, NY

    Science.gov (United States)

    2013-05-24

    ...-AA09 Drawbridge Operation Regulation; Hudson River, Troy and Green Island, NY AGENCY: Coast Guard, DHS... that governs the highway bridge (Troy Green Island) across the Hudson River, mile 152.7, between Troy... the regulations for the 112th Street Bridge, mile 155.4, between Troy and Cohoes which has been...

  3. Designprocesser og arbejdsmiljø: Udvikling af ny teknologi til fødevareindustrien

    DEFF Research Database (Denmark)

    Broberg, Ole

    1999-01-01

    Dette papir handler om muligheder og betingelser for at inddrage arbejdsmiljøhensyn i designprocesser. Baggrunden for det er, at jeg har haft mulighed for at følge udviklingen af en ny maskine til fødevareindustrien næsten lige fra de grundlæggende idéer blev udviklet og foreløbig frem til i dag,...

  4. 78 FR 56607 - Drawbridge Operation Regulation; Hudson River, Troy and Green Island, NY

    Science.gov (United States)

    2013-09-13

    ...-AA09 Drawbridge Operation Regulation; Hudson River, Troy and Green Island, NY AGENCY: Coast Guard, DHS... operation of the highway bridge across the Hudson River, mile 152.7, between Troy and Green Island, New York... Street Bridge, mile 155.4, between Troy and Cohoes which has been converted to a fixed bridge. It is...

  5. 78 FR 74009 - Safety Zone; Nike Fireworks, Upper New York Bay, Ellis Island, NY

    Science.gov (United States)

    2013-12-10

    ... DEPARTMENT OF HOMELAND SECURITY Coast Guard 33 CFR Part 165 [Docket No. USCG-2013-0962] Safety Zone; Nike Fireworks, Upper New York Bay, Ellis Island, NY AGENCY: Coast Guard, DHS. ACTION: Notice of... published in the Federal Register on November 9, 2011 (76 FR 69614). [[Page 74010

  6. Morte e ironia em “A exposição das rosas”, de István Örkény

    Directory of Open Access Journals (Sweden)

    Leonardo Francisco Soares

    2009-03-01

    Full Text Available Estudo da narrativa “A exposição das rosas”, de István Örkény, examinando o tema da morte e a problematização de sua representação. Nascido em 1912 e falecido em 1979, Örkény testemunhou de forma intensa e intrínseca as grandes convulsões que abalaram a Europa no século 20. Longe do panfleto, sua literatura tem como traço marcante a ironia. Na novela analisada, Iron Korom, um jovem e inexperiente diretor, tenta realizar um documentário sobre as horas finais de três pacientes desenganados, com o intuito de, nas suas palavras, ajudar os seus contemporâneos a compreenderem a experiência da morte. A partir do projeto de Korom, o texto de Örkény coloca-­nos diante de um confim: o limite da representação.

  7. 77 FR 52058 - Notice of Inventory Completion: Longyear Museum of Anthropology, Colgate University, Hamilton, NY

    Science.gov (United States)

    2012-08-28

    ... Inventory Completion: Longyear Museum of Anthropology, Colgate University, Hamilton, NY AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The Longyear Museum of Anthropology has completed an... cultural affiliation with the human remains should contact the Longyear Museum of Anthropology at the...

  8. 77 FR 43167 - Safety Zone; Electric Zoo Fireworks, East River, Randall's Island, NY

    Science.gov (United States)

    2012-07-24

    ... establishes a temporary safety zone on the waters of the East River in the vicinity of Randall's Island, NY.... This temporary safety zone will restrict vessels from a portion of the East River around the location... area is a temporary safety zone: all navigable waters of the East River within a 164-yard radius of the...

  9. 77 FR 42642 - Safety Zone; City of Ogdensburg Fireworks, St. Lawrence River, Ogdensburg, NY

    Science.gov (United States)

    2012-07-20

    ...-AA00 Safety Zone; City of Ogdensburg Fireworks, St. Lawrence River, Ogdensburg, NY AGENCY: Coast Guard... portion of the St. Lawrence River during the City of Ogdensburg Fireworks display. This temporary safety... as follows: Sec. 165.T09-0608 Safety Zone; City of Ogdensburg Fireworks, St. Lawrence River...

  10. 75 FR 11937 - Eagle Sportswear, Inc.; New York, NY; Notice of Termination of Investigation

    Science.gov (United States)

    2010-03-12

    ... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-73,023] Eagle Sportswear, Inc.; New York, NY; Notice of Termination of Investigation Pursuant to Section 223 of the Trade Act of 1974... company official on behalf of workers of Eagle Sportswear, Inc., New York, New York. The petitioner has...

  11. 78 FR 45957 - Notice of Inventory Completion: Columbia University, Department of Anthropology, New York, NY

    Science.gov (United States)

    2013-07-30

    ....R50000] Notice of Inventory Completion: Columbia University, Department of Anthropology, New York, NY... Anthropology, has completed an inventory of human remains, in consultation with the appropriate Indian tribes... August 29, 2013. ADDRESSES: Dr. Nan Rothschild, Department of Anthropology, Columbia University, New York...

  12. 77 FR 39638 - Safety Zone; Barbara Harder Wedding Fireworks, Lake Erie, Lake View, NY

    Science.gov (United States)

    2012-07-05

    ... environmental risk to health or risk to safety that may disproportionately affect children. 10. Indian Tribal... be held on Lake Erie near Lake View, NY. The Captain of the Port Buffalo has determined that fireworks launched proximate to a gathering of watercraft pose a significant risk to public safety and...

  13. 76 FR 48178 - Notice of Inventory Completion: Longyear Museum of Anthropology, Colgate University, Hamilton, NY

    Science.gov (United States)

    2011-08-08

    ...: Longyear Museum of Anthropology, Colgate University, Hamilton, NY AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The Longyear Museum of Anthropology has completed an inventory of a human remain... human remain should contact the Longyear Museum of Anthropology at the address below by September 7...

  14. High temperature dielectric properties of (BxNyOz thin films deposited using ion source assisted physical vapor deposition

    Directory of Open Access Journals (Sweden)

    N. Badi

    2015-12-01

    Full Text Available The dielectric integrity has been one of the major obstacle in bringing out capacitor devices with suitable performance characteristics at high temperatures. In this paper, BxNyOz dielectric films for high temperature capacitors solutions are investigated. The films were grown on silicon substrate by using ion source assisted physical vapor deposition technique. The as-grown films were characterized by SEM, XRD, and XPS. The capacitor structures were fabricated using BxNyOz as a dielectric and titanium as metal electrodes. The elaborated devices were subjected to electrical and thermal characterization. They exhibited low electrical loss and very good stability when subjected to high temperature for a prolonged period of time.

  15. 77 FR 46349 - Safety Zone; DeStefano Wedding Fireworks Display, Patchogue Bay, Patchogue, NY

    Science.gov (United States)

    2012-08-03

    ... announced by a later notice in the Federal Register. B. Regulatory History and Information This is a first time event with no regulatory history. C. Basis and Purpose The legal basis for this temporary rule is... Bay'' restaurant in Patchogue, NY. This rule will be effective from 8:30 p.m. on November 3, 2012...

  16. 76 FR 31679 - Saratoga and North Creek Railway, LLC-Operation Exemption-Warren County, NY

    Science.gov (United States)

    2011-06-01

    ... that it is negotiating the terms of an agreement with the County to restore common carrier rail freight... operate approximately 39.07 miles of rail line owned by Warren County, NY (the County), a noncarrier... Class III rail carrier and a subsidiary of Permian Basin Railways, Inc., which in turn is owned by Iowa...

  17. 75 FR 15739 - International Business Machines Corporation: Armonk, NY; Notice of Termination of Investigation

    Science.gov (United States)

    2010-03-30

    ... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-70,580] International Business Machines Corporation: Armonk, NY; Notice of Termination of Investigation Pursuant to Section 223 of the Trade Act of 1974, as amended, an investigation was initiated in response to a petition filed on May 21, 2009 on behalf of workers of International...

  18. 78 FR 1713 - Golden Nematode; Removal of Regulated Areas in Livingston and Steuben Counties, NY

    Science.gov (United States)

    2013-01-09

    ...-0079] Golden Nematode; Removal of Regulated Areas in Livingston and Steuben Counties, NY AGENCY: Animal... are amending the golden nematode regulations by removing areas in Livingston and Steuben Counties in... areas in these two counties are free of golden nematode, and we have determined that regulation of these...

  19. 77 FR 65360 - Grant of Authority for Subzone Status (Centrifugal and Submersible Pumps); Auburn, NY

    Science.gov (United States)

    2012-10-26

    ... Status (Centrifugal and Submersible Pumps); Auburn, NY Pursuant to its authority under the Foreign-Trade... authority to establish a special-purpose subzone at the centrifugal and submersible pump manufacturing and... submersible pumps and related controllers at the Xylem Water Systems U.S.A., LLC, facilities located in Auburn...

  20. 75 FR 76943 - Regulated Navigation Area; Hudson River South of the Troy Locks, NY

    Science.gov (United States)

    2010-12-10

    ...-AA11 Regulated Navigation Area; Hudson River South of the Troy Locks, NY AGENCY: Coast Guard, DHS... Navigation Area (RNA) on the navigable waters of the Hudson River in New York, south of the Troy Locks. This... within the waters of the Hudson River south of the Troy Locks when ice is a threat to navigation. DATES...

  1. 76 FR 8654 - Regulated Navigation Area; Hudson River South of the Troy Locks, NY

    Science.gov (United States)

    2011-02-15

    ...-AA11 Regulated Navigation Area; Hudson River South of the Troy Locks, NY AGENCY: Coast Guard, DHS... navigable waters of the Hudson River in New York, south of the Troy Locks. This action is necessary to... Hudson River south of the Troy Locks when ice is a threat to navigation. DATES: This rule is effective in...

  2. Establishment of a new immortalized human corneal epithelial cell line (iHCE-NY1) for use in evaluating eye irritancy by in vitro test methods.

    Science.gov (United States)

    Yamamoto, Naoki; Kato, Yoshinao; Sato, Atsushi; Hiramatsu, Noriko; Yamashita, Hiromi; Ohkuma, Mahito; Miyachi, Ei-Ichi; Horiguchi, Masayuki; Hirano, Koji; Kojima, Hajime

    2016-08-01

    In vitro test methods that use human corneal epithelial cells to evaluate the eye irritation potency of chemical substances do not use human corneal epithelium because it has been difficult to maintain more than four passages. In this study, we make a new cell line comprising immortalized human corneal epithelial cells (iHCE-NY1). The IC50 of iHCE-NY1 cells is slightly higher than that of Statens Seruminstitut Rabbit Cornea (SIRC) cells, which are currently used in some in vitro test methods. CDKN1A in iHCE-NY1 cells was used as a marker of gene expression to indicate cell cycle activity. This enabled us to evaluate cell recovery characteristics at concentrations lower than the IC50 of cytotoxic tests.

  3. 78 FR 27856 - Golden Nematode; Removal of Regulated Areas in Livingston and Steuben Counties, NY

    Science.gov (United States)

    2013-05-13

    .... APHIS-2012-0079] Golden Nematode; Removal of Regulated Areas in Livingston and Steuben Counties, NY... nematode regulations by removing areas in Livingston and Steuben Counties in New York from the list of... nematode, and we determined that regulation of these areas was no longer necessary. As a result of that...

  4. SOURCE CHARACTERIZATION AND CONTROL TECHNOLOGY ASSESSMENT OF METHYLENE CHLORIDE EMISSIONS FROM EASTMAN KODAK COMPANY, ROCHESTER, NY

    Science.gov (United States)

    The report gives results of an assessment of potential control technologies for methylene chloride (also known as dichloromethane or DCM) emission sources at Eastman Kodak Company's Kodak Park facility in Rochester, NY. DCM is a solvent used by Kodak in the manufacture of cellulo...

  5. 75 FR 25290 - Notice of Intent To Repatriate Cultural Items: Rochester Museum & Science Center, Rochester, NY

    Science.gov (United States)

    2010-05-07

    ... Museum & Science Center, Rochester, NY, that meet the definitions of ``sacred objects'' and ``objects of.... Tonawanda Seneca Nation traditional religious leaders have identified these medicine faces as being needed...-Haudenosaunee consultants, the museum has determined that the medicine faces are both sacred objects and objects...

  6. 75 FR 25289 - Notice of Intent To Repatriate Cultural Items: Rochester Museum & Science Center, Rochester, NY

    Science.gov (United States)

    2010-05-07

    ... Museum & Science Center, Rochester, NY, that meet the definitions of ``sacred object'' and object of...- 9). They are of Onondaga origin and were made circa 1970. Onondaga Nation traditional religious... that these medicine faces are culturally affiliated with the Onondaga Nation, and are both sacred...

  7. 77 FR 51912 - Safety Zone; Tom Lyons Productions Fireworks, Long Island Sound, Sands Point, NY

    Science.gov (United States)

    2012-08-28

    ... DEPARTMENT OF HOMELAND SECURITY Coast Guard 33 CFR Part 165 [Docket Number USCG-2012-0618] RIN 1625-AA00 Safety Zone; Tom Lyons Productions Fireworks, Long Island Sound, Sands Point, NY AGENCY.... 165.T01-0618 to read as follows: Sec. 165.T01-0618 Safety Zone; Tom Lyons Productions Fireworks, Long...

  8. 76 FR 77175 - New York Fun Factory Fireworks Display, Western Long Island Sound; Mamaroneck, NY

    Science.gov (United States)

    2011-12-12

    ...-AA00 New York Fun Factory Fireworks Display, Western Long Island Sound; Mamaroneck, NY AGENCY: Coast... in support of the New York Fun Factory Fireworks display. This action is necessary to provide for the... the Coast Guard to define regulatory safety zones. On May 10, 2012 New York Fun Factory Events is...

  9. 78 FR 50108 - Notice of Intent To Repatriate Cultural Item: Rochester Museum & Science Center, Rochester, NY

    Science.gov (United States)

    2013-08-16

    ....R50000] Notice of Intent To Repatriate Cultural Item: Rochester Museum & Science Center, Rochester, NY AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The Rochester Museum & Science Center... that the cultural item listed in this notice meets the definition of a sacred object and an object of...

  10. 75 FR 23801 - Notice of Intent to Repatriate Cultural Items: Rochester Museum & Science Center, Rochester, NY

    Science.gov (United States)

    2010-05-04

    ... Museum & Science Center, Rochester, NY, that meet the definitions of ``sacred objects'' and ``objects of... center of the Seneca religious fire. This was agreed upon by representatives from the Seneca Nation of.... Tonawanda Seneca Nation traditional religious leaders have identified these medicine faces as being needed...

  11. 77 FR 42508 - Notice of Inventory Completion: New York University College of Dentistry, New York, NY

    Science.gov (United States)

    2012-07-19

    ... Inventory Completion: New York University College of Dentistry, New York, NY AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The New York University College of Dentistry has completed an inventory... the New York University College of Dentistry. Repatriation of the human remains to the Indian tribes...

  12. 77 FR 42513 - Notice of Inventory Completion: New York University College of Dentistry, New York, NY

    Science.gov (United States)

    2012-07-19

    ... Inventory Completion: New York University College of Dentistry, New York, NY AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The New York University College of Dentistry has completed an inventory... the New York University College of Dentistry. Disposition of the human remains to the Indian tribes...

  13. 77 FR 42507 - Notice of Inventory Completion: New York University College of Dentistry, New York, NY

    Science.gov (United States)

    2012-07-19

    ... Inventory Completion: New York University College of Dentistry, New York, NY AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The New York University College of Dentistry has completed an inventory... the New York University College of Dentistry. Disposition of the human remains to the Indian tribes...

  14. 77 FR 38488 - Safety Zone; Alexandria Bay Chamber of Commerce, St. Lawrence River, Alexandria Bay, NY

    Science.gov (United States)

    2012-06-28

    ... 1625-AA00 Safety Zone; Alexandria Bay Chamber of Commerce, St. Lawrence River, Alexandria Bay, NY... restrict vessels from a portion of the St. Lawrence River during the Alexandria Bay Chamber of Commerce... of proposed rulemaking (NPRM) entitled Safety Zone; Alexandria Bay Chamber of Commerce, St. Lawrence...

  15. 77 FR 10960 - Security Zone, East River and Bronx Kill; Randalls and Wards Islands, NY

    Science.gov (United States)

    2012-02-24

    ...'' W (Port Morris Stacks), and all waters of the Bronx Kill southeast of the Bronx Kill Rail Road...-AA87 Security Zone, East River and Bronx Kill; Randalls and Wards Islands, NY AGENCY: Coast Guard, DHS... waters of the East River and Bronx Kill, in the vicinity of Randalls and Wards Islands, New York. This...

  16. 78 FR 46855 - Safety Zone; East End Maritime Foundation Fireworks Display, Greenport Harbor, Greenport, NY

    Science.gov (United States)

    2013-08-02

    ... 1625-AA00 Safety Zone; East End Maritime Foundation Fireworks Display, Greenport Harbor, Greenport, NY... temporary rule proposes to establish a safety zone for the East End Maritime Foundation fireworks display....1. 0 2. Add Sec. 165.T01-0600 to read as follows: Sec. 165.T01-0600 Safety Zone; East End Maritime...

  17. 75 FR 58425 - Notice of Intent to Repatriate Cultural Items: American Museum of Natural History, New York, NY

    Science.gov (United States)

    2010-09-24

    ... Museum of Natural History, New York, NY, that meets the definition of unassociated funerary objects under... remains as a ``Pima ... medicine man.'' The two associated funerary objects were a pair of metal spurs. In...

  18. Energy Optimization Assessment at U.S. Army Installations: West Point Military Academy, NY

    Science.gov (United States)

    2008-09-01

    chillers to work unnecessarily more than needed. Other buildings had setpoints at different areas above 55 °F. Many buildings are air-conditioned and... optimal . The cost of 12.5 cents/KWh makes it unlikely, especially where steam adsorption chillers exist. 11.8.2 Solution Use the existing steam...ER D C/ CE R L TR -0 8 -1 4 Energy Optimization Assessment at U.S. Army Installations West Point Military Academy, NY David M

  19. MAGE-A1, GAGE and NY-ESO-1 cancer/testis antigen expression during human gonadal development

    DEFF Research Database (Denmark)

    Gjerstorff, Morten F; Kock, Kirsten; Nielsen, Ole

    2007-01-01

    BACKGROUND: Cancer/testis antigens (CTAs) are expressed in several cancers and during normal adult male germ cell differentiation. Little is known about their role in fetal development of human germ cells. METHODS: We examined expression of the CTAs MAGE-A1, GAGE and NY-ESO-1 in fetal gonads...

  20. 77 FR 42640 - Safety Zone; Can-Am Festival Fireworks, Black River Bay, Sackets Harbor, NY

    Science.gov (United States)

    2012-07-20

    ...-AA00 Safety Zone; Can-Am Festival Fireworks, Black River Bay, Sackets Harbor, NY AGENCY: Coast Guard... Black River Bay during the Can-Am Festival Fireworks display. This temporary safety zone is necessary to... Can-Am Festival Fireworks. This zone will be effective and enforced from 9:15 p.m. until 10:45 p.m. on...

  1. Udvikling af en internetsøgestrategi til identifikation af ny medicinsk teknologi inden for prostatacancer

    DEFF Research Database (Denmark)

    Thygesen, Marianne; Vondeling, Hindrik; Douw, Karla

    2007-01-01

    internetsider efter efficiens. Her er efficiens forstået som mindst antal minutter brugt pr. fund af information om en ny væsentlig medicinsk teknologi. Resultater: Strategien består af ti sider, som bør benyttes i følgende rækkefølge: YahooHealth, DoctorsGuide, The National Electronic Library for Medicines...

  2. 75 FR 23800 - Notice of Intent to Repatriate a Cultural Item: Rochester Museum & Science Center, Rochester, NY

    Science.gov (United States)

    2010-05-04

    ... Museum & Science Center, Rochester, NY, that meets the definitions of ``sacred object'' and object of... responsibility within the Haudenosaunee Confederacy to bring back national cultural patrimony and sacred objects... not have the authority to do so. Furthermore, Onondaga Nation traditional religious leaders have...

  3. 75 FR 23799 - Notice of Intent to Repatriate a Cultural Item: Rochester Museum & Science Center, Rochester, NY

    Science.gov (United States)

    2010-05-04

    ... Museum & Science Center, Rochester, NY, that meets the definitions of ``sacred object'' and object of... responsibility within the Haudenosaunee Confederacy to bring back national cultural patrimony and sacred objects... not have the authority to do so. Furthermore, Onondaga Nation traditional religious leaders have...

  4. Negative differential resistance and switch behavior of T-BxNy (x, y = 5, 6, 11) molecular junctions

    Science.gov (United States)

    Wang, Shi-Liang; Yang, Chuan-Lu; Wang, Mei-Shan; Ma, Xiao-Guang; Xin, Jian-Guo

    2017-05-01

    The electronic transport properties of T-BxNy (x, y = 5, 6, 11) molecular junction are investigated based on first-principle density functional theory and non-equilibrium Green's function method. Strong negative differential resistance (NDR) behavior is observed for T-B5N6 molecule under negative and positive bias voltages, with an obvious switch effect for T-B6N5. However, only small NDR is shown for the complex of the two molecules. The projected device density of states, the spatial distribution of molecular orbitals, and the effect of transmission spectra under various bias voltages on the electronic transport properties are analyzed. The obvious effect of bias voltage on the changes in the electronic distribution of frontier molecular orbitals is responsible for the NDR or switch behavior. Therefore, different functional molecular devices can be obtained with different structures of T-BxNy.

  5. 75 FR 29727 - Reorganization of Foreign-Trade Zone 37 Under Alternative Site Framework Orange County, NY

    Science.gov (United States)

    2010-05-27

    ... Zone 37 Under Alternative Site Framework Orange County, NY Pursuant to its authority under the Foreign... reorganization of general-purpose zones; Whereas, Orange County, New York, grantee of Foreign-Trade Zone 37... under the ASF with a service area of Orange County, New York, adjacent to the New York/Newark Customs...

  6. NY-ESO-1- and survivin-specific T-cell responses in the peripheral blood from patients with glioma

    DEFF Research Database (Denmark)

    Liu, Zhenjiang; Poiret, Thomas; Persson, Oscar

    2018-01-01

    The prognosis for patients with glioblastoma is grim. Ex vivo expanded tumor-associated antigen (TAA)-reactive T-cells from patients with glioma may represent a viable source for anticancer-directed cellular therapies. Immunohistochemistry was used to test the survivin (n = 40 samples) and NY-ESO...

  7. 77 FR 38486 - Safety Zone; City of Tonawanda July 4th Celebration, Niagara River, Tonawanda, NY

    Science.gov (United States)

    2012-06-28

    ... 1625-AA00 Safety Zone; City of Tonawanda July 4th Celebration, Niagara River, Tonawanda, NY AGENCY... safety zone on the Niagara River, Tonawanda, New York. This safety zone is intended to restrict vessels from a portion of the Niagara River during the City of Tonawanda July 4th Celebration fireworks on July...

  8. Characterization of the cloud conditions at Ny-Ålesund using sensor synergy and representativeness of the observed clouds across Arctic sites

    Science.gov (United States)

    Nomokonova, Tatiana; Ebell, Kerstin; Löhnert, Ulrich; Maturilli, Marion

    2017-04-01

    Clouds are one of the crucial components of the hydrological and energy cycles and thus affecting the global climate. Their special importance in Arctic regions is defined by cloud's influence on the radiation budget. Arctic clouds usually occur at low altitudes and often contain highly concentrated tiny liquid drops. During winter, spring, and autumn periods such clouds tend to conserve the long-wave radiation in the atmosphere and, thus, produce warming of the Arctic climate. In summer though clouds efficiently scatter the solar radiation back to space and, therefore, induce a cooling effect. An accurate characterization of the net effect of clouds on the Arctic climate requires long-term and precise observations. However, only a few measurement sites exist which perform continuous, vertically resolved observations of clouds in the Arctic, e.g. in Alaska, Canada, and Greenland. These sites typically make use of a combination of different ground-based remote sensing instruments, e.g. cloud radar, ceilometer and microwave radiometer in order to characterize clouds. Within the Transregional Collaborative Research Center (TR 172) "Arctic Amplification: Climate Relevant Atmospheric and Surface Processes, and Feedback Mechanisms (AC)3" comprehensive observations of the atmospheric column are performed at the German-French Research Station AWIPEV at Ny-Ålesund, Svalbard. Ny-Ålesund is located in the warmest part of the Arctic where climate is significantly influenced by adiabatic heating from the warm ocean. Thus, measurements at Ny-Ålesund will complement our understanding of cloud formation and development in the Arctic. This particular study is devoted to the characterization of the cloud macro- and microphysical properties at Ny-Ålesund and of the atmospheric conditions, under which these clouds form and develop. To this end, the information of the various instrumentation at the AWIPEV observatory is synergistically analysed: information about the thermodynamic

  9. Arctic warming, moisture increase and circulation changes observed in the Ny-Ålesund homogenized radiosonde record

    Science.gov (United States)

    Maturilli, Marion; Kayser, Markus

    2017-10-01

    Radiosonde measurements obtained at the Arctic site Ny-Ålesund (78.9°N, 11.9°E), Svalbard, from 1993 to 2014 have been homogenized accounting for instrumentation discontinuities by correcting known errors in the manufacturer provided profiles. The resulting homogenized radiosonde record is provided as supplementary material at http://doi.pangaea.de/10.1594/PANGAEA.845373. From the homogenized data record, the first Ny-Ålesund upper-air climatology of wind, temperature and humidity is presented, forming the background for the analysis of changes during the 22-year period. Particularly during the winter season, a strong increase in atmospheric temperature and humidity is observed, with a significant warming of the free troposphere in January and February up to 3 K per decade. This winter warming is even more pronounced in the boundary layer below 1 km, presumably amplified by mesoscale processes including e.g. orographic effects or the boundary layer capping inversion. Though the largest contribution to the increasing atmospheric water vapour column in winter originates from the lowermost 2 km, no increase in the contribution by specific humidity inversions is detected. Instead, we find an increase in the humidity content of the large-scale background humidity profiles. At the same time, the tropospheric flow in winter is found to occur less frequent from northerly directions and to the same amount more frequent from the South. We conclude that changes in the atmospheric circulation lead to an enhanced advection of warm and moist air from lower latitudes to the Svalbard region in the winter season, causing the warming and moistening of the atmospheric column above Ny-Ålesund, and link the observations to changes in the Arctic Oscillation.

  10. 77 FR 30242 - Safety Zone; City of Tonawanda July 4th Celebration, Niagara River, Tonawanda, NY

    Science.gov (United States)

    2012-05-22

    ...-AA00 Safety Zone; City of Tonawanda July 4th Celebration, Niagara River, Tonawanda, NY AGENCY: Coast... vessels from a portion of the Niagara River during the City of Tonawanda July 4th Celebration fireworks... read as follows: Sec. 165.T09-0352 Safety Zone; City of Tonawanda July 4th Celebration, Niagara River...

  11. Thermal stability of atomic layer deposited WCxNy electrodes for metal oxide semiconductor devices

    Science.gov (United States)

    Zonensain, Oren; Fadida, Sivan; Fisher, Ilanit; Gao, Juwen; Danek, Michal; Eizenberg, Moshe

    2018-01-01

    This study is a thorough investigation of the chemical, structural, and electrical stability of W based organo-metallic films, grown by atomic layer deposition, for future use as gate electrodes in advanced metal oxide semiconductor structures. In an earlier work, we have shown that high effective work-function (4.7 eV) was produced by nitrogen enriched films (WCxNy) dominated by W-N chemical bonding, and low effective work-function (4.2 eV) was produced by hydrogen plasma resulting in WCx films dominated by W-C chemical bonding. In the current work, we observe, using x-ray diffraction analysis, phase transformation of the tungsten carbide and tungsten nitride phases after 900 °C annealing to the cubic tungsten phase. Nitrogen diffusion is also observed and is analyzed with time-of-flight secondary ion mass spectroscopy. After this 900 °C anneal, WCxNy effective work function tunability is lost and effective work-function values of 4.7-4.8 eV are measured, similar to stable effective work function values measured for PVD TiN up to 900 °C anneal. All the observed changes after annealing are discussed and correlated to the observed change in the effective work function.

  12. Orbital Period Variations in the NY Vir System, Revisited in the Light of New Data

    Directory of Open Access Journals (Sweden)

    Baştürk Özgür

    2018-02-01

    Full Text Available NY Virginis is an eclipsing binary system with a subdwarf B primary and an M type dwarf secondary. Recent studies (Qian et al. 2012; Lee et al. 2014 suggested the presence of two circumbinary planets with a few Jovian masses within the system. Lee et al. (2014 examined the orbital stabilities of the suggested planets, using the best-fit parameters derived from their eclipse timing variation analysis. They found that the outer companion should be ejected from the system in about 800 000 years. An observational report from Pulley et al. (2016 pointed out that the recent mideclipse times of the binary deviate significantly from the models suggested by Lee et al. (2014. In fact, variations in the orbital period of the system had already been recognized by many authors, but the parameters of these variations vary significantly as new data accumulate. Here, we analyze the eclipse timing variations of the NY Vir system, using new mid-eclipse times that we have obtained together with earlier published measurements in order to understand the nature of the system and constrain its parameters.

  13. 76 FR 29797 - Westpoint Home, Inc., New York Corporate Sales Office, New York, NY, Including Employees Working...

    Science.gov (United States)

    2011-05-23

    ... Home, Inc., New York Corporate Sales Office, working off-site in Illinois, Georgia, Minnesota, Indiana...,218B, TA-W-74,218C, TA-W-74,218D] Westpoint Home, Inc., New York Corporate Sales Office, New York, NY, Including Employees Working Off-Site in Illinois, Georgia, Minnesota, Indiana, North Carolina; Westpoint...

  14. En ny historie om guld og svovl - guld-svovlbindingen i thiolers adsorption på guldnanopartikler og plane guldoverflader

    DEFF Research Database (Denmark)

    Chi, Qijin; Ford, Michael J.; Halder, Arnab

    2016-01-01

    En netop publiceret større australsk-dansk undersøgelse giver ny indsigt i, hvordan thioldækkede Au-overflader er opbygget. Det har betydning for design, syntese og dannelsesmekanismer for Au-nanopartikler og Au-overflader med skræddersyede fysiske og kemiske egenskaber....

  15. Chemical and geochemical composition of spring-summer Arctic aerosol collected at Ny Alesund, Svalbard Islands.

    Science.gov (United States)

    Udisti, Roberto; Becagli, Silvia; Caiazzo, Laura; Cappelletti, David; Giardi, Fabio; Grotti, Marco; Lucarelli, Franco; Moroni, Beatrice; Nava, Silvia; Severi, Mirko; Traversi, Rita

    2017-04-01

    Since March 2010, spring-summer (usually March - September) campaigns were continuously carried out at the Italian Gruvebadet Observatory, Ny Alesund, Svalbard Island. Aerosol was sampled by PM10 (daily) and 4-stage (4-day resolution) collector devices and size distribution was evaluated at 10 min resolution in the range 10 nm - 20 um (106 size classes by a TSI SMPS-APS integrated system). Six-year (2010-2015) PM10 and size-segregated (>10, 10-2.5, 2.5-1, metal content (major and trace metals, including Rare Earth Elements - REEs, by PIXE and ICP-MS), Pb isotopic composition (by ICP-MS) and Elemental and Organic Carbon (EC-OC) concentrations. The data set was elaborated by multi-parametric statistical analysis (Positive Matrix Factorization - PMF), in order to identifying and quantifying the contribution of the main anthropic and natural aerosol sources. Particular attention was spent in evaluating the anthropic contribution of nss-sulphate, nitrate, EC and heavy metals during the Arctic Haze in spring. The isotopic composition of Pb was used in identifying the source areas (North America, Greenland, North Europe, Siberia, Iceland) of anthropic emissions as a function of seasonality (different atmospheric circulation pathway). Crustal metals and, especially, REEs anomalies (with respect to the Chondrite-normalized profile) allowed characterizing the dust emissions from their Potential Source Areas (PSA). Biogenic markers (especially methane sulfonic acid - MSA - and bio-nss-sulphate) was used to obtain relevant information about the relationship between marine biogenic activity (primary productivity) and sea ice coverage and atmospheric conditions (irradiance, temperature, circulation pathways). The seasonal pattern of the nitrate deposition was also investigated. Chemical and geochemical measurements were compared with high-resolution size distribution and back-trajectory cluster analysis in order to understand the seasonal pattern of the contributions of long

  16. Ny styring af lærernes autonomi?

    DEFF Research Database (Denmark)

    Holm, Claus

    2015-01-01

    Kapitlet ”Ny styring af lærernes autonom?” i bogen Folkeskolen - efter reformen fokuserer på, hvordan en realisering af den vedtagne skolereform og forventningen om en kommende brug af nye forenklede Fælles Mål ud fra en målstyringstænkning ændrer lærernes autonomi til at udøve dømmekraft i...... klasseværelset. Dermed er kapitlets tese, at man ikke – i hvert fald ikke kun – kan tale om et tab af autonomi, men en ændret opfattelse og indhold heraf. Opgaven er derfor at indkredse, hvordan danske læreres autonomi til at udøve professionel dømmekraft forandrer sig, hvis man realiserer idéen om en...... læringsmålstyret undervisning, konkret i form af forenklede Fælles Mål. Og netop spørgsmålet om lærerens autonomi til at udøve professionel dømmekraft bliver i sammenhæng med styring heraf et centralt emne og problematik at afklare. Ikke kun i dansk sammenhæng, men også internationalt....

  17. Recombination of strain O segments to HCpro-encoding sequence of strain N of Potato virus Y modulates necrosis induced in tobacco and in potatoes carrying resistance genes Ny or Nc.

    Science.gov (United States)

    Tian, Yan-Ping; Valkonen, Jari P T

    2015-09-01

    Hypersensitive resistance (HR) to strains O and C of Potato virus Y (PVY, genus Potyvirus) is conferred by potato genes Ny(tbr) and Nc(tbr), respectively; however, PVY N strains overcome these resistance genes. The viral helper component proteinases (HCpro, 456 amino acids) from PVY(N) and PVY(O) are distinguished by an eight-amino-acid signature sequence, causing HCpro to fold into alternative conformations. Substitution of only two residues (K269R and R270K) of the eight-amino-acid signature in PVY(N) HCpro was needed to convert the three-dimensional (3D) model of PVY(N) HCpro to a PVY(O) -like conformation and render PVY(N) avirulent in the presence of Ny(tbr), whereas four amino acid substitutions were necessary to change PVY(O) HCpro to a PVY(N) -like conformation. Hence, the HCpro conformation rather than other features ascribed to the sequence were essential for recognition by Ny(tbr). The 3D model of PVY(C) HCpro closely resembled PVY(O), but differed from PVY(N) HCpro. HCpro of all strains was structurally similar to β-catenin. Sixteen PVY(N) 605-based chimeras were inoculated to potato cv. Pentland Crown (Ny(tbr)), King Edward (Nc(tbr)) and Pentland Ivory (Ny(tbr)/Nc(tbr)). Eleven chimeras induced necrotic local lesions and caused no systemic infection, and thus differed from both parental viruses that infected King Edward systemically, and from PVY(N) 605 that infected Pentland Crown and Pentland Ivory systemically. These 11 chimeras triggered both Ny(tbr) and Nc(tbr) and, in addition, six induced veinal necrosis in tobacco. Further, specific amino acid residues were found to have an additive impact on necrosis. These results shed new light on the causes of PVY-related necrotic symptoms in potato. © 2014 BSPP AND JOHN WILEY & SONS LTD.

  18. STDとしての男子尿道炎・子宮頸管炎の疫学的・治療学的研究 - NY-198(Lomefloxacin)による検討 -

    OpenAIRE

    熊本, 悦明; 広瀬, 崇興; 林, 謙治; 郷路, 勉; 児玉, 直彦; 宮岸, 武弘; 上野, 了; 毛利, 和弘; 阿部, 清孝

    1990-01-01

    Urethritis in males and cervicitis in females, which were sexually transmitted diseases, were treated with NY-198, a new quinolone antibiotic, and its efficacy was studied. Seventeen male patients with gonorrheal urethritis were administered a single 300 mg dose of NY-198. The efficacy rate on the 3rd day after administration was 100%, but it was 85.7% on the 7th day due to recurrence in 1 patient. The results of treatment of non-gonorrheal infections were as follow. In this treatment, NY-198...

  19. 75 FR 24612 - Order Finding That the Zone 6-NY Financial Basis Contract Traded on the IntercontinentalExchange...

    Science.gov (United States)

    2010-05-05

    ... COMMODITY FUTURES TRADING COMMISSION Order Finding That the Zone 6-NY Financial Basis Contract.... Although Transco's Zone 6 hub is a major trading center for natural gas in the United States and, as noted... AGENCY: Commodity Futures Trading Commission. ACTION: Final order. SUMMARY: On October 9, 2009, the...

  20. 77 FR 30443 - Safety Zone; Alexandria Bay Chamber of Commerce, St. Lawrence River, Alexandria Bay, NY

    Science.gov (United States)

    2012-05-23

    ...The Coast Guard proposes to establish a temporary safety zone on the St. Lawrence River, Alexandria Bay, NY. This proposed rule is intended to restrict vessels from a portion of the St. Lawrence River during the Alexandria Bay Chamber of Commerce fireworks display. The safety zone established by this proposed rule is necessary to protect spectators and vessels from the hazards associated with a fireworks display.

  1. Polar cloud observatory at Ny-Ålesund in GRENE Arctic Climate Change Research Project

    Science.gov (United States)

    Yamanouchi, Takashi; Takano, Toshiaki; Shiobara, Masataka; Okamoto, Hajime; Koike, Makoto; Ukita, Jinro

    2016-04-01

    Cloud is one of the main processes in the climate system and especially a large feed back agent for Arctic warming amplification (Yoshimori et al., 2014). From this reason, observation of polar cloud has been emphasized and 95 GHz cloud profiling radar in high precision was established at Ny-Ålesund, Svalbard in 2013 as one of the basic infrastructure in the GRENE (Green Network of Excellence Program) Arctic Climate Change Research Project. The radar, "FALCON-A", is a FM-CW (frequency modulated continuous wave) Doppler radar, developed for Arctic use by Chiba University (PI: T. Takano) in 2012, following its prototype, "FALCON-1" which was developed in 2006 (Takano et al., 2010). The specifications of the radar are, central frequency: 94.84 GHz; antenna power: 1 W; observation height: up to 15 km; range resolution: 48 m; beam width: 0.2 degree (15 m at 5 km); Doppler width: 3.2 m/s; time interval: 10 sec, and capable of archiving high sensitivity and high spatial and time resolution. An FM-CW type radar realizes similar sensitivity with much smaller parabolic antennas separated 1.4 m from each other used for transmitting and receiving the wave. Polarized Micro-Pulse Lidar (PMPL, Sigma Space MPL-4B-IDS), which is capable to measure the backscatter and depolarization ratio, has also been deployed to Ny-Ålesund in March 2012, and now operated to perform collocated measurements with FALCON-A. Simultaneous measurement data from collocated PMPL and FALCON-A are available for synergetic analyses of cloud microphysics. Cloud mycrophysics, such as effective radius of ice particles and ice water content, are obtained from the analysis based on algorithm, which is modified for ground-based measurements from Okamoto's retrieval algorithm for satellite based cloud profiling radar and lidar (CloudSat and CALIPSO; Okamoto et al., 2010). Results of two years will be shown in the presentation. Calibration is a point to derive radar reflectivity (dBZ) from original intensity data

  2. Examination of Below-Ground Structure and Soil Respiration Rates of Stable and Deteriorating Salt Marshes in Jamaica Bay (NY)

    Science.gov (United States)

    CAT scan imaging is currently being used to examine below-ground peat and root structure in cores collected from salt marshes of Jamaica Bay, part of the Gateway National Recreation Area (NY). CAT scans or Computer-Aided Tomography scans use X-ray equipment to produce multiple i...

  3. Evidences of extracellular abiotic degradation of hexadecane through free radical mechanism induced by the secreted phenazine compounds of P. aeruginosa NY3.

    Science.gov (United States)

    Nie, Hongyun; Nie, Maiqian; Wang, Lei; Diwu, Zhenjun; Xiao, Ting; Qiao, Qi; Wang, Yan; Jiang, Xin

    2018-03-02

    The aim of this work was to investigate the effects of secreted extracellular phenazine compounds (PHCs) on the degradation efficiency of alkanes by P. aeruginosa NY3. Under aerobic conditions, the PHCs secreted by P. aeruginosa NY3 initiate the oxidation of alkanes outside cells, in coupling with some reducing agents, such as β-Nicotinamide adenine dinucleotide, reduced disodium salt (NADH) or reduced glutathione (GSH). This reaction might be via free radical reactions similar to Fenton Oxidation Reaction (FOR). P. aeruginosa NY3 secretes pyocyanin (Pyo), 1-hydroxyphenazine (HPE), phenazine-1-carboxylic acid (PCA), and phenazine-1-amide (PCN) simultaneously. The cell-free extracellular fluid containing these four PHCs degrades hexadecane effectively. The observation of Electron Spin Resonance (EPR) signals of superoxide anion radical (O 2 - ), hydroxyl radical (OH) and/or carbon free radicals (R) both in vivo and in vitro suggested the degradation of hexadecane could be via a free radical pathway. Secretion of PHCs has been found to be characteristic of Pseudomonas which is often involved in or related to the degradation of organic pollutants. Our work suggested that certain organic contaminants may be oxidized through ubiquitously extracellular abiotic degradation by the free radicals produced during bio-remediation and bio-treatment. Copyright © 2018. Published by Elsevier Ltd.

  4. Salicylic acid is an indispensable component of the Ny-1 resistance-gene-mediated response against Potato virus Y infection in potato.

    Science.gov (United States)

    Baebler, Š; Witek, K; Petek, M; Stare, K; Tušek-Žnidarič, M; Pompe-Novak, M; Renaut, J; Szajko, K; Strzelczyk-Żyta, D; Marczewski, W; Morgiewicz, K; Gruden, K; Hennig, J

    2014-03-01

    The purpose of the study was to investigate the role of salicylic acid (SA) signalling in Ny-1-mediated hypersensitive resistance (HR) of potato (Solanum tuberosum L.) to Potato virus Y (PVY). The responses of the Ny-1 allele in the Rywal potato cultivar and transgenic NahG-Rywal potato plants that do not accumulate SA were characterized at the cytological, biochemical, transcriptome, and proteome levels. Analysis of noninoculated and inoculated leaves revealed that HR lesions started to develop from 3 d post inoculation and completely restricted the virus spread. At the cytological level, features of programmed cell death in combination with reactive oxygen species burst were observed. In response to PVY infection, SA was synthesized de novo. The lack of SA accumulation in the NahG plants led to the disease phenotype due to unrestricted viral spreading. Grafting experiments show that SA has a critical role in the inhibition of PVY spreading in parenchymal tissue, but not in vascular veins. The whole transcriptome analysis confirmed the central role of SA in orchestrating Ny-1-mediated responses and showed that the absence of SA leads to significant changes at the transcriptome level, including a delay in activation of expression of genes known to participate in defence responses. Moreover, perturbations in the expression of hormonal signalling genes were detected, shown as a switch from SA to jasmonic acid/ethylene signalling. Viral multiplication in the NahG plants was accompanied by downregulation of photosynthesis genes and activation of multiple energy-producing pathways.

  5. 75 FR 13131 - Notice of Intent To Prepare an Environmental Impact Statement (EIS) for the Sale of Plum Island, NY

    Science.gov (United States)

    2010-03-18

    ... the anticipated sale of Plum Island, New York and an ancillary support facility at Orient Point, New...) for the Sale of Plum Island, NY AGENCY: Office of Real Property Utilization & Disposal; General...: Plum Island is an 840-acre island located approximately 1.5 miles off the northeast tip of Orient Point...

  6. Structural, optical and electrical properties of reactively sputtered CrxNy films: Nitrogen influence on the phase formation

    Directory of Open Access Journals (Sweden)

    Mirjana Novaković

    2017-03-01

    Full Text Available The properties of various CrxNy films grown by direct current (DC reactive sputtering process with different values of nitrogen partial pressures (0, 2×10-4, 3.5×10-4 and 5×10-4 mbar were studied. The structural analysis of the samples was performed by using X-ray diffraction and transmission electron microscopy (TEM, while an elemental analysis was realized by means of Rutherford backscattering spectrometry. By varying nitrogen partial pressure the pure Cr layer, mixture of Cr, Cr2N and CrN phases, or single-phase CrN was produced. TEM analysis showed that at pN2 = 2×10-4 mbar the layer has dense microstructure. On the other hand, the layer deposited at the highest nitrogen partial pressure exhibits pronounced columnar structure. The optical properties of CrxNy films were evaluated from spectroscopic ellipsometry data by the Drude or combined Drude and Tauc-Lorentz model. It was found that both refractive index and extinction coefficient are strongly dependent on the dominant phase formation (Cr, Cr2N, CrN during the deposition process. Finally, the electrical studies indicated the metallic character of Cr2N phase and semiconducting behaviour of CrN.

  7. Primes of the form x2+ny2 Fermat, class field theory, and complex multiplication

    CERN Document Server

    Cox, David A

    2014-01-01

    An exciting approach to the history and mathematics of number theory ". . . the author's style is totally lucid and very easy to read . . .the result is indeed a wonderful story." -Mathematical ReviewsWritten in a unique and accessible style for readers of varied mathematical backgrounds, the Second Edition of Primes of the Form p = x2+ ny2 details the history behind how Pierre de Fermat's work ultimately gave birth to quadratic reciprocity and the genus theory of quadratic forms. The book also illustrates how results of Euler and Gauss can be fully understood only in the context of class fi

  8. Strømmålinger for ny forbindelse over Limfjorden i Lindholmlinien ved Aalborg

    DEFF Research Database (Denmark)

    Burcharth, Hans F.; Larsen, Torben

    På foranledning af "Undersøgelsesgruppen af 1. maj 1975", repræsenteret ved Rambøll og Hannemann A/S, Nørresundby har laboratoriet i november og december udført en række strømmålinger i området mellem Egholm og jernbanebroen i Limfjorden ved Aalborg med henblik på at fremskaffe et grundlag...... for vurderingen af besejlingsforholdene ved en kommende ny forbindelse over limfjorden ved lindholmlinien. Ved undersøgelsens planlægning har medvirket civilingeniør J. C. Schmidt, Rambøll og Hannemann A/S, ingeniørdocent H. F. Burchart og civilingeniør Torben Larsen. Herværende rapport er udarbejdet af Torben...

  9. Remote Sensing of Surficial Process Responses to Extreme Meteorological Events

    Science.gov (United States)

    Brakenridge, G. Robert

    1997-01-01

    Changes in the frequency and magnitude of extreme meteorological events are associated with changing environmental means. Such events are important in human affairs, and can also be investigated by orbital remote sensing. During the course of this project, we applied ERS-1, ERS-2, Radarsat, and an airborne sensor (AIRSAR-TOPSAR) to measure flood extents, flood water surface profiles, and flood depths. We established a World Wide Web site (the Dartmouth Flood Observatory) for publishing remote sensing-based maps of contemporary floods worldwide; this is also an online "active archive" that presently constitutes the only global compilation of extreme flood events. We prepared an article for EOS concerning SAR imaging of the Mississippi Valley flood; an article for the International Journal of Remote Sensing on measurement of a river flood wave using ERS-2, began work on an article (since completed and published) on the Flood Observatory for a Geoscience Information Society Proceedings volume, and presented lectures at several Geol. Soc. of America Natl. Meetings, an Assoc. of Amer. Geographers Natl. Meeting, and a Binghamton Geomorphology Symposium (all on SAR remote sensing of the Mississippi Valley flood). We expanded in-house modeling capabilities by installing the latest version of the Army Corps of Engineers RMA two-dimensional hydraulics software and BYU Engineering Graphics Lab's Surface Water Modeling System (finite elements based pre- and post-processors for RMA work) and also added watershed modeling software. We are presently comparing the results of the 2-d flow models with SAR image data. The grant also supported several important upgrades of pc-based remote sensing infrastructure at Dartmouth. During work on this grant, we collaborated with several workers at the U.S. Army Corps of Engineers, Remote Sensing/GIS laboratory (for flood inundation mapping and modeling; particularly of the Illinois River using the AIRSAR/TOPSAR/ERS-2 combined data), with Dr

  10. Composition and sources of winter and summertime aerosols at Ny Alesund, Spitsbergen

    International Nuclear Information System (INIS)

    Maenhaut, W.; Cornille, P.; Pacyna, J.M.

    1991-01-01

    Filter samples of < 2.5 μm aerosol were collected in (late) winter of 1983, 1984, 1986, and 1987 and in the summer of 1984, 1986, and 1987 at Ny Alesund, Spitsbergen, and analyzed for over 40 elements by a combination of INAA and PIXE. The data sets of the various sampling campaigns and the combined winter and combined summer data were examined by receptor modeling, including absolute principal component analysis (APCA), chemical mass balance (CMB) and multiple linear regression (MLR) techniques. APCA yielded four components, both for the winter and for the summer aerosol. For the winter aerosol, the components were identified as a general pollution component, crustal dust, sea-salt, and a halogen (Br,I) component. The CMB and MLR calculations were used to obtain source (source region) apportionments for the anthropogenic trace elements and for sulfate. For the summer, about 50% of the sulfate was attributed to a marine biogenic source

  11. Correlations between physicochemical properties of PAHs and their distribution in soil, moss and reindeer dung at Ny-Alesund of the Arctic

    Energy Technology Data Exchange (ETDEWEB)

    Wang Zhen; Ma Xindong; Na Guangshui; Lin Zhongsheng [National Marine Environmental Monitoring Center, Dalian 116023 (China); Ding Qian [Environmental Science and Engineering College, Dalian Maritime University, Dalian 116026 (China); Yao Ziwei, E-mail: zwyao@nmemc.gov.c [National Marine Environmental Monitoring Center, Dalian 116023 (China)

    2009-11-15

    Concentrations of 16 polycyclic aromatic hydrocarbons (PAHs) in soil, moss and reindeer dung collected at Ny-Alesund of the Arctic were measured to investigate their accumulation trends and distribution in the three compartments. Compared with the other regions, the proportions of 2 + 3 ring PAHs to the total PAHs were higher, whereas the proportions of 5 + 6 ring PAHs were lower in the three compartments at Ny-Alesund. Significant log/log-linear relationship was observed between the sub-cooled liquid vapor pressure (p{sub L}{sup o}) and the soil/moss quotient (Q{sub SM}). The relation was similar to the relationship between the gas/particle partition coefficient (K{sub P}) and p{sub L}{sup o} of PAHs, implying Q{sub SM} would be a 'mirror image' of K{sub P}. Excellent log/log-linear relationships were observed between Q{sub SM} and K{sub OA} as well as between the moss/dung quotient (Q{sub MD}) and K{sub OW}. The results presented here indicate the physicochemical properties are suitable for characterizing the distribution of PAHs in soil, moss and reindeer dung. - The physicochemical properties of PAHs are suitable for characterizing their distribution in soil, moss and reindeer dung.

  12. Ten Year Study of the Stringently Defined Otitis Prone Child in Rochester, NY

    Science.gov (United States)

    Pichichero, Michael E.

    2016-01-01

    This review summarizes a prospective, longitudinal 10-year study in Rochester NY with virtually every clinically diagnosed acute otitis media (AOM) confirmed by bacterial culture of middle ear fluid. Children experiencing 3 episodes within 6 months or 4 episodes in 12 months were considered stringently-defined otitis prone (sOP). We found stringent diagnosis compared with clinical diagnosis reduced the frequency of children meeting the OP definition from 27% to 6% resulting in 14.8% and 2.4% receiving tympanostomy tubes, respectively. Significantly more often RSV infection led to AOM in sOP than non-otitis prone (NOP) children that correlated with diminished total RSV-specific serum IgG. sOP children produced low levels of antibody to Streptococcus pneumoniae and Haemophilus influenzae candidate vaccine protein antigens and to routine pediatric vaccines. sOP children generated significantly fewer memory B cells, functional and memory T cells to otopathogens following NP colonization and AOM than NOP children and they had defects in antigen presenting cells. PMID:27273691

  13. Rugby-metoden SCRUM: En ny måde at bedrive projekter på

    DEFF Research Database (Denmark)

    Pries-Heje, Lene; Pries-Heje, Jan

    2012-01-01

    En ny måde at bedrive projekter på breder sig i disse år med overraskende fart. Selv om de første tanker om ”Scrum” – hvor navnet og fremgangsmåden er inspireret af Rugby-spillet – blev tænkt for mere end 10 år siden, så er det først nu at fremgangsmåden for alvor har vundet udbredelse i Danmark....... Denne artikel gennemgår metoden og fortæller om både positive resultater og udfordringer i tre danske organisationer: Et softwarehus, en bank, og et universitet. De tre cases illustrer meget forskellige anvendelsessituationer af Scrum set i forhold til projekternes størrelse, karakter og den...... organisatoriske kontekst. Artiklen slutter med at diskutere, hvad det er der gør, at Scrum er blevet så populær, og i dag fremstår som et reelt alternativ til klassisk plandreven projektledelse...

  14. St. Lawrence Seaway N.Y. Feasibility Study for Additional Locks and Other Navigation Improvements: Plan of Study. Revision.

    Science.gov (United States)

    1979-11-01

    work in the marketing area in its attempt to establish a viable direct container trade. 48 200 FIG11E lI-C-1l POE LOCK CAPACITY ANALYSIS 8UJ04*1 190 ISO ...Avenue, SW Washington, DC 20591 Commissioner New York State Dept. of Comerce 112 State Street Albany, NY 12207 Commissioner New York State Dept. of Er...In the spring, we hAy’: exc,311ent fishing. AL ISO *PP59001111006V SUPLOVIS C.amotb a.,t COIN*m C lobt.. V*. MOM"ua. h"g C. 5.4. tftamw Ua A. 10"I."Hoa

  15. Evidence of the Adoption and Implementation of a Statewide Childhood Obesity Prevention Initiative in the New York State WIC Program: The "NY Fit WIC" Process Evaluation

    Science.gov (United States)

    Sekhobo, Jackson P.; Egglefield, Katherine; Edmunds, Lynn S.; Shackman, Gene

    2012-01-01

    Process evaluations are critical in determining whether outcome evaluations are warranted. This study assessed the extent to which a childhood obesity prevention initiative, "NY Fit WIC", was adopted and implemented by the New York State Supplemental Nutrition Program for Women, Infants and Children (WIC). Process data came from…

  16. Evaluation of the ceramographies of the KNK II/1 test zone fuel assembly NY-202-IA

    International Nuclear Information System (INIS)

    Geier, F.

    1983-12-01

    From the 211 fuel pins of the KNK II/1 fuel assembly NY-202-IA six intact fuel pins were selected in addition to the defective pin for destructive post-irradiation examinations in the Hot Cells of the KfK Karlsruhe. The assembly had been unloaded due to a pin failure after 192 equivalent full-power days and a maximum burnup of 5.4 %. The main aspect of these investigations was to record the fuel and fuel pin behavior and thus to allow a comparison of the status before and after irradiation. The results can also be used for comparative calculations and adaptations of existing calculational models. This report documents in detailed form the results of the fuel and fuel pin examinations [de

  17. Burden of Mental Illness and Non-communicable Diseases and Risk Factors for Mental Illness Among Refugees in Buffalo, NY, 2004-2014.

    Science.gov (United States)

    Mulugeta, Wudeneh; Xue, Hong; Glick, Myron; Min, Jungwon; Noe, Michael F; Wang, Youfa

    2018-05-21

    Limited is known about mental illness and non-communicable diseases (NCDs) and their risk factors among refugees. These were studied using data collected from a refugee population in Buffalo, NY. Longitudinal data collected on 1055 adults (> 18 years) at a large refugee health center in Buffalo, NY, during 2004-2014 were used. Main outcomes were hypertension, diabetes, tobacco use, obesity, overweight/obesity, and mental illness. Risk factors were assessed using multivariate regression models. Compared to those without mental illness, refugees with mental illness had higher rates of hypertension (16.9 vs 28.4%, P mental illness (25.4 to 36.7%, P mental illness (13.0 to 24.5%, P mental illness prevalence among refugees was 16%, ranging from 6.9% among Asians to 43.9% among Cubans. Women were more likely to have mental illness (odds ratio = 2.45; 95% confidence interval [CI] = 1.68-3.58) than men. Refugees who lived longer in the USA were more likely to carry psychiatric diagnoses (OR = 1.12; 95% CI = 1.04-1.21). Mental illness rates varied considerably across various refugee groups. Rates of obesity and NCDs among refugees with mental illness were higher than among those without mental disorders. Gender, region of origin, and length of stay in the USA were associated with mental illness. Accurate and culturally sensitive screenings and assessments of mental illness are needed to reduce these health disparities.

  18. Návrh změny metody konsolidace u vybraného konsolidovaného celku

    OpenAIRE

    Čadová, Michaela

    2017-01-01

    Téma diplomové práce je konsolidace účetní závěrky. Práce obsahuje teoretická východiska, která se týkají problematiky konsolidace účetní závěrky, a tyto poznatky jsou potom zúročeny v části praktické. Analytická část se zaobírá zhodnocením současného stavu, obsahuje tedy původní konsolidaci účetní závěrky zvolené společnosti. V návrhové části je aplikována nová metoda konsolidace účetní závěrky. Následně je zhodnocen dopad změny konsolidační metody na ekonomickou situaci konsolidačního celku...

  19. Studium tepelných vlastností materiálů akumulujících teplo na bázi fázové přeměny

    OpenAIRE

    Valentová, Kateřina

    2016-01-01

    Diplomová práce se zabývá studiem tepelných vlastností materiálů akumulující teplo na bázi fázové přeměny. Cílem této práce bylo proměřit tepelné vlastnosti materiálů využívající k akumulaci tepla fázovou přeměnu, a to především komerčního materiálu od firmy Phase Change Material Products Ltd pod názvem PlusICE A118. Takové materiály se označují jako PCM (z angl. Phase Change Material) a využívají se například jako tepelné akumulátory (izolanty) ve stavebnictví. Nejprve byly popsány fázové př...

  20. Size distributions and chemical properties of aerosol at Ny Ålesund, Svalbard

    Science.gov (United States)

    Covert, David S.; Heintzenberg, Jost

    Physical and chemical parameters of the arctic aerosol were investigated at Ny Ålesund, Svalbard, in March and April 1989 in connection with the third Arctic Gas and Aerosol Project (AGASP III). The number size distribution of the particles was measured over the range of 0.02-1.0 μm. Filter samples were analysed for elemental composition and two integral chemical properties, hygroscopic growth and volatility, were measured. Along with the latter measurements, the distribution of these properties at specific particle sizes, i.e. the degree of internal mixing, was determined. Both clean, marine conditions and "arctic haze" episodes were included in the series of measurements. The number size distribution indicated that the aerosol was well aged based on its narrowness and the relative low concentration of nuclei mode particles. It had a number mode at 0.22 μm diameter and geometric standard deviation of 1.4. Generally the particles exhibited uniform hygroscopic growth properties, i.e. they were largely internally mixed. The growth factor was 1.45 at 90% relative humidity. Approximately 40% of the overall particulate mass was volatile at a temperature of 50°C. The volatile fraction varied form particle to particle, i.e. the particles were externally mixed with respect to volatility.

  1. Oxygen vibrations in the series Bi2Sr2Ca{_{n-1}}Cu{n}O{_{4+2 n+y}}

    Science.gov (United States)

    Faulques, E.; Dupouy, P.; Lefrant, S.

    1991-06-01

    We present a discussion of the oxygen vibrations in the Bi{2}Sr{2}Ca{n-1}Cu{n}O{4+2 n+y} high T_c superconductors with the aim of interpreting Raman spectra in the case of the non-symmorphic Amaa structure. Group theory shows that the oxygen atoms belonging to the central CuO{2} plane generate a Raman activity for the n=1,3 phases. Consequently, we propose a novel assignment for the lines of weak intensity at 297, 316 and 333 cm^{-1}. It is shown that the two components of the 460 cm^{-1} band may be consistent with the Amma structure. Spectra recorded in crossed polarization exhibit weak lines which could be assigned to B {1g} modes expected for the three phases. Nous présentons une discussion sur les vibrations des atomes d'oxygène dans la série des supraconducteurs Bi{2}Sr{2}Ca{n-1}Cu{n}O{4+2 n+y} dans le but d'interpréter les spectres Raman. L'analyse des modes normaux de vibration de la structure Amaa pour les phases n=1 ou 3 montre que les atomes d'oxygène du plan CuO{2} contenant les centres d'inversion donnent lieu à une activité Raman. En conséquence, nous proposons une nouvelle attribution pour les raies de faible intensité à 297, 316 et 333 cm^{-1}. Nous montrons que le dédoublement de la bande à 460 cm^{-1} pourrait être dû à la structure Amaa. Les spectres enregistrés en polarization croisée montrent de faibles bandes qui peuvent être attribuées aux modes B {1g} attendus pour les trois phases.

  2. Double-difference relocation of the 29 January 2011 ML 4.5 Oroszlány earthquake and its aftershocks and its relevance to the rheology of the lithosphere and geothermal prospectivity

    NARCIS (Netherlands)

    Békési, E.; Süle, B.; Lenkey, L.; Lenkey-Bőgér, Á.; Bondár, I.

    2017-01-01

    In the central part of Hungary, an earthquake with the local magnitude of 4.5 occurred near the town of Oroszlány, on 29 January 2011. The main shock and its more than 200 aftershocks were recorded by a significant number of three-component seismic stations, which enabled us to perform multiple

  3. Post-irradiation examinations on the KNK II/1 fuel element NY-203 with 400 equivalent full-power days residence time and 10 % burnup

    International Nuclear Information System (INIS)

    Patzer, G.; Geier, F.

    1984-09-01

    The fuel assembly NY-203 has been irradiated in the first core of KNK II up to a burnup of about 10 % and a residence time of 400 equivalent full-power days. The assembly contained 211 fuel pins with 6.0 mm outer diameter and fuel pellets with the composition (U 0 .7Pu 0 .3)O 2 .00. The cladding material was the austenitic steel 1.4988 lg. Some selected pins were examined in the hot cells of the KfK Karlsruhe. The post-irradiation examinations did not reveal any critical design aspects [de

  4. Estimation of the annual primary production of the lichen Cetrariella delisei in a glacier foreland in the High Arctic, Ny-Ålesund, Svalbard

    OpenAIRE

    Uchida, Masaki; Nakatsubo, Takayuki; Kanda, Hiroshi; Koizumi, Hiroshi

    2006-01-01

    The fruticose lichen Cetrariella delisei is among the dominant lichen species in the deglaciated High Arctic areas of Svalbard. As part of a study of carbon cycling in the High Arctic, we aimed to estimate the primary production of lichen in a deglaciated area in Ny-Ålesund, Svalbard (79° N), by examining the effects of abiotic factors on the net photosynthesis (Pn) and dark respiration (R) rates of C. delisei. Experiments were conducted in the snow-free season of 2000 using an open-fl ow gas...

  5. National Dam Safety Program. Larchwood Lake Dam (Inventory Number NY 727), Susquehanna River Basin, Otsego County, New York. Phase I Inspection Report,

    Science.gov (United States)

    1981-08-04

    8217 IELT OR BASE FLOw. USE VALUE i9?OF’ N. Y STATE NAMP - MINI/tM W’ RUNOFF (1ANm~s/DAy) FOR DEE,4-,/w,6 7W P-S/ r’ Pslic 2/6 t US5E 0. (/1IAy D-9...RESOURCES COMMISSION CONSERVATION DEPARTMENT ALBANY, N.Y. 12226 Do Not Write in This Box AppI. No. _____411_____V/ Darn No. __ __ __ __ Permit No. Watershed...extent and in such time and manner also notify him promptly in writing of the completion of the as the Water Resources Commission may require, remove

  6. Trends of fruit and vegetable availability in neighbourhoods in Albany, NY, USA, 2003-2012.

    Science.gov (United States)

    Hosler, Akiko S; Kammer, Jamie R

    2015-02-01

    To investigate a 9-year trend of fresh fruit and vegetable availability and factors associated with the net availability change in two contrasting neighbourhoods. Longitudinal design. Data were collected in 2003, 2009 and 2012 through in-store observations. Fresh fruit and vegetable availability was presented by weight-adjusted counts of stores having designated varieties per 10 000 population. A low-income minority neighbourhood and an adjacent middle-income racially mixed neighbourhood in Albany, NY, USA. These neighbourhoods became sites of fresh produce interventions after baseline data were collected. A total of 111, 128 and 146 eligible food stores in respective years. Fresh fruit availability (two or more varieties) increased in both neighbourhoods. Inventory expansion of existing stores and the convenience store intervention contributed to the significant increase (P for trend=0·04) of fresh fruit availability in the minority neighbourhood. Although not statistically significant (P>0·05), the availability of two or more dark-coloured fresh vegetables also increased in the mixed neighbourhood, but declined slightly in the minority neighbourhood. The secular (non-intervention) fresh vegetable availability rate ratio by neighbourhood reached 3·0 in 2012 (Pconvenience store intervention to address the fresh vegetable disparity.

  7. Ground-based lidar measurements from Ny-Ålesund during ASTAR 2007

    Directory of Open Access Journals (Sweden)

    A. Herber

    2009-11-01

    Full Text Available During the Arctic Study of Tropospheric Aerosol, Clouds and Radiation (ASTAR in March and April 2007, measurements obtained at the AWIPEV Arctic Research Base in Ny-Ålesund, Spitsbergen at 78.9° N, 11.9° E (operated by the Alfred Wegener Institute for Polar and Marine Research – AWI and the Institut polaire français Paul-Emile Victor – IPEV, supported the airborne campaign. This included lidar data from the Koldewey Aerosol Raman Lidar (KARL and the Micro Pulse Lidar (MPL, located in the atmospheric observatory as well as photometer data and the daily launched radiosonde. The MPL features nearly continuous measurements; the KARL was switched on whenever weather conditions allowed observations (145 h in 61 days. From 1 March to 30 April, 71 meteorological balloon soundings were performed and compared with the concurrent MPL measurements; photometer measurements are available from 18 March. For the KARL data, a statistical overview of particle detection based on their optical properties backscatter ratio and volume depolarization can be given. The altitudes of the occurrence of the named features (subvisible and visible ice and water as well as mixed-phase clouds, aerosol layers as well as their dependence on different air mass origins are analyzed. Although the spring 2007 was characterized by rather clean conditions, diverse case studies of cloud and aerosol occurrence during March and April 2007 are presented in more detail, including temporal development and main optical properties as depolarization, backscatter and extinction coefficients. Links between air mass origins and optical properties can be presumed but need further evidence.

  8. Nanocrystalline Si pathway induced unipolar resistive switching behavior from annealed Si-rich SiNx/SiNy multilayers

    Science.gov (United States)

    Jiang, Xiaofan; Ma, Zhongyuan; Yang, Huafeng; Yu, Jie; Wang, Wen; Zhang, Wenping; Li, Wei; Xu, Jun; Xu, Ling; Chen, Kunji; Huang, Xinfan; Feng, Duan

    2014-09-01

    Adding a resistive switching functionality to a silicon microelectronic chip is a new challenge in materials research. Here, we demonstrate that unipolar and electrode-independent resistive switching effects can be realized in the annealed Si-rich SiNx/SiNy multilayers with high on/off ratio of 109. High resolution transmission electron microscopy reveals that for the high resistance state broken pathways composed of discrete nanocrystalline silicon (nc-Si) exist in the Si nitride multilayers. While for the low resistance state the discrete nc-Si regions is connected, forming continuous nc-Si pathways. Based on the analysis of the temperature dependent I-V characteristics and HRTEM photos, we found that the break-and-bridge evolution of nc-Si pathway is the origin of resistive switching memory behavior. Our findings provide insights into the mechanism of the resistive switching behavior in nc-Si films, opening a way for it to be utilized as a material in Si-based memories.

  9. Vertical Profiles and Chemical Properties of Aerosol Particles upon Ny-Ålesund (Svalbard Islands

    Directory of Open Access Journals (Sweden)

    B. Moroni

    2015-01-01

    Full Text Available Size-segregated particle samples were collected in the Arctic (Ny-Ålesund, Svalbard in April 2011 both at ground level and in the free atmosphere exploiting a tethered balloon equipped also with an optical particle counter (OPC and meteorological sensors. Individual particle properties were investigated by scanning electron microscopy coupled with energy dispersive microanalysis (SEM-EDS. Results of the SEM-EDS were integrated with particle size and optical measurements of the aerosols properties at ground level and along the vertical profiles. Detailed analysis of two case studies reveals significant differences in composition despite the similar structure (layering and the comparable texture (grain size distribution of particles in the air column. Differences in the mineral chemistry of samples point at both local (plutonic/metamorphic complexes in Svalbard and remote (basic/ultrabasic magmatic complexes in Greenland and/or Iceland geological source regions for dust. Differences in the particle size and shape are put into relationship with the mechanism of particle formation, that is, primary (well sorted, small or secondary (idiomorphic, fine to coarse grained origin for chloride and sulfate crystals and transport/settling for soil (silicate, carbonate and metal oxide particles. The influence of size, shape, and mixing state of particles on ice nucleation and radiative properties is also discussed.

  10. Preliminary Results from the First Deployment of a Tethered-Balloon Cloud Particle Imager Instrument Package in Arctic Stratus Clouds at Ny-Alesund

    Science.gov (United States)

    Lawson, P.; Stamnes, K.; Stamnes, J.; Zmarzly, P.; O'Connor, D.; Koskulics, J.; Hamre, B.

    2008-12-01

    A tethered balloon system specifically designed to collect microphysical data in mixed-phase clouds was deployed in Arctic stratus clouds during May 2008 near Ny-Alesund, Svalbard, at 79 degrees North Latitude. This is the first time a tethered balloon system with a cloud particle imager (CPI) that records high-resolution digital images of cloud drops and ice particles has been operated in cloud. The custom tether supplies electrical power to the instrument package, which in addition to the CPI houses a 4-pi short-wavelength radiometer and a met package that measures temperature, humidity, pressure, GPS position, wind speed and direction. The instrument package was profiled vertically through cloud up to altitudes of 1.6 km. Since power was supplied to the instrument package from the ground, it was possible to keep the balloon package aloft for extended periods of time, up to 9 hours at Ny- Ålesund, which was limited only by crew fatigue. CPI images of cloud drops and the sizes, shapes and degree of riming of ice particles are shown throughout vertical profiles of Arctic stratus clouds. The images show large regions of mixed-phase cloud from -8 to -2 C. The predominant ice crystal habits in these regions are needles and aggregates of needles. The amount of ice in the mixed-phase clouds varied considerably and did not appear to be a function of temperature. On some occasions, ice was observed near cloud base at -2 C with supercooled cloud above to - 8 C that was devoid of ice. Measurements of shortwave radiation are also presented. Correlations between particle distributions and radiative measurements will be analyzed to determine the effect of these Arctic stratus clouds on radiative forcing.

  11. The distribution of depleted uranium contamination in Colonie, NY, USA

    International Nuclear Information System (INIS)

    Lloyd, N.S.; Chenery, S.R.N.; Parrish, R.R.

    2009-01-01

    Uranium oxide particles were dispersed into the environment from a factory in Colonie (NY, USA) by prevailing winds during the 1960s and '70s. Uranium concentrations and isotope ratios from bulk soil samples have been accurately measured using inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) without the need for analyte separation chemistry. The natural range of uranium concentrations in the Colonie soils has been estimated as 0.7-2.1 μg g -1 , with a weighted geometric mean of 1.05 μg g -1 ; the contaminated soil samples comprise uranium up to 500 ± 40 μg g -1 . A plot of 236 U/ 238 U against 235 U/ 238 U isotope ratios describes a mixing line between natural uranium and depleted uranium (DU) in bulk soil samples; scatter from this line can be accounted for by heterogeneity in the DU particulate. The end-member of DU compositions aggregated in these bulk samples comprises (2.05 ± 0.06) x 10 -3235 U/ 238 U, (3.2 ± 0.1) x 10 -5236 U/ 238 U, and (7.1 ± 0.3) x 10 -6234 U/ 238 U. The analytical method is sensitive to as little as 50 ng g -1 DU mixed with the natural uranium occurring in these soils. The contamination footprint has been mapped northward from site, and at least one third of the uranium in a soil sample from the surface 5 cm, collected 5.1 km NNW of the site, is DU. The distribution of contamination within the surface soil horizon follows a trend of exponential decrease with depth, which can be approximated by a simple diffusion model. Bioturbation by earthworms can account for dispersal of contaminant from the soil surface, in the form of primary uranium oxide particulates, and uranyl species that are adsorbed to organic matter. Considering this distribution, the total mass of uranium contamination emitted from the factory is estimated to be c. 4.8 tonnes.

  12. The distribution of depleted uranium contamination in Colonie, NY, USA

    Energy Technology Data Exchange (ETDEWEB)

    Lloyd, N.S., E-mail: nsl3@alumni.leicester.ac.uk [Department of Geology, University of Leicester, University Road, Leicester, LE1 7RH (United Kingdom); Chenery, S.R.N. [British Geological Survey, Kingsley Dunham Centre, Keyworth, Nottingham, NG12 5GG (United Kingdom); Parrish, R.R. [Department of Geology, University of Leicester, University Road, Leicester, LE1 7RH (United Kingdom); NERC Isotope Geosciences Laboratory, Kingsley Dunham Centre, Keyworth, Nottingham, NG12 5GG (United Kingdom)

    2009-12-20

    Uranium oxide particles were dispersed into the environment from a factory in Colonie (NY, USA) by prevailing winds during the 1960s and '70s. Uranium concentrations and isotope ratios from bulk soil samples have been accurately measured using inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) without the need for analyte separation chemistry. The natural range of uranium concentrations in the Colonie soils has been estimated as 0.7-2.1 {mu}g g{sup -1}, with a weighted geometric mean of 1.05 {mu}g g{sup -1}; the contaminated soil samples comprise uranium up to 500 {+-} 40 {mu}g g{sup -1}. A plot of {sup 236}U/{sup 238}U against {sup 235}U/{sup 238}U isotope ratios describes a mixing line between natural uranium and depleted uranium (DU) in bulk soil samples; scatter from this line can be accounted for by heterogeneity in the DU particulate. The end-member of DU compositions aggregated in these bulk samples comprises (2.05 {+-} 0.06) x 10{sup -3235}U/{sup 238}U, (3.2 {+-} 0.1) x 10{sup -5236}U/{sup 238}U, and (7.1 {+-} 0.3) x 10{sup -6234}U/{sup 238}U. The analytical method is sensitive to as little as 50 ng g{sup -1} DU mixed with the natural uranium occurring in these soils. The contamination footprint has been mapped northward from site, and at least one third of the uranium in a soil sample from the surface 5 cm, collected 5.1 km NNW of the site, is DU. The distribution of contamination within the surface soil horizon follows a trend of exponential decrease with depth, which can be approximated by a simple diffusion model. Bioturbation by earthworms can account for dispersal of contaminant from the soil surface, in the form of primary uranium oxide particulates, and uranyl species that are adsorbed to organic matter. Considering this distribution, the total mass of uranium contamination emitted from the factory is estimated to be c. 4.8 tonnes.

  13. Alongshore Momentum Balance Over Shoreface-Connected Ridges, Fire Island, NY

    Science.gov (United States)

    Ofsthun, C.; Wu, X.; Voulgaris, G.; Warner, J. C.

    2016-12-01

    he momentum balance of alongshore flows over straight, uniform shelfs has been analyzed extensively over the last few decades. More recently, the effect of coastline curvature and how this might alter the relative significance of the momentum terms has received additional attention. In this contribution, the alongshore momentum over shelves with straight coastline, but non-uniform bathymetry is examined. Hydrodynamic and hydrographic data collected by the US Geological Survey (Fire Island Coastal Change project) on the inner shelf of Fire Island, NY over a region of shore-face connected ridges (SFCRs) are used to describe wind-induced circulation and the terms of the alongshore momentum balance equation. Analysis of the data revealed a predominantly alongshore circulation, under westward wind forcing, with localized offshore (onshore) current veering over the ridge crests (troughs). Momentum balance analysis hinted that local acceleration, advective acceleration, and bottom stress are balanced by wind stress and regional (>100 km) pressure gradient force. In addition, a numerical model using an idealized SFCR bathymetry, forced by our observed winds, was employed to compare the momentum balance relationships identified by the data and those under steady-state conditions published earlier (Warner et al., 2014). A synthesis of the numerical and experimental data revealed that the true pressure gradient force results from the sum of local pressure gradient force, which maintains a Bernoulli-like relationship with alongshore advective acceleration, and regional pressure gradient force, which maintains a strong, negative relationship with wind stress. The differences between steady-state and realistic conditions is mainly on the contributions of regional scale pressure gradients that develop under realistic conditions, and the reduced contribution of local scale pressure gradients which develop best under steady-state conditions. Our analysis indicates that current

  14. American Fisheries Society 136th Annual Meeting Lake Placid, NY 10-14 September, 2006

    Science.gov (United States)

    Einhouse, D.; Walsh, M.G.; Keeler, S.; Long, J.M.

    2005-01-01

    The New York Chapter of the American Fisheries Society and the New York State Department of Environmental Conservation invite you to experience the beauty of New York's famous Adirondack Park as the American Fisheries Society (AFS) convenes its 136th Annual Meeting in the legendary Olympic Village of Lake Placid, NY, 10-14 September 2006. Our meeting theme "Fish in the Balance" will explore the interrelation between fish, aquatic habitats, and man, highlighting the challenges facing aquatic resource professionals and the methods that have been employed to resolve conflicts between those that use or have an interest in our aquatic resources. As fragile as it is beautiful, the Adirondack Region is the perfect location to explore this theme. Bordered by Mirror Lake and its namesake, Lake Placid, the Village of Lake Placid has small town charm, but all of the conveniences that a big city would provide. Whether its reliving the magic of the 1980 hockey team's "Miracle on Ice" at the Lake Placid Olympic Center, getting a panoramic view of the Adirondack high peaks from the top of the 90 meter ski jumps, fishing or kayaking in adjacent Mirror Lake, hiking a mountain trail, or enjoying a quiet dinner or shopping excursion in the various shops and restaurants that line Main Street, Lake Placid has something for everyone.

  15. Dynamisk Ledarutveckling : En ny metod för personlig utveckling av ledare skapad genom integration av två etablerade metoder för personlig utveckling

    OpenAIRE

    Rudbäck, Marie-Christine

    2013-01-01

    Syftet med denna studie är att teoretiskt pröva att integrera en etablerad metod för personlig utveckling, The Skilled Helper, med metoden Dynamisk Pedagogik och skapa en ny metod för en specifik tillämpning, personlig utveckling av ledare. Integrationen görs med hjälp av en etablerad metametod för metodutveckling. De bägge ingående metoderna värderas enligt fastställda kriterier. Samma kriterier används sedan för att värdera den nya metod som designas. Med detta har studien uppnått en jämför...

  16. Simultaneous cytoplasmic and nuclear protein expression of melanoma antigen-A family and NY-ESO-1 cancer-testis antigens represents an independent marker for poor survival in head and neck cancer.

    Science.gov (United States)

    Laban, Simon; Atanackovic, Djordje; Luetkens, Tim; Knecht, Rainald; Busch, Chia-Jung; Freytag, Marcus; Spagnoli, Giulio; Ritter, Gerd; Hoffmann, Thomas K; Knuth, Alexander; Sauter, Guido; Wilczak, Waldemar; Blessmann, Marco; Borgmann, Kerstin; Muenscher, Adrian; Clauditz, Till S

    2014-09-01

    The prognosis of head and neck squamous cell carcinoma (HNSCC) patients remains poor. The identification of high-risk subgroups is needed for the development of custom-tailored therapies. The expression of cancer-testis antigens (CTAs) has been linked to a worse prognosis in other cancer types; however, their prognostic value in HNSCC is unclear because only few patients have been examined and data on CTA protein expression are sparse. A tissue microarray consisting of tumor samples from 453 HNSCC patients was evaluated for the expression of CTA proteins using immunohistochemistry. Frequency of expression and the subcellular expression pattern (nuclear, cytoplasmic, or both) was recorded. Protein expression of melanoma antigen (MAGE)-A family CTA, MAGE-C family CTA and NY-ESO-1 was found in approximately 30, 7 and 4% of tumors, respectively. The subcellular expression pattern in particular had a marked impact on the patients' prognosis. Median overall survival (OS) of patients with (i) simultaneous cytoplasmic and nuclear expression compared to (ii) either cytoplasmic or nuclear expression and (iii) negative patients was 23.0 versus 109.0 versus 102.5 months, for pan-MAGE (p family members or NY-ESO-1 represent a subgroup with an extraordinarily poor survival. The development of immunotherapeutic strategies targeting these CTA may, therefore, be a promising approach to improve the outcome of HNSCC patients. © 2014 UICC.

  17. Metallographic examinations of the wear-marks on fuel pins of the KNK II/2 fuel assembly NY-308

    International Nuclear Information System (INIS)

    Patzer, G.

    1987-12-01

    On the fuel pins and pin spacers of the fuel assembly NY-308 of the second core of KNK II pronounced wear marks had been found in the area of the contact points. In order to determine the exact form of the marks, metallographic investigations were performed on two test pieces of fuel pins in the Hot Cells of the KfK Karlsruhe. It was found that the wear marks did show the already observed stratified structure. Next to the unchanged cladding area there is a peripheral zone with modified grain structure, followed by a layer of moved material and finally there is a flake-like zone of accumulated cladding material at the lower end of the wear marks. Longitudinal cuts do not show grain deformations, which could indicate axial friction forces between pin and spacer. The wear marks are rapidly dropping to their maximum depth at the ends and the depth shows a relatively uniform pattern between both. The findings are confirming the picture, that a stirring movement of the fuel pins took place, which caused adhesive wear [de

  18. Depleted and enriched uranium exposure quantified in former factory workers and local residents of NL Industries, Colonie, NY USA

    International Nuclear Information System (INIS)

    Arnason, John G.; Pellegri, Christine N.; Moore, June L.; Lewis-Michl, Elizabeth L.; Parsons, Patrick J.

    2016-01-01

    Background: Between 1958 and 1982, NL Industries manufactured components of enriched (EU) and depleted uranium (DU) at a factory in Colonie NY, USA. More than 5 metric tons of DU was deposited as microscopic DU oxide particles on the plant site and surrounding residential community. A prior study involving a small number of individuals (n=23) indicated some residents were exposed to DU and former workers to both DU and EU, most probably through inhalation of aerosol particles. Objectives: Our aim was to measure total uranium [U] and the uranium isotope ratios: 234 U/ 238 U; 235 U/ 238 U; and 236 U/ 238 U, in the urine of a cohort of former workers and nearby residents of the NLI factory, to characterize individual exposure to natural uranium (NU), DU, and EU more than 3 decades after production ceased. Methods: We conducted a biomonitoring study in a larger cohort of 32 former workers and 99 residents, who may have been exposed during its period of operation, by measuring Total U, NU, DU, and EU in urine using Sector Field Inductively Coupled Plasma - Mass Spectrometry (SF-ICP-MS). Results: Among workers, 84% were exposed to DU, 9% to EU and DU, and 6% to natural uranium (NU) only. For those exposed to DU, urinary isotopic and [U] compositions result from binary mixing of NU and the DU plant feedstock. Among residents, 8% show evidence of DU exposure, whereas none shows evidence of EU exposure. For residents, the [U] geometric mean is significantly below the value reported for NHANES. There is no significant difference in [U] between exposed and unexposed residents, suggesting that [U] alone is not a reliable indicator of exposure to DU in this group. Conclusions: Ninety four percent of workers tested showed evidence of exposure to DU, EU or both, and were still excreting DU and EU decades after leaving the workforce. The study demonstrates the advantage of measuring multiple isotopic ratios (e.g., 236 U/ 238 U and 235 U/ 238 U) over a single ratio ( 235 U/ 238 U

  19. [Diagnostic criteria for Menière's disease according to the Classification Committee of the Bárány Society].

    Science.gov (United States)

    Lopez-Escamez, J A; Carey, J; Chung, W-H; Goebel, J A; Magnusson, M; Mandalà, M; Newman-Toker, D E; Strupp, M; Suzuki, M; Trabalzini, F; Bisdorff, A

    2017-11-01

    This paper presents diagnostic criteria for Menière's disease jointly formulated by the Classification Committee of the Bárány Society, The Japan Society for Equilibrium Research, the European Academy of Otology and Neurotology (EAONO), the Equilibrium Committee of the American Academy of Otolaryngology-Head and Neck Surgery (AAO-HNS) and the Korean Balance Society. The classification includes two categories: definite Menière's disease and probable Menière's disease. The diagnosis of definite Menière's disease is based on clinical criteria and requires the observation of an episodic vertigo syndrome associated with low- to medium-frequency sensorineural hearing loss and fluctuating aural symptoms (hearing, tinnitus and/or fullness) in the affected ear. Duration of vertigo episodes is limited to a period between 20 min and 12 h. Probable Menière's disease is a broader concept defined by episodic vestibular symptoms (vertigo or dizziness) associated with fluctuating aural symptoms occurring in a period from 20 min to 24 h.

  20. Depleted and enriched uranium exposure quantified in former factory workers and local residents of NL Industries, Colonie, NY USA

    Energy Technology Data Exchange (ETDEWEB)

    Arnason, John G. [Laboratory of Inorganic and Nuclear Chemistry, Wadsworth Center, New York State Department of Health, P.O. Box 509, Albany, NY 12201-0509 (United States); Department of Environmental Health Sciences, School of Public Health, The University at Albany, P.O. Box 509, Albany, NY 12201-0509 (United States); Pellegri, Christine N. [Laboratory of Inorganic and Nuclear Chemistry, Wadsworth Center, New York State Department of Health, P.O. Box 509, Albany, NY 12201-0509 (United States); Moore, June L.; Lewis-Michl, Elizabeth L. [Bureau of Environmental and Occupational Epidemiology, Center for Environmental Health, New York State Department of Health, Albany, NY (United States); Parsons, Patrick J., E-mail: patrick.parsons@health.ny.gov [Laboratory of Inorganic and Nuclear Chemistry, Wadsworth Center, New York State Department of Health, P.O. Box 509, Albany, NY 12201-0509 (United States); Department of Environmental Health Sciences, School of Public Health, The University at Albany, P.O. Box 509, Albany, NY 12201-0509 (United States)

    2016-10-15

    Background: Between 1958 and 1982, NL Industries manufactured components of enriched (EU) and depleted uranium (DU) at a factory in Colonie NY, USA. More than 5 metric tons of DU was deposited as microscopic DU oxide particles on the plant site and surrounding residential community. A prior study involving a small number of individuals (n=23) indicated some residents were exposed to DU and former workers to both DU and EU, most probably through inhalation of aerosol particles. Objectives: Our aim was to measure total uranium [U] and the uranium isotope ratios: {sup 234}U/{sup 238}U; {sup 235}U/{sup 238}U; and {sup 236}U/{sup 238}U, in the urine of a cohort of former workers and nearby residents of the NLI factory, to characterize individual exposure to natural uranium (NU), DU, and EU more than 3 decades after production ceased. Methods: We conducted a biomonitoring study in a larger cohort of 32 former workers and 99 residents, who may have been exposed during its period of operation, by measuring Total U, NU, DU, and EU in urine using Sector Field Inductively Coupled Plasma - Mass Spectrometry (SF-ICP-MS). Results: Among workers, 84% were exposed to DU, 9% to EU and DU, and 6% to natural uranium (NU) only. For those exposed to DU, urinary isotopic and [U] compositions result from binary mixing of NU and the DU plant feedstock. Among residents, 8% show evidence of DU exposure, whereas none shows evidence of EU exposure. For residents, the [U] geometric mean is significantly below the value reported for NHANES. There is no significant difference in [U] between exposed and unexposed residents, suggesting that [U] alone is not a reliable indicator of exposure to DU in this group. Conclusions: Ninety four percent of workers tested showed evidence of exposure to DU, EU or both, and were still excreting DU and EU decades after leaving the workforce. The study demonstrates the advantage of measuring multiple isotopic ratios (e.g., {sup 236}U/{sup 238}U and {sup 235}U

  1. Fuel and fuel pin behaviour in a high burnup fast breeder fuel subassembly: Results of destructive post-irradiation examinations of the KNK II/1 fuel subassembly NY-205

    International Nuclear Information System (INIS)

    Patzer, G.

    1991-05-01

    The report gives a summarizing overview of the design characteristics, of the irradiation history and of the results of the destructive post-irradiation examinations of the fuel pins of the high-burnup fuel subassembly NY-205 of the KNK II first core. This element was operated for about 10 years and reached a maximum local burnup of 175 MWd/kg(HM) and a maximum neutron dose of 67 dpa-NRT. The main design data of this subassembly agree with those of the SNR 300 Mark-Ia, and it reached more than twice of the burnup and a similar neutron dose as foreseen for the SNR 300 fuel subassemblies [de

  2. Reintroduction of Lake Sturgeon (Acipenser fulvescens) into the St. Regis River, NY: Post-release assessment of habitat use and growth

    Science.gov (United States)

    Dittman, Dawn E.; Chalupnicki, Marc A.; Johnson, James H.; Snyder, James

    2015-01-01

    One of the depleted endemic fish species of the Great Lakes, Acipenser fulvescens (Lake Sturgeon), has been the target of extensive conservation efforts. One strategy is reintroduction into historically productive waters. The St. Regis River, NY, represents one such adaptive-management effort, with shared management between New York and the St. Regis Mohawk Tribe. Between 1998 and 2004, a total of 4977 young-of-year Lake Sturgeon were released. Adaptive management requires intermediate progress metrics. During 2004 and 2005, we measured growth, habitat use, and survivorship metrics of the released fish. We captured a total of 95 individuals of all stocked ages. Year-class minimal-survival rates ranged from 0.19–2.1%. The size-at-age and length/biomass relationships were comparable to those reported for juveniles in other Great Lakes waters. These intermediate assessment metrics can provide feedback to resource managers who make restoration-program decisions on a much shorter time-scale than the time-frame in which the ultimate goal of a self-sustaining population can be attained.

  3. Seasonal Progression of the Deposition of Black Carbon by Snowfall at Ny-Ålesund, Spitsbergen

    Science.gov (United States)

    Sinha, P. R.; Kondo, Y.; Goto-Azuma, K.; Tsukagawa, Y.; Fukuda, K.; Koike, M.; Ohata, S.; Moteki, N.; Mori, T.; Oshima, N.; Førland, E. J.; Irwin, M.; Gallet, J.-C.; Pedersen, C. A.

    2018-01-01

    Deposition of black carbon (BC) aerosol in the Arctic lowers snow albedo, thus contributing to warming in the region. However, the processes and impacts associated with BC deposition are poorly understood because of the scarcity and uncertainties of measurements of BC in snow with adequate spatiotemporal resolution. We sampled snowpack at two sites (11 m and 300 m above sea level) at Ny-Ålesund, Spitsbergen, in April 2013. We also collected falling snow near the surface with a windsock from September 2012 to April 2013. The size distribution of BC in snowpack and falling snow was measured using a single-particle soot photometer combined with a characterized nebulizer. The BC size distributions did not show significant variations with depth in the snowpack, suggesting stable size distributions in falling snow. The BC number and mass concentrations (CNBC and CMBC) at the two sites agreed to within 19% and 10%, respectively, despite the sites' different snow water equivalent (SWE) loadings. This indicates the small influence of the amount of SWE (or precipitation) on these quantities. Average CNBC and CMBC in snowpack and falling snow at nearly the same locations agreed to within 5% and 16%, after small corrections for artifacts associated with the sampling of the falling snow. This comparison shows that the dry deposition was a small contributor to the total BC deposition. CMBC were highest (2.4 ± 3.0 μg L-1) in December-February and lowest (1.2 ± 1.2 μg L-1) in September-November.

  4. Summer indoor heat exposure and respiratory and cardiovascular distress calls in New York City, NY, U.S.

    Science.gov (United States)

    Uejio, C K; Tamerius, J D; Vredenburg, J; Asaeda, G; Isaacs, D A; Braun, J; Quinn, A; Freese, J P

    2016-08-01

    Most extreme heat studies relate outdoor weather conditions to human morbidity and mortality. In developed nations, individuals spend ~90% of their time indoors. This pilot study investigated the indoor environments of people receiving emergency medical care in New York City, NY, U.S., from July to August 2013. The first objective was to determine the relative influence of outdoor conditions as well as patient characteristics and neighborhood sociodemographics on indoor temperature and specific humidity (N = 764). The second objective was to determine whether cardiovascular or respiratory cases experience hotter and more humid indoor conditions as compared to controls. Paramedics carried portable sensors into buildings where patients received care to passively monitor indoor temperature and humidity. The case-control study compared 338 respiratory cases, 291 cardiovascular cases, and 471 controls. Intuitively, warmer and sunnier outdoor conditions increased indoor temperatures. Older patients who received emergency care tended to occupy warmer buildings. Indoor-specific humidity levels quickly adjusted to outdoor conditions. Indoor heat and humidity exposure above a 26 °C threshold increased (OR: 1.63, 95% CI: 0.98-2.68, P = 0.056), but not significantly, the proportion of respiratory cases. Indoor heat exposures were similar between cardiovascular cases and controls. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  5. Controls on Nitrous Oxide Production in, and Fluxes from a Coastal Aquifer in Long Island, NY, USA

    Directory of Open Access Journals (Sweden)

    Caitlin Young

    2016-11-01

    Full Text Available Nitrous oxide (N2O has 265 times greater greenhouse potential than carbon dioxide and its atmospheric concentration has increased by about 20% since industrialization; however, N2O production and emissions from aquatic systems are poorly constrained. To evaluate N2O fluxes associated with meteoric groundwater discharge to coastal zones, we measured N2O concentrations in May and October 2011 from two discharge points of the Upper Glacial aquifer on Long Island, NY, USA. One coastal zone contains only fresh water and the other contains an upper saline zone. N2O concentrations decreased by around 40% for the fresh water and a factor of two for the salt water from May to October, 2011. Fluxes were around 100 to 200 times greater from the freshwater (246 to 448 µmol/m shoreline/day than saltwater aquifer (26.1 to 26.5 µmol/m shoreline/day. N2O concentrations correlate positively with NO3− and dissolved oxygen concentrations and negatively with salinity, dissolved organic carbon (DOC and N2 denitrification concentrations. The smaller saltwater N2O export resulted from DOC enrichment in the upper saline zone, which appears to have driven denitrification to completion, removed N2O, and increased N2 denitrification. DOC concentrations should be considered in global N2O flux estimates for coastal aquifers.

  6. Comparison of sources of submicron particle number concentrations measured at two sites in Rochester, NY.

    Science.gov (United States)

    Kasumba, John; Hopke, Philip K; Chalupa, David C; Utell, Mark J

    2009-09-01

    Sources contributing to the submicron particles (100-470 nm) measured between January 2002 and December 2007 at two different New York State Department of Environmental Conservation (NYS DEC) sites in Rochester, NY were identified and apportioned using a bilinear receptor model, positive matrix factorization (PMF). Measurements of aerosol size distributions and number concentrations for particles in the size range of 10-500 nm have been made since December 2001 to date in Rochester. The measurements are being made using a scanning mobility particle sizer (SMPS) consisting of a DMA and a CPC (TSI models 3071 and 3010, respectively). From December 2001 to March 2004, particle measurements were made at the NYS DEC site in downtown Rochester, but it was moved to the eastside of Rochester in May 2004. Each measurement period was divided into three seasons i.e., winter (December, January, and February), summer (June, July, and August), and the transitional periods (March, April, May, September, October, and November) so as to avoid experimental uncertainty resulting from too large season-to-season variability in ambient temperature and solar photon intensity that would lead to unstable/non-stationary size distributions. Therefore, the seasons were analyzed independently for possible sources. Ten sources were identified at both sites and these include traffic, nucleation, residential/commercial heating, industrial emissions, secondary nitrate, ozone- rich secondary aerosol, secondary sulfate, regionally transported aerosol, and a mixed source of nucleation and traffic. These results show that the measured total outdoor particle number concentrations in Rochester generally vary with similar temporal patterns, suggesting that the central monitoring site data can be used to estimate outdoor exposure in other parts of the city.

  7. Vertical variability of aerosol single-scattering albedo and equivalent black carbon concentration based on in-situ and remote sensing techniques during the iAREA campaigns in Ny-Ålesund

    Science.gov (United States)

    Markowicz, K. M.; Ritter, C.; Lisok, J.; Makuch, P.; Stachlewska, I. S.; Cappelletti, D.; Mazzola, M.; Chilinski, M. T.

    2017-09-01

    This work presents a methodology for obtaining vertical profiles of aerosol single scattering properties based on a combination of different measurement techniques. The presented data were obtained under the iAREA (Impact of absorbing aerosols on radiative forcing in the European Arctic) campaigns conducted in Ny-Ålesund (Spitsbergen) during the spring seasons of 2015-2017. The retrieval uses in-situ observations of black carbon concentration and absorption coefficient measured by a micro-aethalometer AE-51 mounted onboard a tethered balloon, as well as remote sensing data obtained from sun photometer and lidar measurements. From a combination of the balloon-borne in-situ and the lidar data, we derived profiles of single scattering albedo (SSA) as well as absorption, extinction, and aerosol number concentration. Results have been obtained in an altitude range from about 400 m up to 1600 m a.s.l. and for cases with increased aerosol load during the Arctic haze seasons of 2015 and 2016. The main results consist of the observation of increasing values of equivalent black carbon (EBC) and absorption coefficient with altitude, and the opposite trend for aerosol concentration for particles larger than 0.3 μm. SSA was retrieved with the use of lidar Raman and Klett algorithms for both 532 and 880 nm wavelengths. In most profiles, SSA shows relatively high temporal and altitude variability. Vertical variability of SSA computed from both methods is consistent; however, some discrepancy is related to Raman retrieval uncertainty and absorption coefficient estimation from AE-51. Typically, very low EBC concentration in Ny-Ålesund leads to large error in the absorbing coefficient. However, SSA uncertainty for both Raman and Klett algorithms seems to be reasonable, e.g. SSA of 0.98 and 0.95 relate to an error of ±0.01 and ± 0.025, respectively.

  8. Analysis of Atmospheric Aerosols Collected in an Urban Area in Upstate NY Using Proton Induced X-ray Emission (PIXE) Spectroscopy

    Science.gov (United States)

    Smith, Jeremy; Ali, Salina; Nadareski, Benjamin; Safiq, Alexandrea; Yoskowitz, Joshua; Labrake, Scott; Vineyard, Michael

    2013-10-01

    We examined atmospheric aerosol samples collected in Schenectady NY for evidence of pollution. We collected aerosol samples using a nine stage cascade impactor which distributes the particulate matter by aerodynamic size onto 7.5 μm Kapton foils. We then used a 1MV electrostatic Pelletron accelerator to produce a 2.2 MeV proton beam to hit the impacted foils. X-ray intensity versus energy spectra were collected using an Amptek x-ray detector where the x-rays are produced from the proton beam interacting with the sample. This is called PIXE. The elemental composition and concentrations of the elements present in the aerosol samples were determined using a software package called GUPIX. We have found elements ranging from Al to Pb and in particular have found significant amounts of Pb and Br on some of our impacted foils, with a Br/Pb ratio of 0.6 +/- 0.2 which agrees with previous studies. This result suggests the presence of leaded aviation fuel perhaps due to the proximity of the collection site to a small airport with a significant amount of general aviation traffic. Union College.

  9. Parabolic dune reactivation and migration at Napeague, NY, USA: Insights from aerial and GPR imagery

    Science.gov (United States)

    Girardi, James D.; Davis, Dan M.

    2010-02-01

    Observations from mapping since the 19th century and aerial imagery since 1930 have been used to study changes in the aeolian geomorphology of coastal parabolic dunes over the last ~ 170 years in the Walking Dune Field, Napeague, NY. The five large parabolic dunes of the Walking Dune Field have all migrated across, or are presently interacting with, a variably forested area that has affected their migration, stabilization and morphology. This study has concentrated on a dune with a particularly complex history of stabilization, reactivation and migration. We have correlated that dune's surface evolution, as revealed by aerial imagery, with its internal structures imaged using 200 MHz and 500 MHz Ground Penetrating Radar (GPR) surveys. Both 2D (transect) and high-resolution 3D GPR imagery image downwind dipping bedding planes which can be grouped by apparent dip angle into several discrete packages of beds that reflect distinct decadal-scale episodes of dune reactivation and growth. From aerial and high resolution GPR imagery, we document a unique mode of reactivation and migration linked to upwind dune formation and parabolic dune interactions with forest trees. This study documents how dune-dune and dune-vegetation interactions have influenced a unique mode of blowout deposition that has alternated on a decadal scale between opposite sides of a parabolic dune during reactivation and migration. The pattern of recent parabolic dune reactivation and migration in the Walking Dune Field appears to be somewhat more complex, and perhaps more sensitive to subtle environmental pressures, than an idealized growth model with uniform deposition and purely on-axis migration. This pattern, believed to be prevalent among other parabolic dunes in the Walking Dune Field, may occur also in many other places where similar observational constraints are unavailable.

  10. [Proceedings of the symposium 'Molluscan Palaeontology' : 11th International Malacological Congress, Siena (Italy) 30th August - 5th September 1992 / A.W. Janssen and R. Janssen (editors)]: Trace fossils on molluscs from the Molluscan Clay (Late Oligocene, Egerian) — a comparison between two localities (Wind Brickyard, Eger, and Nyárjas Hill, Novaj, NE Hungary)

    NARCIS (Netherlands)

    Årpád, Dàvid

    1992-01-01

    Trace fossils, found on shells of gastropods, bivalves and scaphopods from Molluscan Clay exposures (Oligocene, Egerian) at Eger (Wind brickyard) and Novaj (Nyárjas Hill) (NE Hungary), were studied. The relative abundance of different types of borings, traces of bioerosion and palaeopathological

  11. 40 CFR Appendix A to Part 97 - Final Section 126 Rule: EGU Allocations, 2004-2007

    Science.gov (United States)

    2010-07-01

    ... DE EDGE MOOR 593 5 602 DE HAY ROAD 7153 **3 184 DE HAY ROAD 7153 —1 235 DE HAY ROAD 7153 —2 207 DE... 115 32 NY 74TH STREET 2504 120 70 NY 74TH STREET 2504 121 80 NY 74TH STREET 2504 122 65 NY ARTHUR KILL 2490 20 524 NY ARTHUR KILL 2490 30 380 NY ASTORIA 8906 30 557 NY ASTORIA 8906 40 505 NY ASTORIA 8906 50...

  12. Prehistoric spatial patterning and subsistence studies: Archaeological investigations at Sample Unit U19arP4, Nevada Test Site, Nye County, Nevada

    International Nuclear Information System (INIS)

    Johnson, W.G.; DuBarton, A.; Edwards, S.; Drollinger, H.

    1992-01-01

    This report documents the methods and results of archaeological investigations at Sample Unit U19arP4 on Pahute Mesa at the Nevada Test Site (NTS). Eight sites were located there: four lithic artifact scatters (26NY1370, 26NY1372, 26NY3666 and 26NY3667), two temporary camps (26NY3665 and 26NY5418), one artifact locality (26NY5419), and one quarry (26NY3664). One of the lithic scatters, 26NY3667, incorporated a previously recorded rock ring, 26NY1371, that could not be relocated during subsequent investigations. Surface artifacts were collected from all but two of the sites, 26NY1370 and 26NY1372. The data retrieved from these investigations include over one thousand artifacts, such as projectile points, bifaces, debitage, groundstone, and pottery. The temporally diagnostic materials indicate periodic use of Sample Unit U19arP4 from the Middle Archaic to the Shoshonean period

  13. Aerosol absorption coefficient and Equivalent Black Carbon by parallel operation of AE31 and AE33 aethalometers at the Zeppelin station, Ny Ålesund, Svalbard

    Science.gov (United States)

    Eleftheriadis, Konstantinos; Kalogridis, Athina-Cerise; Vratolis, Sterios; Fiebig, Markus

    2016-04-01

    Light absorbing carbon in atmospheric aerosol plays a critical role in radiative forcing and climate change. Despite the long term measurements across the Arctic, comparing data obtained by a variety of methods across stations requires caution. A method for extracting the aerosol absorption coefficient from data obtained over the decades by filter based instrument is still under development. An IASOA Aerosol working group has been initiated to address this and other cross-site aerosol comparison opportunities. Continuous ambient measurements of EBC/light attenuation by means of a Magee Sci. AE-31 aethalometer operating at the Zeppelinfjellet station (474 m asl; 78°54'N, 11°53'E), Ny Ålesund, Svalbard, have been available since 2001 (Eleftheriadis et al, 2009), while a new aethalometer model (AE33, Drinovec et al, 2014) has been installed to operate in parallel from the same inlet since June 2015. Measurements are recorded by a Labview routine collecting all available parameters reported by the two instrument via RS232 protocol. Data are reported at 1 and 10 minute intervals as averages for EBC (μg m-3) and aerosol absorption coefficients (Mm-1) by means of routine designed to report Near Real Time NRT data at the EBAS WDCA database (ebas.nilu.no) Results for the first 6 month period are reported here in an attempt to evaluate comparative performance of the two instruments in terms of their response with respect to the variable aerosol load of light absorbing carbon during the warm and cold seasons found in the high arctic. The application of available conversion schemes for obtaining the absorption coefficient by the two instruments is found to demonstrate a marked difference in their output. During clean periods of low aerosol load (EBC origin was also conducted. Drinovec, L., Močnik, G., Zotter, P., Prévôt, A. S. H., Ruckstuhl, C., Coz, E., Rupakheti, M., Sciare, J., Müller, T., Wiedensohler, A., and Hansen, A. D. A. The "dual-spot" Aethalometer: an

  14. Diversity and distribution of lichen-associated fungi in the Ny-Ålesund Region (Svalbard, High Arctic) as revealed by 454 pyrosequencing

    Science.gov (United States)

    Zhang, Tao; Wei, Xin-Li; Zhang, Yu-Qin; Liu, Hong-Yu; Yu, Li-Yan

    2015-01-01

    This study assessed the diversity and distribution of fungal communities associated with seven lichen species in the Ny-Ålesund Region (Svalbard, High Arctic) using Roche 454 pyrosequencing with fungal-specific primers targeting the internal transcribed spacer (ITS) region of the ribosomal rRNA gene. Lichen-associated fungal communities showed high diversity, with a total of 42,259 reads belonging to 370 operational taxonomic units (OTUs) being found. Of these OTUs, 294 belonged to Ascomycota, 54 to Basidiomycota, 2 to Zygomycota, and 20 to unknown fungi. Leotiomycetes, Dothideomycetes, and Eurotiomycetes were the major classes, whereas the dominant orders were Helotiales, Capnodiales, and Chaetothyriales. Interestingly, most fungal OTUs were closely related to fungi from various habitats (e.g., soil, rock, plant tissues) in the Arctic, Antarctic and alpine regions, which suggests that living in association with lichen thalli may be a transient stage of life cycle for these fungi and that long-distance dispersal may be important to the fungi in the Arctic. In addition, host-related factors shaped the lichen-associated fungal communities in this region. Taken together, these results suggest that lichens thalli act as reservoirs of diverse fungi from various niches, which may improve our understanding of fungal evolution and ecology in the Arctic. PMID:26463847

  15. Diversity and distribution of lichen-associated fungi in the Ny-Ålesund Region (Svalbard, High Arctic) as revealed by 454 pyrosequencing.

    Science.gov (United States)

    Zhang, Tao; Wei, Xin-Li; Zhang, Yu-Qin; Liu, Hong-Yu; Yu, Li-Yan

    2015-10-14

    This study assessed the diversity and distribution of fungal communities associated with seven lichen species in the Ny-Ålesund Region (Svalbard, High Arctic) using Roche 454 pyrosequencing with fungal-specific primers targeting the internal transcribed spacer (ITS) region of the ribosomal rRNA gene. Lichen-associated fungal communities showed high diversity, with a total of 42,259 reads belonging to 370 operational taxonomic units (OTUs) being found. Of these OTUs, 294 belonged to Ascomycota, 54 to Basidiomycota, 2 to Zygomycota, and 20 to unknown fungi. Leotiomycetes, Dothideomycetes, and Eurotiomycetes were the major classes, whereas the dominant orders were Helotiales, Capnodiales, and Chaetothyriales. Interestingly, most fungal OTUs were closely related to fungi from various habitats (e.g., soil, rock, plant tissues) in the Arctic, Antarctic and alpine regions, which suggests that living in association with lichen thalli may be a transient stage of life cycle for these fungi and that long-distance dispersal may be important to the fungi in the Arctic. In addition, host-related factors shaped the lichen-associated fungal communities in this region. Taken together, these results suggest that lichens thalli act as reservoirs of diverse fungi from various niches, which may improve our understanding of fungal evolution and ecology in the Arctic.

  16. Molecular role of TGF-beta, secreted from a new type of CD4+ suppressor T cell, NY4.2, in the prevention of autoimmune IDDM in NOD mice.

    Science.gov (United States)

    Han, H S; Jun, H S; Utsugi, T; Yoon, J W

    1997-06-01

    A new type of CD4+ T cell clone (NY4.2) isolated from pancreatic islet-infiltrated lymphocytes of acutely diabetic non-obese diabetic (NOD) mice prevents the development of insulin-dependent diabetes mellitus (IDDM) in NOD mice, as well as the recurrence of autoimmune diabetes in syngeneic islet-transplanted NOD mice. It has been demonstrated that the cytokine TGF-beta, secreted from the cells of this clone, is the substance which prevents autoimmune IDDM. This investigation was initiated to determine the molecular role TGF-beta plays in the prevention of autoimmune IDDM by determining its effect on IL-2-induced signal transduction in Con A-activated NOD mouse splenocytes and HT-2 cells. First, we determined whether TGF-beta, secreted from NY4.2 T cells, inhibits IL-2-dependent T cell proliferation in HT-2 cells (IL-2-dependent T cell line) and NOD splenocytes. We found that TGF-beta suppresses IL-2-dependent T cell proliferation. Second, we determined whether TGF-beta inhibits the activation of Janus kinases (JAKs), as well as signal transducers and activators of transcription (STAT) proteins, involved in an IL-2-induced signalling pathway that normally leads to the proliferation of T cells. We found that TGF-beta inhibited tyrosine phosphorylation of JAK1, JAK3, STAT3 and STAT5 in Con A blasts from NOD splenocytes and HT-2 cells. Third, we examined whether TGF-beta inhibits the cooperation between STAT proteins and mitogen-activated protein kinase (MAPK), especially extracellular signal-regulated kinase 2 (ERK2). We found that TGF-beta inhibited the association of STAT3 and STAT5 with ERK2 in Con A blasts from NOD splenocytes and HT-2 cells. On the basis of these observations, we conclude that TGF-beta may interfere with signal transduction via inhibition of the IL-2-induced JAK/STAT pathway and inhibition of the association of STAT proteins with ERK2 in T cells from NOD splenocytes, resulting in the inhibition of IL-2-dependent T cell proliferation. TGF

  17. Atmospheric black carbon concentrations in North America, ~1100 to 2005. Liaquat Husain and Tanveer Ahmed Wadsworth Center, New York State Department of Health, Albany, NY 12201-0509, USA, and Department of Environmental Health Sciences, School of Public Health, State University of New York, Albany, NY, 12201-0509, USA

    Science.gov (United States)

    Husain, L.

    2013-05-01

    Black carbon (BC) aerosols in the atmosphere absorb solar radiation, and cause heating of the atmosphere, may alter Earth's cloud cover, and impact precipitation cycle. The best estimate for radiative forcing from BC with 90% certainty is + 1.1 Wm-2 ( + 0.17 to 2.1 Wm-2), second only to that of CO2. A major uncertainty in the estimation is a lack of atmospheric BC data. Models are used to estimate BC emissions into the atmosphere. They have not been validated by field data. We report measurements of BC in the atmosphere, over a period of several centuries using lake sediments. Retrieval of such records provides an invaluable source for understanding changes in the atmosphere with time. Numerous studies have been conducted with such an objective. Owing to a lack of knowledge of deposition rates of atmospheric aerosols into the lake sediments, a major shortcoming of these studies have been an inability to convert the measurements of chemical species in lake sediments into the atmosphere. We have developed a technique to overcome this shortcoming by measuring black carbon in atmospheric aerosols, and in lake sediment cores. The concentrations of BC were determined in daily filters collected at Whiteface Mountain, NY, from 1978 to 2005. Cores from two lakes around Whiteface Mountain, NY, were collected. Cores were (1) sectioned in thin slices, (2) freeze dried, (3) dated using the 210Pb technique, (4) BC chemically separated, and (5) concentrations measured using the thermal-optical method. By The deposition rate of BC from the atmosphere to the lakes was determined by comparing the BC concentration in air and the sediments for the 1978 -2005 period. The deposition rate so determined was used to concert the BC in the sediment into the atmosphere for the ~1978 to ~1100 period. The BC concentrations for the industrial period, ~1850 was low but rapidly increased from ~1900, peaked ~1925, decreased very slowly ~ 1980, followed by a sharp decrease. Concentrations has

  18. The KNK II/1 fuel assembly NY-205: Compilation of the irradiation history and the fuel and fuel pin fabrication data of the INTERATOM data bank system BESEX

    International Nuclear Information System (INIS)

    Patzer, G.; Geier, F.

    1988-01-01

    The fuel assembly NY-205 has been irradiated during the first and the second core of KNK II with a total residence time of 832 equivalent full-power days. A maximum burnup of 175.000 MWd/tHM or 18.6 % was reached with a maximum steel damage of 66 dpa-NRT. For the cladding the materials 1.4970 and 1.4981 have been used in different metallurgical conditions, and for the Uranium/Plutonium mixed- oxide fuel the most important variants of the major fabrication parameters had been realized. The assembly will be brought to the Hot Cells of the KfK Karlsruhe for post-irradiation examination in February 1988, so that the knowledge of the fabrication data is of interest for the selection of fuel pins and for the evaluation of the examination results. Therefore this report compiles the fuel and fuel pin fabrication data from the INTERATOM data bank system BESEX and additionally, an overview of the irradiation history of the assembly is given [de

  19. Submarine groundwater discharge driven nitrogen fluxes to Long Island Sound, NY: Terrestrial vs. marine sources

    Science.gov (United States)

    Tamborski, J. J.; Cochran, J. K.; Bokuniewicz, H. J.

    2017-12-01

    Bottom-waters in Smithtown Bay (Long Island Sound, NY) are subject to hypoxic conditions every summer despite limited nutrient inputs from waste-water and riverine sources, while modeling estimates of groundwater inputs are thought to be insignificant. Terrestrial and marine fluxes of submarine groundwater discharge (SGD) were quantified to Smithtown Bay using mass balances of 222Rn, 224Ra, 226Ra and 228Ra during the spring and summer of 2014/2015, in order to track this seasonal transition period. Intertidal pore waters from a coastal bluff (terrestrial SGD) and from a barrier beach (marine SGD) displayed substantial differences in N concentrations and sources, traced using a multi-isotope approach (222Rn, Ra, δ15N-NO3-, δ18O-NO3-). NO3- in terrestrial SGD did not display any seasonality and was derived from residential septic systems and fertilizer. Marine SGD N concentrations varied month-to-month because of mixing between oxic seawater and hypoxic saline pore waters; N concentrations were greatest during the summer, when NO3- was derived from the remineralization of organic matter. Short-lived 222Rn and 224Ra SGD fluxes were used to determine remineralized N loads along tidal recirculation flow paths, while long-lived 228Ra was used to trace inputs of anthropogenic N in terrestrial SGD. 228Ra-derived terrestrial N load estimates were between 20 and 55% lower than 224Ra-derived estimates (excluding spring 2014); 228Ra may be a more appropriate tracer of terrestrial SGD N loads. Terrestrial SGD NO3- (derived from 228Ra) to Smithtown Bay varied from (1.40-12.8) ∗ 106 mol N y-1, with comparable marine SGD NO3- fluxes of (1.70-6.79) ∗ 106 mol N y-1 derived from 222Rn and 224Ra. Remineralized N loads were greater during the summer compared with spring, and these may be an important driver toward the onset of seasonal hypoxic conditions in Smithtown Bay and western Long Island Sound. Seawater recirculation through the coastal aquifer can rival the N load from

  20. Parkinson's Disease Videos

    Medline Plus

    Full Text Available ... Miami, FL 33131 NY: 1359 Broadway, Suite 1509, New York, NY 10018 contact@parkinson.org Press Room Ask ... Miami, FL 33131 NY: 1359 Broadway, Suite 1509, New York, NY 10018 contact@parkinson.org

  1. Dispersal and survival of Nyssomyia intermedia and Nyssomyia neivai (Diptera: Psychodidae: Phlebotominae) in a cutaneous leishmaniasis endemic area of the speleological province of the Ribeira Valley, state of São Paulo, Brazil.

    Science.gov (United States)

    Galati, Eunice A B; Fonseca, Mauro Breviglieri; Marassá, Ana Maria; Bueno, Edna Fátima M

    2009-12-01

    The dispersal and survival of the phlebotomines Nyssomyia intermedia and Nyssomyia neivai (both implicated as vectors of the cutaneous leishmaniasis agent) in an endemic area was investigated using a capture-mark-release technique in five experiments from August-December 2003 in municipality of Iporanga, state of São Paulo, Brazil. A total of 1,749 males and 1,262 females of Ny. intermedia and 915 males and 411 females of Ny. neivai were marked and released during the five experiments. Recapture attempts were made using automatic light traps, aspiration in natural resting places and domestic animal shelters and Shannon traps. A total of 153 specimens (3.48%) were recaptured: 2.59% (78/3,011) for Ny. intermedia and 5.35% (71/1,326) for Ny. neivai. Both species were recaptured up to 144 h post-release, with the larger part of them recaptured within 48 h. The median dispersion distances for Ny. intermedia and Ny. neivai, respectively, were 109 m and 100 m. The greatest dispersal range of Ny. intermedia was 180 m, while for Ny. neivai one female was recaptured in a pasture at 250 m and another in a pigsty at 520 m, showing a tendency to disperse to more open areas. The daily survival rates calculated based on regressions of the numbers of marked insects recaptured on the six successive days after release were 0.746 for males and 0.575 for females of Ny. intermedia and 0.649 for both sexes of Ny. neivai. The size of the populations in the five months ranged from 8,332-725,085 for Ny. intermedia males, 2,193-104,490 for Ny. intermedia females, 1,687-350,122 for Ny. neivai males and 254-49,705 for Ny. neivai females.

  2. Modeling the Effects of a Transportation Security Incident on the Commercial Container Transportation System

    Science.gov (United States)

    2009-09-01

    Robert F. Dell Chairman, Department of Operations Research iv THIS PAGE INTENTIONALLY LEFT BLANK v ABSTRACT We develop a modeling tool to...Tauro AUSTRIA Trieste JAPAN Tokyo BANGLADESH Chittagong MALAYSIA Singapore BELGIUM Antwerp NETHERLANDS Rotterdam BRAZIL Santos NEW ZEALAND Tauranga... MALAYSIA Albany, NY 37 NETHERLANDS Albany, NY 47 SOUTH KOREA Albany, NY 65 THAILAND Albany, NY 55 UNITED KINGDOM Albany, NY 41 Origin Destination 2007

  3. A high-precision continuous measurement system for the atmospheric O_2/N_2 ratio at Ny-Alesund, Svalbard and preliminary observational results

    Directory of Open Access Journals (Sweden)

    Daisuke Goto

    2013-03-01

    Full Text Available With the aim of carrying out detailed monitoring of temporal variations in the atmospheric O_2/N_2 ratio at Ny-Alesund, Svalbard, we have developed a new highprecision continuous measurement system, with a precision of better than ±4.0 per meg, using a fuel-cell O_2 analyzer. Considering the remoteness of the observation site, special attention was paid to the measurement system, in that: (1 the system can be controlled remotely from Japan using the Internet; (2 all of the data output from the system can be monitored and collected in Japan via the Internet; (3 a specially designed water trap based on a Stirling cooler is employed to automate the removal of water vapor from the sample air; (4 the CO_2 concentration can also be measured; and (5 it is possible to operate the system for one year without having to manually replace the high-pressure cylinders of standard gas and reference air. Systematic observation of the atmospheric O_2/N_2 ratio using the newly developed measurement system began at the site on November 8, 2012. By analyzing the observational results obtained over the first month, the effectiveness of the measurement system was verified, and the causes of cha acteristic temporal variations in the observed atmospheric O_2/N_2 ratio were examined.

  4. Soil pH is a Key Determinant of Soil Fungal Community Composition in the Ny-Ålesund Region, Svalbard (High Arctic)

    Science.gov (United States)

    Zhang, Tao; Wang, Neng-Fei; Liu, Hong-Yu; Zhang, Yu-Qin; Yu, Li-Yan

    2016-01-01

    This study assessed the fungal community composition and its relationships with properties of surface soils in the Ny-Ålesund Region (Svalbard, High Arctic). A total of thirteen soil samples were collected and soil fungal community was analyzed by 454 pyrosequencing with fungi-specific primers targeting the rDNA internal transcribed spacer (ITS) region. The following eight soil properties were analyzed: pH, organic carbon (C), organic nitrogen (N), ammonium nitrogen (NH4+-N), silicate silicon (SiO42--Si), nitrite nitrogen (NO2--N), phosphate phosphorus (PO43--P), and nitrate nitrogen (NO3--N). A total of 57,952 reads belonging to 541 operational taxonomic units (OTUs) were found. of these OTUs, 343 belonged to Ascomycota, 100 to Basidiomycota, 31 to Chytridiomycota, 22 to Glomeromycota, 11 to Zygomycota, 10 to Rozellomycota, whereas 24 belonged to unknown fungi. The dominant orders were Helotiales, Verrucariales, Agaricales, Lecanorales, Chaetothyriales, Lecideales, and Capnodiales. The common genera (>eight soil samples) were Tetracladium, Mortierella, Fusarium, Cortinarius, and Atla. Distance-based redundancy analysis (db-rda) and analysis of similarities (ANOSIM) revealed that soil pH (p = 0.001) was the most significant factor in determining the soil fungal community composition. Members of Verrucariales were found to predominate in soils of pH 8–9, whereas Sordariales predominated in soils of pH 7–8 and Coniochaetales predominated in soils of pH 6–7. The results suggest the presence and distribution of diverse soil fungal communities in the High Arctic, which can provide reliable data for studying the ecological responses of soil fungal communities to climate changes in the Arctic. PMID:26955371

  5. Soil pH is a key determinant of soil fungal community composition in the Ny-Ålesund Region, Svalbard (High Arctic

    Directory of Open Access Journals (Sweden)

    Tao eZhang

    2016-02-01

    Full Text Available This study assessed the fungal community composition and its relationships with properties of surface soils in the Ny-Ålesund Region (Svalbard, High Arctic. A total of thirteen soil samples were collected and soil fungal community was analyzed by 454 pyrosequencing with fungi-specific primers targeting the rDNA internal transcribed spacer (ITS region. The following eight soil properties were analyzed: pH, organic carbon (C, organic nitrogen (N, ammonium nitrogen (NH4+-N, silicate silicon (SiO42--Si, nitrite nitrogen (NO2--N, phosphate phosphorus (PO43--P and nitrate nitrogen (NO3--N. A total of 57,952 reads belonging to 541 operational taxonomic units (OTUs were found. Of these OTUs, 343 belonged to Ascomycota, 100 to Basidiomycota, 31 to Chytridiomycota, 22 to Glomeromycota, 11 to Zygomycota, 10 to Rozellomycota, whereas 24 belonged to unknown fungi. The dominant orders were Helotiales, Verrucariales, Agaricales, Lecanorales, Chaetothyriales, Lecideales, and Capnodiales. The common genera (>8 soil samples were Tetracladium, Mortierella, Fusarium, Cortinarius, and Atla. Distance-based redundancy analysis (db-rda and analysis of similarities (ANOSIM revealed that soil pH (p=0.001 was the most significant factor in determining the soil fungal community composition. Members of Verrucariales were found to predominate in soils of pH 8-9, whereas Sordariales predominated in soils of pH 7-8 and Coniochaetales predominated in soil samples of pH 6-7. The results suggest the presence and distribution of diverse soil fungal communities in the High Arctic, which can provide reliable data for studying the ecological responses of soil fungal communities to climate changes in the Arctic.

  6. Phlebotomines (Diptera, Psychodidae in the Speleological Province of the Ribeira Valley: 3. Serra district - area of hostels for tourists who visit the Parque Estadual do Alto Ribeira (PETAR, state of São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Eunice Aparecida Bianchi Galati

    2010-01-01

    Full Text Available Phlebotomines (Diptera, Psychodidae in the Speleological Province of the Ribeira Valley: 3. Area of hostels for tourists who visit the Parque Estadual do Alto Ribeira (PETAR, state of São Paulo, Brazil. The study characterizes some ecological aspects of the phlebotomine fauna in an endemic area of cutaneous leishmaniasis (CL situated in the Serra district, Iporanga municipality where the hostels for tourists visiting the PETAR are located. Captures were undertaken on a smallholding and a small farm situated near the hostels, monthly between January/2001 and December/2003 with automatic light traps (ALT in pigsty, hen-house and veranda of a domicile at the two sites, and in peridomicile of the small farm also with black/white Shannon traps. With the ALT a total of 87,224 phlebotomines representing 19 species and also two hybrids of Nyssomyia intermedia (Lutz & Neiva and Nyssomyia neivai (Pinto and two anomalous specimens were captured. The standardized index species abundance was for Ny. intermedia = 1.0 and Ny. neivai = 0.935. The highest frequencies of the smallholding occurred in the pigsty, the Williams' mean/capture for Ny. intermedia being 63.7 specimens and for Ny. neivai 29.2, and on the small farm, in the hen-house, Ny. intermedia 402.6 and Ny. neivai 116.2. A total of 863 phlebotomines (Ny. intermedia: 75.4%; Ny. neivai: 24.3% were captured with black/white Shannon traps; females of both species being predominant in the white trap. The high frequencies of Ny. intermedia and Ny. neivai, both implicated in CL transmission, indicate the areas presenting risk of the disease.

  7. Intro til Learning Analytics & datainformeret undervisning og læring

    DEFF Research Database (Denmark)

    Ringtved, Ulla Lunde

    Introduktion til Learning Analytics – Modeller og eksempler fra forskningsfeltet Learning Analytics. Data fra ny opgavetyper, ny kompetencer, nyt læringsudbytte. Nye Målemetoder – Hvad er det vi vil måle – Hvordan viser vi det?......Introduktion til Learning Analytics – Modeller og eksempler fra forskningsfeltet Learning Analytics. Data fra ny opgavetyper, ny kompetencer, nyt læringsudbytte. Nye Målemetoder – Hvad er det vi vil måle – Hvordan viser vi det?...

  8. Protective role of 3-nitrotyrosine against gamma radiation-induced DNA strand breaks: A comparison study with tyrosine

    International Nuclear Information System (INIS)

    Shi Weiqun; Ni Meinan; Kong Fuquan; Sui Li; Hu Jia; Xu Diandou; Li Yanmei

    2008-01-01

    3-Nitrotyrosine(3-NY) has been reported as a potential source of reactive oxygen species (ROSs). In this work, plasmid pBR322 DNA was irradiated by gamma rays in aqueous solution in presence and absence of 3-NY, DNA strand breaks were analyzed by neutral electrophoresis followed by quantification with image analysis software. It was found that the presence of 3-NY could effectively reduce radiation-induced DNA strand breaks. A side-by-side comparison was performed between 3-NY and tyrosine, the results showed that the protective role 3-NY was comparable with tyrosine, which might imply that protein tyrosine nitration might not significantly decrease its ability as a free radical scavenger

  9. montauk_ny.grd

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NGDC builds and distributes high-resolution, coastal digital elevation models (DEMs) that integrate ocean bathymetry and land topography to support NOAA's mission to...

  10. Hovedpineklassifikation, ny udgave

    DEFF Research Database (Denmark)

    Jensen, Rigmor Højland; Kruuse, Christina; Bendtsen, Lars

    2006-01-01

    Headache is extremely prevalent and experienced by almost everyone. A clinical test for the diagnosis of headache is still lacking, and a detailed clinical description is therefore essential for a precise diagnosis. The second edition of the International Headache Classification is presented, along...... knowledge of the major subforms of primary and secondary headaches is a very important tool for diagnosis and treatment....

  11. Hovedpineklassifikation, ny udgave

    DEFF Research Database (Denmark)

    Jensen, Rigmor Højland; Kruuse, Christina Rostrup; Bendtsen, Lars

    2006-01-01

    with a translation into Danish. The major changes from the first edition are a detailed description of several subtypes of migraine, three subdivisions of tension-type headache according to frequency of headache and a major extension of the chapter concerning secondary headaches due to medication overuse. General...... knowledge of the major subforms of primary and secondary headaches is a very important tool for diagnosis and treatment.......Headache is extremely prevalent and experienced by almost everyone. A clinical test for the diagnosis of headache is still lacking, and a detailed clinical description is therefore essential for a precise diagnosis. The second edition of the International Headache Classification is presented, along...

  12. Ny svensk teaterhistoria

    DEFF Research Database (Denmark)

    Kuhlmann, Annelis

    2009-01-01

    Review about the New Swedish Theatre History, edited by Sven Åke Heed and Tomas Forser. The book is in three volumes. Focus is on performativity and theatrical appearances within spoken theatre, opera, ballet, musicals, free dance (a Swedish notion of modern dance).......Review about the New Swedish Theatre History, edited by Sven Åke Heed and Tomas Forser. The book is in three volumes. Focus is on performativity and theatrical appearances within spoken theatre, opera, ballet, musicals, free dance (a Swedish notion of modern dance)....

  13. Ny Nordisk Hverdagsmad

    DEFF Research Database (Denmark)

    2010-01-01

    Valg af materiale/medie/form: Clio online Valg af arbejdsform: Interaktivt læringsmateriale for skolebørn......Valg af materiale/medie/form: Clio online Valg af arbejdsform: Interaktivt læringsmateriale for skolebørn...

  14. Plavíny

    Czech Academy of Sciences Publication Activity Database

    Navrátilová, Jana

    2017-01-01

    Roč. 49, č. 1 (2017), s. 20-21 ISSN 0139-7761 Grant - others:AV ČR(CZ) StrategieAV21/9 Program:StrategieAV Institutional support: RVO:67985939 Keywords : floating heart * cultivation * water plants Subject RIV: GC - Agronomy OBOR OECD: Agronomy, plant breeding and plant protection

  15. Solar Market Analytics, Roadmapping, and Tracking NY (SMART NY) Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Case, Tria [City University of New York; Reilly, Laurie [City University of New York; Kling, Alison [Con Edison, formerly City University of New York

    2014-05-15

    This is the final report, including links to Working Group reports and an attached Working Group report for SunShot Initiative Rooftop Solar Challenge I, from Sustainable CUNY of the City University of New York, on behalf of New York City

  16. Real-Space Bonding Indicator Analysis of the Donor-Acceptor Complexes X3BNY3, X3AlNY3, X3BPY3, and X3AlPY3 (X, Y = H, Me, Cl).

    Science.gov (United States)

    Mebs, Stefan; Beckmann, Jens

    2017-10-12

    Calculations of real-space bonding indicators (RSBI) derived from Atoms-In-Molecules (AIM), Electron Localizability Indicator (ELI-D), Non-Covalent Interactions index (NCI), and Density Overlap Regions Indicator (DORI) toolkits for a set of 36 donor-acceptor complexes X 3 BNY 3 (1, 1a-1h), X 3 AlNY 3 (2, 2a-2h), X 3 BPY 3 (3, 3a-3h), and X 3 AlPY 3 (4, 4a-4h) reveal that the donor-acceptor bonds comprise covalent and ionic interactions in varying extents (X = Y = H for 1-4; X = H, Y = Me for 1a-4a; X = H, Y = Cl for 1b-4b; X = Me, Y = H for 1c-4c; X, Y = Me for 1d-4d; X = Me, Y = Cl for 1e-4e; X = Cl, Y = H for 1f-4f; X = Cl, Y = Me for 1g-4g; X, Y = Cl for 1h-4h). The phosphinoboranes X 3 BPY 3 (3, 3a-3h) in general and Cl 3 BPMe 3 (3f) in particular show the largest covalent contributions and the least ionic contributions. The aminoalanes X 3 AlNY 3 (2, 2a-2h) in general and Me 3 AlNCl 3 (2e) in particular show the least covalent contributions and the largest ionic contributions. The aminoboranes X 3 BNY 3 (1, 1a-1h) and the phosphinoalanes X 3 AlPY 3 (4, 4a-4h) are midway between phosphinoboranes and aminoalanes. The degree of covalency and ionicity correlates with the electronegativity difference BP (ΔEN = 0.15) < AlP (ΔEN = 0.58) < BN (ΔEN = 1.00) < AlN (ΔEN = 1.43) and a previously published energy decomposition analysis (EDA). To illustrate the importance of both contributions in Lewis formula representations, two resonance formulas should be given for all compounds, namely, the canonical form with formal charges denoting covalency and the arrow notation pointing from the donor to the acceptor atom to emphasis ionicity. If the Lewis formula mainly serves to show the atomic connectivity, the most significant should be shown. Thus, it is legitimate to present aminoalanes using arrows; however, for phosphinoboranes the canonical form with formal charges is more appropriate.

  17. Physicochemical properties and ecotoxicological effects of yttrium oxide nanoparticles in aquatic media: Role of low molecular weight natural organic acids

    International Nuclear Information System (INIS)

    Zhang, Fan; Wang, Zhuang; Wang, Se; Fang, Hao; Chen, Mindong; Xu, Defu; Tang, Lili; Wang, Degao

    2016-01-01

    Understanding how engineered nanoparticles (ENPs) interact with natural organic acids is important to ecological risk assessment of ENPs, but this interaction remains poorly studied. Here, we investigate the dispersion stability, ion release, and toxicity of yttrium oxide nanoparticles (nY_2O_3) suspensions after exposure to two low molecular weight natural organic acids (LOAs), namely benzoic acid and gallic acid. We find that in the presence of LOAs the nY_2O_3 suspensions become more stable with surface zeta potential more positive or negative, accompanied by small agglomerated size. LOA interaction with nY_2O_3 is shown to promote the release of dissolved yttrium from the nanoparticles, depending on the concentrations of LOAs. Toxic effects of the nY_2O_3 suspensions incubated with LOAs on Scenedesmus obliquus as a function of their mixture levels show three types of signs: stimulation, inhibition, and alleviation. The mechanism of the effects of LOAs on the nY_2O_3 toxicity may be mainly associated with the degree of agglomeration, particle-induced oxidative stress, and dissolved yttrium. Our results stressed the importance of LOA impacts on the fate and toxicity of ENPs in the aquatic environment. - Highlights: • LOAs significantly increased aqueous stability of nY2O3 in a dose-dependent manner. • The presence of LOAs promoted dissolution of nY2O3 in a dose-dependent manner. • Toxicity of nY2O3 with LOAs to Scenedesmus obliquus varied with mixture levels. • Stimulation, inhibition, and alleviation effects of nY2O3 with LOAs were observed. • Mechanism may be driven by agglomeration, oxidative stress, and dissolved yttrium. - LOAs elevate the dispersion stability of nano-Y_2O_3, promote the release of dissolved yttrium, and alter the algal toxicity of nano-Y_2O_3.

  18. Power Supply Fault Tolerant Reliability Study

    Science.gov (United States)

    1991-04-01

    performance. MCDONNELL AIRCRAFT COMPANY 100,000 10,0001". Hours". to 1,000 -• Failure " - 1% 120 ISO 200 250 300 Temrperature - OC OPO-0571-30-D Figure 31...Ronkonkoma, NY 11779 Covina, CA 91724 Kepco, Inc. Lamba Electronics 131-38 Sanford Ave. 515 Broad Hollow Rd Flushing, NY 11352 Melville, NY 11747

  19. 78 FR 62766 - Self-Regulatory Organizations; NYSE MKT LLC; Order Instituting Proceedings To Determine Whether...

    Science.gov (United States)

    2013-10-22

    ... Index (``RUT'') combination orders.\\8\\ Currently, NYSE MKT Rule 965NY(b) allows an ATP Holder holding an...\\ \\8\\ See NYSE MKT Rule 965NY(b)(4)(iii). A ``NDX combination order'' is an order to purchase or sell... with the corresponding NDX or RUT option position. See NYSE MKT Rule 965NY(b)(1)-(3). \\9\\ The ATP...

  20. Central and Peripheral Mechanisms of Antipsychotic Medication-Induced Metabolic Dysregulation

    Science.gov (United States)

    2016-10-01

    may also significantly contribute to our fundamental understanding of obesity and lead to novel treatments. Since APD-induced metabolic disturbances...York, NY 10032 Department of Psychology , Yeshiva University, New York, NY 10016 Sponsor: Jonathan A. Javitch Background: Antipsychotic drugs...Zachary Freyberg Departments of Psychiatry, Pharmacology & Medicine, Columbia University, New York, NY 10032 Department of Psychology , Yeshiva

  1. Forbedret natur? - om computerspil i naturen

    DEFF Research Database (Denmark)

    Kristiansen, Erik

    2006-01-01

    Location Based Computer Games er en ny genre indenfor computerspil. Spillerne anvender håndholdt computer (fx mobiltelefon) og positioneringsudstyr (fx GPS) samt trådløst net. Spillene foregår ofte i bymiljøer, men har også potentiale som en ny type oplevelse af naturen.......Location Based Computer Games er en ny genre indenfor computerspil. Spillerne anvender håndholdt computer (fx mobiltelefon) og positioneringsudstyr (fx GPS) samt trådløst net. Spillene foregår ofte i bymiljøer, men har også potentiale som en ny type oplevelse af naturen....

  2. Tissue Fractions of Cadmium in Two Hyperaccumulating Jerusalem Artichoke Genotypes

    Directory of Open Access Journals (Sweden)

    Xiaohua Long

    2014-01-01

    Full Text Available In order to investigate the mechanisms in two Jerusalem artichoke (Helianthus tuberosus L. genotypes that hyperaccumulate Cd, a sand-culture experiment was carried out to characterize fractionation of Cd in tissue of Cd-hyperaccumulating genotypes NY2 and NY5. The sequential extractants were: 80% v/v ethanol (FE, deionized water (FW, 1 M NaCl (FNaCl, 2% v/v acetic acid (FAcet, and 0.6 M HCl (FHCl. After 20 days of treatments, NY5 had greater plant biomass and greater Cd accumulation in tissues than NY2. In both genotypes the FNaCl fraction was the highest in roots and stems, whereas the FAcet and FHCl fractions were the highest in leaves. With an increase in Cd concentration in the culture solution, the content of every Cd fraction also increased. The FW and FNaCl ratios in roots were lower in NY5 than in NY2, while the amount of other Cd forms was higher. It implied that, in high accumulator, namely, NY5, the complex of insoluble phosphate tends to be shaped more easily which was much better for Cd accumulation. Besides, translocation from plasma to vacuole after combination with protein may be one of the main mechanisms in Cd-accumulator Jerusalem artichoke genotypes.

  3. The possibilities of reducing the opposition between the peasant populists and the Church in Lithuania during 1918–1926

    OpenAIRE

    Stakeliūnaitė, Danutė

    2014-01-01

    Straipsnyje aptariamos aplinkybės, mažinusios (galimai mažinusios) liaudininkų ir Katalikų Bažnyčios susipriešinimą tarpukario parlamentinėje Lietuvoje. Bažnyčios ir liaudininkų santykiai nagrinėjami trimis aspektais. Pirma, pateikiamas Bažnyčios hierarchų ir dvasininkijos požiūris į Bažnyčios dalyvavimą politikoje bei valstiečius liaudininkus. Antra, atskleidžiamos dvasininkijos luomo ir jo santykių su tikinčiaisiais problemos. Trečia, apibūdinami atvejai, švelninantys abiejų institucijų san...

  4. Leadership Principles Leveraged from Key Civil War Battles

    Science.gov (United States)

    2017-05-15

    war answer book . Canton, MI: Visible Ink Press. Foote, S. (1994). Stars in their courses: the Gettysburg campaign june-july 1863. New York , NY... York , NY: Ballantine Books . Shaara, M. (1975). The killer angels. New York , NY: Random House Publishing Group. Snow D.M. & Drew D.M. (2015). From...pertinent data from books , journals, periodicals, and videos in this area of leadership research. The review of literature will entail analyzing

  5. Revalidation of Nyssomyia fraihai (Martins, Falcão & Silva 1979) (Diptera: Psychodidae).

    Science.gov (United States)

    Godoy, R E; Galati, E A B

    2016-11-01

    Lutzomyia fraihai (Martins, Falcão & Silva 1979), described from Três Braços municipality (Bahia state, Brazil), is closely related to Nyssomyia yuilli yuilli (Young & Porter, 1972), described from Rio Anori, Antioquia, Colombia. The former species, despite the morphological differences reported by its authors, was included as a junior synonym of Ny. yuilli yuilli, and this status has been accepted by sand fly-taxonomists. However, we had an opportunity to examine both taxa, and a clear difference was noted in their male genitalia. In this study, the morphometric/morphologic characters of specimens that had been identified as Ny. yuilli yuilli from different localities (Brazil, Peru, Colombia, Bolivia) and type material of both Ny. yuilli yuilli and Lu. fraihai were analyzed. The results revealed that males from Brazil (Bahia, Acre, Pará, and Rondônia states) and Peru present statistically significant differences in the ratio between paramere rectangular and digitiform areas as well as for the cercus length and width of the aedeagal ducts tips, when compared with the type specimens of Ny. yuilli yuilli, but are statistically similar to those characters of Lu. fraihai However, females of the two species are indistinguishable. Thus, based on the male morphology, Ny. fraihai STAT REV N COM: was resurrected from the synonymy of Ny. yuilli yuilli. The specimens from the Atlantic forest biome and the Amazon biome in Brazil, Peru, and Bolivia in fact belong to Ny. fraihai This species presents a cis-Andean distribution, while Ny. yuilli yuilli has been found in both Andean and Trans-Andean areas. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  6. Pharmaceutical Formulation Facilities as Sources of Opioids and Other Pharmaceuticals to Wastewater Treatment Plant Effluents

    Science.gov (United States)

    2010-01-01

    Facilities involved in the manufacture of pharmaceutical products are an under-investigated source of pharmaceuticals to the environment. Between 2004 and 2009, 35 to 38 effluent samples were collected from each of three wastewater treatment plants (WWTPs) in New York and analyzed for seven pharmaceuticals including opioids and muscle relaxants. Two WWTPs (NY2 and NY3) receive substantial flows (>20% of plant flow) from pharmaceutical formulation facilities (PFF) and one (NY1) receives no PFF flow. Samples of effluents from 23 WWTPs across the United States were analyzed once for these pharmaceuticals as part of a national survey. Maximum pharmaceutical effluent concentrations for the national survey and NY1 effluent samples were generally effluent had median concentrations ranging from 3.4 to >400 μg/L. Maximum concentrations of oxycodone (1700 μg/L) and metaxalone (3800 μg/L) in samples from NY3 effluent exceeded 1000 μg/L. Three pharmaceuticals (butalbital, carisoprodol, and oxycodone) in samples of NY2 effluent had median concentrations ranging from 2 to 11 μg/L. These findings suggest that current manufacturing practices at these PFFs can result in pharmaceuticals concentrations from 10 to 1000 times higher than those typically found in WWTP effluents. PMID:20521847

  7. Dicty_cDB: VFH545 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EYLTFMLEDDEHIKRYRS*ifelvk**lvklhtnfn*sye*nyhss*rsks*ny*x vlstfmsxrkl Translated Amino Acid sequence (All Fra...IKKHAFSGGGATKEEQEKNGADLSV DITYEYLTFMLEDDEHIKRYRS*ifelvk**lvklhtnfn*sye*nyhss*rsks*ny*x vlstfmsx

  8. Effect of vitamin C supplementation on stroke recovery: A case-control study

    OpenAIRE

    Rabadi, Meheroz H; Kristal, Bruce S

    2007-01-01

    Meheroz H Rabadi1, Bruce S Kristal2,31Burke Rehabilitation Hospital, an affiliate of Weill Medical College of Cornell Medical College, White Plains, NY, USA; 2Burke Medical Research Institute, an affiliate of Weill Medical College of Cornell Medical College, White Plains, NY, USA; 3Department of Neuroscience, Cornell University Medical College, White Plains, NY, USABackground and purpose: Epidemiological studies have associated increased dietary intake of antioxidants (vitamin C, E, and &beta...

  9. Understanding Long-term, Large-scale Shoreline Change and the Sediment Budget on Fire Island, NY, using a 3D hydrodynamics-based model

    Science.gov (United States)

    List, J. H.; Safak, I.; Warner, J. C.; Schwab, W. C.; Hapke, C. J.; Lentz, E. E.

    2016-02-01

    The processes responsible for long-term (decadal) shoreline change and the related imbalance in the sediment budget on Fire Island, a 50 km long barrier island on the south coast of Long Island, NY, has been the subject of debate. The estimated net rate of sediment leaving the barrier at the west end of the island is approximately double the estimated net rate of sediment entering in the east, but the island-wide average sediment volume change associated with shoreline change is near zero and cannot account for this deficit. A long-held hypothesis is that onshore sediment flux from the inner continental shelf within the western half of the island is responsible for balancing the sediment budget. To investigate this possibility, we use a nested, 3-D, hydrodynamics-based modeling system (COAWST) to simulate the island-wide alongshore and cross-shore transport, in combination with shoreline change observations. The modeled, net alongshore transport gradients in the nearshore predict that the central part of Fire Island should be erosional, yet shoreline change observations show this area to be accretionary. We compare the model-predicted alongshore transport gradients with the flux gradients that would be required to generate the observed shoreline change, to give the pattern of sediment volume gains or losses that cannot be explained by the modeled alongshore transport gradients. Results show that the western 30 km of coast requires an input of sediment, supporting the hypothesis of onshore flux in this area. The modeled cross-shore flux of sediment between the shoreface and inner shelf is consistent these results, with onshore-directed bottom currents creating an environment more conducive to onshore sediment flux in the western 30 km of the island compared to the eastern 20 km. We conclude that the cross-shore flux of sediment can explain the shoreline change observations, and is an integral component of Fire Island's sediment budget.

  10. NY KANDIDATUDDANNELSE I LYSDESIGN

    DEFF Research Database (Denmark)

    Hansen, Ellen Kathrine; Mullins, Michael

    2013-01-01

    En kandidatuddannelse på højt internationalt niveau i lysdesign har været drøftet og ønsket gennem mange år blandt branchens aftagere. Der er en bred enighed om, at der i Danmark er behov for en tværfaglig uddannelse i lysdesign. Aalborg Universitet, Institut for Arkitektur og Medieteknologi har ...... Denmark, ved positiv behandling forventes, at de første stude- rende starter i september 2014....

  11. ORTHOIMAGERY, Otsego County, NY

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Digital orthographic imagery datasets contain georeferenced images of the Earth's surface, collected by a sensor in which object displacement has been removed for...

  12. Coastal Analysis, Nassau,NY

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Coastal study as defined in FEMA Guides and Specifications, Appendix D: Guidance for coastal Flooding Analyses and Mapping submitted as a result of a coastal study....

  13. FLOODPLAIN, JEFFERSON COUNTY, NY

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — The Floodplain Mapping/Redelineation study deliverables depict and quantify the flood risks for the study area. The primary risk classifications used are the...

  14. NYESO-1/LAGE-1s and PRAME are targets for antigen specific T cells in chondrosarcoma following treatment with 5-Aza-2-deoxycitabine.

    Directory of Open Access Journals (Sweden)

    Seth M Pollack

    Full Text Available Chondrosarcoma has no proven systemic option in the metastatic setting. The development of a non-cross-resistant strategy, such as cellular immunotherapy using antigen-specific T cells would be highly desirable. NY-ESO-1 and PRAME are members of the Cancer Testis Antigen (CTA family that have been identified as promising targets for T cell therapy. LAGE-1 is a cancer testis antigen 90% homologous to NY-ESO-1, sharing the 157-165 A*0201 NY-ESO-1 epitope with its transcript variant, LAGE-1s. A number of CTA's have been induced using 5-Aza-2-Deoxycitabine (5-Aza-dC in other cancers. We sought to evaluate the feasibility of targeting chondrosarcoma tumors using NY-ESO-1/LAGE-1s and PRAME specific T cells using 5-Aza-dC to induce antigen expression.We used 11 flash frozen tumors from the University of Washington tumor bank to test for the expression of NY-ESO-1, PRAME, LAGE-1s and LAGE-1L in chondrosarcoma tumors. Using four chondrosarcoma cell lines we tested the expression of these CTA's with and without 5-Aza-dC treatments. Finally, using NY-ESO-1/LAGE-1s and PRAME specific effectors that we generated from sarcoma patients, we evaluated the ability of these T cells to lyse A*0201 expressing chondrosarcoma cell lines in vitro both with and without 5-Aza-dC treatment.A minority (36% of chondrosarcoma tumors expressed either NY-ESO-1 or LAGE-1s at >10% of our reference value and none expressed PRAME at that level. However, in all four of the chondrosarcoma cell lines tested, NY-ESO-1 and PRAME expression could be induced following treatment with 5-Aza-dC including in cell lines where expression was absent or barely detectable. Furthermore, NY-ESO-1/LAGE-1s and PRAME specific CD8+ effector T cells were able to specifically recognize and lyse A*0201 expressing chondrosarcoma cell lines following 5-Aza-dC treatment.These data suggest that adoptive immunotherapy in combination with 5-Aza-dC may be a potential strategy to treat unresectable or metastatic

  15. Defense Use of Certain Federal Property: Birmingham, Columbia, Detroit, Goldsboro, Jackson, Kansas City, Ravenna Depot, Rochester, Seneca Depot, Syracuse

    Science.gov (United States)

    1973-02-01

    weekend and annual training. The task assignment of the 926th to Childersburg would directly and immediately benefit the government as follows: a. Provide...and a bid has been submitted to purchase 10 acres in the suburb o< Chili , NY, 6 miles southwesl of the present center. The project calls for, the...Navy in Chili , NY as out- lined in ref (b). c. Designate Canandaigua, NY property as an Armed Forces Reserve Center. d. Commensurate with Army-Navy

  16. Multiagent Task Coordination Using a Distributed Optimization Approach

    Science.gov (United States)

    2015-09-01

    AND ADDRESS(ES) Air Force Research Laboratory/ RISC 525 Brooks Road Rome NY 13441-4505 10. SPONSOR/MONITOR’S ACRONYM(S) AFRL/RI 11. SPONSOR...Staskevich and B. Abbe are with AFRL/ RISC , Rome, NY, 13441. Email: jingwang@fsmail.bradley.edu This work was supported by the Air Force Research...Engineering and Computer Science, University of Central Florida, Orlando, FL 32816, USA. G. Staskevich and B. Abbe are with AFRL/ RISC , Rome, NY, 13441. T

  17. Farlig trend: Unge deler deres ADHD medicin med andre

    DEFF Research Database (Denmark)

    Lange, Anne-Mette

    2017-01-01

    Faglig rapport om ny forskning præsenteret ved the International Congress for ADHD, Vancouver, 2017......Faglig rapport om ny forskning præsenteret ved the International Congress for ADHD, Vancouver, 2017...

  18. Radiation grafting of pH-sensitive acrylic acid and 4-vinyl pyridine onto nylon-6 using one- and two-step methods

    International Nuclear Information System (INIS)

    Ortega, Alejandra; Alarcón, Darío; Muñoz-Muñoz, Franklin; Garzón-Fontecha, Angélica; Burillo, Guillermina

    2015-01-01

    Acrylic acid (AAc) and 4-vinyl pyridine (4VP) were γ-ray grafted onto nylon-6 (Ny 6 ) films via pre-irradiation oxidative method. These monomers were grafted using a one-step method to render Ny 6 -g–(AAc/4VP). A two-step or sequential method was used to render (Ny 6 -g–AAc)-g–4VP. Random copolymer branches were obtained when the grafting was carried out via one-step method using the two monomers together. The two-step method was applied to graft chains of 4VP on both Ny 6 substrate and previously grafted AAc chains (Ny 6 -g–AAc). The two types of binary copolymers synthesized were characterized to determine the amount of grafted polymers, the thermal behavior (DSC and TGA), the surface composition (XPS), and the pH responsiveness. In the two-step process, it is possible to achieve a higher graft yield, better control of the amount of each monomer, good reversibility in the swelling/deswelling process and shorter time to achieve equilibrium swelling. - Highlights: • A new binary graft of 4VP and AAc onto Ny 6 films was synthesized by γ-radiation. • The binary grafted material has potential application for heavy ion retention. • The two-step method shows better conditions in swelling and reversibility properties. • Surface distribution of monomers was evaluate by XPS characterization

  19. Detection of Sequence-Specific Tyrosine Nitration of Manganese SOD and SERCA in Cardiovascular Disease and Aging

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Shanqin; Ying, Jia; Jiang, Bingbing; Guo, Wei; Adachi, Takeshi; Sharov, Victor; Lazar, Harold; Menzoian, James; Knyushko, Tanya V.; Bigelow, Diana J.; Schoneich, Christian; Cohen, Richard

    2006-06-01

    Nitration of protein tyrosine residues (nY) is a marker of oxidative stress and may alter the biological activity of the modified proteins. The aim of this study was to develop antibodies towards site-specific nY-modified proteins and to use histochemical and immunoblotting to demonstrate protein nitration in tissues. Affinity-purified polyclonal antibodies towards peptides with known nY sites in MnSOD nY-34 and of two adjacent nY in the sarcoplasmic endoplasmic reticulum calcium ATPase (SERCA2 di-nY-294,295) were developed. Kidneys from rats infused with angiotensin II with known MnSOD nY and aorta from atherosclerotic rabbits and aging rat skeletal and cardiac sarcoplasmic reticulum with known SERCA di-nY were used for positive controls. Staining for MnSOD nY-34 was most intense in distal renal tubules and collecting ducts. Staining of atherosclerotic aorta for SERCA2 di-nY was most intense in atherosclerotic plaques. Aging rat skeletal muscle and atherosclerotic aorta and cardiac atrium from human diabetic patients also stained positively. Staining was decreased by sodium dithionite that chemically reduces nitrotyrosine to aminotyrosine, and the antigenic nY-peptide blocked staining for each respective nY site, but not for the other. As previously demonstrated, immunoblotting failed to detect these modified proteins in whole tissue lysates, but did when the proteins were concentrated. Immunohistochemical staining for specific nY-modified tyrosine residues offers the ability to assess the effects of oxidant stress associated with pathological conditions on individual proteins whose function may be affected in specific tissue sites.

  20. A new species of Nyanzachoerus (Cetartiodactyla: Suidae from the late Miocene Toros-Ménalla, Chad, central Africa.

    Directory of Open Access Journals (Sweden)

    Jean-Renaud Boisserie

    Full Text Available During the latest Miocene and the early Pliocene, tetraconodontine suids were the most predominant large omnivorous mammals in Africa. Yet, new species were often identified on the grounds of limited evidence, a situation impacting their value for biochronological correlations as well as for environmental and biogeographical reconstructions. The description of the most abundant known collection of craniodental remains attributed to the tetraconodontine Nyanzachoerus helps to improve this situation. These specimens were collected in the upper Miocene deposits at Toros-Ménalla, northern Chad, central Africa, by the Mission Paléoanthropologique Franco-Tchadienne. We compared them with Nyanzachoerus from eastern and southern Africa, using extant species as a reference for patterns of morphological variation. Thanks to a large sample of observations, our work focused as much on craniomandibular morphology as on dental morphology and metrics (improved by an index scoring for the complexity of distal third molars and a detailed investigation of premolar-molar ratios. We recognized two taxa at Toros-Ménalla: Nyanzachoerus khinzir nov. sp. and Ny. cf. australis. We also revised the taxonomic status for other species, including: the restriction of Ny. syrticus to its holotype specimen from Sahabi (Libya, the resurrection of the nomen Ny. tulotos, and the synonymy of Ny. kuseralensis with Ny. waylandi. At Toros-Ménalla, Ny. khinzir was the only suid coexisting with the anthracotheriid Libycosaurus and the hominid Sahelanthropus, whereas Ny. cf. australis was associated with a different, probably younger faunal context. Nyanzachoerus. khinzir, which probably had a diversified diet, supports a latest Miocene biogeographical distinction between central Africa and eastern Africa.

  1. 77 FR 1950 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2012-01-12

    ..., Wind Turbine Blade Division. 80,512 Pilgrim's Pride Dallas, TX Corporation. I hereby certify that the........... February 13, 2010. Inc. 81,009 Birds Eye Foods, LLC, Fulton, NY February 13, 2010. Fulton, NY Plant...

  2. 75 FR 20037 - Petition for Waiver of Compliance

    Science.gov (United States)

    2010-04-16

    ... on two line segments which are connected and extend from Cattaraugus, NY, to Dayton, NY (10.1 miles... had to replace glass due to breakage from flying objects. Because of low risk of exposure to their...

  3. 77 FR 20010 - Notice of Public Workshop: “Designing for Impact: Workshop on Building the National Network for...

    Science.gov (United States)

    2012-04-03

    ... Polytechnic Institute, Troy, NY, 12180. EMPAC is located at the corner of 8th Street and College Avenue, in Troy, NY. Members of the public wishing to attend the public workshop may register online at: http...

  4. Drama på dagsordenen

    DEFF Research Database (Denmark)

    Austring, Bennyé D.; Sørensen, Merete Cornet

    2012-01-01

    Artiklen argumenterer for Dramafagets relevans i Ny Nordisk Skole-regi, bl.a. ved at henvise til nyere forskning.......Artiklen argumenterer for Dramafagets relevans i Ny Nordisk Skole-regi, bl.a. ved at henvise til nyere forskning....

  5. A Cultural Resource and Geological Study Pertaining to Four Selected Petroglyph/Pictograph Sites on Nellis Air Force Range and Adjacent Overflight Lands, Lincoln and Nye Countries, Nevada

    Science.gov (United States)

    1999-08-01

    petroglyph elements from this site were included in Heizer and Baumhoff s (1962:57) classic analysis. Unfortunately, the two researchers equate Steward’s...mining camp 2 to 3 miles southwest of this site. Heizer and Baumhoff additionally apply the site number of NY-3 to this site in their work, when actually...26NY3 is recorded as 38 0 Wagon Parts . Map 6. Civet Cat Canyon (26NY369) Site Plan. 39 * Contours not to scale - rendered for relief. ■T-.IKI

  6. Expression of genes MAGE-A3 MAGE-C1, NY-ESO-1 and SSX1 in patients with multiple myeloma at the General Hospital of Mexico

    Directory of Open Access Journals (Sweden)

    A. De la Cruz-Rosas

    2018-04-01

    Full Text Available Multiple myeloma is the most common form of plasma cell cancer. It is a disease of elderly people, with a mean age at diagnosis of 65–70, and represents 10–15% of all blood cancers. It is a heterogeneous disease associated with intrinsic factors and disease characteristics such as genetics, which dictate the clinical course of the disease. Multiple myeloma involves several abnormalities in the IgH variable region. The first oncogenic events in this cancer occur in the germinal centre, apparently during isotype switching and somatic hypermutation of B cells. While these primary mutations have been found in myeloma cells, these events alone are not enough to cause pathogenesis. However, few genes have been identified in this type of disease. The expression of cancer/testis antigens (CTAs is limited to testis tissue and various types of cancer, in which they are considered as a tumour marker as they are associated with the prognosis and monitoring of the disease, and are involved with overall survival and event-free disease. In view of the above, the objective of this study was to analyse the expression of CTAs (MAGE-A3 and -C1, NY-ESO and SSX1 by RT-PCR in patients diagnosed with de novo multiple myeloma admitted to the Haematology Department of Hospital General de México. Our results proved that there is presence of these genes and that they may be involved in resistance, progression and survival. Resumen: El mieloma múltiple es la forma más común de las neoplasias malignas de células plasmáticas. Es una enfermedad de los adultos mayores, la media al diagnóstico es de 65 a 70 años y representa del 10 al 15% de todas las neoplasias hematológicas. Es una enfermedad heterogénea donde existe una asociación con factores y características intrínsecas de la enfermedad, tales como las genéticas, las cuales dictan el curso clínico del padecimiento. El mieloma múltiple involucra diversas anormalidades en la región variable de la Ig

  7. Parkinson's Disease Videos

    Medline Plus

    Full Text Available ... Skills for Parkinson's Care Partners Expert Briefings: What's New in Genetics and Parkinson's? Expert Briefings: Understanding the ... Miami, FL 33131 NY: 1359 Broadway, Suite 1509, New York, NY 10018 contact@parkinson.org Press Room ...

  8. Medline Plus

    Full Text Available ... Surgery, New York, NY, 12/11/2013) Computer Guided Knee Replacement (Broward Health North Medical Center, Deerfield ... Surgery, New York, NY, 12/11/2013) Computer Guided Knee Replacement (Broward Health North Medical Center, Deerfield ...

  9. Medline Plus

    Full Text Available ... Special Surgery, New York, NY, 12/11/2013) Computer Guided Knee Replacement (Broward Health North Medical Center, ... Special Surgery, New York, NY, 12/11/2013) Computer Guided Knee Replacement (Broward Health North Medical Center, ...

  10. Medline Plus

    Full Text Available ... Cruciate Stabilized (BCS) Total Knee System (Hospital for Special Surgery, New York, NY, 12/11/2013) Computer ... Cruciate Stabilized (BCS) Total Knee System (Hospital for Special Surgery, New York, NY, 12/11/2013) Computer ...

  11. Medline Plus

    Full Text Available ... 5/08/2008) Testicular Disorders Varicocele Surgery (Beth Israel Medical Center, New York, NY, 2/24/2009) ... Reconstruction Breast Reconstruction: Deep Inferior Epigastric Perforator (Beth Israel Medical Center, New York, NY, 1/11/2008) ...

  12. Natural Leishmania (Viannia) infections of phlebotomines (Diptera: Psychodidae) indicate classical and alternative transmission cycles of American cutaneous leishmaniasis in the Guiana Shield, Brazil.

    Science.gov (United States)

    de Souza, Adelson Alcimar Almeida; da Rocha Barata, Iorlando; das Graças Soares Silva, Maria; Lima, José Aprígio Nunes; Jennings, Yara Lúcia Lins; Ishikawa, Edna Aoba Yassui; Prévot, Ghislaine; Ginouves, Marine; Silveira, Fernando Tobias; Shaw, Jeffrey; Dos Santos, Thiago Vasconcelos

    2017-01-01

    From 1996 to 1999 multi-trapping methods (Center of Diseases Control, CDC) light traps, light-baited Shannon traps, and aspiration on tree bases) were used to study the phlebotomine fauna of the "Serra do Navio" region of the Brazilian State of Amapá, which is part of the Guiana Shield. Fifty-three species were identified among 8,685 captured individuals. The following species, associated with the transmission of American cutaneous leishmaniasis in Amazonian Brazil, were captured: Nyssomyia umbratilis (3,388), Psychodopygus squamiventris maripaensis (995), Ny. anduzei (550), Trichophoromyia ubiquitalis (400), Ny. whitmani (291), Ps. paraensis (116), and Bichromomyia flaviscutellata (50). Flagellate infections were detected in 45 flies. Of the 19 parasites isolated in vitro, 15 were Leishmania (Viannia) guyanensis (13 in Ny. umbratilis, 1 in Ny. whitmani, 1 in Ny. anduzei) and three were L. (V.) naiffi (2 in Ps. s. maripaensis, 1 in Ny. anduzei). The results indicate the participation of three phlebotomine species in the transmission of L. (V.) guyanensis and two species in that of L. (V.) naiffi, and show that the same phlebotomine species is involved in the transmission of different Leishmania (Viannia) species in the Guianan/Amazon region. A review of the literature together with the results of the present study, and other published and unpublished results, indicate that eight phlebotomine species potentially participate in the transmission of Leishmania (Viannia) naiffi in Amazonia. © A.A.A. de Souza et al., published by EDP Sciences, 2017.

  13. Site differences in mild cognitive dysfunction (MCD) among patients with systemic lupus erythematosus (SLE).

    Science.gov (United States)

    Kozora, E; Erkan, D; West, S G; Filley, C M; Zhang, L; Ramon, G; Duggan, E; Lockshin, M D

    2013-01-01

    Mild cognitive dysfunction (MCD) is common in patients with systemic lupus erythematosus (MCD-SLE) but few studies have investigated potential site differences. SLE patients from Denver, CO, and New York, NY, were enrolled in two different cognition studies employing similar screening methods. Using the resulting neuropsychological scores, cognitive impairment was calculated using a cognitive impairment index (CII). The rate of MCD-SLE was 24% at the Denver, CO, site and 60% at the New York, NY, site. The mean CII was 2.6 ± 2.3 versus 4.4 ± 2.7, respectively (p = 0.005). The NY participants had a significantly longer disease duration (p = 0.13) and higher American College of Rheumatology SLE criteria scores (p > 0.001). NY participants had a higher frequency of impairment in semantic verbal fluency (p = 0.005), visuomotor speed (p = 0.013), and motor sequencing (p = 0.001). A correlation was found between cognitive impairment and SLE disease duration (p = 0.03). The rate of MCD-SLE was greater in SLE patients from New York, NY, compared to patients in the Denver, CO, area. The greater duration of disease and higher prevalence of medical complications in the NY group might contribute to this difference. Findings suggest that MCD-SLE may differ by site, but future studies that better evaluate site or selection bias are recommended.

  14. Erhvervsjura for marketing og service

    DEFF Research Database (Denmark)

    Christensen, Tom Bramminge; Föh, Kennet Fischer; Nibe, Anne Mette Bryde

    Ny lærebog i erhvervsjura tilpasset de nyeste studieordninger på markedsførings- og serviceøkonomuddannelserne......Ny lærebog i erhvervsjura tilpasset de nyeste studieordninger på markedsførings- og serviceøkonomuddannelserne...

  15. The endogenous plant hormones and ratios regulate sugar and dry matter accumulation in Jerusalem artichoke in salt-soil.

    Science.gov (United States)

    Li, Lingling; Shao, Tianyun; Yang, Hui; Chen, Manxia; Gao, Xiumei; Long, Xiaohua; Shao, Hongbo; Liu, Zhaopu; Rengel, Zed

    2017-02-01

    The changes in content of endogenous hormones in stolons and tubers of Jerusalem artichoke (Helianthus tuberosus L.) regulate tuber growth, but the specific knowledge about the importance of balance among the endogenous hormones is lacking. Two varieties of Jerusalem artichoke (NY-1 and QY-2) were tested for the endogenous zeatin (ZT), auxins (IAA), gibberellins (GA 3 ) and abscisic acid (ABA) in regulating sugar and dry matter accumulation in tubers. The dry matter content and sugar accumulation in tubers were correlated positively with endogenous ZT and negatively with GA 3 content and GA 3 /ABA and IAA/ABA content ratios. Throughout the tuber formation, ZT content was higher in NY-1 than QY-2 tubers, whereas ABA content was higher in QY-2 than NY-1 tubers. The content ratios GA 3 /ABA and IAA/ABA were greater in NY-1 than QY-2 before tuber initiation, but QY-2 surpassed NY-1 during the tuber growth stage. The GA 3 /ABA and IAA/ABA content ratios declined during tuber growth. The results suggested that a dynamic balance of endogenous hormones played an important role in tuber development. Copyright © 2016 Elsevier B.V. All rights reserved.

  16. Medline Plus

    Full Text Available ... to Treat Obstructive Hypertrophic Cardiomyopathy (HCM) (Roosevelt Hospital, New York, NY, 1/04/2012) Coronary Artery Disease Transradial ... Heart Failure Surgical Ventricular Reconstruction (Montefiore Medical Center, New York, NY, 2/13/2008) Heart Health Tests Transesophageal ...

  17. Nonlinear structural analysis using integrated force method

    Indian Academy of Sciences (India)

    A new formulation termed the Integrated Force Method (IFM) was proposed by Patnaik ... nated ``Structure (nY m)'' where (nY m) are the force and displacement degrees of ..... Patnaik S N, Yadagiri S 1976 Frequency analysis of structures.

  18. 78 FR 61392 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2013-10-03

    ..., Hartford, CT. Inc., Corporate/Finance/ Controllers. The following determinations terminating investigations... Staffing, Employee Management, CBS Personnel, etc. 82,977 Pall Corporation, Finance Port Washington, NY..., Greensboro, NC. Finance Department, Novartis AG, ProUnlimited. 82,984 The Berry Company, LLC Rochester, NY...

  19. Mellem nyliberalisme og terror - Interview med Chantal Mouffe

    DEFF Research Database (Denmark)

    Hansen, Allan Dreyer; Sonnichsen, André

    2012-01-01

    Interview med Chantal Mouffe om Hegemony and Socalist Strategy, modstandere og fjender en ny multipolær verdensorden og demokrati......Interview med Chantal Mouffe om Hegemony and Socalist Strategy, modstandere og fjender en ny multipolær verdensorden og demokrati...

  20. 40 CFR 81.333 - New York.

    Science.gov (United States)

    2010-07-01

    ... Designated area Designation Date 1 Type Classification Date 1 Type Albany-Schenectady-Troy Area: Albany... Date 1 Type Albany-Schenectady-Troy, NY: Albany County Nonattainment Subpart 1. Greene County.... Albany-Schenectady-Troy, NY: Albany County Unclassifiable/Attainment. Greene County Unclassifiable...

  1. Anxiety and Overgener a lization: Negative Results

    Science.gov (United States)

    Murray, E. Neil

    1969-01-01

    Research supported in part by a United States Public Health Service grant. Article based on a PhD thesis submitted to the University of Pittsburgh. Reprints from: E.N. Murray, Dept of Psychology, State Univ of N.Y., Buffalo, N.Y.

  2. Strategies for RUN1 Deployment Using RUN2 and REN2 to Manage Grapevine Powdery Mildew Informed by Studies of Race Specificity.

    Science.gov (United States)

    Feechan, Angela; Kocsis, Marianna; Riaz, Summaira; Zhang, Wei; Gadoury, David M; Walker, M Andrew; Dry, Ian B; Reisch, Bruce; Cadle-Davidson, Lance

    2015-08-01

    The Toll/interleukin-1 receptor nucleotide-binding site leucine-rich repeat gene, "resistance to Uncinula necator 1" (RUN1), from Vitis rotundifolia was recently identified and confirmed to confer resistance to the grapevine powdery mildew fungus Erysiphe necator (syn. U. necator) in transgenic V. vinifera cultivars. However, sporulating powdery mildew colonies and cleistothecia of the heterothallic pathogen have been found on introgression lines containing the RUN1 locus growing in New York (NY). Two E. necator isolates collected from RUN1 vines were designated NY1-131 and NY1-137 and were used in this study to inform a strategy for durable RUN1 deployment. In order to achieve this, fitness parameters of NY1-131 and NY1-137 were quantified relative to powdery mildew isolates collected from V. rotundifolia and V. vinifera on vines containing alleles of the powdery mildew resistance genes RUN1, RUN2, or REN2. The results clearly demonstrate the race specificity of RUN1, RUN2, and REN2 resistance alleles, all of which exhibit programmed cell death (PCD)-mediated resistance. The NY1 isolates investigated were found to have an intermediate virulence on RUN1 vines, although this may be allele specific, while the Musc4 isolate collected from V. rotundifolia was virulent on all RUN1 vines. Another powdery mildew resistance locus, RUN2, was previously mapped in different V. rotundifolia genotypes, and two alleles (RUN2.1 and RUN2.2) were identified. The RUN2.1 allele was found to provide PCD-mediated resistance to both an NY1 isolate and Musc4. Importantly, REN2 vines were resistant to the NY1 isolates and RUN1REN2 vines combining both genes displayed additional resistance. Based on these results, RUN1-mediated resistance in grapevine may be enhanced by pyramiding with RUN2.1 or REN2; however, naturally occurring isolates in North America display some virulence on vines with these resistance genes. The characterization of additional resistance sources is needed to identify

  3. The Cyber War: Maintaining and Controlling the Key Cyber Terrain of the Cyberspace Domain

    Science.gov (United States)

    2016-06-26

    Awareness”, Inf. Exploitation Group, CUBRC , Buffalo, NY, 11th International Conference on Information Fusion, 2008, Figure 4 30 Fava, D., et. al...Group, CUBRC , Buffalo, NY, 11th International Conference on Information Fusion, 2008, Figure 4 Jakobson G., "Extending Situation Modeling with

  4. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    population stratification; ancestry informative markers (AIMs); race; ethnicity; genetic epidemiology; forensic genetics; Hispanics. ... Department of Microbiology, Mount Sinai School of Medicine, New York, NY 10029, USA; Department of Genetics and Genomic Sciences, Mount Sinai School of Medicine, New York, NY 10029 ...

  5. Metallurgi for Ingeniører

    DEFF Research Database (Denmark)

    Pedersen, Jan

    Ny gennemarbejdet udgave af den klassiske "Metallurgi for Ingeniører", først skrevet af K. Offer Andersen i 1962......Ny gennemarbejdet udgave af den klassiske "Metallurgi for Ingeniører", først skrevet af K. Offer Andersen i 1962...

  6. Human-Swarm Interactions Based on Managing Attractors

    Science.gov (United States)

    2014-03-06

    Laboratory/ Brigham Young University Information Directorate Provo, UT 84602 Rome Research Site/ RISC 525 Brooks Road Rome NY 13441...Information Directorate Rome Research Site/ RISC 525 Brooks Road Rome NY 13441-4505 10. SPONSOR/MONITOR’S ACRONYM(S) AFRL/RI 11. SPONSORING

  7. Domácí meteostanice využívající Raspberry Pi

    OpenAIRE

    Špringer, Radek

    2014-01-01

    Cílem této bakalářské práce je navržení a vytvoření domácí meteostanice s využitím platformy \\raspi{}. Meteostanice je členěna na výpočetní a senzorovou část. Senzorová část meteostanice je realizována bezdrátovým modulem, který měří teplotu, tlak, osvětlení a vlhkost. Naměřené hodnoty jsou odesílány do výpočetní části meteostanice, kde jsou zpracovány \\raspi{}. Zpracované hodnoty jsou ukládány do MySQL databáze na externím webovém serveru. Na webovém serveru jsou uživateli zobrazovány aktuál...

  8. Konsolidovaná účetní závěrka

    OpenAIRE

    Lungová, Monika

    2015-01-01

    Tato diplomová práce se zabývá problematikou konsolidované účetní závěrky. Práce je zaměřena na zahrnutí nové, přidružené jednotky do konsolidace, při použití ekvivalenční metody a následné posouzení výkonosti nově vzniklé skupiny oproti původnímu konsolidačnímu celku. V jednotlivých kapitolách diplomové práce jsou popsány a rozebrány zejména principy, postupy a metody konsolidace účetní závěrky. V praktické části jsou interpretovány a analyzovány výsledky konsolidované účetní závěrky. Posled...

  9. The role of bromine and chlorine chemistry for arctic ozone depletion events in Ny-Ålesund and comparison with model calculations

    Directory of Open Access Journals (Sweden)

    M. Martinez

    1999-07-01

    Full Text Available During the Arctic Tropospheric Ozone Chemistry (ARCTOC campaigns at Ny-Ålesund, Spitsbergen, the role of halogens in the depletion of boundary layer ozone was investigated. In spring 1995 and 1996 up to 30 ppt bromine monoxide were found whenever ozone decreased from normal levels of about 40 ppb. Those main trace gases and others were specifically followed in the UV-VIS spectral region by differential optical absorption spectroscopy (DOAS along light paths running between 20 and 475 m a.s.l.. The daily variation of peroxy radicals closely followed the ozone photolysis rate J(O3(O1D in the absence of ozone depletion most of the time. However, during low ozone events this close correlation was no longer found because the measurement of radicals by chemical amplification (CA turned out to be sensitive to peroxy radicals and ClOx. Large CA signals at night can sometimes definitely be assigned to ClOx and reached up to 2 ppt. Total bromine and iodine were both stripped quantitatively from air by active charcoal traps and measured after neutron activation of the samples. Total bromine increased from background levels of about 15 ppt to a maximum of 90 ppt during an event of complete ozone depletion. For the spring season a strong source of bromine is identified in the pack ice region according to back trajectories. Though biogenic emission sources cannot be completely ruled out, a primary activation of halogenides by various oxidants seems to initiate an efficient autocatalytic process, mainly driven by ozone and light, on ice and perhaps on aerosols. Halogenides residing on pack ice surfaces are continuously oxidised by hypohalogenous acids releasing bromine and chlorine into the air. During transport and especially above open water this air mixes with upper layer pristine air. As large quantities of bromine, often in the form of BrO, have been observed at polar sunrise also around Antarctica, its release seems to be a natural phenomenon. The

  10. Green binary and phase shifting mask

    Science.gov (United States)

    Shy, S. L.; Hong, Chao-Sin; Wu, Cheng-San; Chen, S. J.; Wu, Hung-Yu; Ting, Yung-Chiang

    2009-12-01

    SixNy/Ni thin film green mask blanks were developed , and are now going to be used to replace general chromium film used for binary mask as well as to replace molydium silicide embedded material for AttPSM for I-line (365 nm), KrF (248 nm), ArF (193 nm) and Contact/Proximity lithography. A bilayer structure of a 1 nm thick opaque, conductive nickel layer and a SixNy layer is proposed for binary and phase-shifting mask. With the good controlling of plasma CVD of SixNy under silane (50 sccm), ammonia (5 sccm) and nitrogen (100 sccm), the pressure is 250 mTorr. and RF frequency 13.56 MHz and power 50 W. SixNy has enough deposition latitude to meet the requirements as an embedded layer for required phase shift 180 degree, and the T% in 193, 248 and 365 nm can be adjusted between 2% to 20% for binary and phase shifting mask usage. Ni can be deposited by E-gun, its sheet resistance Rs is less than 1.435 kΩ/square. Jeol e-beam system and I-line stepper are used to evaluate these thin film green mask blanks, feature size less than 200 nm half pitch pattern and 0.558 μm pitch contact hole can be printed. Transmission spectrums of various thickness of SixNy film are inspected by using UV spectrometer and FTIR. Optical constants of the SixNy film are measured by n & k meter and surface roughness is inspected by using Atomic Force Microscope (AFM).

  11. Søarsenalet på Holmen: Kongeportalen

    DEFF Research Database (Denmark)

    Larsen, Lene Gerd

    2001-01-01

    En redegørelse for kongeportalens restaureringshistorie baseret på arkivalske og bygningsarkæologiske undersøgelser. Der fremlægges ny byggeteknisk viden om portalens skulpturelle udsmykning og ny indsigt i de restaureringsetiske principper, der var fremme i begyndelsen af 1900-tallet....

  12. Investigation for Low-Cost Permanent Magnets.

    Science.gov (United States)

    1981-09-01

    Code RRM I | -. .. _ _ _ - -,’ .-- -- nnwi-- l aI l l ai Professor G.A. Ansell Professor N.S. Stoloff Rensselaer Polytechnic Institute Rensselaer...Polytechnic Institute Department of Metallurgical Engineering School of Engineering Troy, NY 02181 Troy, NY 12181 Dr. C. Adam Professor A. Lawley Pratt

  13. Growth of a New Ternary BON Crystal on Si(100) by Plasma-Assisted MOCVD and Study on the Effects of Fed Gas and Growth Temperature

    Science.gov (United States)

    Chen, G. C.; Lee, S.-B.; Boo, J.-H.

    A new ternary BOxNy crystal was grown on Si(100) substrate at 500°C by low-frequency (100 kHz) radio-frequency (rf) derived plasma-assisted MOCVD with an organoborate precursor. The as-grown deposits were characterized by SEM, TED, XPS, XRD, AFM and FT-IR. The experimental results showed that BOxNy crystal was apt to be formed at N-rich atmosphere and high temperature. The decrease of hydrogen flux in fed gases was of benefit to form BON crystal structure. The crystal structure of BOxNy was as similar to that of H3BO3 in this study.

  14. It is not Just a Press Conference: The Consequences of Crisis Communication While the World Watches

    Science.gov (United States)

    2014-03-01

    Abraham H. Maslow , Motivation and Personality (New York, NY: Harper and Row, 1970). 26 THIS PAGE INTENTIONALLY LEFT BLANK 27 III. RESEARCH DESIGN...http://www.forbes.com/sites/kenmakovsky/2013/10/03/1159/. Maslow , Abraham H. Motivation and Personality. New York, NY: Harper and Row, 1970. Miles

  15. 77 FR 49783 - Procurement List; Additions

    Science.gov (United States)

    2012-08-17

    ...), Office of the Principal Legal Advisor, New York Office of Chief Counsel, 290 Broadway Street, New York, NY NPA: Fedcap Rehabilitation Services, Inc., New York, NY Contracting Activity: Dept of Homeland... ``E'' Street, Buildings 59 & 79 Magazine Road, Portsmouth, VA Washington Navy Yard, 1325 10th Street...

  16. Segmental NF: A Guide for Patients

    Science.gov (United States)

    ... available. How can I learn more? Children’s Tumor Foundation 120 Wall Street, 16th Floor New York, NY 10005 toll ... University of Alabama at Birmingham © 2011 Children’s Tumor Foundation. All rights reserved. Reprinted 2015 120 Wall Street, 16 th Floor New York, NY 10005 ...

  17. 76 FR 54251 - Notice of Receipt of Complaint; Solicitation of Comments Relating to the Public Interest

    Science.gov (United States)

    2011-08-31

    ...; Pandigital, Dublin of CA; Royal Consumer Information Products Inc. of NJ; Sony Corporation of Japan...; Aluratek Inc. of CA; Audiovox Corporation of NY; CEIVA Logic of CA; Circus World Displays Ltd. of Canada; Coby Electronics Corporation of NY; Curtis International Ltd. of Canada; Digital Spectrum Solutions Inc...

  18. When in Doubt...?

    DEFF Research Database (Denmark)

    Bubandt, Nils Ole

    2016-01-01

    Response to Hau Symposium on Bubandt, Nils. 2014. The empty seashell: Witchcraft and doubt on an Indonesian island. Ithaca, NY: Cornell University Press.......Response to Hau Symposium on Bubandt, Nils. 2014. The empty seashell: Witchcraft and doubt on an Indonesian island. Ithaca, NY: Cornell University Press....

  19. Libraries in New York: MedlinePlus

    Science.gov (United States)

    ... 212-410-8142 http://library.nycpm.edu NYU School of Medicine Health Sciences Library 550 First Avenue New York, NY 10016-6402 ... 4743 http://wernerlibrary.org/wellness University of Rochester School of Medicine and Dentistry Edward G. Miner Library 601 Elmwood Avenue Rochester, NY 14642 585-275- ...

  20. 78 FR 20277 - Safety Zones & Special Local Regulations; Recurring Marine Events in Captain of the Port Long...

    Science.gov (United States)

    2013-04-04

    .... Regulatory History and Information The Coast Guard promulgated safety zones and special local regulations for... first week of July. Location: Waters of the Connetquot River off Snapper Inn Restaurant, Oakdale, NY in...: Waters of Patchogue Bay off ``Lombardi's On the Bay'' restaurant, Patchogue, NY in approximate position...

  1. Blue Harvest: Evaluating Human Capital Management Policy for the 21st Century Air Force

    Science.gov (United States)

    2017-06-01

    231 Kane, Bleeding Talent, 219. 232 Sun Tzu , The Art of War, trans. Samuel B. Griffith (New York, NY: Oxford...Economics, January 1997: 165-188. 78 Sun Tzu . The Art of War. Translated by Samuel B. Griffith. New York, NY: Oxford University Press, 1963...63 BIBLIOGRAPHY

  2. Det muliges kunst og det umuliges politik

    DEFF Research Database (Denmark)

    Mai, Anne-Marie

    2014-01-01

    Artiklen diskuterer Rancières ideer om litteratur og politik som bidrag til ny politisk historie og inddrager Vita Andersens forfatterskab som eksempel......Artiklen diskuterer Rancières ideer om litteratur og politik som bidrag til ny politisk historie og inddrager Vita Andersens forfatterskab som eksempel...

  3. Limited Bandwidth Recognition of Collective Behaviors in Bio-Inspired Swarms

    Science.gov (United States)

    2014-05-09

    RISC 525 Brooks Road Rome NY 13441-4505 8. PERFORMING ORGANIZATION REPORT NUMBER N/A 9. SPONSORING/MONITORING AGENCY NAME(S) AND ADDRESS...ES) Air Force Research Laboratory/Information Directorate Rome Research Site/ RISC 525 Brooks Road Rome NY 13441-4505 10. SPONSOR/MONITOR’S ACRONYM

  4. Studies of nitride- and oxide-based materials as absorptive shifters for embedded attenuated phase-shifting mask in 193 nm

    Science.gov (United States)

    Lin, Cheng-ming; Chang, Keh-wen; Lee, Ming-der; Loong, Wen-An

    1999-07-01

    Abstract-Five materials which are PdSixOy, CrAlxOy, SiNx, TiSixNy, and TiSixOyNz as absorptive shifters for attenuated phase-shifting mask in 193 nm wavelength lithography are presented. PdSixOy films were deposited by dual e-gun evaporation. CrAlxOy, TiSixNy and TiSixOyNz films were formed by plasma sputtering and SiNx films were formed with LPCVD. All of these materials are shown to be capable of achieving 4 percent - 15 percent transmittance in 193 nm with thickness that produce a 180 degrees phase shift. Under BCl3:Cl2 equals 14:70 sccm; chamber pressure 5 mtorr and RF power 1900W, the dry etching selectivity of TiSixNy over DQN positive resist and fused silica, were found to be 2:1 and 4,8:1 respectively. An embedded layer TiSixNy with 0.5 micrometers line/space was successfully patterned.

  5. Archaeological studies at Drill Hole U20az Pahute Mesa, Nye county, Nevada. [Contains bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Simmons, A.H.; Hemphill, M.L.; Henton, G.H.; Lockett, C.L.; Nials, F.L.; Pippin, L.C.; Walsh, L.

    1991-07-01

    During the summer of 1987, the Quaternary Sciences Center (formerly Social Science Center) of the Desert Research Institute (DRI), University of Nevada System, conducted data recovery investigations at five archaeological sites located near Drill Hole U20az on the Nevada Test Site in southern Nevada. These sites were among 12 recorded earlier during an archaeological survey of the drill hole conducted as part of the environmental compliance activities of the Department of Energy (DOE). The five sites discussed in this report were considered eligible for the National Register of Historic Places and were in danger of being adversely impacted by construction activities or by effects of the proposed underground nuclear test. Avoidance of these sites was not a feasible alternative; thus DRI undertook a data recovery program to mitigate expected adverse impacts. DRI's research plan included controlled surface collections and excavation of the five sites in question, and had the concurrence of the Nevada Division of Historic Preservation and Archaeology and the Advisory Council of Historic Preservation. Of the five sites investigated, the largest and most complex, 26Ny5207, consists of at least three discrete artifact concentrations. Sites 26Ny5211 and 26Ny5215, both yielded considerable assemblages. Site 26Ny5206 is very small and probably is linked to 26Ny5207. Site 26Ny5205 contained a limited artifact assemblage. All of the sites were open-air occurrences, and, with one exception contained no or limited subsurface cultural deposits. Only two radiocarbon dates were obtained, both from 26Ny5207 and both relatively recent. While the investigations reported in the volume mitigate most of the adverse impacts from DOE activities at Drill Hole U20az, significant archaeological sites may still exist in the general vicinity. Should the DOE conduct further activities in the region, additional cultural resource investigations may be required. 132 refs., 71 figs., 44 tabs.

  6. Sedimentary record and anthropogenic pollution of a complex, multiple source fed dam reservoirs: An example from the Nové Mlýny reservoir, Czech Republic.

    Science.gov (United States)

    Sedláček, Jan; Bábek, Ondřej; Nováková, Tereza

    2017-01-01

    While numerous studies of dam reservoirs contamination are reported world-wide, we present a missing link in the study of reservoirs sourced from multiple river catchments. In such reservoirs, different point sources of contaminants and variable composition of their sedimentary matrices add to extremely complex geochemical patterns. We studied a unique, step-wise filled Nové Mlýny dam reservoir, Czech Republic, which consists of three interconnected sub-basins. Their source areas are located in units with contrasting geology and different levels and sources of contamination. The aim of this study is to provide an insight into the provenance of the sediment, including lithogenic elements and anthropogenic pollutants, to investigate the sediment dispersal across the reservoir, and to assess the heavy metal pollution in each basin. The study is based on multi-proxy stratigraphic analysis and geochemistry of sediment cores. There is a considerable gradient in the sediment grain size, brightness, MS and geochemistry, which reflects changing hydrodynamic energy conditions and primary pelagic production of CaCO 3 . The thickness of sediments generally decreases from proximal to distal parts, but underwater currents can accumulate higher amounts of sediments in distal parts near the thalweg line. Average sedimentation rates vary over a wide range from 0.58cm/yr to 2.33cm/yr. In addition, the petrophysical patterns, concentrations of lithogenic elements and their ratios made it possible to identify two main provenance areas, the Dyje River catchment (upper basin) and the Svratka and Jihlava River catchments (middle and lower basin). Enrichment factors (EF) were used for distinguishing the anthropogenic element contribution from the local background levels. We found moderate Zn and Cu pollution (EF ~2 to 5) in the upper basin and Zn, Cu and Pb (EF ~2 to 4.5) in the middle basin with the peak contamination in the late 1980s, indicating that the two basins have different

  7. 78 FR 45592 - DeltaPoint Capital IV, LP;

    Science.gov (United States)

    2013-07-29

    ..., Suite 160, Pittsford, NY 14534. The financing was contemplated for working capital. The financing is... SMALL BUSINESS ADMINISTRATION [License No. 02/02-0662] DeltaPoint Capital IV, LP; Notice Seeking... given that DeltaPoint Capital IV, L.P., 45 East Avenue, 6th Floor, Rochester, NY 14604, Federal...

  8. Gamification is broken. An interview with Steven Poole

    Directory of Open Access Journals (Sweden)

    Marco Benoit Carbone

    2012-05-01

    Full Text Available Steven Poole is the author of Trigger Happy (2000. New York, NY: Arcade Publish, Unspeak (2006. New York, NY: Grove Press, and You Aren’t What You Eat (2012. In press. He has written extensively on books, culture, and videogames for The Guardian and other publications.

  9. Nutrient content of wheat and corn in response to the application of urea and the urease inhibitor NPBT

    Science.gov (United States)

    A field study was conducted to evaluate the effects of the addition of two different urease inhibitors on the volatilization of ammonia from top dressed ammonia sources on winter wheat and dent corn. Two commercial urease inhibitors (NY and AG) were tested. Treatments included compost, compost+NY, u...

  10. 75 FR 17457 - Self-Regulatory Organizations; NYSE Amex LLC; Order Granting Accelerated Approval of the Proposed...

    Science.gov (United States)

    2010-04-06

    ...--Trading Systems), 964.2NY(b)(1)(iii) (Participation Entitlement of Specialists and e-Specialists), 964.2NY... protection. The proposal requires ATP holders to indicate whether Customer orders are ``Professional Customer'' orders.\\5\\ To comply with this requirement, ATP holders would be required to review their customers...

  11. The Snackbot: Documenting the Design of a Robot for Long-term Human-Robot Interaction

    Science.gov (United States)

    2009-03-01

    distributed robots. Proceedings of the Computer Supported Cooperative Work Conference’02. NY: ACM Press. [18] Kanda, T., Takayuki , H., Eaton, D., and...humanoid robots. Proceedings of HRI’06. New York, NY: ACM Press, 351-352. [23] Nabe, S., Kanda, T., Hiraki , K., Ishiguro, H., Kogure, K., and Hagita

  12. Jagten på det ukendte

    DEFF Research Database (Denmark)

    Mordhorst, Camilla

    2008-01-01

    En ny verden af mærkelige væsener og fremmede materialer flød ind over Europa i renæssancen. Gennem indsamling og konkrete undersøgelser af de nye fænomener forholdt de lærde sig til en ny tid. Udgivelsesdato: september...

  13. 77 FR 36396 - Safety Zones; Fireworks Displays in Captain of the Port Long Island Sound Zone

    Science.gov (United States)

    2012-06-19

    ... viewing or submitting material to the docket, call Renee V. Wright, Program Manager, Docket Operations... Fireworks. South Bay off Snapper Inn Restaurant, Oakdale, NY. 5. North Bay 4th of July Fireworks... p.m. Location: A point on the Connetquot River off Snapper Inn Restaurant, Oakdale, NY in...

  14. Impact of the snow cover scheme on snow distribution and energy budget modeling over the Tibetan Plateau

    Science.gov (United States)

    Xie, Zhipeng; Hu, Zeyong; Xie, Zhenghui; Jia, Binghao; Sun, Genhou; Du, Yizhen; Song, Haiqing

    2018-02-01

    This paper presents the impact of two snow cover schemes (NY07 and SL12) in the Community Land Model version 4.5 (CLM4.5) on the snow distribution and surface energy budget over the Tibetan Plateau. The simulated snow cover fraction (SCF), snow depth, and snow cover days were evaluated against in situ snow depth observations and a satellite-based snow cover product and snow depth dataset. The results show that the SL12 scheme, which considers snow accumulation and snowmelt processes separately, has a higher overall accuracy (81.8%) than the NY07 (75.8%). The newer scheme performs better in the prediction of overall accuracy compared with the NY07; however, SL12 yields a 15.1% underestimation rate while NY07 overestimated the SCF with a 15.2% overestimation rate. Both two schemes capture the distribution of the maximum snow depth well but show large positive biases in the average value through all periods (3.37, 3.15, and 1.48 cm for NY07; 3.91, 3.52, and 1.17 cm for SL12) and overestimate snow cover days compared with the satellite-based product and in situ observations. Higher altitudes show larger root-mean-square errors (RMSEs) in the simulations of snow depth and snow cover days during the snow-free period. Moreover, the surface energy flux estimations from the SL12 scheme are generally superior to the simulation from NY07 when evaluated against ground-based observations, in particular for net radiation and sensible heat flux. This study has great implications for further improvement of the subgrid-scale snow variations over the Tibetan Plateau.

  15. Reynolds Metals Company, Massena, NY

    Science.gov (United States)

    The 1,600-acre former Reynolds Metals Facility is located on the St. Lawrence River, approximately eight miles east of the Village of Massena, New York. The facility, which was constructed in 1958 for the production of aluminum, closed in 2014. It is owned

  16. Ny klassifikation af pancreatitis acuta

    DEFF Research Database (Denmark)

    Hansen, Benny Østerbye; Schmidt, Palle Nordblad

    2011-01-01

    parenchymal necrosis, or 3) peripancreatic necrosis alone. The classification also defines four types of collections: 1) Acute peripancreatic fluid collection, 2) pseudocyst, 3) acute post-necrotic collection, and 4) walled-off necrosis. This article summarizes the terminology of the revised Atlanta...

  17. Ny viden begynder med forhindringer

    DEFF Research Database (Denmark)

    Johansen, Martin Blok

    2017-01-01

    Pædagogik og pædagogisk arbejde diskuteres typisk inden for rammerne af det at hjælpe, støtte, simplificere og kompleksitetsreducere. Hvis man ønsker at vide noget om forhindringer, modstand og vanskeligheder som pædagogiske muligheder, så er udbuddet derimod forsvindende småt. Og når sådanne...... begreber endelig tages op, så benævnes de typisk blot, men bliver sjældent defineret. Hvad menes der med modstand, vanskeligheder eller kompleksitet? Med afsæt i en kort gennemgang af eksisterende forskning på området forsøger denne artikel at give et bud på en mulig definition af begrebet forhindring...

  18. Ny klassifikation af pancreatitis acuta

    DEFF Research Database (Denmark)

    Hansen, Benny Østerbye; Schmidt, Palle Nordblad

    2011-01-01

    The course of acute pancreatitis is in the initial phase dominated by a systemic inflammatory response, later by local complications. A new classification defines three specific types of pancreatitis: 1) interstitial oedematous pancreatitis and 2) necrotizing pancreatitis with pancreatic...

  19. En ny by i byen

    DEFF Research Database (Denmark)

    Grønlund, Bo

    2003-01-01

    Kunstakademiets Arkitektskoles Center for Tværfaglige Urbane Studier (Kactus, konference på Arkitektskolen 23. april 2003 om: Massekonsum og bymønstre, storcentre og indkøbsgader, velfærdstatsby og kollektivt forbrug, livsstilsgrupper og identitetsdannelser. 77 billedsider......Kunstakademiets Arkitektskoles Center for Tværfaglige Urbane Studier (Kactus, konference på Arkitektskolen 23. april 2003 om: Massekonsum og bymønstre, storcentre og indkøbsgader, velfærdstatsby og kollektivt forbrug, livsstilsgrupper og identitetsdannelser. 77 billedsider...

  20. Ny jagt på pelsgener

    DEFF Research Database (Denmark)

    Thirstrup, Janne Pia; Labouriau, Rodrigo; Guldbrandtsen, Bernt

    2011-01-01

    Kvalitet er en sammensat egenskab, der bl.a. består af dækhårslængde (nap), dækhårstykkelse og pelsfylde. Vi har analyseret hele minkens genom (undtaget kønskromosomerne) for at finde evidens for QTL for disse egenskaber. Til denne analyse har vi benyttet et F2-design. Vores resultater påviser QTL...

  1. Underdanmark i ny dansk prosa

    DEFF Research Database (Denmark)

    Gemzøe, Anker

    2016-01-01

    conceptions of working class literature? The article applies an updated terminology of literary history, an optic of genres and currents, firstly applied in a description of Danish working class literature 1890-1930. Through this comparative approach, the readings of contemporary works show that considerable...

  2. Ny verdensrekord for DTU Roadrunners

    DEFF Research Database (Denmark)

    Lassen, Lisbeth

    2015-01-01

    Økobilen har slået sin egen verdensrekord fra 2013 ved at køre hvad der svarer til 665 km på en liter benzin til Shell Eco – Marathon i Rotterdam lørdag d. 23. maj i kategorien Urban Concept.......Økobilen har slået sin egen verdensrekord fra 2013 ved at køre hvad der svarer til 665 km på en liter benzin til Shell Eco – Marathon i Rotterdam lørdag d. 23. maj i kategorien Urban Concept....

  3. Elliptic Solvers for Mediterranean Sea Ocean Modeling,

    Science.gov (United States)

    1984-05-01

    KWSP =21*(112+2*21+6) C PARAMETER (NX=IH-2, NY=JHS-2, KQ=NY*((NX+7)/4+1)+(NY+3)/2+8) 9C DOUBLE PRECISION AX,AY,AC(KH),ACKL DIMENSION HD(IH,JH),HT(IH...JH),RS(IH,JH) C COMMON/BV/ W1(IH,JHS),W2(IH,JHS),W3(IH,JHS),W4(IH,JHS) DOUBLE PRECISION WQ DIMENSION MAP(IH,JHS),WQ(JHS,5),WC( KWSP ) EQUIVALENCE (W1(1...AND ALL OTHER MODES C ( TYPICALLY MXKC1 .GE. MXKC2 .GE .MXKC3 ), C MXKC3 = MAX SIZE OF CV FOR RESTART T.S. C ( TYPICALLY MXKC3 = MXKP*3 ). C KWSP

  4. On Law and Justice

    DEFF Research Database (Denmark)

    Alf, Ross

    Alf Ross' omstridte hovedværk i ny engelsk oversættelse. Redigeret og med introduktion af Jakob v. H. Holtermann, oversat af Uta Bindreiter......Alf Ross' omstridte hovedværk i ny engelsk oversættelse. Redigeret og med introduktion af Jakob v. H. Holtermann, oversat af Uta Bindreiter...

  5. Paying for Hitler's War

    DEFF Research Database (Denmark)

    Lund, Joachim

    2017-01-01

    Book review of: Jonas Scherner & Eugene N. White (eds.), Paying for Hitler's War: The Consequenses of Nazi Hegemony for Europe (NY: Cambridge University Press, 2016)......Book review of: Jonas Scherner & Eugene N. White (eds.), Paying for Hitler's War: The Consequenses of Nazi Hegemony for Europe (NY: Cambridge University Press, 2016)...

  6. 77 FR 10792 - Self-Regulatory Organizations; Chicago Stock Exchange, Inc.; Notice of Filing and Immediate...

    Science.gov (United States)

    2012-02-23

    ... like to connect to the new facility and then subsequently disconnect from the Chicago facility. To... port fees and cross connection charges otherwise applicable to any Participants connecting to CHX's new... connecting to CHX's new facilities in the Equinix NY4 data center (``NY4'') until April 1, 2012. CHX also...

  7. 78 FR 20332 - Changes in Flood Hazard Determinations

    Science.gov (United States)

    2013-04-04

    ..., Mayor, Lynbrook, NY Village of 11563. Lynbrook, P.O. Box 7021, Lynbrook, NY 11563. Nassau Village of Valley The Honorable Village Hall, 123 http://www.rampp- July 16, 2013........ 360495 Stream (12-02- Edwin A. Fare, South Central team.com/lomrs.htm. 1677P). Mayor, Village of Avenue, Valley Valley Stream...

  8. 77 FR 20324 - Special Local Regulation and Safety Zones; Marine Events in Captain of the Port Sector Long...

    Science.gov (United States)

    2012-04-04

    ...: Waters of Reynolds Channel West of the loop parkway Bridge in Hempstead, NY. 7 July 7.1 Devon Yacht Club.... 8 August 8.1 Shelter Island Yacht Club Fireworks..... Location: Waters of Dering Harbor north of the Shelter Island yacht Club in Shelter Island, NY. 8.2 Stamford Fireworks Location: Waters of Stamford...

  9. 77 FR 17526 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2012-03-26

    ... Services. 81,162 Kennametal, Inc., Greenfield, MA April 1, 2011. JSCL Division. 81,324 CSB Fashion Inc..... New York, NY February 10, 2011. 81,337 Fu Sing Fashion, Inc Brooklyn, NY February 12, 2011. 81,374... Staffing and Adecco. 81,336 Bureau Veritas, Taunton, MA February 14, 2011. Consumer Product Services, Inc...

  10. Infestation dynamics of the Asian longhorned beetle in the United States

    Science.gov (United States)

    Alan Sawyer

    2007-01-01

    The Asian longhorned beetle (ALB), Anoplophora glabripennis (Coleoptera: Cerambycidae), is an exotic pest of Asian origin, first discovered in North America (Brooklyn, NY) in 1996. That infestation has now spread to Queens, Manhattan and Long Island, NY and Jersey City, NJ. Based on DNA profiles (Carter et al. 2005) and other evidence, independent...

  11. Fremtidens forskning skal streames på Netflix

    DEFF Research Database (Denmark)

    Agerbæk, Jonas; Hendriksen, Lauge; Mohr, Markus

    2015-01-01

    En ny dokumentarfilm eksperimenterer med at formidle forskning på film. To studerende og en forsker fortæller, hvordan de har testet den nye formidlingsform.......En ny dokumentarfilm eksperimenterer med at formidle forskning på film. To studerende og en forsker fortæller, hvordan de har testet den nye formidlingsform....

  12. 78 FR 33866 - Self-Regulatory Organizations; NYSE MKT LLC; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2013-06-05

    ... purpose of executing a particular investment strategy. Exchange Rule 900.3NY governs Complex Orders, Stock... rules of the stock execution venue, and sets out the priority ranking used by Exchange systems to... ``Electronic Complex Order'' is any Complex Order, as defined in Exchange Rule 900.3NY(e), or Stock/Option...

  13. Yet another call for a greater role for good faith in the South African ...

    African Journals Online (AJOL)

    NWUuser

    (Pty) Ltd and a KwaZulu-Natal franchisee, Dula Investments (Pty) Ltd, .... Company v The Paul Armstrong Company 263 NY 79; 188 NE 163; 1933 NY 167 (as recently ..... where his best advantage lies has a state of mind that falls short of the ...... ravages of apartheid, disadvantage and inequality are just immeasurable.

  14. Spoils of Truce

    DEFF Research Database (Denmark)

    Haugbølle, Sune

    2014-01-01

    Review of Spoils of Truce. Corruption and stat building in Postwar Lebanon Reinoud Leenders Ithaca, NY, Cornell University Press, 2012, ISBN 978-0-8014-5100-3......Review of Spoils of Truce. Corruption and stat building in Postwar Lebanon Reinoud Leenders Ithaca, NY, Cornell University Press, 2012, ISBN 978-0-8014-5100-3...

  15. The role of bromine and chlorine chemistry for arctic ozone depletion events in Ny-Ålesund and comparison with model calculations

    Directory of Open Access Journals (Sweden)

    M. Martinez

    Full Text Available During the Arctic Tropospheric Ozone Chemistry (ARCTOC campaigns at Ny-Ålesund, Spitsbergen, the role of halogens in the depletion of boundary layer ozone was investigated. In spring 1995 and 1996 up to 30 ppt bromine monoxide were found whenever ozone decreased from normal levels of about 40 ppb. Those main trace gases and others were specifically followed in the UV-VIS spectral region by differential optical absorption spectroscopy (DOAS along light paths running between 20 and 475 m a.s.l.. The daily variation of peroxy radicals closely followed the ozone photolysis rate J(O3(O1D in the absence of ozone depletion most of the time. However, during low ozone events this close correlation was no longer found because the measurement of radicals by chemical amplification (CA turned out to be sensitive to peroxy radicals and ClOx. Large CA signals at night can sometimes definitely be assigned to ClOx and reached up to 2 ppt. Total bromine and iodine were both stripped quantitatively from air by active charcoal traps and measured after neutron activation of the samples. Total bromine increased from background levels of about 15 ppt to a maximum of 90 ppt during an event of complete ozone depletion. For the spring season a strong source of bromine is identified in the pack ice region according to back trajectories. Though biogenic emission sources cannot be completely ruled out, a primary activation of halogenides by various oxidants seems to initiate an efficient autocatalytic process, mainly driven by ozone and light, on ice and perhaps on aerosols. Halogenides residing on pack ice surfaces are continuously oxidised by hypohalogenous acids releasing bromine and chlorine into the air. During transport and especially above open water this air mixes with upper layer pristine air. As large quantities of bromine, often in the form of BrO, have been observed at polar sunrise also around Antarctica, its release

  16. Matter of 381 Search Warrants Directed to Facebook, 2017 N.Y. Lexis 767, 2; 2017 NY Slip op. 02586, 2 (N.Y. April 4, 2017

    Directory of Open Access Journals (Sweden)

    Trad. Leopoldo Villar

    2017-08-01

    Full Text Available The growing importance of electronic communications gives a special interest to its protection, which involves several fundamental rights and guarantees such as freedom, privacy and property. Due to the importance of the discussion and the different positions it reflects on an issue of such sensitivity and pertinence in the world today, we publish below the translation of the decision by the Supreme Court of the State of New York of April 4, 2017, on the 381 search warrants directed to Facebook user accounts, ordered by the same Court in 2013 in response to a request by the New York County District Attorney, supported in turn by an affidavit given by a prosecutor in a criminal investigation. Facebook filed a motion seeking annulment of the search warrants and disclosure of the Prosecutor’s affidavit but both motions were rejected by the Appeals Division, whereupon Facebook appealed to the New York Supreme Court, which dismissed the appeal. Although most agreed that the appeal was not appropriate, the views of the judges contain interpretations that make their reading very useful and particularly the opinión given by the dissenting judge offers enriching arguments for defending the rights of users of electronic services.

  17. Reseñas de Libros

    Directory of Open Access Journals (Sweden)

    Diego Iturriaga Barco

    2009-04-01

    Full Text Available Aznar López, José María, Ocho años de gobierno. Una visión personal de España. Barcelona, Planeta, 2004.Páginas 201-203Diego Iturriaga BarcoChamocho Cantudo, Miguel Ángel, La Justicia del Pueblo. Los tribunales populares de Jaén durante la Guerra Civil. Jaén, Instituto de Estudios Giennenses, 2004, 296 pp.Páginas 203-205Eduardo Cebreiros ÁlvarezCobo Romero, Francisco, Revolución campesina y contrarrevolución franquista en Andalucía. Granada, Universidad de Granada, Universidad de Córdoba, 2004, 396 pp.Páginas 205-207David Molina RabadánDay, Timothy, Un siglo de música grabada. Madrid, Alianza Editorial, 2002, 312 pp.Páginas 207-209Joaquín Piñeiro BlancaDos Santos, Theotonio, La teoría de la dependencia. Balance y perspectivas. México, Plaza & Janés, 2003, 170 pp.Páginas 209-213Andre Gunder FrankGoodman, Amy, En la cama con el enemigo. Contra los políticos untados de petróleo, los empresarios que se benefician de las guerras y los medios de comunicación que los encubren. Madrid, Temas de Hoy, 2004, 364 pp.Páginas 213-215Inmaculada Ramírez PérezGu, Zhibin, China's Global Reach. Markets, Multinationals, and Globalization. Binghamton, Haworth Press, 2005, 359 pp.Páginas 215-216Jorge Nascimento RodriguesJiménez Bautista, Francisco, Las gentes del área metropolitana de Granada. Relaciones, percepciones y conflictos. Granada, Universidad de Granada, Instituto de la Paz y los Conflictos, 2004, 872 pp.Páginas 217-218David Molina RabadánKaye, H.J., Los historiadores marxistas británicos: un análisis introductorio. Zaragoza, Prensas Universitarias, 1989, 240 pp.Páginas 218-220Alejandro Estrella GonzálezKüng, Hans, Libertad conquistada: memorias. Madrid, Trotta, 2003, 619 pp.Páginas 221-222Gonzalo Ruiz BidónLópez Martínez, Mario (dir., Enciclopedia de Paz y Conflictos. Granada, Editorial Universidad de Granada, Junta de Andalucía-Consejería de Educación y Ciencia, 1.228 pp.Páginas 222-225Francisco Jim

  18. A Leadership Competency Model for U.S. Air Force Wing Chaplains

    Science.gov (United States)

    2009-02-12

    Daniel Goleman , Working with Emotional Intelligence (New York, NY: Bantam Books, 1998); Richard L...Competencies.” 51 Howard, “Identifying, Assessing, and Selecting Leaders.” 52 Daniel Goleman , Working with Emotional Intelligence (New York: Bantam Books...and Mechanical College, 1967. Goleman , Daniel . Working with Emotional Intelligence . New York, NY: Bantam Books, 1998. Goleman , Daniel ,

  19. 78 FR 65736 - Self-Regulatory Organizations; NYSE MKT LLC; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2013-11-01

    ... Proposed Rule Change 1. Purpose The Exchange is proposing to amend Rules 980NY(c)(i), (c)(iii), (e)(6)(A... specified conditions, in which case such individual orders and quotes have priority. Rule 980NY(c)(iii) currently provides that ATP Holders can view Electronic Complex Orders in the Consolidated Book via an...

  20. Laser Reliability Prediction

    Science.gov (United States)

    1975-08-01

    qovernment aqencies on request from RADC ( nCTM ) Griffiss AFP NY 13441. 71. Cochran, Albert L., "Check Test of Rangefinder, AN/GVS-3 (SM23E2)," Army...Qualified military and oovemnent aoencles on request from RAOC ( ncTM ) Griff Iss AFB NY 13441. 222. This reference will be made available to Qualified

  1. Dette er ikke for enhver fisk

    DEFF Research Database (Denmark)

    Opstrup, Kasper

    2018-01-01

    Omhandler fremkomsten af moderne okkultisme hos 1800-tallets utopiske socialister der ønskede at skabe en ny religion som grundstenen for en ny religion og denne tankes udvikling fra Eliphas Lévi til Fin-de-Siécle symbolisterne som f.eks. Josephin Péladan, der så kunsten som værende denne religio...

  2. Doku - sygepleje

    DEFF Research Database (Denmark)

    Sandholm Larsen, Niels

    2000-01-01

    Kommentar til Jette Baghs faglige kommentar "Primærbehandlet i Østrig" i Sygeplejersken nr. 18/2000. En ny trend inden for tv-underholdningen er doku-soaps.......Kommentar til Jette Baghs faglige kommentar "Primærbehandlet i Østrig" i Sygeplejersken nr. 18/2000. En ny trend inden for tv-underholdningen er doku-soaps....

  3. Rationalitet 2.0

    DEFF Research Database (Denmark)

    Schultz, Majken

    2014-01-01

    En ny rationalitet baserer sig på en økonomisk logik uden skelen til holdninger, værdier, omdømme eller bredere samfundsmæssige hensyn.......En ny rationalitet baserer sig på en økonomisk logik uden skelen til holdninger, værdier, omdømme eller bredere samfundsmæssige hensyn....

  4. Talentudfordringer

    DEFF Research Database (Denmark)

    Jørgensen, Frances; Gerstrøm, Anna; Molly-Søholm, Thorkil

    oplever rigtig mange virksomheder stadig store udfordringer med arbejdet med talentudvikling. For at imødekomme disse udfordringer og skabe ny viden om feltet nedsatte DEA i foråret 2009 en tænketank for talentudvikling.   Vi er bestemt blevet bestyrket i, at der er behov for ny viden på området. Fx er...

  5. 76 FR 33367 - Employment and Training Administration Program Year (PY) 2011 Allotments for the Workforce...

    Science.gov (United States)

    2011-06-08

    ..., ....... $9,123.00 $8,154.00 ($969) -10.60% Inc.. NY Native American Cultural Center, ....... $3,219.00 $2,878....00 $147,008.00 ($294.00) -0.2% Erie & Niagara Co. NY Native American Cultural Center, ....... $192... ($627) -10.60% Center. UT Ute Indian Tribe ....... $60,368.00 $53,955.00 ($6,413) -10.60% WA American...

  6. 77 FR 39288 - Self-Regulatory Organizations; NYSE MKT LLC; Notice of Filing of Proposed Rule Change Amending...

    Science.gov (United States)

    2012-07-02

    ... (i) ``ATP Holders,'' as that term is defined in Rule 900.2NY(5); (ii) Sponsored Participants, as that term is defined in Rule 900.2NY(77); and (iii) non-ATP Holder broker-dealers and vendors that request... change as described in Items I, II, and III below, which Items have been prepared by the self-regulatory...

  7. MAPP-konference om brugerdrevet innovation

    DEFF Research Database (Denmark)

    Stacey, Julia

    2005-01-01

    Er fødevareinnovation kun et spørgsmål om ny teknologi? Nej - for ny teknologi skal anvendes i produkter, som matcher markedets behov. Fødevarevirksomheder kan også være innovative bare ved at bruge kendt teknologi på nye måder, hvis produktet rammer de rigtige nicher på markedet. Innovationen er...

  8. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Shibi Thomas1 George Varghese1 István Lagzi2 3. Department of Physics, University of Calicut, Malappuram 673 635, India; Department of Meteorology, Eötvös University, H-1117 Pázmány sétány 1/A, Budapest, Hungary; Department of Chemical and Biological Engineering, Northwestern University, 2145 Sheridan Road, ...

  9. 27 CFR 26.11 - Meaning of terms.

    Science.gov (United States)

    2010-04-01

    ... headquarters port of the district (except the district of New York, N.Y.); the area directors of customs in the district of New York, N.Y.; and the port director at a port not designated as a headquarters port... estate, a partnership, an association, a company, or a corporation. Proof gallon. A gallon of liquid at...

  10. Er jeres ledere 'likeable'?

    DEFF Research Database (Denmark)

    Nielsen, Rikke Kristine

    2013-01-01

    Færdigheder: Oftest er lederne langtfra de første til at kaste sig over ny teknologi. It-kundskaberne på chefgangen trænger til en opgradering.......Færdigheder: Oftest er lederne langtfra de første til at kaste sig over ny teknologi. It-kundskaberne på chefgangen trænger til en opgradering....

  11. Jagten på virus i Tanzania

    DEFF Research Database (Denmark)

    Braae, Uffe Christian; Johansen, Maria Vang; Uttenthal, Åse

    2012-01-01

    Succesfuld feltafprøvning af ny metode til indsamling og påvisning af afrikansk svinepest viser, at virus gemmer sig i klinisk raske svin af dansk afstamning.......Succesfuld feltafprøvning af ny metode til indsamling og påvisning af afrikansk svinepest viser, at virus gemmer sig i klinisk raske svin af dansk afstamning....

  12. Migranten im frühneuzeitlichen Skandinavien

    DEFF Research Database (Denmark)

    Atzbach, Rainer

    2017-01-01

    This paper discusses the possibility how to identify Dutch, German and Scottish migrants in Aalborg, Elsinore and Nyä Lödöse on the basis of stove tiles......This paper discusses the possibility how to identify Dutch, German and Scottish migrants in Aalborg, Elsinore and Nyä Lödöse on the basis of stove tiles...

  13. En polymer og et netværk

    DEFF Research Database (Denmark)

    Birk, Torben

    2006-01-01

    Organisering af et system ved netværksdannelse mellem metalioncentre og organiske broer medfører ofte nye og/eller ændrede egenskaber af fysisk/mekanisk eller kemisk karakter. Her præsenteres et klassisk »netværks«-forsøg og en ny udgave med PVA-polymerer og borationer. Den ny udgave giver en...

  14. 78 FR 31402 - Safety Zones and Special Local Regulations; Recurring Marine Events in Captain of the Port Long...

    Science.gov (United States)

    2013-05-24

    ... Operations, telephone (202) 366-9826. SUPPLEMENTARY INFORMATION: Table of Acronyms COTP Captain of the Port... River off Snapper Inn Restaurant, Oakdale, NY in approximate position 40[deg]43'32.38'' N, 073[deg]9'02...'' restaurant Patchogue, NY in approximate position 40[deg]44'39.18'' N 073[deg]00'37.80'' W (NAD 83). 11.3...

  15. The Thoc1 Ribonucleoprotein as a Novel Biomarker for Prostate Cancer Treatment Assignment

    Science.gov (United States)

    2017-10-01

    INVESTIGATOR: James L. Mohler, MD CONTRACTING ORGANIZATION: Health Research, Inc., Roswell Park Division Buffalo, NY 14263-0001 REPORT DATE...ORGANIZATION REPORT NUMBER Health Research, Inc. Buffalo,NY 14263 9. SPONSORING / MONITORING AGENCY NAME(S) AND ADDRESS(ES) 10. SPONSOR/MONITOR’S ACRONYM...support for cancer clinical trials. Specific Aims: 1. Facilities: Physical facilities dedicated to the conduct of cancer focused research, and to

  16. Sanskrit og Latin

    DEFF Research Database (Denmark)

    Bang, Peter Fibiger

    2008-01-01

    Denne kronik præsenterer ligheder påpeget af ny forskning mellem den måde latin og sanskrit fungerede på som kosmopolitiske elitesprog. Udgivelsesdato: 1-7. Aug.......Denne kronik præsenterer ligheder påpeget af ny forskning mellem den måde latin og sanskrit fungerede på som kosmopolitiske elitesprog. Udgivelsesdato: 1-7. Aug....

  17. 77 FR 29257 - Registration of Copyright: Definition of Claimant

    Science.gov (United States)

    2012-05-17

    ... intestate succession.'' 17 U.S.C. 201(d)(1) In subsection 201(d)(2), Congress further stated that ``[a]ny of...., Morris v. Business Concepts, Inc., 259 F.3d 65, 70 (2d Cir. N.Y. 2001). As the Second Circuit makes clear... Pictures Entertainment, Inc., 402 F.3d 881 (9th Cir. 2005), quoting, 4 Business and Commercial Litigation...

  18. Outdoor Adventure er mulighedernes læringslandskab

    DEFF Research Database (Denmark)

    Pedersen, Sune Ib Schou

    2014-01-01

    Global Nutrition and Health er en ny international uddannelse for ernærings- og sundhedsstuderende ved Professionshøjskolen Metropol. De tilbydes Outdoor Adventure, som bryder de vante rammer for undervisning.......Global Nutrition and Health er en ny international uddannelse for ernærings- og sundhedsstuderende ved Professionshøjskolen Metropol. De tilbydes Outdoor Adventure, som bryder de vante rammer for undervisning....

  19. Outdoor Adventure er mulighedernes læringslandskab

    DEFF Research Database (Denmark)

    Pedersen, Sune

    2015-01-01

    Global Nutrition and Health er en ny international uddannelse for ernærings- og sundhedsstuderende ved Professionshøjskolen Metropol. De tilbydes Outdoor Adventure, som bryder de vante rammer for undervisning.......Global Nutrition and Health er en ny international uddannelse for ernærings- og sundhedsstuderende ved Professionshøjskolen Metropol. De tilbydes Outdoor Adventure, som bryder de vante rammer for undervisning....

  20. 3 og 13 på scenen

    DEFF Research Database (Denmark)

    Degerbøl, Stine Mikés

    2010-01-01

    Reportage fra Teater Republiques laboratorium QUE, hvor nye kunstneriske arbejdsmetoder afprøves af danske ny cirkus artister sammen med artister fra det canadiske kampagni Les 7 Doigts de la Main.......Reportage fra Teater Republiques laboratorium QUE, hvor nye kunstneriske arbejdsmetoder afprøves af danske ny cirkus artister sammen med artister fra det canadiske kampagni Les 7 Doigts de la Main....

  1. Åndens rene skabelse

    DEFF Research Database (Denmark)

    Bjerrum, Peter

    2002-01-01

    Kort essay om spændingen i Le Corbusier's værk mellem på den ene side bestræbelsen: at konstituere en ny universel orden for arkitekturen, de "5 punkter", modulor m.m., og på den anden side bestræbelsen: at sætte arkitekturen fri som åndens rene skabelse formuleret i "Mod en ny arkitektur", hvor...

  2. Seks bud på nye landvindinger inden for talent management

    DEFF Research Database (Denmark)

    Holt Larsen, Henrik

    2016-01-01

    Ledelse. Udviklingen af talenter i virksomhederne - ikke bare til chefstillinger, men også specialister - fintunes i disse år. Her præsenteres ny viden på området.......Ledelse. Udviklingen af talenter i virksomhederne - ikke bare til chefstillinger, men også specialister - fintunes i disse år. Her præsenteres ny viden på området....

  3. Phase and thickness dependence of thermal diffusivity in a-SiCxNy and a-BCxNy

    International Nuclear Information System (INIS)

    Chattopadhyay, S.; Chen, L.C.; Chien, S.C.; Lin, S.T.; Wu, C.T.; Chen, K.H.

    2002-01-01

    Thermal diffusivity (α) and bonding configuration of amorphous silicon carbon nitride (a-SiC x N y ) and boron carbon nitride (a-BC x N y ) films on silicon substrates were studied. Measurement of α by the traveling wave technique and bonding characterisation through X-ray photoelectron spectroscopy in a-SiC x N y and a-BC x N y films having different carbon concentrations revealed that lower coordinated bonds were detrimental to the thermal diffusivity of these films. Furthermore, α was found to depend on the thickness of these films deposited on silicon. This was attributed to the interface thermal resistance between two thermally different materials, the film and the substrate, although other factors such as film microstructure could also play a role. An empirical relation for the variation of thermal diffusivity with thickness is proposed

  4. Inheritance of downy mildew (Plasmopara viticola) and anthracnose (Sphaceloma ampelinum) resistance in grapevines.

    Science.gov (United States)

    Poolsawat, O; Mahanil, S; Laosuwan, P; Wongkaew, S; Tharapreuksapong, A; Reisch, B I; Tantasawat, P A

    2013-12-13

    Downy mildew (Plasmopara viticola) and anthracnose (Sphaceloma ampelinum) are two of the major diseases of most grapevine (Vitis vinifera L.) cultivars grown in Thailand. Therefore, breeding grapevines for improved downy mildew and anthracnose resistance is crucial. Factorial crosses were made between three downy mildew and/or anthracnose resistant lines ('NY88.0517.01', 'NY65.0550.04', and 'NY65.0551.05'; male parents) and two or three susceptible cultivars of V. vinifera ('Black Queen', 'Carolina Black Rose', and/or 'Italia'; female parents). F1 hybrid seedlings were evaluated for downy mildew and anthracnose resistance using a detached/excised leaf assay. For both diseases, the general combining ability (GCA) variance among male parents was significant, while the variance of GCA among females and the specific combining ability (SCA) variance were not significant, indicating the prevalence of additive over non-additive gene actions. The estimated narrow sense heritabilities of downy mildew and anthracnose resistance were 55.6 and 79.2%, respectively, suggesting that downy mildew/anthracnose resistance gene(s) were highly heritable. The 'Carolina Black Rose x NY65.0550.04' cross combination is recommended for future use.

  5. The archaeology of drill hole U20bc, Nevada Test Site, Nye County, Nevada

    International Nuclear Information System (INIS)

    McLane, A.R.; Hemphill, M.L.; Livingston, S.J.; Pippin, L.C.; Walsh, L.A.

    1992-01-01

    Impacts to four sites near drill hole U20bc on Pahute Mesa in the northwestern part of the Nevada Test Site were mitigated through data recovery. The work was done during 1988 by the Desert Research Institute for the Department of Energy, Nevada Field Office (DOE/NV)- The four sites that warranted data recovery were 26NY3171, 26NY3173, 26NY5561 and 26NY5566. These sites had previously been determined eligible to the National Register of Historic Places. They were temporary camps that contained lithic debitage, projectile points, milling stones and pottery, and therefore contributed significant information concerning the prehistory of the area. The study of the archaeological remains shows that the prehistoric people subsisted on plant foods and game animals as determined by the artifacts including manos, metates, pottery, lithic scrapers, and projectile points. The time sensitive arfifacts (pottery and diagnostic points) suggest that the region was used from about 12,000 B.P. to just before the historic period, possibly 150 years ago. DOE/NV has met its obligation to mitigate adverse impacts to the cultural resources at U20bc. Therefore, it is recommended that this project proceed as planned

  6. The Validity of the New York Radiological Grading Criteria in Diagnosing Sacroiliitis by Computed Tomography

    Energy Technology Data Exchange (ETDEWEB)

    Geijer, M.; Gadeholt Goethlin, G.; Goethlin, J.H. (Dept. of Diagnostic Radiology, Sahlgrenska Univ. Hospital, Goeteborg (Sweden))

    2009-07-15

    Background: Sacroiliitis in ankylosing spondylitis has frequently been graded radiographically using the New York (NY) criteria, which also have been applied in computed tomography (CT). Purpose: To validate the grading of the NY criteria in CT of the sacroiliac joints. Material and Methods: With the aid of the NY criteria, assessment of inflammatory and degenerative changes was made in 1304 CT studies. Assessment included erosions, the distribution, type, and width of sclerosis, and the involvement of the joints in sacroiliitis, as well as of normal anatomic variants such as joint space width and shape. Results: There was definite radiological sacroiliitis in 420 joints in 251 patients. Among these, more than two-thirds of the joint was involved in 71.0% of the affected joints. Sclerosis of the ilium was much more prevalent than sacral sclerosis. With increasing NY grade, iliac sclerosis, width, and extent increased, transition from sclerosis to normal bone became indistinct, and the structure of sclerosis was more inhomogeneous. Erosions of the joint surfaces were localized predominantly on the iliac side. Conclusion: Only erosions seem to be a valid solitary diagnostic sign. Solitary erosions need supplemental evidence from other inflammatory signs. Inflammatory sclerosis may be distinguished from degenerative sclerosis, and can sometimes support early diagnosis. Joint space width, joint shape, bone mineral content, or enthesopathy have no place in sacroiliitis diagnosis on CT. The NY criteria are not ideal for use with CT. A practical classification of sacroiliitis on CT is proposed, with a grading of no disease, suspected disease, and definite disease

  7. Landsdækkende symposium sætter fokus på biodiversitet

    DEFF Research Database (Denmark)

    Pedersen, Jens Christian

    2010-01-01

    Formålet med biodiversitetssymposiet er at skabe et nationalt forum hvor forskere, forvaltere og beslutningstagere mødes og diskuterer ny viden og aktuelle problemstillinger relateret til den danske biodiversitet og naturforvaltning.......Formålet med biodiversitetssymposiet er at skabe et nationalt forum hvor forskere, forvaltere og beslutningstagere mødes og diskuterer ny viden og aktuelle problemstillinger relateret til den danske biodiversitet og naturforvaltning....

  8. Alf Ross

    DEFF Research Database (Denmark)

    Ryberg, Jesper

    En (overvejende) ny generation af akademikere møder og prøver Ross' tanker om emner som retfærdighed, demokrati, statsforfatningsret, ytringsfrihed, straf, erkendelsesteori, etik, logik, fri vilje og sygdom.......En (overvejende) ny generation af akademikere møder og prøver Ross' tanker om emner som retfærdighed, demokrati, statsforfatningsret, ytringsfrihed, straf, erkendelsesteori, etik, logik, fri vilje og sygdom....

  9. Enhancing Unit Cohesion Via Social Media

    Science.gov (United States)

    2016-06-10

    Leavenworth, March 22, 2016). 8 Jeremy Harris Lipschultz, Social Media Communication : Concepts, Practices, Data, Law and Ethics (New York, NY...Gazette 97, no. 2 (February 2013): 8-14. Lipschultz, Jeremy Harris. Social Media Communication : Concepts, Practices, Data, Law and Ethics . New York, NY... communicate , but usually limit their scope of online participation to simply obtaining a social media presence. Although having a presence online is

  10. Anmeldelse af World Drug Report 2005

    DEFF Research Database (Denmark)

    Møller, Kim

    2005-01-01

    Internationale udfordringer i spændingsfeltet mellem organiseret kriminalitet og narkotika. Værdien af det illegale narkotikamarked. Skabelsen af et Illicit Drug Index. Ny organisationsstruktur bag udgivelsen af denne WDR. Udgivelsesdato: December......Internationale udfordringer i spændingsfeltet mellem organiseret kriminalitet og narkotika. Værdien af det illegale narkotikamarked. Skabelsen af et Illicit Drug Index. Ny organisationsstruktur bag udgivelsen af denne WDR. Udgivelsesdato: December...

  11. Effekter af koordineret hjerneskaderehabilitering. Et systematisk litteraturreview

    DEFF Research Database (Denmark)

    Glintborg, Chalotte; Hansen, Tia G. B.

    beskrevet. Der er ingen klar dansk definition af koordination. Begrebet bliver ofte brugt inkonsistent, og koordination er meget forskelligt tilrettelagt. Derfor kan man ikke generelt dokumentere, om koordinatorfunktioner er en sikker vej til forbedring af komplekse rehabiliteringsforløb. Sundhedsstyrelsen......Forskningsprojekt udvikler ny definition af begrebet koordination Som et led i forskningsprojektet ”Bio-psyko-sociale effekter af koordineret hjerneskaderehabilitering” er der udviklet en ny definition af koordinationsbegrebet. Forskningsprojektet ”Bio-psyko-sociale effekter af koordineret...... senhjerneskadeområdet – initiativer, der skal fremme en sammenhængende og helhedsorienteret rehabiliteringsindsats. Men hvad dækker begrebet koordination egentlig over? Det har et nyt forskningsprojekt set på og kommer med et bud på en ny definition. Dansk definition mangler Indholdet i koordination har været upræcist...

  12. 1979 Reserve Force Studies Surveys: Survey Design, Sample Design and Administrative Procedures,

    Science.gov (United States)

    1981-08-01

    Webster NY 14580 35 29 R064 Q43AA R 11 SC Des Moines IA 50315 109 60 R125 Q7ZAA R 11 AG Tifton GA 31794 9 70 R027 Q9XAA R 11 QM Helena MT 59601 21 23...NY 12208 8 46 GIB PCNBO AR 1 AR Palmdale CA 33550 2 68 GO PCQBO AR I AR San Diego CA 2111 78 6 G106 PC2CO AR 1 AR Dalton GA 30720 88 82 G08 PDZBO AR 1...NY 12401 51 47 G016 PCEAO R 4 FA Culver City CA 90230 94 52 G184 a PCKAO R 4 IN Visalia CA 93277 G197 a PDACO R 4 IN Eastman GA 31810 G130 PDGCO R 4 FA

  13. [Infrared videonystagmography in vestibular diagnosis].

    Science.gov (United States)

    Frisina, A; Piazza, F; Quaranta, N

    2000-01-01

    Vestibular examination relied upon electronystagmography (ENG) for more than 50 years. This method is based on recording of nystagmus (Ny) without any possibility to see the ocular movements directly. More recently, infrared videonystagmography (VNG) entered the diagnostic protocol of vestibular disorders. VNG permits to record and visualize Ny, both in the darkness and with open eyes. Aim of the present study was to verify the possible advantages of VNG versus ENG for functional evaluation of the vestibular system in patients suffering from otoneurological disorders. To that purpose, VNG and ENG tracings were recorded in 12 patients. The preliminary results show that there are not significant differences in quantitative evaluation of Ny between the two methods. Anyhow, VNG has some technical and clinical advantages that make it the method of choice.

  14. Kritikai menedzsmentelméletek – irányzatok és törésvonalak (Critical Management Studies: Streams and Debates)

    OpenAIRE

    Hidegh, Anna Laura

    2015-01-01

    A tanulmány a kritikai menedzsmentelméletek (KME) területére nyújt bevezetést a Hidegh – Gelei – Primecz (2014) által a Vezetéstudomány hasábjain kezdeményezett cikksorozat részeként. A KME fogalmát a korábbi, szervezetelméleti paradigmákat ismertető tanulmányoktól eltérő módon, a mátrixokon át-/ túllépve lépcsőszerűen tárgyalja. Bemutatja, hogyan definiálhatjuk kritikai módon a menedzsmentet és a menedzsmentelméleteket, majd a KME meghatározása és három legfontosabb jellemzője (d...

  15. Photosynthetic and growth response of sugar maple (Acer saccharum Marsh.) mature trees and seedlings to calcium, magnesium, and nitrogen additions in the Catskill Mountains, NY, USA

    Science.gov (United States)

    Momen, Bahram; Behling, Shawna J; Lawrence, Gregory B.; Sullivan, Joseph H

    2015-01-01

    Decline of sugar maple in North American forests has been attributed to changes in soil calcium (Ca) and nitrogen (N) by acidic precipitation. Although N is an essential and usually a limiting factor in forests, atmospheric N deposition may cause N-saturation leading to loss of soil Ca. Such changes can affect carbon gain and growth of sugar maple trees and seedlings. We applied a 22 factorial arrangement of N and dolomitic limestone containing Ca and Magnesium (Mg) to 12 forest plots in the Catskill Mountain region of NY, USA. To quantify the short-term effects, we measured photosynthetic-light responses of sugar maple mature trees and seedlings two or three times during two summers. We estimated maximum net photosynthesis (An-max) and its related light intensity (PAR at An-max), apparent quantum efficiency (Aqe), and light compensation point (LCP). To quantify the long-term effects, we measured basal area of living mature trees before and 4 and 8 years after treatment applications. Soil and foliar chemistry variables were also measured. Dolomitic limestone increased Ca, Mg, and pH in the soil Oe horizon. Mg was increased in the B horizon when comparing the plots receiving N with those receiving CaMg. In mature trees, foliar Ca and Mg concentrations were higher in the CaMg and N+CaMg plots than in the reference or N plots; foliar Ca concentration was higher in the N+CaMg plots compared with the CaMg plots, foliar Mg was higher in the CaMg plots than the N+CaMg plots; An-max was maximized due to N+CaMg treatment; Aqe decreased by N addition; and PAR at An-max increased by N or CaMg treatments alone, but the increase was maximized by their combination. No treatment effect was detected on basal areas of living mature trees four or eight years after treatment applications. In seedlings, An-max was increased by N+CaMg addition. The reference plots had an open herbaceous layer, but the plots receiving N had a dense monoculture of common woodfern in the

  16. Photosynthetic and Growth Response of Sugar Maple (Acer saccharum Marsh.) Mature Trees and Seedlings to Calcium, Magnesium, and Nitrogen Additions in the Catskill Mountains, NY, USA.

    Science.gov (United States)

    Momen, Bahram; Behling, Shawna J; Lawrence, Greg B; Sullivan, Joseph H

    2015-01-01

    Decline of sugar maple in North American forests has been attributed to changes in soil calcium (Ca) and nitrogen (N) by acidic precipitation. Although N is an essential and usually a limiting factor in forests, atmospheric N deposition may cause N-saturation leading to loss of soil Ca. Such changes can affect carbon gain and growth of sugar maple trees and seedlings. We applied a 22 factorial arrangement of N and dolomitic limestone containing Ca and Magnesium (Mg) to 12 forest plots in the Catskill Mountain region of NY, USA. To quantify the short-term effects, we measured photosynthetic-light responses of sugar maple mature trees and seedlings two or three times during two summers. We estimated maximum net photosynthesis (An-max) and its related light intensity (PAR at An-max), apparent quantum efficiency (Aqe), and light compensation point (LCP). To quantify the long-term effects, we measured basal area of living mature trees before and 4 and 8 years after treatment applications. Soil and foliar chemistry variables were also measured. Dolomitic limestone increased Ca, Mg, and pH in the soil Oe horizon. Mg was increased in the B horizon when comparing the plots receiving N with those receiving CaMg. In mature trees, foliar Ca and Mg concentrations were higher in the CaMg and N+CaMg plots than in the reference or N plots; foliar Ca concentration was higher in the N+CaMg plots compared with the CaMg plots, foliar Mg was higher in the CaMg plots than the N+CaMg plots; An-max was maximized due to N+CaMg treatment; Aqe decreased by N addition; and PAR at An-max increased by N or CaMg treatments alone, but the increase was maximized by their combination. No treatment effect was detected on basal areas of living mature trees four or eight years after treatment applications. In seedlings, An-max was increased by N+CaMg addition. The reference plots had an open herbaceous layer, but the plots receiving N had a dense monoculture of common woodfern in the forest floor

  17. Digital dannelse til gymnasieeleverne

    DEFF Research Database (Denmark)

    Kaarsted, Thomas; Holch Andersen, Knud

    2012-01-01

    Søsætningen af en ny tænketank skal udstikke nye digital retningslinjer for gymnasiekolerne. Baggrunden er en erkendelse af, at it-infrastruktur og digital teknologi ikke gør de alene.......Søsætningen af en ny tænketank skal udstikke nye digital retningslinjer for gymnasiekolerne. Baggrunden er en erkendelse af, at it-infrastruktur og digital teknologi ikke gør de alene....

  18. Methods for Functional Connectivity Analyses

    Science.gov (United States)

    2012-12-13

    motor , or hand motor function (green, red, or blue shading, respectively). Thus, this work produced the first comprehensive analysis of ECoG...Computer Engineering, University of Texas at El Paso , TX, USA 3Department of Neurology, Albany Medical College, Albany, NY, USA 4Department of Computer...Department of Health, Albany, NY, USA bDepartment of Electrical and Computer Engineering, University of Texas at El Paso , TX, USA cDepartment of Neurology

  19. Measurements in Regions of Shock Wave/Turbulent Boundary Layer Interaction from Mach 3 to 10 for Open and Blind Code Evaluation/Validation

    Science.gov (United States)

    2013-03-01

    34Blind" Code Evaluation/Validation Michael S. Holden, Timothy P. Wadhams, Matthew G. MacLean, Aaron Dufrene CUBRC , Inc March 2013 Final...298 Back (Rev. 8/98) *Fellow, AIAA, Vice President-Hypersonics, CUBRC , 4455 Genesee Street, Buffalo, NY 14225 ** Member, AIAA, Project Engineers... CUBRC , 4455 Genesee Street, Buffalo, NY 14225 This work was supported by AFOSR Grant No. FA9550-11-1-0290 MEASUREMENTS IN REGIONS OF SHOCK WAVE

  20. Vaccine mod halthed testes i besætning

    DEFF Research Database (Denmark)

    Lauritsen, Klara Tølbøll

    2012-01-01

    Ny vaccine mod ledbetændelse forårsaget af Mycoplasma hyosynoviae testes nu hos 200 svin i en problembesætning. Håbet er færre halte svin og en nedbringelse af antibiotikaforbruget.......Ny vaccine mod ledbetændelse forårsaget af Mycoplasma hyosynoviae testes nu hos 200 svin i en problembesætning. Håbet er færre halte svin og en nedbringelse af antibiotikaforbruget....

  1. New York esophageal squamous cell carcinoma-1 and cancer immunotherapy.

    Science.gov (United States)

    Esfandiary, Ali; Ghafouri-Fard, Soudeh

    2015-01-01

    New York esophageal squamous cell carcinoma 1 (NY-ESO-1) is a known cancer testis gene with exceptional immunogenicity and prevalent expression in many cancer types. These characteristics have made it an appropriate vaccine candidate with the potential application against various malignancies. This article reviews recent knowledge about the NY-ESO-1 biology, function, immunogenicity and expression in cancers as well as and the results of clinical trials with this antigen.

  2. United States Air Force Faculty Research Program 1989. Program Technical Report. Volume 4

    Science.gov (United States)

    1989-12-01

    Psychophysiology Systems, Processes and Applications, The Guilford Press, NY, pp. 354-377, 1986. Somsen, R., M. van der Molen , D. Boosma and J. Orlebeke. Phasic...June 1989. 5. Petri, C. A., "Kommiunikation mit Automaten," Schrifte des Rheinisch- Westfalischen Institutes fur instrumentelle Mathematik an der ...Psychophysiology of Cardiovascular Control. Orlebeke, J., G. Mulder and L. van Doornen (eds.), Plenum Press, NY, pp. 583-598, 1984. Wientjes, Kees. personal

  3. Disrupt mig vel: Fire gode råd om disruption

    DEFF Research Database (Denmark)

    Rydén, Pernille; Ringberg, Torsten; Østergaard Jacobsen, Per

    2017-01-01

    Forandring. Ønsket om at være teknologisk foran, kommer ofte til at ske på bekostning af fokus på kundernes oplevelser. Lighedstegnet mellem disruption og ny teknologi er kun den halve sandhed.......Forandring. Ønsket om at være teknologisk foran, kommer ofte til at ske på bekostning af fokus på kundernes oplevelser. Lighedstegnet mellem disruption og ny teknologi er kun den halve sandhed....

  4. CRISPR – hot genteknologisk teknik til at skabe nye sygdomsmodeller

    DEFF Research Database (Denmark)

    Alstrup, Aage Kristian Olsen

    2017-01-01

    CRISPR er i en ny genteknologisk teknik, som gør det muligt at ændre i genomet på alle arter af forsøgsdyr, hvor den gammelkendte teknik kun fungerede i mus.......CRISPR er i en ny genteknologisk teknik, som gør det muligt at ændre i genomet på alle arter af forsøgsdyr, hvor den gammelkendte teknik kun fungerede i mus....

  5. Strategisk ledelse i det offentlige

    DEFF Research Database (Denmark)

    Klausen, Kurt Klaudi

    Bogen opsamler 10 års forskning og undervisning i strategisk ledelse i det offentlige og udvikler en ny koncepttænkning om at se ind i fremtiden og foregribe den gennem de tre F'er......Bogen opsamler 10 års forskning og undervisning i strategisk ledelse i det offentlige og udvikler en ny koncepttænkning om at se ind i fremtiden og foregribe den gennem de tre F'er...

  6. Hippolytus' Sværd? En Note om Seneca, Phaedra vv. 896-7

    DEFF Research Database (Denmark)

    Bloch, David Kristian

    2007-01-01

    Denne korte artikel argumenterer for en ny tolkning af en passage fra Senecas tragedie Phaedra. Især er det væsentligt for fortolkningen, hvem der skal tildeles de relevante vers. Udgivelsesdato: 1. oktober......Denne korte artikel argumenterer for en ny tolkning af en passage fra Senecas tragedie Phaedra. Især er det væsentligt for fortolkningen, hvem der skal tildeles de relevante vers. Udgivelsesdato: 1. oktober...

  7. Beretning for Bulbrogård 2012 (BU2012), aristokratisk kompleks. NM I journalnr. 7701/94 Store Fuglede sogn, Ars herred, (Holbæk Amt) Region Sjælland. Sted nr. 03.01.06 – sb. nr. 102 Kort nr. 1413 III NØ Beretning for undersøgelse aristokratisk kompleks fra det 6. – 7. årh. ved Bulbrogård ved Tissø

    DEFF Research Database (Denmark)

    Bican, Josefine Franck

    De afsluttende undersøgelser på Bulbrogård 2012 bød på nye og overraskende resultater: Bulbrogård har fået en ny fase. Som det nogle gange sker, bliver man mere forvirret end oplyst ved at få mere viden – dette er også tilfældet her. Den ny hal (hus 7) kan være det manglende arkitektoniske bindel...

  8. Børn med ADHD skaber øget konflikt om morgenen

    DEFF Research Database (Denmark)

    Lange, Anne-Mette

    2017-01-01

    Dækning af ny forskning fra videnskabelige præsentationer på den femte Internationale ADHD Congress i Vancouver, 2017. http://propatienter.dk/sygdomme/psyken/280-born-med-adhd-skaber-oget-konflikt-om-morgenen.html......Dækning af ny forskning fra videnskabelige præsentationer på den femte Internationale ADHD Congress i Vancouver, 2017. http://propatienter.dk/sygdomme/psyken/280-born-med-adhd-skaber-oget-konflikt-om-morgenen.html...

  9. Approximate effective nonlinear coefficient of second-harmonic generation in KTiOPO(4).

    Science.gov (United States)

    Asaumi, K

    1993-10-20

    A simplified approximate expression for the effective nonlinear coefficient of type-II second-harmonicgeneration in KTiOPO(4) was obtained by observing that the difference between the refractive indices n(x) and n(y) is 1 order of magnitude smaller than the difference between n(z) and n(y) (or n(x)). The agreement of this approximate equation with the true definition is good, with a maximum discrepancy of 4%.

  10. Ny behandling af kronisk hepatitis B

    DEFF Research Database (Denmark)

    Andersen, Ellen Sloth; Weis, Nina M

    2008-01-01

    Worldwide, 350 million people are infected with chronic hepatitis B. Over the last few years, it has been possible to treat chronic hepatitis B. Treatment very often consists of nucleos(t)ide analogs and in a few cases of pegylated alpha-interferon. In 2007, a new nucleoside analog, Telbivudine...

  11. Rusland - en ny trussel fra fortiden

    DEFF Research Database (Denmark)

    Clemmesen, Michael Hesselholt

    2016-01-01

    Den russiske udenrigspolitik søger en maksimal »Putinisering« af nabolande. Man giver støtte til partier, der vil ødelægge det liberalt baserede vestlige politiske, økonomiske og militære samarbejde....

  12. Survey Submission for Chemung County, NY

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Survey data includes spatial datasets and data tables necessary to digitally represent data collected in the survey phase of the study. (Source: FEMA Guidelines and...

  13. Proměny Corporate Social Responsibility

    OpenAIRE

    Knížová, Kristýna

    2014-01-01

    In 1953, Howard R. Bowen gave rise to the debate on social responsibility, and since then it has become very widespread. The concept of Corporate Social Responsibility gained a lot of forms during the second half of the twentieth century and from the university campuses got into practice and also into the Czech Republic. On the background of changing theoretical approaches toward CSR we can see changes of business environment - especially in the change of the conceptualization of the enterpri...

  14. Ny simplere diagnosticering af multipel sklerose

    DEFF Research Database (Denmark)

    Mathiesen, Henrik Kahr; Sørensen, Per Soelberg

    2012-01-01

    The 2010 revision of the McDonald diagnostic criteria for multiple sclerosis is reviewed. The diagnostic criteria have been simplified, which allows earlier diagnosis and treatment of multiple sclerosis.......The 2010 revision of the McDonald diagnostic criteria for multiple sclerosis is reviewed. The diagnostic criteria have been simplified, which allows earlier diagnosis and treatment of multiple sclerosis....

  15. Ny behandling af kronisk hepatitis B

    DEFF Research Database (Denmark)

    Andersen, Ellen Sloth; Weis, Nina M; Weis, Nina M

    2008-01-01

    Worldwide, 350 million people are infected with chronic hepatitis B. Over the last few years, it has been possible to treat chronic hepatitis B. Treatment very often consists of nucleos(t)ide analogs and in a few cases of pegylated alpha-interferon. In 2007, a new nucleoside analog, Telbivudine......, was approved to treat chronic hepatitis B. In phase II and ongoing phase III studies, Telbivudine has proven more effective than the nucleoside analog, Lamivudine, which was very often used up until recently. Udgivelsesdato: 2008-Nov-24...

  16. En ny flugt ind i skoven

    DEFF Research Database (Denmark)

    Haarder, Jon Helt

    2008-01-01

    Thure Erik Lund: IND. (Inn). Oversat fra norsk af Sara Koch. 192 sider, 199 kr. Gyldendal. UDKOMMER I DAG. Fire stjerner......Thure Erik Lund: IND. (Inn). Oversat fra norsk af Sara Koch. 192 sider, 199 kr. Gyldendal. UDKOMMER I DAG. Fire stjerner...

  17. Turkish and American Undergraduate Students' Attitudes Toward HIV/AIDS Patients: A Comparative Study.

    Science.gov (United States)

    Atav, A Serdar; Sendir, Merdiye; Darling, Rosa; Acaroglu, Rengin

    2015-01-01

    Human immunodeficiency virus/acquired immunodeficiency syndrome (HIV/AIDS) is a complex healthcare problem. Research has demonstrated that negative attitudes affect healthcare provision. The purpose of this study was to compare nursing students' attitudes using the AIDS Attitude Scale (AAS). A descriptive, cross-sectional study was conducted in nursing schools in Istanbul, Turkey, and in Upstate New York (NY). Baccalaureate nursing students (n = 613) from both countries completed the questionnaire. Demographic data, overall AAS attitudes, and attitudes within each subscale were compared. Analyses included frequency and percentages of the grouped variables, arithmetic means and standard deviations, t-test for independent samples, and multiple analysis of variance. Upstate NY students' mean total AAS scores were significantly more positive toward HIV+ patients than Turkish students'. Scores for Professional Resistance and Emotions subscales were significantly more positive for the Upstate NY students, but Fear of Contagion was not. Upstate NY students had more negative attitudes in the contexts of job risk and eating in a restaurant where the chef has AIDS; more professional resistance to referring patients and training specialists for HIV/AIDS patients; and lower tender feelings for people with HIV/AIDS (p < .01 for each). Improvement in students' attitudes is beneficial for promoting nonjudgmental, compassionate care for the HIV+ population. © 2014 Wiley Periodicals, Inc.

  18. WE-C-TOUR-T-00: Exhibit Hall Guided Tours-Microdosimeters for Therapy (Wednesday) WE-C-TOUR-T-01

    International Nuclear Information System (INIS)

    2016-01-01

    Tour Leader: Indra Das, NYU Langone Medical Center, New York, NY Tour Guides: Hsui Ai, Indiana University School of Medicine, Indianapolis, IN Paulina Galvis, NYU Langone Medical Center, New York, NY Olga Volotoskova, NYU Langone Medical Center, New York, NY Participating Vendors: IBA PTW – New York RTI Electronics, Inc. Standard Imaging, Inc. Sun Nuclear Corporation Small fields are increasing used in specialized radiation treatments such as Gammaknife, Cyberknife, Tomotherapy, IMRT, VMAT, SRS and SBRT. Due to small field size electron transport creates lateral electronic disequilibrium and thus dosimetry could be very difficult. Microdetectors are used for small field dosimetry which will be discussed in preface of this tour as below: Understanding small field e.g. meaning and definition of small field IAEA definition and approach Characteristics of microdetectors in terms of perturbation, recombination, correction Suitability of microdetectors in small field dosimetry

  19. WE-C-TOUR-T-01: Microdosimeters for Therapy

    International Nuclear Information System (INIS)

    Das, I.

    2016-01-01

    Tour Leader: Indra Das, NYU Langone Medical Center, New York, NY Tour Guides: Hsui Ai, Indiana University School of Medicine, Indianapolis, IN Paulina Galvis, NYU Langone Medical Center, New York, NY Olga Volotoskova, NYU Langone Medical Center, New York, NY Participating Vendors: IBA PTW – New York RTI Electronics, Inc. Standard Imaging, Inc. Sun Nuclear Corporation Small fields are increasing used in specialized radiation treatments such as Gammaknife, Cyberknife, Tomotherapy, IMRT, VMAT, SRS and SBRT. Due to small field size electron transport creates lateral electronic disequilibrium and thus dosimetry could be very difficult. Microdetectors are used for small field dosimetry which will be discussed in preface of this tour as below: Understanding small field e.g. meaning and definition of small field IAEA definition and approach Characteristics of microdetectors in terms of perturbation, recombination, correction Suitability of microdetectors in small field dosimetry

  20. Srovnání ochrany měny na území ČR a eurozóny

    OpenAIRE

    NESNÍDALOVÁ, Kristýna

    2017-01-01

    The bachelor thesis deals with the problem of counterfeit currency. It focuses primarily on banknotes in the Czech Republic and the Euro zone. The first part describes the history of development in forgery and falsification of the banknotes, especially the counterfeit methods. Special attention is given to protective elements found on the "Czech Koruna" and the Euro banknotes. The second part solves the security features on the various denominations of banknotes. This work compares the securi...

  1. Large Scale System Defense

    Science.gov (United States)

    2008-10-01

    NUMBER 00 5f. WORK UNIT NUMBER 01 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) Columbia University 1700 Broadway New York NY 10019-5905 8...PERFORMING ORGANIZATION REPORT NUMBER 9. SPONSORING/MONITORING AGENCY NAME(S) AND ADDRESS(ES) AFRL/RIGA 525 Brooks Rd. Rome NY 13441-4505...pealing because of the need to modify source code. Since source-level annotations serve as a vestigial policy, we articulated a way to augment self

  2. Recommendations for the Interagency Ship Structure Committee’s Fiscal 1985 Research Program.

    Science.gov (United States)

    1984-01-01

    of the World War II 70 ship fracture problems. For over 30 years, the SSC has undertaken ,merous efforts to study the problem of brittle fracture. An...Research & Development Company, Houston, TX Prof. N. A. Hamlin, Webb Institute of Naval Architecture, Glen Cove, NY Prof. W. H. C. Maxwell...Institute of Naval Architecture, Glen Cove, NY OBJECTIVE The objective of this study is to determine sloshing loads on the boundaries, swash bulkheads, and

  3. Transition Workbook for Combat Veterans. Postdeployment User Guide

    Science.gov (United States)

    2009-01-01

    for Cognitive Therapy and Research. (2008). For consumers. http://www.beckinstitute.org/FolderID/223/SessionID/a/PageVars/Library/ InfoManage...particularly in the late afternoon or evening, including alcohol, caffeine, chocolate , and tobacco. 11. If you find there is a specific task or problem that... therapy and the emotional disorders. New York, NY: Penguin Books; 1979. 22. Burns DD. Feeling good: The new mood therapy . New York, NY: Harper Collins

  4. Duloxetine in the management of chronic musculoskeletal pain

    OpenAIRE

    Smith, Howard; Smith,; Smith,

    2012-01-01

    Howard S Smith,1 Eric J Smith,2 Benjamin R Smith21Department of Anesthesiology, Albany Medical College, Albany, NY; 2The Pharmaceutical Research Institute, Albany College of Pharmacy and Health Sciences, Rensselaer, NY, USAAbstract: Chronic musculoskeletal pain is among the most frequent painful complaints that healthcare providers address. The bulk of these complaints are chronic low back pain and chronic osteoarthritis. Osteoarthritis is the most common form of arthritis in the United State...

  5. Lost Unconventional Warfare Lessons from the Yugoslav Front

    Science.gov (United States)

    2012-12-06

    James D. Kiras, Special Operations and Strategy: From World War II to the War on Terror (NY: Routledge, Taylor and Francis Group, 2006), 93. 74 Walter...77 James D. Kiras, Special Operations and Strategy: From World War II to the War on Terror (NY: Routledge, Taylor and Francis Group, 2006), 94...79 Nigel West, Secret War: The Story of SOE, Britain’s Wartime Sabotage Organization (UK: Hodder & Stoughton Ltd., 1992), 189. 80

  6. Breaking Bad: The Efficacy of Ethics Education in Air Force Officer PME

    Science.gov (United States)

    2015-02-12

    of Teaching Ethics in the Military?” in Ethics Education in the Military, eds. Paul Robinson, Nigel De Lee, and Don Carrick (Burlington, VT: Ashgate...Decision Making: Social Dilemmas, Social Values, and Ethical Judgments, (New York, NY: Taylor and Francis Group, 2010), 288. 25. Ronald F. Duska and...Decision Making: Social Dilemmas, Social Values, and Ethical Judgments. (New York, NY: Taylor and Francis Group, 2010), 259. 41. Jones and Ryan, “The

  7. [Diagnostic criteria for Menière's disease. Consensus document of the Bárány Society, the Japan Society for Equilibrium Research, the European Academy of Otology and Neurotology (EAONO), the American Academy of Otolaryngology-Head and Neck Surgery (AAO-HNS) and the Korean Balance Society].

    Science.gov (United States)

    Lopez-Escamez, José A; Carey, John; Chung, Won-Ho; Goebel, Joel A; Magnusson, Måns; Mandalà, Marco; Newman-Toker, David E; Strupp, Michael; Suzuki, Mamoru; Trabalzini, Franco; Bisdorff, Alexandre

    2016-01-01

    This paper presents diagnostic criteria for Menière's disease jointly formulated by the Classification Committee of the Bárány Society, The Japan Society for Equilibrium Research, the European Academy of Otology and Neurotology (EAONO), the Equilibrium Committee of the American Academy of Otolaryngology-Head and Neck Surgery (AAO-HNS) and the Korean Balance Society. The classification includes 2 categories: definite Menière's disease and probable Menière's disease. The diagnosis of definite Menière's disease is based on clinical criteria and requires the observation of an episodic vertigo syndrome associated with low-to medium-frequency sensorineural hearing loss and fluctuating aural symptoms (hearing, tinnitus and/or fullness) in the affected ear. Duration of vertigo episodes is limited to a period between 20 min and 12h. Probable Menière's disease is a broader concept defined by episodic vestibular symptoms (vertigo or dizziness) associated with fluctuating aural symptoms occurring in a period from 20 min to 24h. Copyright © 2015 Elsevier España, S.L.U. and Sociedad Española de Otorrinolaringología y Patología Cérvico-Facial. All rights reserved.

  8. Rapport fra 2nd Supply Chain Leaders Forum 2013

    DEFF Research Database (Denmark)

    Knak, Henrik; Hald, Kim Sundtoft

    2013-01-01

    Dette års udgave af Supply Chain Leaders Forum diskede op med innovation, inspiration og ny indsigt i outsourcing. Konferencen var arrangeret i et samarbejde mellem Copenhagen Business School og Tata Consultancy Services. (Artiklen er på engelsk).......Dette års udgave af Supply Chain Leaders Forum diskede op med innovation, inspiration og ny indsigt i outsourcing. Konferencen var arrangeret i et samarbejde mellem Copenhagen Business School og Tata Consultancy Services. (Artiklen er på engelsk)....

  9. Data for DoD Manpower Policy Analysis

    Science.gov (United States)

    2009-01-01

    World War II Veterans Earn More Than Nonveterans?” Journal of Labor Economics , Vol. 12, No. 1, January 1994, pp. 74–97. ———, “Empirical Strategies in... Labor Economics ,” in Orley Ashenfelter and David Cards, eds., Handbook of Labor Economics Vol. 3a, Amsterdam, N.Y.: North-Holland, 2001. Antel, John...Microdata in Labor Economics Research,” in Handbook of Labor Economics , 1st ed., Orley Ashenfelter and Richard Layard, eds., Amsterdam, N.Y.: North

  10. Proceedings of the International Wire and Cable Symposium (31st) Held at Cherry Hill, New Jersey, on November 16, 17 and 18, 1982.

    Science.gov (United States)

    1982-11-01

    Comunicaciones , S.A. Arlington. TX Zarogoza, Spain Albany International Corporation Camden Wire Co., Inc. Chatham. NY Camden. NY Alcan Aluminio Do... COMUNICACIONES , S.A. ZARAGOZA (SPAIN) ABSIRACT the object of this paper. Fiq. I show the tradltio- Seo hnal schematic diagram of analoqical measurements of...power sum: ACKNOWLEDGMENT F2 F2 FN F(fo,!.o)dB = i0logi0 + 10 + ... IOT ) The authors qish to thank the people of Cables de Comunicaciones S.A. for

  11. Små kvalitetsforskelle mellem offentlige og private plejecentre

    DEFF Research Database (Denmark)

    Hjelmar, Ulf; Bhatti, Yosef; Vrangbæk, Karsten

    2016-01-01

    I en ny forskningsrapport sammenlignes kvaliteten på tværs af offentlige og private plejehjem i Danmark. Rapporten finder interessante forskelle mellem offentlige og private udbydere men konkluderer overordnet, at lighederne generelt er større end forskellene.......I en ny forskningsrapport sammenlignes kvaliteten på tværs af offentlige og private plejehjem i Danmark. Rapporten finder interessante forskelle mellem offentlige og private udbydere men konkluderer overordnet, at lighederne generelt er større end forskellene....

  12. Lyden af musik - er lyden af idealisme

    DEFF Research Database (Denmark)

    Eigtved, Michael

    2015-01-01

    Programartiklen til Det Ny Teaters opsætning af Rodgers & Hammersteins The Sound of Music, undersøger musicalgenrens - og især de konkrete ophavsmænds- affinitet til fremstillingen af såvel idealistiske som ideologiske universer.......Programartiklen til Det Ny Teaters opsætning af Rodgers & Hammersteins The Sound of Music, undersøger musicalgenrens - og især de konkrete ophavsmænds- affinitet til fremstillingen af såvel idealistiske som ideologiske universer....

  13. New New Nordic Branding

    DEFF Research Database (Denmark)

    Andersen, Lars Pynt

    2017-01-01

    Konstruktionen af nordisk regionalisme er en stærk tendens som udgangspunkt for Nordic branding, men har vi egentlig forstået de værdier og spændinger, der driver hele projektet om en ny ’nordiskhed’?......Konstruktionen af nordisk regionalisme er en stærk tendens som udgangspunkt for Nordic branding, men har vi egentlig forstået de værdier og spændinger, der driver hele projektet om en ny ’nordiskhed’?...

  14. The Linear Quadratic Adjustment Cost Model and the Demand for Labour

    DEFF Research Database (Denmark)

    Engsted, Tom; Haldrup, Niels

    1994-01-01

    Der udvikles en ny metode til estimation og test af den lineære kvadratiske tilpasningsomkostningsmodel når de underliggende tidsserier er ikke-stationære, og metoden anvendes til modellering af arbejdskraftefterspørgslen i danske industrisektorer.......Der udvikles en ny metode til estimation og test af den lineære kvadratiske tilpasningsomkostningsmodel når de underliggende tidsserier er ikke-stationære, og metoden anvendes til modellering af arbejdskraftefterspørgslen i danske industrisektorer....

  15. A Reduced-Order Successive Linear Estimator for Geostatistical Inversion and its Application in Hydraulic Tomography

    Science.gov (United States)

    Zha, Yuanyuan; Yeh, Tian-Chyi J.; Illman, Walter A.; Zeng, Wenzhi; Zhang, Yonggen; Sun, Fangqiang; Shi, Liangsheng

    2018-03-01

    Hydraulic tomography (HT) is a recently developed technology for characterizing high-resolution, site-specific heterogeneity using hydraulic data (nd) from a series of cross-hole pumping tests. To properly account for the subsurface heterogeneity and to flexibly incorporate additional information, geostatistical inverse models, which permit a large number of spatially correlated unknowns (ny), are frequently used to interpret the collected data. However, the memory storage requirements for the covariance of the unknowns (ny × ny) in these models are prodigious for large-scale 3-D problems. Moreover, the sensitivity evaluation is often computationally intensive using traditional difference method (ny forward runs). Although employment of the adjoint method can reduce the cost to nd forward runs, the adjoint model requires intrusive coding effort. In order to resolve these issues, this paper presents a Reduced-Order Successive Linear Estimator (ROSLE) for analyzing HT data. This new estimator approximates the covariance of the unknowns using Karhunen-Loeve Expansion (KLE) truncated to nkl order, and it calculates the directional sensitivities (in the directions of nkl eigenvectors) to form the covariance and cross-covariance used in the Successive Linear Estimator (SLE). In addition, the covariance of unknowns is updated every iteration by updating the eigenvalues and eigenfunctions. The computational advantages of the proposed algorithm are demonstrated through numerical experiments and a 3-D transient HT analysis of data from a highly heterogeneous field site.

  16. Blood feeding patterns of Nyssomyia intermedia and Nyssomyia neivai (Diptera, Psychodidae in a cutaneous leishmaniasis endemic area of the Ribeira Valley, State of São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Ana Maria Marassa

    2013-09-01

    Full Text Available Introduction The aim of this study was to identify the blood feeding sources of Nyssomyia intermedia (Ny. intermedia and Nyssomyia neivai (Ny. neivai, which are Leishmania vectors and the predominant sandfly species in the Ribeira Valley, State of São Paulo, Brazil, an endemic area for cutaneous leishmaniasis. Methods Specimens were captured monthly between February 2001 and December 2003 on a smallholding and a small farm situated in the Serra district in the Iporanga municipality. The blood meals of 988 engorged females were tested using the avidin-biotin immunoenzymatic enzyme-linked immunosorbent assay (ELISA. Seven blood meal sources were investigated: human, dog, chicken, bovine, pig, horse and rat. Results The results showed that among the females that fed on one or more blood sources, the respective percentages for Ny. intermedia and Ny. neivai, respectively, were as follows: human (23% and 36.8%, pig (47.4% and 26.4%, chicken (25.7% and 36.8% and dog (3.9% and 0%, and the differences in the blood sources between the two species were statistically significant (p = 0.043. Conclusions Both species had predominant reactivity for one or two blood sources, and few showed reactivity indicating three or four sources. Many different combinations were observed among the females that showed reactivity for more than one source, which indicated their opportunistic habits and eclecticism regarding anthropic environmental conditions.

  17. The Environmental Assessment and Management (TEAM) Guide: West Virginia Supplement

    Science.gov (United States)

    2010-01-01

    WVCSR 45-21-19) [Citation Revised January 2008]. • Paper Coating Line - a web coating line where coating is applied to paper . Printing presses are...from a ny stack, pi pe, a ir pol lution c ontrol de vice, or f rom a ny ot her equipment or facilities associated with a c hemical processing unit...to, hoods, ducts, fans, booths, ovens, dryers , e tc.) that contains, collects, and transports an air pollutant to a control device (WVCSR 45-21-2.9

  18. Ketofol for monitored anesthesia care in shoulder arthroscopy and labral repair: a case report

    OpenAIRE

    Lee, Kevin C; Shi, Hanyuan; Lee, Brian C

    2016-01-01

    Kevin C Lee,1 Hanyuan Shi,2 Brian C Lee3 1Columbia University College of Dental Medicine, New York, NY, 2Vanderbilt University School of Medicine, Nashville, TN, 3Department of Anesthesiology, Columbia University Medical Center, New York, NY, USA Abstract: A 21-year-old male (body mass index: 28.3) with a history of asthma and reactive airway disease since childhood underwent left shoulder arthroscopy and labral repair surgery under monitored anesthesia care. Because the procedure was perform...

  19. Politisk disruption

    DEFF Research Database (Denmark)

    Tække, Jesper

    2018-01-01

    Dette blogindlæg giver en kort analyse af hvordan de sociale medier ved at give en ny tid har åbnet for den disruption af de politiske processer som især Trump stå som et eksempel på.......Dette blogindlæg giver en kort analyse af hvordan de sociale medier ved at give en ny tid har åbnet for den disruption af de politiske processer som især Trump stå som et eksempel på....

  20. Emergence and Evolution of Multidrug-Resistant Klebsiella pneumoniae with both blaKPC and blaCTX-M Integrated in the Chromosome

    OpenAIRE

    Huang, Weihua; Wang, Guiqing; Sebra, Robert; Zhuge, Jian; Yin, Changhong; Aguero-Rosenfeld, Maria E.; Schuetz, Audrey N.; Dimitrova, Nevenka; Fallon, John T.

    2017-01-01

    The extended-spectrum-β-lactamase (ESBL)- and Klebsiella pneumoniae carbapenemase (KPC)-producing Enterobacteriaceae represent serious and urgent threats to public health. In a retrospective study of multidrug-resistant K. pneumoniae, we identified three clinical isolates, CN1, CR14, and NY9, carrying both blaCTX-M and blaKPC genes. The complete genomes of these three K. pneumoniae isolates were de novo assembled by using both short- and long-read whole-genome sequencing. In CR14 and NY9, bla...

  1. Conference Digest - International Conference on Infrared and Millimeter Waves (13th) Held in Honolulu, Hawaii on 5-9 December 1988. Volume 1039.

    Science.gov (United States)

    1989-12-09

    BY MICROSTRIP LINES - ERTIES OF GLASSES AND THE ENERGY TRANSFER TiROUGH S.T. Peng, NY Inst of Technology, Old Westbury, NY 11568; R.T. WINDOWS - R...Power is available from a Varian gyrotron oscillator design is an all-copper machined grating. The polarization in the TEo2 mode in 6.35-cm-diam...dielectric waveguide necessary. The Abel-inverted profile is shown in of *59 mm (Pyrex glass ). The laser beam is divided Fig.3(b). The measured density profile

  2. Schizophrenia relapse after stopping olanzapine treatment during pregnancy: a case report

    OpenAIRE

    Ifteni, Petru; Moga, Marius A; Burtea, Victoria; Correll, Christoph U

    2014-01-01

    Petru Ifteni,1,2 Marius A Moga,1 Victoria Burtea,1,2 Christoph U Correll3,4 1Faculty of Medicine, Transilvania University, Brasov, Romania; 2Psychiatry and Neurology Hospital, Brasov, Romania; 3Department of Psychiatry, The Zucker Hillside Hospital, North Shore-Long Island Jewish (LIJ) Health System, New York, NY, USA; 4Hofstra North Shore-LIJ School of Medicine, New York, NY, USA Abstract: Women with schizophrenia have a high risk for symptom exacerbation or relapse during pregnan...

  3. Stress, Shock, and Adaptation in the Twentieth Century

    DEFF Research Database (Denmark)

    Leese, Peter

    2016-01-01

    Review article on: David Cantor and Edmund Ramsden, eds. Stress, Shock, and Adaptation in the Twentieth Century. Rochester Studies in Medical History. Rochester, N.Y.: University of Rochester Press, 2014. vi + 367 pp. Ill. $125.00 (978-1-58046-476-5).......Review article on: David Cantor and Edmund Ramsden, eds. Stress, Shock, and Adaptation in the Twentieth Century. Rochester Studies in Medical History. Rochester, N.Y.: University of Rochester Press, 2014. vi + 367 pp. Ill. $125.00 (978-1-58046-476-5)....

  4. Investigation of Acoustic Vector Sensor Data Processing in the Presence of Highly Variable Bathymetry

    Science.gov (United States)

    2014-06-01

    shelf 10 region to the north of the canyon. The impact of this 3-dimensional (3D) variable bathymetry, which may be combined with the effects of...weaker arrivals at large negative angles, consistent with the earliest bottom reflections on the left. The impact of the bottom-path reflections from...nzout*(nrout+1)*ny))),’bof’); for ifr =1:64, for ir=1:nrout+1, for iy=1:ny, data=fread(fid3,2*nzout,’float32’); fwrite(fid,data

  5. Design Integration - a theroretical and empirical study of design integration in small and medium sized Danish companies

    DEFF Research Database (Denmark)

    Erichsen, Pia Geisby

    er drivkræft. Afhandlingen bidrager til design management feltet med en ny måde at tale om og forstå design integration. Yderligere bidrager den med ny viden omkring dynamikken omkring design integration. Sidst men ikke mindst biddrager den til, at designledelseskonsulenter samt små og mellemstore...... organisatorisk kontekst?’ - blev søgt besvaret gennem to litteraturstudier af henholdsvis design management og design. Litteraturstudiet af design management gav imidlertid kun begrænsede svar på spørgsmålet ’hvad er design?’. Designfeltet derimod kunne give et mere nuanceret svar, hvilket resulterede i en ny...... blev det identificeret, at det var relevant, at se på barrierer og drivkræfter et dynamisk perspektiv. Via observationsstudiet blev designtrappen identificeret som relevant i forhold til forskningsspørgsmålet, men modellen havde også nogle indbyggede barrierer, hvorfor der blev søgt efter andre...

  6. Použití OpenCl v AVG na platformě Windows

    OpenAIRE

    Bajcar, Martin

    2012-01-01

    Tato práce se zabývá praktickým využitím technologie OpenCL ve společnosti AVG. AVG vidí OpenCL jako jednu z možností, jak ulehčit zátěž procesoru a případně urychlit výpočet některých algoritmů. Velká část práce se zabývá optimalizacemi pro grafické karty AMD a NVIDIA, jakožto současné nejrozšířenější karty. Praktická část popisuje paralelizaci dvou algoritmů dodaných AVG, jejich analýzu z pohledu OpenCL a implementaci. Následně jsou popsány a odůvodněny dosažené výsledky a jsou popsány podm...

  7. Dynamic viscoelasticity of protease-treated rice batters for gluten-free rice bread making.

    Science.gov (United States)

    Honda, Yuji; Inoue, Nanami; Sugimoto, Reina; Matsumoto, Kenji; Koda, Tomonori; Nishioka, Akihiro

    2018-03-01

    Papain (cysteine protease), subtilisin (Protin SD-AY10, serine protease), and bacillolysin (Protin SD-NY10, metallo protease) increased the specific volume of gluten-free rice breads by 19-63% compared to untreated bread. In contrast, Newlase F (aspartyl protease) did not expand the volume of the rice bread. In a rheological analysis, the viscoelastic properties of the gluten-free rice batters also depended on the protease categories. Principal component analysis (PCA) analysis suggested that the storage and loss moduli (G' and G″, respectively) at 35 °C, and the maximum values of G' and G″, were important factors in the volume expansion. Judging from the PCA of the viscoelastic parameters of the rice batters, papain and Protin SD-AY10 improved the viscoelasticity for gluten-free rice bread making, and Protin SD-NY effectively expanded the gluten-free rice bread. The rheological properties differed between Protin SD-NY and the other protease treatments.

  8. Demokrati

    DEFF Research Database (Denmark)

    Larsen, Steen Nepper

    2014-01-01

    Skriver på opfordring af red. v. Lars Jakob Muschinsky to opslag à ca. 9-10.000 enheder om hhv. ”Demokrati” (s.65-69) og ”Værdier” (s.493-497) til Ny Pædagogisk Opslagsbog, der udgives af Hans Reitzels Forlag......Skriver på opfordring af red. v. Lars Jakob Muschinsky to opslag à ca. 9-10.000 enheder om hhv. ”Demokrati” (s.65-69) og ”Værdier” (s.493-497) til Ny Pædagogisk Opslagsbog, der udgives af Hans Reitzels Forlag...

  9. Værdier

    DEFF Research Database (Denmark)

    Larsen, Steen Nepper

    2014-01-01

    Skriver på opfordring af red. v. Lars Jakob Muschinsky to opslag à ca. 9-10.000 enheder om hhv. ”Demokrati” (s.65-69) og ”Værdier” (s.493-497) til Ny Pædagogisk Opslagsbog, der udgives af Hans Reitzels Forlag......Skriver på opfordring af red. v. Lars Jakob Muschinsky to opslag à ca. 9-10.000 enheder om hhv. ”Demokrati” (s.65-69) og ”Værdier” (s.493-497) til Ny Pædagogisk Opslagsbog, der udgives af Hans Reitzels Forlag...

  10. Vesicular stomatitis virus modified with single chain IL-23 exhibits oncolytic activity against tumor cells in vitro and in vivo

    OpenAIRE

    Reiss, Carol Shoshkes

    2010-01-01

    James M Miller1, Sarah McNulty Bidula1,5, Troels Mygind Jensen1,6, Carol Shoshkes Reiss1,2,3,41Department of Biology, New York University, New York, NY, USA; 2Center for Neural Science, NYU; 3NYU Cancer Institute; 4Departments of Microbiology, NYU School of Medicine and Mt Sinai School of Medicine, New York, NY, USA; 5Present address Graduate Program, University of Pittsburgh School of Medicine, Pittsburgh, PA,USA 6Present address: Univercity of Copenhagen, Copenhagen, DenmarkAbstract: Viruse...

  11. Lille spejl i hjernen dér

    DEFF Research Database (Denmark)

    Wallentin, Mikkel

    2014-01-01

    Myte? Spejlneuroner er blevet brugt til at forklare både læring, empati og sprog, og tidligere i år modtog Giacomo Rizzolatti den store Brain Prize for opdagelsen af dem. Ny bog er kritisk over for fænomenet.......Myte? Spejlneuroner er blevet brugt til at forklare både læring, empati og sprog, og tidligere i år modtog Giacomo Rizzolatti den store Brain Prize for opdagelsen af dem. Ny bog er kritisk over for fænomenet....

  12. Risk and vulnerability to global and climate change in South Africa

    CSIR Research Space (South Africa)

    Mambo, Julia

    2017-12-01

    Full Text Available of working group II to the fifth assessment report of the Intergovernmental Panel on Climate Change [C.B. Field, V. Barros, D.J. Dokken, K.J. Mach, M.D. Mastrandrea, T.E. Bilir et al. (eds)]. Cambridge, UK and New York, NY: Cambridge University Press.... Qin, Z. Manning, Z. Chen, M. Marquis, K. Averyt et al. (eds)]. Cambridge, UK and New York, NY: Cambridge University Press. IPCC (Intergovernmental Panel on Climate Change). 2012. Managing the risks of extreme events and disasters to advance...

  13. Darwin på arabisk

    DEFF Research Database (Denmark)

    Riexinger, Martin Thomas

    2014-01-01

    Det var to revolutionære spor, som i begyndelsen af 1800-talet gødede jorden for introduktionen af Darwins evolutionsteori i Mellemøsten, og muslimer spillede stort set ingen rolle for den udviklingen. Ny bog om islam og evolutionsteorien.......Det var to revolutionære spor, som i begyndelsen af 1800-talet gødede jorden for introduktionen af Darwins evolutionsteori i Mellemøsten, og muslimer spillede stort set ingen rolle for den udviklingen. Ny bog om islam og evolutionsteorien....

  14. Bæredygtig modeindustri

    DEFF Research Database (Denmark)

    Skjold, Else; Kjær, Lykke Bloch; Gerner Nielsen, Elsebeth

    2017-01-01

    Indlæg om de udfordringer modeindustrien står over for i forhold til bæredygtighed - og de løsningsmodeller der udvikles gennem udvikling og implementering af ny viden på området i regi af Designskolen Kolding......Indlæg om de udfordringer modeindustrien står over for i forhold til bæredygtighed - og de løsningsmodeller der udvikles gennem udvikling og implementering af ny viden på området i regi af Designskolen Kolding...

  15. Tiden kræver nye karakteregenskaber

    DEFF Research Database (Denmark)

    Holm, Claus

    2013-01-01

    I Danmark har vi tradition for, at unges studievalg er styret af faglig interesse og lyst. Men en ny global konkurrencetilstand kræver, at lysten også omfatter vilje til at udføre kedsommelige pligter som moderne og fleksible medarbejdere......I Danmark har vi tradition for, at unges studievalg er styret af faglig interesse og lyst. Men en ny global konkurrencetilstand kræver, at lysten også omfatter vilje til at udføre kedsommelige pligter som moderne og fleksible medarbejdere...

  16. Hollywood er bange for kineserne

    DEFF Research Database (Denmark)

    Mehlsen, Camilla

    2011-01-01

    Frygten for Kina vokser i Vesten. Amerikanerne mener, at Kina udgør den største fare for USA, men i Hollywood tør man for det meste ikke bruge kineserne som skurke. Det laver ny film om på.......Frygten for Kina vokser i Vesten. Amerikanerne mener, at Kina udgør den største fare for USA, men i Hollywood tør man for det meste ikke bruge kineserne som skurke. Det laver ny film om på....

  17. Accelerator lyfter forskningen

    CERN Multimedia

    Frankel, Göran

    2004-01-01

    "Geologerna i Lund har under hösten byggt upp och testat en ny anläggning för $^{14}$C-datering med s.k. AMS - Acceleratormasspektrometri. AMS - Metodenär inte ny men just den här teknologinär det - det här är den första anläggningen i shitt slag i världen och förvänt-ningarna på vad den ska kunna åstad komma är stora" (1 page)

  18. Professor håber på åbenhed om CRISPR/Cas9

    DEFF Research Database (Denmark)

    Hokland, Peter

    2016-01-01

    CRISPR/Cas9 er navnet på en ny, revolutionerende genteknologi, der på sigt kan ændre menneskeheden. Forhåbentligt vil processen være være løbende opdateringer om frem- og tilbageskridt om teknikken, skriver professor.......CRISPR/Cas9 er navnet på en ny, revolutionerende genteknologi, der på sigt kan ændre menneskeheden. Forhåbentligt vil processen være være løbende opdateringer om frem- og tilbageskridt om teknikken, skriver professor....

  19. Derfor er Fodbold Fitness svær at udbrede

    DEFF Research Database (Denmark)

    Bennike, Søren

    2016-01-01

    DBU ønsker at udbrede Fodbold Fitness som en ny og anderledes måde at organisere og dermed 'gå til fodbold på'. Imidlertid udfordrer organiseringen af foreningsfodbold dette ønske, skriver idrætsforsker Søren Bennike i denne artikel.......DBU ønsker at udbrede Fodbold Fitness som en ny og anderledes måde at organisere og dermed 'gå til fodbold på'. Imidlertid udfordrer organiseringen af foreningsfodbold dette ønske, skriver idrætsforsker Søren Bennike i denne artikel....

  20. Dicty_cDB: CHJ858 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gdstgastspqfqsinglsgasqssgsstwwyw***fkdrq*gnylfikgi ny*psrkyhwsscync*rffgc--- ---GEDIDEYEAAQHEVAFLDENEQDAAKL...ctsnqisedvgkainqklneniekvedvvvqfenvan qvieelkvehqrqellgevkhdslrdsatnyiwglldkiqsylpkdnnkvskveeafssg qnnnigssi

  1. Development of the breastfeeding quality improvement in hospitals learning collaborative in New York state.

    Science.gov (United States)

    Fitzpatrick, Eileen; Dennison, Barbara A; Welge, Sara Bonam; Hisgen, Stephanie; Boyce, Patricia Simino; Waniewski, Patricia A

    2013-06-01

    Exclusive breastfeeding is a public health priority. A strong body of evidence links maternity care practices, based on the Ten Steps to Successful Breastfeeding, to increased breastfeeding initiation, duration and exclusivity. Despite having written breastfeeding policies, New York (NY) hospitals vary widely in reported maternity care practices and in prevalence rates of breastfeeding, especially exclusive breastfeeding, during the birth hospitalization. To improve hospital maternity care practices, breastfeeding support, and the percentage of infants exclusively breastfeeding, the NY State Department of Health developed the Breastfeeding Quality Improvement in Hospitals (BQIH) Learning Collaborative. The BQIH Learning Collaborative was the first to use the Institute for Health Care Improvement's Breakthrough Series methodology to specifically focus on increasing hospital breastfeeding support. The evidence-based maternity care practices from the Ten Steps to Successful Breastfeeding provided the basis for the Change Package and Data Measurement Plan. The present article describes the development of the BQIH Learning Collaborative. The engagement of breastfeeding experts, partners, and stakeholders in refining the Learning Collaborative design and content, in defining the strategies and interventions (Change Package) that drive hospital systems change, and in developing the Data Measurement Plan to assess progress in meeting the Learning Collaborative goals and hospital aims is illustrated. The BQIH Learning Collaborative is a model program that was implemented in a group of NY hospitals with plans to spread to additional hospitals in NY and across the country.

  2. Management of type 2 diabetes mellitus in the elderly: role of the pharmacist in a multidisciplinary health care team

    Directory of Open Access Journals (Sweden)

    Grossman S

    2011-05-01

    Full Text Available Samuel GrossmanDepartment of Veterans Affairs, New York Harbor Healthcare System, New York, NY, USA; Diabetes Care On-The-Go Inc, Brooklyn, NY, USA; Hunter-Bellevue School of Nursing, Hunter College, City University of New York, New York, NY, USA; Arnold and Marie Schwartz College of Pharmacy of Long Island University, Brooklyn, NY, USA; Garden State Association of Diabetes Educators, Edison, NJ, USAAbstract: Intensive glycemic control using insulin therapy may be appropriate for many healthy older adults to reduce premature mortality and morbidity, improve quality of life, and reduce health care costs. However, frail elderly people are more prone to develop complications from hypoglycemia, such as confusion and dementia. Overall, older persons with type 2 diabetes mellitus are at greater risk of death from cardiovascular disease (CVD than from intermittent hyperglycemia; therefore, diabetes management should always include CVD prevention and treatment in this patient population. Pharmacists can provide a comprehensive medication review with subsequent recommendations to individualize therapy based on medical and cognitive status. As part of the patient’s health care team, pharmacists can provide continuity of care and communication with other members of the patient’s health care team. In addition, pharmacists can act as educators and patient advocates and establish patient-specific goals to increase medication effectiveness, adherence to a medication regimen, and minimize the likelihood of adverse events.Keywords: glycemic control, hyperglycemia, continuity of care, hypertension and cardiovascular disease, elderly, type 2 diabetes, pharmacist

  3. Ole Rømer som enevældens administrator

    DEFF Research Database (Denmark)

    Olden-Jørgensen, Sebastian

    2004-01-01

    En biografisk skitse af Ole Rømers virke med vægt på hans rolle som embedsmand og rådgiver for Christian V. Hans virke analyseres på baggrund af en ny forståelse for den tidlige enevældes politiske kultur.......En biografisk skitse af Ole Rømers virke med vægt på hans rolle som embedsmand og rådgiver for Christian V. Hans virke analyseres på baggrund af en ny forståelse for den tidlige enevældes politiske kultur....

  4. The Effect of Load Factor on Aircraft Handling Qualities.

    Science.gov (United States)

    1984-08-10

    sideslip, rudder and aileron deflection are calculated in the AMAT and BMAT program using data frcon this program and solving the side force, yawing and...0 PP = 0 RI = I NY = 8 GOTO 4530 4520 00 = 0 PP = 0 :RI = 8 NY = 8 4538 REM CHANGES EXISTING ELEMENTS OF AMAT & BMAT FOR CO NT AUG - ON & OFF 4540...IN POUNDS ;E 5670 A(9,9) = L4 * A(3,9) - L5 * ZD(5) - 16 5680 GOSUB 5716 5696 GOTO 5590 5706 RETURN 5710 REM SUBROUTINE FOR STORING AMAT & BMAT TO

  5. Vil ny regnskapslov gi internasjonalt sammenlignbare regnskaper?

    OpenAIRE

    Røsok, Kjell Ove

    2017-01-01

    Regnskapslovutvalget bruker internasjonalt sammenlignbare regnskaper som ett viktig argument for å tilpasse norsk regnskapslov til IFRS for SMEs. Denne artikkelen bruker Brunssons (2000) teoretiske rammeverk for uniformity til å analysere faktorer som kan avgjøre om en regnskapsstandard bidrar til lik praksis og dermed til sammenlignbare regnskaper. Artikkelen påpeker flere forhold som tilsier at den foreslåtte bruken av IFRS for SMEs i Norge vil avvike fra andre lands regnskapspraksis, delvi...

  6. DCS Hydraulics Submission for Albany County, NY

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Recent developments in digital terrain and geospatial database management technology make it possible to protect this investment for existing and future projects to...

  7. DCS Hydraulic Submission for Ulster County NY

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Recent developments in digital terrain and geospatial database management technology make it possible to protect this investment for existing and future projects to...

  8. DCS Hydrology Submission for Rockland County NY

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Hydrology data include spatial datasets and data tables necessary for documenting the hydrologic procedures for estimating flood discharges for a flood insurance...

  9. Ledelse af samskabelse er en ny ledelsesdisciplin

    DEFF Research Database (Denmark)

    Ulrich, Jens; Martin Nielsen, Kim; Bartram, Jan

    2018-01-01

    Samskabelse er blevet det nye orienteringspunkt for rigtig mange offentlige organisationer. Det skyldes en udbredt konsensus om, at velfærdsopgaverne ikke kan løses inden for de vante organisatoriske rammer, men må løses i tæt kontakt med de parter, som opgaverne vedrører. Denne nye tilgang til...

  10. En ny krabbe i den danske fauna

    DEFF Research Database (Denmark)

    Tendal, Ole Secher; Olesen, Jørgen

    2011-01-01

    A new crab in Danish waters: Goneplax rhomboides. In March 2010 two specimens of Goneplax rhomboides (Linné, 1758) were caught north of Skagen at about 90 m depth. Both are males and of the same size, 20 mm in length and 31 mm in width of the carapace. In recent years, in neighbouring countries, ...

  11. Ny Mycoplasma Hyosynoviae vaccine forebygger ikke halthed

    DEFF Research Database (Denmark)

    Nielsen, Elisabeth Okholm; Lauritsen, Klara Tølbøll; Jungersen, Gregers

    Vaccination af smågrise mod Mykoplasma-ledbetændelser viste sig ikke at kunne forebyggede halthed hos slagtesvin. Smitte med Mycoplasma hyosynoviae (M. hyosynoviae) er ofte årsag til ledbetændelse hos slagtesvin. Der er ingen kommerciel vaccine til grise, der beskytter mod mykoplasma-ledbetændels......Vaccination af smågrise mod Mykoplasma-ledbetændelser viste sig ikke at kunne forebyggede halthed hos slagtesvin. Smitte med Mycoplasma hyosynoviae (M. hyosynoviae) er ofte årsag til ledbetændelse hos slagtesvin. Der er ingen kommerciel vaccine til grise, der beskytter mod mykoplasma...

  12. Ny forskning i grammatik. Fællespublikation 9

    DEFF Research Database (Denmark)

    Artikler over grammatik der er blevet til i forlængelse af foredrag holdt på et fællesseminar på Sandbjerg Gods den 11.-13. oktober 2001. Artiklerne omhandler grammatikforskning inden for dansk, fransk, italiensk og spansk...

  13. DCS Terrain Submission for Chemung County, NY

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Terrain data, as defined in FEMA Guidelines and Specifications, Appendix N: Data Capture Standards, describes the digital topographic data that was used to create...

  14. Acid lake in N.Y. gets relief

    Science.gov (United States)

    A pond in the Adirondack Mountains of New York State has received a second soothing dose of baking soda. The 21 tons of sodium bicarbonate should moderate the pond's acidic conditions, lethal to fish and other forms of life.Wolf Pond, 25 miles (40 km) north of Saranac Lake, has developed an extremely low pH (4.5) because of acid rain and the runoff of acidic surface water, combined with very little outflow. The pond was first treated with sodium bicarbonate by t h e New York Department of Environmental Conservation in 1984; afterward the pH rose to about 6.2. Fish stocked by local residents have continued to live in the pond, despite the eventual rebound in its acidity.

  15. Tilblivelselsen af det Ny Nordiske Køkken

    DEFF Research Database (Denmark)

    Nickelsen, Niels Christian; Scheuer, John Damm

    2009-01-01

    aktørens skabende sider eller reducerer aktørens aktive skabende sider til "utilitaristisk mekanik", nuancerer artiklen det handlerum, som findes mellem forenklede forestillinger om fri handling og social determinerethed. Dette finder sted via analyse af nogle empiriske observationer, samt via en...

  16. DCS Terrain Submission for Albany County NY

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Terrain data, as defined in FEMA Guidelines and Specifications, Appendix N: Data Capture Standards, describe the digital topographic data that were used to create...

  17. 'The American Connection' i ny dansk poesi

    DEFF Research Database (Denmark)

    Larsen, Peter Stein

    2011-01-01

    Artiklen fokuserer på lyriktrafikken fra USA til Danmark. Der ses på to litterære bølger, som har haft indflydelse på dansk digtning, nemlig dels 50’ernes beatdigtning eller Oral Poetry, der får stor betydning for en række danske poeter fra 1960’erne og fremefter, dels 80’ernes og 90’ernes flerst...

  18. Erythropoietin--en ny terapi ved cerebral iskaemi?

    DEFF Research Database (Denmark)

    Kalialis, Louise Vennegaard; Olsen, Niels Vidiendal

    2003-01-01

    as an anti-inflammatory and neuroprotective drug. EPO and its receptor are expressed in neurons, glial cells and brain capillary endothelial cells, and the system is upregulated in conditions of cerebral ischaemia and hypoxia. Animal studies have now established that intracerebroventricular administration...... of recombinant EPO exerts neuroprotection in models of stroke. The mechanisms appear to involve an upregulation of specific anti-apoptotic and anti-inflammatory pathways. In addition, neurotrophic and angiogenetic effects of EPO may contribute in a long latency protection. Interestingly, also systemic...... administration of recombinant EPO ameliorates neuronal damage after brain ischaemia, and prevents the loss of autoregulation of cerebral blood flow following experimental subarachnoid haemorrhage. Recombinant human EPO is a safe and non-toxic drug, and clinical studies are currently investigating...

  19. DCS Survey Submission for Cortland County NY

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Survey data includes spatial datasets and data tables necessary to digitally represent data collected in the survey phase of the study. (Source: FEMA Guidelines and...

  20. Ley de alimentos: una mirada de los nutricionistas y estudiantes de nutrición y dietética de Chile

    Directory of Open Access Journals (Sweden)

    Samuel Duran-Agüero

    2017-12-01

    Full Text Available Introducción: En 2016 entró en vigencia en Chile la Ley 20.606, sobre la composición de los alimentos y su publicidad. El objetivo de este estudio fue determinar la percepción que tienen los nutricionistas y los estudiantes de Nutrición y Dietética (NyD respecto a dicha ley. Material y Métodos: Estudio transversal. Se elaboró una encuesta online con preguntas sobre percepción y conocimientos de la Ley de Alimentos 20.606, que se difundió a través de diferentes redes sociales asociadas a nutricionistas entre diciembre 2016 y enero 2017. Resultados: Se aplicaron 1584 encuestas, 902 a nutricionistas y 682 a estudiantes de NyD. Un 99,0% de los nutricionistas y un 99,2% de los estudiantes de NyD declaró conocer la ley; un 81,7% de los nutricionistas y un 85,0% de los estudiantes indicó estar de acuerdo con la Ley de Alimentos. Al consultar sobre la efectividad de la aplicación de la ley en los colegios, un 49% de los nutricionistas y un 51,5% de los estudiantes la consideró efectiva, a pesar de que no impide la venta de alimentos no saludables en el exterior de los colegios. El 88,2% de los nutricionistas y un 86,2% de los estudiantes de NyD señaló que realizó educación respecto a la Ley de Alimentos a pacientes. Conclusiones: Los nutricionistas y estudiantes de NyD en Chile tienen un buen conocimiento de la ley, una percepción favorable de ella y han educado a sus usuarios sobre ella. Sin embargo, consideran relevante mejorar la aplicación de la ley al interior de los establecimientos educacionales e implementar modificaciones futuras que incluyan aspectos como la restricción de venta de alimentos con sellos y así limitar su consumo en población infantil.