Orbital period variations of two W UMa-type binaries: UY UMa and EF Boo
Yu, Yun-Xia; Zhang, Xu-Dong; Hu, Ke; Xiang, Fu-Yuan
2017-08-01
The orbital period variations of two W UMa-type contact binaries, UY UMa and EF Boo, are analyzed by using all available times of light minimum. It is detected that the general trends of their (O - C) curves show an upward parabolic variation, which reveals their continuous period increases at the rates of dP / dt = 2.545 ×10-7 days yr-1 and dP / dt = 2.623 ×10-7 days yr-1 , respectively. Meanwhile, UY UMa also shows a cyclic period variation with a small amplitude of A = 0.0026 days superposed on the long-term increase. Due to their contact configurations, the secular period increases are interpreted as a result of mass transfer from the less massive component to the more massive one. The cyclic period variation of UY UMa may be interpreted in terms of either the magnetic activity or the light time effect.
Chandra resolves the T Tauri binary system RW Aur
Energy Technology Data Exchange (ETDEWEB)
Skinner, Stephen L. [CASA, University of Colorado, Boulder, CO 80309-0389 (United States); Güdel, Manuel, E-mail: stephen.skinner@colorado.edu, E-mail: manuel.guedel@univie.ac.at [Department of Astrophysics, University of Vienna, Türkenschanzstr. 17, A-1180 Vienna (Austria)
2014-06-20
RW Aur is a multiple T Tauri system consisting of an early-K type primary (A) and a K5 companion (B) at a separation of 1.''4. RW Aur A drives a bipolar optical jet that is well characterized optically. We present results of a sensitive Chandra observation whose primary objective was to search for evidence of soft extended X-ray emission along the jet, as has been seen for a few other nearby T Tauri stars. The binary is clearly resolved by Chandra and both stars are detected as X-ray sources. The X-ray spectra of both stars reveal evidence for cool and hot plasma. Surprisingly, the X-ray luminosity of the less-massive secondary is at least twice that of the primary and is variable. The disparity is attributed to the primary whose X-ray luminosity is at the low end of the range for classical T Tauri stars of similar mass based on established correlations. Deconvolved soft-band images show evidence for slight outward elongation of the source structure of RW Aur A along the blueshifted jet axis inside the central arcsecond. In addition, a faint X-ray emission peak is present on the redshifted axis at an offset of 1.''2 ± 0.''2 from the star. Deprojected jet speeds determined from previous optical studies are too low to explain this faint emission peak as shock-heated jet plasma. Thus, unless flow speeds in the redshifted jet have been underestimated, other mechanisms such as magnetic jet heating may be involved.
Li, Lin-Jia; Qian, Sheng-Bang; Voloshina, Irina; Metlov, Vladimir G.; Zhu, Li-Ying; Liao, Wen-Ping
2018-06-01
We present photometric measurements of the short period variable star UY Cam, which has been classified as a δ Scuti or c-type RR Lyrae (RRc) variable in different catalogs. Based on the analyses on Fourier coefficients and (NUV - V)0, we find that UY Cam is probably an RRc star. We obtain 58 new times of light maximum for UY Cam based on several sky surveys and our observations. Combining these with the times of light maximum in literature, a total of 154 times of light maximum are used to analyze the O - C diagram of UY Cam. The results show that the O - C pattern can be described by a downward parabolic component with a rate of -6.86 ± 0.47 × 10-11 d d-1, and a cyclic variation with a period of 65.7 ± 2.4 yr. We suppose these components are caused by the stellar evolution and the light travel time effect (LiTE) of a companion in elliptical orbit, respectively. By calculation, the minimum mass of the potential companion is about 0.17 M⊙, and its mass should be less than or equal to the pulsation primary star when the inclination i > 22.5°D. Therefore, the companion should be a low-mass star, like a late-type main-sequence star or a white dwarf. Due to the unique property of UY Cam, we suggest that more observations and studies on UY Cam and other RRc stars are needed to check the nature of these stars, including the pulsations and binarities.
UBV Light Curves of ζ AUR Star 32 Cygni
Directory of Open Access Journals (Sweden)
Il-Seong Nha
1992-12-01
Full Text Available UBV ovservation of ζ Aur star 32 Cyg have been at the Yonsei University Observatory suing the 60-cm Goto reflector and five years, 1988-1992. Observations made during these years cover outside of eclipse phase only. No significant light variation which would represent the secondary eclipse of red supergiant by a hot main sequence star is found. The light levels in three passbands do not show any evidence of the proximate effect of this binary system. Some strong light variations, particularly in U, are discussed with no successful explanation.
IUE observations of the eclipsing binary Epsilon Aurigae
International Nuclear Information System (INIS)
Hack, M.; Selvelli, P.L.
1978-01-01
It is stated that the eclipsing binary Epsilon Aur is a most peculiar binary system and it has not been explained satisfactorily. Observations of this system using the International Ultraviolet Explorer (IUE) collected at the Villafranca Satellite Tracking Station of the European Space Agency are here reported. (author)
Epsilon Aur monitoring during predicted pulsation phase
Waagen, Elizabeth O.; Templeton, Matthew R.
2014-09-01
Dr. Robert Stencel (University of Denver Astronomy Program) has requested that AAVSO observers monitor epsilon Aurigae from now through the end of the observing season. "Studies of the long-term, out-of-eclipse photometry of this enigmatic binary suggest that intervals of coherent pulsation occur at roughly 1/3 of the 27.1-year orbital period. Kloppenborg, et al. noted that stable variation patterns develop at 3,200-day intervals' implying that 'the next span of dates when such events might happen are circa JD ~2457000 (2014 December)'. "These out-of-eclipse light variations often have amplitudes of ~0.1 magnitude in U, and ~0.05 in V, with characteristic timescales of 60-100 days. The AAVSO light curve data to the present may indicate that this coherent phenomenon has begun, but we encourage renewed efforts by observers...to help deduce whether these events are internal to the F star, or externally-driven by tidal interaction with the companion star." Nightly observations or one observation every few days (CCD/PEP/DSLR, VUBR (amplitude too small for visual)) are requested. Finder charts with sequence may be created using the AAVSO Variable Star Plotter (http://www.aavso.org/vsp). Observations should be submitted to the AAVSO International Database. Epsilon Aur was the subject of major international campaigns and the AAVSO's Citizen Sky project as it went through its 27.1-year eclipse in 2009-2011. Over 700 observers worldwide submitted over 20,000 multicolor observations to the AAVSO International Database for this project. Much information on eps Aur is available from the AAVSO, including material on the Citizen Sky website (http://www.aavso.org/epsilon-aurigae and http://www.citizensky.org/content/star-our-project). The Journal of the AAVSO, Volume 40, No. 2 (2012) was devoted to discussion of and research results from this event. See full Alert Notice for more details and observations.
The Overcontact Binary V535 Aurigae: Well On Its Way to Coalescing?
Bradstreet, David H.; Sanders, S. J.; Hiebert-Crape, B.
2011-01-01
V535 Aurigae is a faint (12.8 mag) short period (9.23 hours) overcontact binary which has only one published light curve and no published analysis. 811 digital images in the V filter and 845 in R were obtained over seven nights in the winter of 2008 at the Bradstreet Observatory at Eastern University. The data were obtained using the Observatory's 41-cm telescope coupled with an SBIG ST-10XME CCD camera. Six new timings of minimum light were measured in order to analyze whether or not the system's period has changed since its discovery. Preliminary results tentatively indicated that the period had been decreasing linearly over the previous nine years since it was discovered. In order to confirm the large change in period the binary was observed in 2009 and 2010 resulting in complete V and R light curves in both seasons and an additional nine timings of minimum light. These timings confirm that V535 Aur has a dP/dt = -0.208 sec/yr, some twenty times greater than the average period change for overcontact systems. V535 Aur thus displays the largest decrease in period for any known overcontact system. The light curves were compiled into phased normal points and analyzed using the Binary Maker 3.0 light curve analysis software. These preliminary results were then fine tuned using the benchmark Wilson-Devinney code as implemented in Andrej Prsa's PHOEBE software suite. The analysis shows that the system is totally-eclipsing with a fillout of 85% and equal component temperatures. The extraordinarily large fillout (average for overcontacts 28%), equal stellar temperatures and very large period decrease may indicate that V535 Aur is well on its way to coalescing into a single star. The methods and results of the data acquisition, period study and light curve analysis will be presented in this poster.
International Nuclear Information System (INIS)
Shevchenko, V.S.
1987-01-01
The variability of AB Aur emission line H α , H β , H γ profiles, equivalent widths (EW λ ) and relative intensity have been observed on the photoelectric scanner. During the 20 d observation period EW λ H α ranged from 23.20 to 35.35 A. Mean EW λ H α is 27.25 A, daily average deviation is 3.60 ± 0.07 A. The minimum time of variability is 1 h . The chromospheric lines near-infrared triplet Ca II and KCaII and emission lines H β -H13, P12-P20, 0I 8446.5 A and the variability of other lines have been studied on the photographic and image-tube spectra. The intensity of these lines and EW λ changed 2-4 times during an interval from 1 h to several years. The AB Aur variability nature of emission lines made it possible to assume that the ''deep chromosphere'' is not a centre-symmetrical or axisymmetrical formation but is a conglomerate of different density and speed gas condensations
A flickering study of nova-like systems KR Aur and UU Aqr
Dobrotka, A.; Mineshige, S.; Casares, J.
2012-03-01
We present a study of the flickering activity in two nova-like systems, KR Aur and UU Aqr. We applied a statistical model of flickering simulations in accretion discs based on turbulent angular momentum transport between two adjacent rings with an exponential distribution of the turbulence dimension scale. The model is based on a steady-state disc model, which is satisfied in the case of hot ionized discs of nova-like cataclysmic variables. Our model successfully fits the observed power-density spectrum of KR Aur with the disc parameter α= 0.10-0.40 and an inner-disc truncation radius in the range Rin= 0.88-1.67 × 109 cm. The exact values depend on the mass-transfer rate in the sense that α decreases and Rin increases with mass-transfer rate. In any case, the inner-disc radius found for KR Aur is considerably smaller than those for quiescent dwarf novae, as predicted by the disc instability model. On the other hand, our simulations fail to reproduce the power-density spectrum of UU Aqr. A tantalizing explanation involves the possible presence of spiral waves, which are expected in UU Aqr because of its low mass ratio but not in KR Aur. In general our model predicts the observed concentration of flickering in the central disc. We explain this by the radial dependence of the angular-momentum gradient.
Kuroda, M; Hashida-Okado, T; Yasumoto, R; Gomi, K; Kato, I; Takesako, K
1999-03-01
The AUR1 gene of Saccharomyces cerevisiae, mutations in which confer resistance to the antibiotic aureobasidin A, is necessary for inositol phosphorylceramide (IPC) synthase activity. We report the molecular cloning and characterization of the Aspergillus nidulans aurA gene, which is homologous to AUR1. A single point mutation in the aurA gene of A. nidulans confers a high level of resistance to aureobasidin A. The A. nidulans aurA gene was used to identify its homologs in other Aspergillus species, including A. fumigatus, A. niger, and A. oryzae. The deduced amino acid sequence of an aurA homolog from the pathogenic fungus A. fumigatus showed 87% identity to that of A. nidulans. The AurA proteins of A. nidulans and A. fumigatus shared common characteristics in primary structure, including sequence, hydropathy profile, and N-glycosylation sites, with their S. cerevisiae, Schizosaccharomyces pombe, and Candida albicans counterparts. These results suggest that the aureobasidin resistance gene is conserved evolutionarily in various fungi.
RW Aur A FROM THE X-WIND POINT OF VIEW: GENERAL FEATURES
International Nuclear Information System (INIS)
Liu, Chun-Fan; Shang, Hsien
2012-01-01
In this paper, the RW Aur A microjet is studied from the point of view of X-wind models. The archived Hubble Space Telescope/STIS spectra of the optical forbidden lines [O I], [S II], and [N II] from RW Aur A, taken in Cycle 8 with seven parallel slits along the jet axis, spaced at 0.''07 apart, were analyzed. Images, position-velocity diagrams, and line ratios among the species were constructed, and compared with synthetic observations generated by selected solutions of the X-wind. Prominent features arising in a steady-state X-wind could be identified within the convolved images and position-velocity diagrams, including FWHM and high-velocity peaks on both of the redshifted and blueshifted jets. The well-known asymmetric velocity profiles of the opposite jets were built into the selected models. We discuss model selections within the existing uncertainties of the stellar parameters and inclination angle of the system. In this framework, the mass-loss rates that were inferred to be decreasing along the jet axis in the literature are the results of slowly decreasing excitation conditions and electron density profiles. Despite the apparent asymmetry in the terminal velocities, line intensities and mass-loss rates, the average linear momenta from the opposite sides of the jet are actually balanced. These previously hard-to-explain features of the asymmetric RW Aur A jet system can now be interpreted in a different but self-consistent manner within the X-wind framework.
RW Aur A FROM THE X-WIND POINT OF VIEW: GENERAL FEATURES
Energy Technology Data Exchange (ETDEWEB)
Liu, Chun-Fan [Graduate Institute of Astrophysics, National Taiwan University, Taipei 10617, Taiwan (China); Shang, Hsien, E-mail: shang@asiaa.sinica.edu.tw [Theoretical Institute for Advanced Research in Astrophysics (TIARA), Academia Sinica, P.O. Box 23-141, Taipei 10641, Taiwan (China)
2012-12-20
In this paper, the RW Aur A microjet is studied from the point of view of X-wind models. The archived Hubble Space Telescope/STIS spectra of the optical forbidden lines [O I], [S II], and [N II] from RW Aur A, taken in Cycle 8 with seven parallel slits along the jet axis, spaced at 0.''07 apart, were analyzed. Images, position-velocity diagrams, and line ratios among the species were constructed, and compared with synthetic observations generated by selected solutions of the X-wind. Prominent features arising in a steady-state X-wind could be identified within the convolved images and position-velocity diagrams, including FWHM and high-velocity peaks on both of the redshifted and blueshifted jets. The well-known asymmetric velocity profiles of the opposite jets were built into the selected models. We discuss model selections within the existing uncertainties of the stellar parameters and inclination angle of the system. In this framework, the mass-loss rates that were inferred to be decreasing along the jet axis in the literature are the results of slowly decreasing excitation conditions and electron density profiles. Despite the apparent asymmetry in the terminal velocities, line intensities and mass-loss rates, the average linear momenta from the opposite sides of the jet are actually balanced. These previously hard-to-explain features of the asymmetric RW Aur A jet system can now be interpreted in a different but self-consistent manner within the X-wind framework.
Gutierrez Orozco, Niverción Hugo; Gutierrez Orozco, Niverción Hugo
2002-01-01
Las microcuencas auríferas de los ríos Caychive y Huaypetue - Madre de Dios, constituyen una zona donde la minería aurífera aluvial, a partir de la última década, se ha desarrollado intensa y desordenadamente a nivel de la pequeña minería, sin el adecuado uso de técnicas mineras que conduzcan a preservar el medio ambiente. Las operaciones de explotación y concentración de gravas auríferas han dado lugar a la degradación y contaminación de los principales factores ambientales, bajo la forma...
AN IONIZED OUTFLOW FROM AB AUR, A HERBIG AE STAR WITH A TRANSITIONAL DISK
Energy Technology Data Exchange (ETDEWEB)
Rodríguez, Luis F.; Zapata, Luis A.; Ortiz-León, Gisela N.; Loinard, Laurent [Centro de Radioastronomía y Astrofísica, UNAM, Apdo. Postal 3-72 (Xangari), 58089 Morelia, Michoacán (Mexico); Dzib, Sergio A. [Max Planck Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Macías, Enrique; Anglada, Guillem, E-mail: l.rodriguez@crya.unam.mx [Instituto de Astrofísica de Andalucía (CSIC), Apartado 3004, E-18080 Granada (Spain)
2014-09-20
AB Aur is a Herbig Ae star with a transitional disk. Transitional disks present substantial dust clearing in their inner regions, most probably because of the formation of one or more planets, although other explanations are still viable. In transitional objects, accretion is found to be about an order of magnitude smaller than in classical full disks. Since accretion is believed to be correlated with outflow activity, centimeter free-free jets are expected to be present in association with these systems, at weaker levels than in classical protoplanetary (full) systems. We present new observations of the centimeter radio emission associated with the inner regions of AB Aur and conclude that the morphology, orientation, spectral index, and lack of temporal variability of the centimeter source imply the presence of a collimated, ionized outflow. The radio luminosity of this radio jet is, however, about 20 times smaller than that expected for a classical system of similar bolometric luminosity. We conclude that centimeter continuum emission is present in association with stars with transitional disks, but at levels than are becoming detectable only with the upgraded radio arrays. On the other hand, assuming that the jet velocity is 300 km s{sup –1}, we find that the ratio of mass loss rate to accretion rate in AB Aur is ∼0.1, similar to that found for less evolved systems.
VizieR Online Data Catalog: UY UMa and EF Boo compiled time of minima (Yu+, 2017)
Yu, Y.-X.; Zhang, X.-D.; Hu, K.; Xiang, F.-Y.
2017-11-01
In order to construct the (O-C) diagram to analyze the period change of UY UMa, we have performed a careful search for all available times of light minima. A total of 76 times of light minima were collected and listed in Table 2. >From the literatures and two well-known databases (i.e., the O-C gateway (http://var.astro.cz/ocgate) and the Lichtenknecker database of the BAV (http://www.bav-astro.de/LkDB/index.php)), we have collected a total of 75 available times of light minima for EF Boo, which are summarized in Table 3. (3 data files).
Lomax, Jamie R.; Wisniewski, John P.; Grady, Carol A.; McElwain, Michael W.; Hashimoto, Jun; Kudo, Tomoyuki; Kusakabe, Nobuhiko; Okamoto, Yoshiko K.; Fukagawa, Misato; Abe, Lyu
2016-01-01
We present a new analysis of multi-epoch, H-band, scattered light images of the AB Aur system. We use a Monte Carlo radiative transfer code to simultaneously model the systems spectral energy distribution (SED) and H-band polarized intensity (PI) imagery. We find that a disk-dominated model, as opposed to one that is envelope dominated, can plausibly reproduce AB Aurs SED and near-IR imagery. This is consistent with previous modeling attempts presented in the literature and supports the idea that at least a subset of AB Aurs spirals originate within the disk. In light of this, we also analyzed the movement of spiral structures in multi-epoch H-band total light and PI imagery of the disk. We detect no significant rotation or change in spatial location of the spiral structures in these data, which span a 5.8-year baseline. If such structures are caused by disk planet interactions, the lack of observed rotation constrains the location of the orbit of planetary perturbers to be 47 au.
La voix off au féminin : Hiroshima mon amour et Aurélia Steiner
Directory of Open Access Journals (Sweden)
Jennifer Cazenave
2011-07-01
Full Text Available Une étude comparée du grand film moderne d’Alain Resnais, Hiroshima mon amour (1959, et du dyptique de Marguerite Duras, Aurélia Steiner (1979, laisse entrevoir une filiation entre deux films que vingt ans séparent et où s’entrecroisent un certain nombre de fils conducteurs : le lieu et la parole ; l’histoire et la mémoire ; la voix-off au féminin et l’irreprésentable. Il s’agira donc de penser ces deux œuvres cinématographiques à partir du rapport entre le parler féminin et la représentation du passé, soit la tonte des femmes au moment de la libération dans Hiroshima mon amour, soit l’extermination des Juifs d’Europe dans Aurélia Steiner.
Anomalous Eclipses of the Young Star RW Aur A
Lamzin, S.; Cheryasov, D.; Chuntonov, G.; Dodin, A.; Grankin, K.; Malanchev, K.; Nadzhip, A.; Safonov, B.; Shakhovskoy, D.; Shenavrin, V.; Tatarnikov, A.; Vozyakova, O.
2017-06-01
Results of UBVRIJHKLM photometry, VRI polarimetry and optical spectroscopy of a young star RW Aur A obtained during 2010-11 and 2014-16 dimming events are presented. During the second dimming the star decreased its brightness to ΔV >4.5 mag, polarization of its light in I-band was up to 30 %, and color-magnitude diagramm was similar to that of UX Ori type stars. We conclude that the reason of both dimmings is an eclipses of the star by dust screen, but the size of the screen is much larger than in the case of UXORs.
Peroxide Activation for Electrophilic Reactivity by the Binuclear Non-heme Iron Enzyme AurF
International Nuclear Information System (INIS)
Park, Kiyoung; Li, Ning; Kwak, Yeonju; Srnec, Martin
2017-01-01
Binuclear non-heme iron enzymes activate O 2 for diverse chemistries that include oxygenation of organic substrates and hydrogen atom abstraction. This process often involves the formation of peroxo-bridged biferric intermediates, only some of which can perform electrophilic reactions. To elucidate the geometric and electronic structural requirements to activate peroxo reactivity, the active peroxo intermediate in 4-aminobenzoate N-oxygenase (AurF) has been characterized spectroscopically and computationally. A magnetic circular dichroism study of reduced AurF shows that its electronic and geometric structures are poised to react rapidly with O 2 . Nuclear resonance vibrational spectroscopic definition of the peroxo intermediate formed in this reaction shows that the active intermediate has a protonated peroxo bridge. Density functional theory computations on the structure established here show that the protonation activates peroxide for electrophilic/single-electron-transfer reactivity. As a result, this activation of peroxide by protonation is likely also relevant to the reactive peroxo intermediates in other binuclear non-heme iron enzymes.
Efectos de la hindarina sobre las aurículas aisladas
Directory of Open Access Journals (Sweden)
Roberto Luis Rojas Martínez
1997-12-01
Full Text Available Se presentan los efectos de la hindarina y de la clorpromacina sobre la amplitud y la frecuencia de las contracciones espontáneas de las aurículas aisladas de rata. La hindarina produjo bradicardia moderada y aumento discreto de la amplitud de las contracciones en forma dosis-dependiente, en tanto que la clorpromacina deprimió más intensamente tanto la frecuencia como la amplitud de dichas contracciones. Se descartó una acción colinérgica o beta-bloqueadora en la producción de la bradicardia por la hindarina. Se descartó también una acción cardiotónica de la hindarina en las aurículas aisladas de cobayo deprimidas por solución hipocálcica o por hipoxia. Se sugiere su estudio como antiarrítmico.The effects of hindarine and of chlorpromazine on the amplitude and frequency of the spontaneous contractions of rats' isolated atria are presented. Hindarine produced a moderate bradycardia and a discreet increase of the contractions in a dosage-dependent way. Chlorpromazine caused a greater depression of the frequency and amplitude of these contractions. The cholinergic or beta-blocker action was discarded in the production of bradycardia brought about by hindarine. It was also eliminated a cadiotonic action of hindarine in the isolated atria of guinea pig depressed by hypocalcic solution or by hipoxia. It is suggested its study as an antiarrhythmic.
AN ORDERED MAGNETIC FIELD IN THE PROTOPLANETARY DISK OF AB Aur REVEALED BY MID-INFRARED POLARIMETRY
Energy Technology Data Exchange (ETDEWEB)
Li, Dan; Pantin, Eric; Telesco, Charles M.; Zhang, Han; Barnes, Peter J.; Mariñas, Naibí [Department of Astronomy, University of Florida, 211 Bryant Space Science Center, FL 32611 (United States); Wright, Christopher M. [School of Physical, Environmental, and Mathematical Sciences, University of New South Wales, Canberra, ACT 2610 (Australia); Packham, Chris, E-mail: d.li@ufl.edu [Physics and Astronomy Department, University of Texas at San Antonio, 1 UTSA Circle, San Antonio, TX 78249 (United States)
2016-11-20
Magnetic fields ( B -fields) play a key role in the formation and evolution of protoplanetary disks, but their properties are poorly understood due to the lack of observational constraints. Using CanariCam at the 10.4 m Gran Telescopio Canarias, we have mapped out the mid-infrared polarization of the protoplanetary disk around the Herbig Ae star AB Aur. We detect ∼0.44% polarization at 10.3 μ m from AB Aur's inner disk ( r < 80 au), rising to ∼1.4% at larger radii. Our simulations imply that the mid-infrared polarization of the inner disk arises from dichroic emission of elongated particles aligned in a disk B -field. The field is well ordered on a spatial scale, commensurate with our resolution (∼50 au), and we infer a poloidal shape tilted from the rotational axis of the disk. The disk of AB Aur is optically thick at 10.3 μ m, so polarimetry at this wavelength is probing the B -field near the disk surface. Our observations therefore confirm that this layer, favored by some theoretical studies for developing magneto-rotational instability and its resultant viscosity, is indeed very likely to be magnetized. At radii beyond ∼80 au, the mid-infrared polarization results primarily from scattering by dust grains with sizes up to ∼1 μ m, a size indicating both grain growth and, probably, turbulent lofting of the particles from the disk mid-plane.
Far Ultraviolet Spectroscopy of Three Long Period Nova-Like Variables, V363 Aur, AC Cnc and RZ Gru
Bisol, Alexandra; Sion, E. M.
2011-01-01
We have selected three nova-like variables: V363 Aur, RZ Gru and AC Cnc, all of which are UX UMa types, having similar orbital periods well beyond the 3 to 4 hour range where most nova-likes are found. All should have very similar secondary stars given the fact that they their physical parameters are so similar. V363 Aur is a bona fide SW Sex star, and AC Cnc is a probable one, while RZ Gru is not a member of the SW Sex subclass. Our objective is to carry out the first synthetic spectral analysis of far ultraviolet spectra of the three systems using state-of-the-art models both of accretion disks and photospheres. Therefore we shall compare the distances we obtain from the best fitting synthetic spectral models to other distance estimates in the literature. We present model-derived accretion rates and distances for all three systems. The FUV flux range of RZ Gru and V363 Aur is dominated by radiation from an optically thick, steady state, accretion but for AC Cnc, we find that a hot white dwarf accounts for 70% of the FUV flux. We compare the FUV characteristics and physical properties of these three long period nova-like systems to the properties of other nova-likes at shorter periods. This work was supported in part by NSF grant AST0807892 to Villanova University.
Human cultural and related remains from Me Aure Cave (site WMD007), Moindou, New Caledonia
International Nuclear Information System (INIS)
Grant-Mackie, J.A.; Sand, C.; Valentin, F.; Fitzgerald, B.M.; Richer de Forges, B.
2013-01-01
In 1995 a small cave near Me Aure (site WMD007) on the west coast of New Caledonia, about 120 km northwest of Noumea, was excavated and found to contain mainly owl and human midden deposits. Some of the contents have already been documented and the present paper completes the study by reporting the human-related materials, including human bone fragments, pottery sherds, bones of four rodent species, and marine mollusc and crab remains. Each of these material classes are reported separately by the authors responsible for their analysis, and the results and interpretations based on each line of evidence are compared and contrasted. The human bone and pottery data suggest a temporally constrained deposit (2750-2350 BP) that has experienced stratigraphic disturbance. This result raises doubt about the un-mixed nature of the deposit emphasized in earlier publications and it urges instead the conclusion that the Me Aure stratigraphy consists mostly of a redeposited set of horizons. If this conclusion is correct, interpretations already published relying on a fixed chronology, especially about vegetation change and avifauna depletion or early aroid introduction will need to be reconsidered. The site constitutes the first in New Caledonia for which a cave deposit has now been fully analysed. (author). 36 refs., 11 figs., 9 tabs.
Luzardo, Leonella; Sottolano, Mariana; Lujambio, Inés; Robaina, Sebastián; Thijs, Lutgarde; da Rosa, Alicia; Krul, Nadia; Carusso, Florencia; Ríos, Ana C; Olascoaga, Alicia; Noboa, Oscar; Staessen, Jan A; Boggia, José
2014-12-01
In the ongoing GEnotipo, Fenotipo y Ambiente de la HiperTensión Arterial en UruguaY (GEFA-HT-UY) study, we applied standardized epidemiological methods to determine complex phenotypes including blood pressure (BP). In this report, we present the quality control of the conventionally measured BP. Three trained observers measured BP five times consecutively in the seated position at each of two home visits and one clinic visit according to the guidelines of the European Society of Hypertension. On 1 December 2013, 4379 single BP readings in 170 participants were available for analysis. Fewer BP readings than the five planned per contact occurred only at one home visit. Among observers, the frequency of identical consecutive readings for systolic or diastolic BP varied from 0 to 4.2%. The occurrence of odd readings ranged from 0.1 to 0.6%. Only 21.6% of the systolic and diastolic BP readings ended on zero (expected 20%). At home visits, there was a progressive decline in BP from the first to the fifth reading. The average of the five BP readings also decreased from the first to the second home visit (-5.63/-2.34 mmHg). Our study highlighted the necessity to implement a stringent quality control of the conventionally measured BP. The procedures set up in the GEFA-HT-UY study are resulting in a well-defined BP phenotype, which is consistent with that in other population studies.
Costafreda Mustelier, Jorge Luis
1996-01-01
El Campo Mineral Aurífero de Aguas Claras se ubica al norte de Holguín, en una franja alargada de unos 15 kilómetros de longitud. Dentro de este campo mineral se encuentran cuatro minas principales: Nuevo Potosí: Formado por 3 tres cuerpos minerales en forma venas y diseminaciones auríferas (55.783 tn), espesor promedio es de 1,06 metros, contenido medio 7,89 g/t de Au y reserva de metal de 440,0 Kg. Agrupada: La mineralización aparece en venas de hasta 1.0 metro de espe...
Pignolet, Thierry
2017-01-01
Este papel es un trabajo sobre la apropriación de conceptos espaciales en la definición del problema de investigación doctoral (sobre una 'political ecology' de extractivismo aurífero, partiendo del caso de Marmato, en Colombia), en el contexto del Seminario complementario I del Doctorado en ciencias sociales (semestre 2017-2) de la Universidad de Antioquia (UdeA), Colombia.
Directory of Open Access Journals (Sweden)
Desmantoro
2016-08-01
Full Text Available A feasibility study toward the prerequisite conditions is required for the successful implementation of the Village Forest program in Tanjung Aur II Village. This study aims to: 1 identify bio-geophysical conditions of the work area; 2 analyze the conditions of sosioeconomic-cultural society/institutional; 3 analyze the support of stakeholders; and 4 formulate appropriate implementation strategies. The study was using survey method and qualitative studies with multiple analysis techniques. The results showed that: 1 the biogeophysical conditions was eligible and suitable to be proposed as village forest working area; 2 conditions of socio-economic-cultural communities enable to form village forest management institution, through collaboration between state forest encroachers and the villager representatives; 3 stakeholders were ready to provide support facilitation and assistance according to their capacity and capabilities. Key stakeholder were among others BPDAS Ketahun, Dishut Provinsi Bengkulu, Dishut ESDM Bengkulu Selatan, NGOs Ulayat, and officials of the Village; 4 the implementation strategy of village forest program that suitable for Tanjung Aur II was a competitive strategy or diversification (S-T strategy, with the main priority of the strategy, among others by seeking and asking for support from relevant stakeholders or other parties who had capacity and capability to undertake facilitation and assistance.
Directory of Open Access Journals (Sweden)
Straižys V.
2010-12-01
Full Text Available The possibility of applying photometry from the 2MASS J, H, Ks, MegaCam u, g and IPHAS r, i, Hα surveys for determining the distance to the dark cloud LDN1525 (TGU 1192 in the direction of the Aur OB1 association is investigated using the red clump giants. The main dust cloud, probably related to the emission nebulae Sh 2-232, Sh 2-233, Sh 2-235, the molecular cloud and the association Aur OB2, is found to be located at a distance of 1.3 kpc from the Sun. The nebula Sh 2-231 can be an object of the Perseus arm. The maximum extinction AV found in the cloud is close to 6 mag.
The properties of the SC stars and chemical composition of UY centauri
International Nuclear Information System (INIS)
Catchpole, R.M.
1981-01-01
This is primarily an observational thesis concerned firstly, with improving our knowlegde of the 12 SC stars, defined as a group by Catchpole and Feast (1971) and secondly, with determining the chemical composition of UY Cen, the brightest member of the group. An atlas, based on 13 A mm- 1 spectra is presented for the S star π Gru and the C star 19 Psc between 5430 and 6850 A. In order to overcome the problems caused by the high density of absorption lines, we use a method of line identification that relies on the statistical interpretation of intensity against wavelength-agreement and Intensity against Excitation diagrams. The objective being to determine which elements are present in the spectrum before assigning identifications to individual lines. The spectrum is found to be rich in 's' process elements and shows weak molecules of both carbides, oxides and hydrides. U to L (0.36 to 3.4μ) photometry is listed for all the stars and shows them to be a very homogeneous group. A set of wavelengths derived from the line list is used to find the radial velocities of all the stars. A solar model atmosphere, with pure absorption as the method of line formation, is used to derive astrophysical log gf values from solar equivalent widths and meteor abundances. The model atmosphere also shows, that for our set of CN equivalent widths, both the CN abundance and the derived isotope ratio depend on the adopted C/O ratio
’n Kort herbetragting van Uys Krige se prosa met verwysing na 'The dream' as sleutelteks
Directory of Open Access Journals (Sweden)
J. L. Marais
1988-05-01
Full Text Available Uys Krigc’s prose has always received less attention from scholars of the Afrikaans literature than his poetry, translations and plays, Krige was never awarded any Afrikaans literary prize for his prose, which evoked comparatively little interest from Afrikaans scholars. This article discusses possible reasons for the above situation regarding Krige’s prose, followed by a critical discussion of several factors that were decisive in the canonization of Krige as a poet, translator and playwright rather than as a prose writer. These include factors such as the reception of Krige’s prose in comparison with the other genres that he practised, and the compilation of anthologies, a practice by which texts are published in a context that differs from the original. The short story “The dream” (from The dream and the desert, 1953 is then discussed briefly, indicating several key features of Krige’s prose as contained in this text. The article concludes with a view that a reassessment of Krige’s work will probably show him to have been a better prose writer than a poet, contrary to past and, to a large extent, present assumptions.
Reduced temperature phase diagrams of the silver-rare earths binary systems
International Nuclear Information System (INIS)
Ferro, R.; Delfino, S.; Capelli, R.; Borsese, A.
1975-01-01
Phase equilibria of the silver-rare earth binary systems have been reported in ''reduced temperature'' diagrams (the ''reduced temperature'' being defined as the ratio between a characteristic temperature of the Agsub(x)R.E. phase and the melting temperature of the corresponding R.E. metal, both in 0 K). The smooth trends of the various characteristic reduced temperatures, when plotted against the R.E. atomic number, have been demonstrated. On passing from the light- to the heavy-rare-earths, a correlation has been found between the crossing of these curves and other phenomena, such as the disappearing of the Ag 5 R.E. phases from incongruently, to congruently melting compounds. The trends of the reduced-temperature curves have been briefly discussed in terms of the treatment suggested by Gschneidner together with the volumetric data known for the different Agsub(x)R.E. phases. In addition, the characteristic data of the 1:1 AgR.E. compounds have been compared with those of the analogous AuR.E. phases. (Auth.)
Phase stability, crystal structure and magnetism in (U1-xNbx)2 Ni21B6 and (UyNb1-y)3Ni20B6
Provino, Alessia; Bhattacharya, Amitava; Dhar, Sudesh K.; Pani, Marcella; Gatti, Flavio; Paudyal, Durga; Manfrinetti, Pietro
Ternary phases with composition T2M21X6 and T3M20X6 (T = transition metal; M = 3 d metal; X = B, C, P) are reported to crystallize with the W2Cr21C6-type and Mg3Ni20B6-type, respectively (ternary ordered derivatives of the cubic Cr23C6-type, cF116). They attract interest due to their refractory, mechanical, and peculiar magnetic properties. Literature data on these compounds only concern apparently stoichiometric 2:21:6 and 3:20:6 phases. Often only nominal composition has been reported, with few structural refinements and no measurements of physical properties. Lack of detailed stoichiometry and crystallographic data does not allow sufficient understanding of the crystal chemistry and properties of these compounds. We studied stability, crystal structure and magnetism of (U1-xNbx)2 Ni21B6 and (UyNb1-y)3Ni20B6; stable phases are U2Ni21B6 and Nb3Ni20B6, as also confirmed by theoretical calculations. The two pristine compounds solubilize Nb and U, respectively, up to a given extent. The substitution of U by Nb leads to a structural change from the W2Cr21C6- to the Mg3Ni20B6-type. While U2Ni21B6 is a Pauli paramagnet (itinerant non-magnetic state of U-5 f electrons), in agreement with literature, magnetization data for (UyNb1-y)3 Ni20B6 show itinerant ferromagnetism with TC >300 K.
Histochemistry for the research in veterinary science: the legacy of Giuseppe Aureli
Directory of Open Access Journals (Sweden)
A Lauria
2009-06-01
Full Text Available Twenty years ago, on April 24th 1984, Giuseppe Aureli, Founding Member and President of the Italian Society of Histochemistry from 1971 to 1973, Director of the Institute of Anatomy of Domestic Animals, Histology and Embryology and Dean of the School of Veterinary Medicine of the University of Milan, died suddenly and before his time. Following in the footsteps of Carlo Bignardi, he started from the time he was a student, to deal with the research approaches of Maffo Vialli, founder of histochemistry in Italy Head in Milan of a skilled group of scientists, he developed a sound and reliable research school mainly based on the use of ever more advanced histochemical and cytochemical techniques to study, in the extensive area of veterinary science, different problems aimed at developing either basic knowledge or animal production.
Probing the Cold Dust Emission in the AB Aur Disk: A Dust Trap in a Decaying Vortex?
Fuente, Asunción; Baruteau, Clément; Neri, Roberto; Carmona, Andrés; Agúndez, Marcelino; Goicoechea, Javier R; Bachiller, Rafael; Cernicharo, José; Berné, Olivier
2017-09-01
One serious challenge for planet formation is the rapid inward drift of pebble-sized dust particles in protoplanetary disks. Dust trapping at local maxima in the disk gas pressure has received much theoretical attention but still lacks observational support. The cold dust emission in the AB Aur disk forms an asymmetric ring at a radius of about 120 au, which is suggestive of dust trapping in a gas vortex. We present high spatial resolution (0".58×0".78 ≈ 80×110 au) NOEMA observations of the 1.12 mm and 2.22 mm dust continuum emission from the AB Aur disk. Significant azimuthal variations of the flux ratio at both wavelengths indicate a size segregation of the large dust particles along the ring. Our continuum images also show that the intensity variations along the ring are smaller at 2.22 mm than at 1.12 mm, contrary to what dust trapping models with a gas vortex have predicted. Our two-fluid (gas+dust) hydrodynamical simulations demonstrate that this feature is well explained if the gas vortex has started to decay due to turbulent diffusion, and dust particles are thus losing the azimuthal trapping on different timescales depending on their size. The comparison between our observations and simulations allows us to constrain the size distribution and the total mass of solid particles in the ring, which we find to be of the order of 30 Earth masses, enough to form future rocky planets.
Probing the Cold Dust Emission in the AB Aur Disk: A Dust Trap in a Decaying Vortex?
Energy Technology Data Exchange (ETDEWEB)
Fuente, Asunción; Bachiller, Rafael [Observatorio Astronómico Nacional (OAN, IGN), Apdo 112, E-28803 Alcalá de Henares (Spain); Baruteau, Clément; Carmona, Andrés; Berné, Olivier [IRAP, Université de Toulouse, CNRS, UPS, Toulouse (France); Neri, Roberto [Institut de Radioastronomie Millimétrique (IRAM), 300 rue de la Piscine, F-38406 Saint Martin d’Hères (France); Agúndez, Marcelino; Goicoechea, Javier R.; Cernicharo, José, E-mail: a.fuente@oan.es [Instituto de Ciencia de Materiales de Madrid (ICMM-CSIC), E-28049 Cantoblanco, Madrid (Spain)
2017-09-01
One serious challenge for planet formation is the rapid inward drift of pebble-sized dust particles in protoplanetary disks. Dust trapping at local maxima in the disk gas pressure has received much theoretical attention but still lacks observational support. The cold dust emission in the AB Aur disk forms an asymmetric ring at a radius of about 120 au, which is suggestive of dust trapping in a gas vortex. We present high spatial resolution (0.″58 × 0.″78 ≈ 80 × 110 au) NOEMA observations of the 1.12 mm and 2.22 mm dust continuum emission from the AB Aur disk. Significant azimuthal variations of the flux ratio at both wavelengths indicate a size segregation of the large dust particles along the ring. Our continuum images also show that the intensity variations along the ring are smaller at 2.22 mm than at 1.12 mm, contrary to what dust trapping models with a gas vortex have predicted. Our two-fluid (gas+dust) hydrodynamical simulations demonstrate that this feature is well explained if the gas vortex has started to decay due to turbulent diffusion, and dust particles are thus losing the azimuthal trapping on different timescales depending on their size. The comparison between our observations and simulations allows us to constrain the size distribution and the total mass of solid particles in the ring, which we find to be of the order of 30 Earth masses, enough to form future rocky planets.
Pignolet, Thierry
2017-01-01
Este papel es el trabajo final de un seminario de profundización del doctorado en ciencias sociales de la Universidad de Antioquia (Colombia). Expone la problemática y la teoría-metodología de una investigación doctoral sobre una 'political ecology' de extractivismo aurífero, partiendo del caso de Marmato, en Colombia.
An UXor among FUors: Extinction-related Brightness Variations of the Young Eruptive Star V582 Aur
Ábrahám, P.; Kóspál, Á.; Kun, M.; Fehér, O.; Zsidi, G.; Acosta-Pulido, J. A.; Carnerero, M. I.; García-Álvarez, D.; Moór, A.; Cseh, B.; Hajdu, G.; Hanyecz, O.; Kelemen, J.; Kriskovics, L.; Marton, G.; Mező, Gy.; Molnár, L.; Ordasi, A.; Rodríguez-Coira, G.; Sárneczky, K.; Sódor, Á.; Szakáts, R.; Szegedi-Elek, E.; Szing, A.; Farkas-Takács, A.; Vida, K.; Vinkó, J.
2018-01-01
V582 Aur is an FU Ori-type young eruptive star in outburst since ∼1985. The eruption is currently in a relatively constant plateau phase, with photometric and spectroscopic variability superimposed. Here we will characterize the progenitor of the outbursting object, explore its environment, and analyze the temporal evolution of the eruption. We are particularly interested in the physical origin of the two deep photometric dips, one that occurred in 2012 and one that is ongoing since 2016. We collected archival photographic plates and carried out new optical, infrared, and millimeter-wave photometric and spectroscopic observations between 2010 and 2018, with a high sampling rate during the current minimum. Besides analyzing the color changes during fading, we compiled multiepoch spectral energy distributions and fitted them with a simple accretion disk model. Based on pre-outburst data and a millimeter continuum measurement, we suggest that the progenitor of the V582 Aur outburst is a low-mass T Tauri star with average properties. The mass of an unresolved circumstellar structure, probably a disk, is 0.04 M ⊙. The optical and near-infrared spectra demonstrate the presence of hydrogen and metallic lines, show the CO band head in absorption, and exhibit a variable Hα profile. The color variations strongly indicate that both the ∼1 yr long brightness dip in 2012 and the current minimum since 2016 are caused by increased extinction along the line of sight. According to our accretion disk models, the reddening changed from A V = 4.5 to 12.5 mag, while the accretion rate remained practically constant. Similarly to the models of the UXor phenomenon of intermediate- and low-mass young stars, orbiting disk structures could be responsible for the eclipses.
Los asentamientos mineros en la minería aurífera de Nueva Granada durante la época colonial
Orche García, Enrique; Puche Riart, Octavio
2000-01-01
El Virreinato de Nueva Granada ocupaba el área que hoy comprende, total o parcialmente, Colombia, Ecuador, Venezuela y Panamá. Desde las primeras incursiones en este vasto territorio, los españoles constataron la enorme riqueza aurífera existente tanto en los aluviales de sus ríos como en los innumerables filones de cuarzo aflorantes en su agreste orografía y, por ello, acometieron la explotación sistemática de los yacimientos de oro en cuanto obtuvieron todo el metal que los indios fueron ca...
A New Look into the Spectral and Light Variations of varepsilon Aur
Czech Academy of Sciences Publication Activity Database
Harmanec, P.; Božić, H.; Korčáková, D.; Kotková, Lenka; Škoda, Petr; Šlechta, Miroslav; Švanda, Michal; Votruba, Viktor; Wolf, M.; Zasche, P.; Henden, A.; Ribeiro, J.
2013-01-01
Roč. 37, č. 1 (2013), s. 99-108 ISSN 1845-8319 Institutional support: RVO:67985815 Keywords : eclipsing binaries * spectroscopic binaries * variable stars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics
A gastronomia e o turismo: Um estudo na fronteira Jaguarão/BR e Rio Branco/UY
Directory of Open Access Journals (Sweden)
Gildo Janke
2016-12-01
Full Text Available A gastronomia é um potencial atrativo no turismo, uma vez que pode gerar experiências únicas e memoráveis. Ela faz parte da experiência turística, não se dissociando desta, e ainda se trabalhada como patrimônio cultural imaterial pode distinguir uma região, evidenciando suas peculiaridades e reforçando sua autenticidade. O patrimônio gastronômico, a fim de reforçar seus diferenciais para atrair os visitantes, pode ser evidenciado pelo desenvolvimento de roteiros turísticos, eventos, os quais a gastronomia é o foco de seus planejamentos. O presente trabalho visa analisar a gastronomia como parte do processo de interação cultural na Fronteira entre o Brasil e Uruguai, por meio das cidades de Jaguarão (BR e Rio Branco (UY e tem como finalidade realizar diagnóstico do potencial gastronômico e turístico brasileiro e uruguaio, na direção de elaborar proposições capazes de promover o desenvolvimento do segmento de turismo gastronômico, logo cultural no município de Jaguarão. Para o diagnóstico foram realizadas pesquisas bibliográficas e documentais, assim como pesquisa de campo, por meio de conversas informais com moradores locais, e análise dos cardápios dos estabelecimentos.
Directory of Open Access Journals (Sweden)
Juan C. Díaz, MD
2013-01-01
Se reporta el caso de una paciente que presentó signos y síntomas compatibles con falla cardíaca derecha y en quien los diferentes estudios demostraron una elevación diafragmática con colapso de la aurícula derecha como causa de su sintomatología.
Determinación de propiedades físicas y parámetros de transporte a colas auríferas de mina El Limón
Directory of Open Access Journals (Sweden)
J. Ramírez
2006-01-01
Full Text Available Los parámetros de transporte de colas mineras y otras propiedades físicas, tales como permeabilidad intrínseca, distribución de tamaño de partículas, porosidad y densidad fueron determinados experimentalmente. Se realizaron experimentos de infiltración en columnas de laboratorio con el fin de determinar; la conductividad hidráulica, las propiedades capilares y estudiar el comportamiento hidrodinámico de las colas auríferas. También se hizo uso de un modelo matemático para simular la infiltración isotérmica unidimensional y ajustar los perfiles experimentales, con el propósito de determinar los parámetros de transporte que describen el proceso de infiltración. Aunque los experimentos se realizaron con diferentes grados de compactación, se obtuvieron parámetros con una coherencia razonable para describir la conductividad hidráulica y las propiedades capilares de las colas por este método. Estos parámetros fueron usados en un modelo simple para simular el lavado con agua del cianuro contenido en las colas auríferas.
STABLE AND UNSTABLE REGIMES OF MASS ACCRETION ONTO RW AUR A
Energy Technology Data Exchange (ETDEWEB)
Takami, Michihiro; Wei, Yu-Jie; Chou, Mei-Yin; Karr, Jennifer L.; Liu, Hauyu Baobab [Institute of Astronomy and Astrophysics, Academia Sinica, 11F of Astronomy-Mathematics Building, AS/NTU, No.1, Sec. 4, Roosevelt Rd., Taipei 10617, Taiwan, R.O.C. (China); Beck, Tracy L. [Space Telescope Science Institute, 3700 San Martin Dr., Baltimore, MD 21218 (United States); Manset, Nadine [Canada–France–Hawaii Telescope, 65-1238 Mamalahoa Hwy., Kamuela, HI 96743 (United States); Chen, Wen-Ping [Institute of Astronomy, National Central University, Taiwan 320, Taiwan (China); Kurosawa, Ryuichi [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Fukagawa, Misato [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); White, Marc [Research School of Astronomy and Astrophysics, The Australian National University, Cotter Rd., Weston, ACT 2611 (Australia); Galván-Madrid, Roberto [Centro de Radioastronomía y Astrofísica, UNAM, Apdo. Postal 3-72 (Xangari), 58089 Morelia, Michoacán, México (Mexico); Pyo, Tae-Soo [Subaru Telescope, 650 North Aohoku Place, Hilo, HI 96720 (United States); Donati, Jean-Francois, E-mail: hiro@asiaa.snica.edu.tw [UPS-Toulouse/CNRS-INSU, Institut de Recherche en Astrophysique et Plańetologie (IRAP) UMR 5277, Toulouse F-31400 (France)
2016-04-01
We present monitoring observations of the active T Tauri star RW Aur, from 2010 October to 2015 January, using optical high-resolution (R ≥ 10,000) spectroscopy with Canada–France–Hawaii Telescope/ESPaDOnS. Optical photometry in the literature shows bright, stable fluxes over most of this period, with lower fluxes (by 2–3 mag) in 2010 and 2014. In the bright period our spectra show clear photospheric absorption, complicated variation in the Ca ii λ8542 emission profile shapes, and a large variation in redshifted absorption in the O i λλ7772 and 8446 and He i λ5876 lines, suggesting unstable mass accretion during this period. In contrast, these line profiles are relatively uniform during the faint periods, suggesting stable mass accretion. During the faint periods, the photospheric absorption lines are absent or marginal, and the averaged Li i profile shows redshifted absorption due to an inflow. We discuss (1) occultation by circumstellar material or a companion and (2) changes in the activity of mass accretion to explain the above results, together with near-infrared and X-ray observations from 2011 to 2015. Neither scenario can simply explain all the observed trends, and more theoretical work is needed to further investigate their feasibilities.
Instabilities in Interacting Binary Stars
Andronov, I. L.; Andrych, K. D.; Antoniuk, K. A.; Baklanov, A. V.; Beringer, P.; Breus, V. V.; Burwitz, V.; Chinarova, L. L.; Chochol, D.; Cook, L. M.; Cook, M.; Dubovský, P.; Godlowski, W.; Hegedüs, T.; Hoňková, K.; Hric, L.; Jeon, Y.-B.; Juryšek, J.; Kim, C.-H.; Kim, Y.; Kim, Y.-H.; Kolesnikov, S. V.; Kudashkina, L. S.; Kusakin, A. V.; Marsakova, V. I.; Mason, P. A.; Mašek, M.; Mishevskiy, N.; Nelson, R. H.; Oksanen, A.; Parimucha, S.; Park, J.-W.; Petrík, K.; Quiñones, C.; Reinsch, K.; Robertson, J. W.; Sergey, I. M.; Szpanko, M.; Tkachenko, M. G.; Tkachuk, L. G.; Traulsen, I.; Tremko, J.; Tsehmeystrenko, V. S.; Yoon, J.-N.; Zola, S.; Shakhovskoy, N. M.
2017-07-01
The types of instability in the interacting binary stars are briefly reviewed. The project “Inter-Longitude Astronomy” is a series of smaller projects on concrete stars or groups of stars. It has no special funds, and is supported from resources and grants of participating organizations, when informal working groups are created. This “ILA” project is in some kind similar and complementary to other projects like WET, CBA, UkrVO, VSOLJ, BRNO, MEDUZA, AstroStatistics, where many of us collaborate. Totally we studied 1900+ variable stars of different types, including newly discovered variables. The characteristic timescale is from seconds to decades and (extrapolating) even more. The monitoring of the first star of our sample AM Her was initiated by Prof. V.P. Tsesevich (1907-1983). Since more than 358 ADS papers were published. In this short review, we present some highlights of our photometric and photo-polarimetric monitoring and mathematical modeling of interacting binary stars of different types: classical (AM Her, QQ Vul, V808 Aur = CSS 081231:071126+440405, FL Cet), asynchronous (BY Cam, V1432 Aql), intermediate (V405 Aql, BG CMi, MU Cam, V1343 Her, FO Aqr, AO Psc, RXJ 2123, 2133, 0636, 0704) polars and magnetic dwarf novae (DO Dra) with 25 timescales corresponding to different physical mechanisms and their combinations (part “Polar”); negative and positive superhumpers in nova-like (TT Ari, MV Lyr, V603 Aql, V795 Her) and many dwarf novae stars (“Superhumper”); eclipsing “non-magnetic” cataclysmic variables(BH Lyn, DW UMa, EM Cyg; PX And); symbiotic systems (“Symbiosis”); super-soft sources (SSS, QR And); spotted (and not spotted) eclipsing variables with (and without) evidence for a current mass transfer (“Eclipser”) with a special emphasis on systems with a direct impact of the stream into the gainer star's atmosphere, which we propose to call “Impactor” (short from “Extreme Direct Impactor”), or V361 Lyr-type stars. Other
International Nuclear Information System (INIS)
Eggleton, P.P.; Pringle, J.E.
1985-01-01
This volume contains 15 review articles in the field of binary stars. The subjects reviewed span considerably, from the shortest period of interacting binaries to the longest, symbiotic stars. Also included are articles on Algols, X-ray binaries and Wolf-Rayet stars (single and binary). Contents: Preface. List of Participants. Activity of Contact Binary Systems. Wolf-Rayet Stars and Binarity. Symbiotic Stars. Massive X-ray Binaries. Stars that go Hump in the Night: The SU UMa Stars. Interacting Binaries - Summing Up
The True Ultracool Binary Fraction Using Spectral Binaries
Bardalez Gagliuffi, Daniella; Burgasser, Adam J.; Schmidt, Sarah J.; Gagné, Jonathan; Faherty, Jacqueline K.; Cruz, Kelle; Gelino, Chris
2018-01-01
Brown dwarfs bridge the gap between stars and giant planets. While the essential mechanisms governing their formation are not well constrained, binary statistics are a direct outcome of the formation process, and thus provide a means to test formation theories. Observational constraints on the brown dwarf binary fraction place it at 10 ‑ 20%, dominated by imaging studies (85% of systems) with the most common separation at 4 AU. This coincides with the resolution limit of state-of-the-art imaging techniques, suggesting that the binary fraction is underestimated. We have developed a separation-independent method to identify and characterize tightly-separated (dwarfs as spectral binaries by identifying traces of methane in the spectra of late-M and early-L dwarfs. Imaging follow-up of 17 spectral binaries yielded 3 (18%) resolved systems, corroborating the observed binary fraction, but 5 (29%) known binaries were missed, reinforcing the hypothesis that the short-separation systems are undercounted. In order to find the true binary fraction of brown dwarfs, we have compiled a volume-limited, spectroscopic sample of M7-L5 dwarfs and searched for T dwarf companions. In the 25 pc volume, 4 candidates were found, three of which are already confirmed, leading to a spectral binary fraction of 0.95 ± 0.50%, albeit for a specific combination of spectral types. To extract the true binary fraction and determine the biases of the spectral binary method, we have produced a binary population simulation based on different assumptions of the mass function, age distribution, evolutionary models and mass ratio distribution. Applying the correction fraction resulting from this method to the observed spectral binary fraction yields a true binary fraction of 27 ± 4%, which is roughly within 1σ of the binary fraction obtained from high resolution imaging studies, radial velocity and astrometric monitoring. This method can be extended to identify giant planet companions to young brown
Directory of Open Access Journals (Sweden)
Giovanny Ríos, MD
2012-05-01
Full Text Available La anomalía total del retorno venoso sistémico tiene gran variedad de presentaciones; sin embargo, la patología de más baja frecuencia es el drenaje de vena cava superior derecha a la aurícula izquierda, hecho de peso para que en el mundo se reporten pocos casos. En la Fundación Clínica Abood Shaio se trató el caso de una paciente de seis años de edad con drenaje venoso total de cava superior derecha a la aurícula izquierda, mediante la técnica de movilización de cava superior y anastomosis cavo-atrial, y se obtuvieron buenos resultados. El caso es mención corresponde al número 21 en la literatura mundial.
Directory of Open Access Journals (Sweden)
Héctor A. Deschle
2010-01-01
Full Text Available RESUMENIntroducciónEl tamaño de la aurícula izquierda (AI se ha relacionado con la ocurrencia de eventoscardiovasculares en pacientes mayores sin cardiopatía previa.Los valores considerados normales en adultos se suelen tomar de publicaciones extranjerasque presentan valores disímiles y no incluyen la división por edades, por lo que no quedaclaro el impacto que el envejecimiento podría tener sobre el tamaño auricular izquierdo, locual los hace difícilmente aplicables a la población general.ObjetivosEvaluar las modificaciones en el volumen indexado de la aurícula izquierda en sujetos saludablesde nuestro medio divididos por sexo y edad.Material y métodosEntre 2007 y 2008 ingresaron 725 pacientes asintomáticos sin antecedentes de cardiopatía,diabetes, ni enfermedades de relevancia clínica. Sexo masculino: 325. Se dividieron en gruposetarios: a 65 años. El volumen de laaurícula izquierda (AI se calculó de acuerdo con la fórmula: 8/3 π [(A1(A2/(L] (A1 = áreaen 4 cámaras, A2 = área en 2 cámaras, L = longitud más pequeña entre ambas vistas. Lasuperficie corporal se calculó con la fórmula de Mosteller.ResultadosEl volumen indexado de la AI fue significativamente mayor en varones > 64 años (32,89 ±5,93 cm³/m² con respecto a los tres primeros grupos etarios (p < 0,01. No hubo diferenciassignificativas entre los grupos del sexo femenino.ConclusiónEl volumen de la AI es significativamente mayor en varones de más de 64 años.REV ARGENT CARDIOL 2010;78:39-42.
Learning to assign binary weights to binary descriptor
Huang, Zhoudi; Wei, Zhenzhong; Zhang, Guangjun
2016-10-01
Constructing robust binary local feature descriptors are receiving increasing interest due to their binary nature, which can enable fast processing while requiring significantly less memory than their floating-point competitors. To bridge the performance gap between the binary and floating-point descriptors without increasing the computational cost of computing and matching, optimal binary weights are learning to assign to binary descriptor for considering each bit might contribute differently to the distinctiveness and robustness. Technically, a large-scale regularized optimization method is applied to learn float weights for each bit of the binary descriptor. Furthermore, binary approximation for the float weights is performed by utilizing an efficient alternatively greedy strategy, which can significantly improve the discriminative power while preserve fast matching advantage. Extensive experimental results on two challenging datasets (Brown dataset and Oxford dataset) demonstrate the effectiveness and efficiency of the proposed method.
Binary Linear-Time Erasure Decoding for Non-Binary LDPC codes
Savin, Valentin
2009-01-01
In this paper, we first introduce the extended binary representation of non-binary codes, which corresponds to a covering graph of the bipartite graph associated with the non-binary code. Then we show that non-binary codewords correspond to binary codewords of the extended representation that further satisfy some simplex-constraint: that is, bits lying over the same symbol-node of the non-binary graph must form a codeword of a simplex code. Applied to the binary erasure channel, this descript...
DEFF Research Database (Denmark)
Keiding, Hans; Peleg, Bezalel
2006-01-01
is binary if it is rationalized by an acyclic binary relation. The foregoing result motivates our definition of a binary effectivity rule as the effectivity rule of some binary SCR. A binary SCR is regular if it satisfies unanimity, monotonicity, and independence of infeasible alternatives. A binary...
Reyes Gil, Rosa; Bermúdez, Alexis; De Abreu, Orlando; Alvarado, José; Dominguez, José
2006-01-01
Metales pesados en plantas provenientes de áreas afectadas por la minería aurífera en la reserva forestal Imataca, Venezuela. Reyes Gil, Rosa; Bermúdez, Alexis; De Abreu, Orlando; Alvarado, José y Dominguez, José Resumen La Reserva Forestal Imataca ha sido explotada artesanalmente para la extracción de oro de aluvión con la utilización de técnicas agresivas para el ambiente, que incluyen la deforestación de grandes áreas boscosas y el uso de mercurio. El objetivo de este traba...
Metales en suelos explotados por la pequeña minería aurífera aluvial en Madre de Dios, Perú
Velásquez Ramírez, Manuel Gabriel
2017-01-01
Universidad Nacional Agraria La Molina. Escuela de Posgrado. Maestría en Suelos La región Madre de Dios es considerada la “Capital de la Biodiversidad del Perú”; sin embargo, su riqueza sufre la deforestación, pérdida de suelo y posible contaminación por mercurio a causa de la minería aurífera aluvial. La investigación se realizó en la comunidad de Fortuna en las concesiones de la empresa comunal Sociedad Minera Fortuna Milagritos S.R.L. El objetivo de la investigación fue evaluar el grado...
Hakobyan, Astghik; Galindo, Inmaculada; Nañez, Almudena; Arabyan, Erik; Karalyan, Zaven; Chistov, Alexey A; Streshnev, Philipp P; Korshun, Vladimir A; Alonso, Covadonga; Zakaryan, Hovakim
2018-01-01
Rigid amphipathic fusion inhibitors (RAFIs) are a family of nucleoside derivatives that inhibit the infectivity of several enveloped viruses by interacting with virion envelope lipids and inhibiting fusion between viral and cellular membranes. Here we tested the antiviral activity of two RAFIs, 5-(Perylen-3-ylethynyl)-arabino-uridine (aUY11) and 5-(Perylen-3-ylethynyl)uracil-1-acetic acid (cm1UY11) against African swine fever virus (ASFV), for which no effective vaccine is available. Both compounds displayed a potent, dose-dependent inhibitory effect on ASFV infection in Vero cells. The major antiviral effect was observed when aUY11 and cm1UY11 were added at early stages of infection and maintained during the complete viral cycle. Furthermore, virucidal assay revealed a significant extracellular anti-ASFV activity for both compounds. We also found decrease in the synthesis of early and late viral proteins in Vero cells treated with cm1UY11. Finally, the inhibitory effect of aUY11 and cm1UY11 on ASFV infection in porcine alveolar macrophages was confirmed. Overall, our study has identified novel anti-ASFV compounds with potential for future therapeutic developments.
International Nuclear Information System (INIS)
Kuznietz, M.
2002-01-01
During the 16-year period 1952-1968, starting with the pioneering discovery of ferro-magnetism in uranium hydride (β-UH 3 ) by Trzebiatowski and coworkers in Wroclaw, Poland, and ending with the first model accounting for the electronic properties of the NaCl-type uranium monopnictides (UX) and monochalcogenides (UY), a lot of experimental investigations were carried out in Poland, mainly in Wroclaw, on these compounds, as well as on other binary uranium pnictides (such as UX 2 and U 3 X 4 ) and chalcogenides (such as UY 2 and UY 3 ). One of the last studies of these compounds was done on magnetic properties of the uranium bismuthides. Among these bismuthides, UBi was reported to undergo antiferromagnetic (AF) transition close to room temperature. This observation was in line with the AF ordering of all the monopnictides UN, UP, UAs, and USb, found by magnetic measurements, and subsequently confirmed by powder neutron diffraction. These four compounds order with the AF-1 structure(+-+-) below the Noel temperature (TN), with UAs undergoing another transition to the AF-IA structure(++--) at x T N /2. On moving from UN to USb, TN rises from 50 K to 220 K, while the ordered magnetic moment at 4.2 K (m) rises from 0.75 μ B to 2.85 μ B . Later neutron-diffraction studies on UX single crystals showed variation in the magnetic structure from single-k in UN (and in UP and UAs phases below TN) to triple-k in USb
Near-IR High-Resolution Imaging Polarimetry of the SU Aur Disk: Clues for Tidal Tails?
De Leon, Jerome; Michihiro, Takami; Karr, Jennifer; Hashimoto, Jun; Kudo, Tomoyuki; Sitko, Michael; Mayama, Satoshi; Kusakabe, Nobuyuki; Grady, Carol A.; McElwain, Michael W.
2015-01-01
We present new high-resolution (approximately 0.09) H-band imaging observations of the circumstellar disk around the T Tauri star SU Aur. Our observations with Subaru-HiCIAO have revealed the presence of scattered light as close as 0.15 (approximately 20 AU) to the star. Within our image, we identify bright emission associated with a disk with a minimum radius of approximately 90 AU, an inclination of approximately 35 deg from the plane of the sky, and an approximate PA of 15 deg for the major axis. We find a brightness asymmetry between the northern and southern sides of the disk due to a non-axisymmetric disk structure. We also identify a pair of asymmetric tail structures extending east and west from the disk. The western tail extends at least 2. 5 (350 AU) from the star, and is probably associated with a reflection nebula previously observed at optical and near-IR wavelengths. The eastern tail extends at least 1 (140 AU) at the present signal-to-noise. These tails are likely due to an encounter with an unseen brown dwarf, but our results do not exclude the explanation that these tails are outflow cavities or jets.
Directory of Open Access Journals (Sweden)
Mássimo Canevacci
2010-04-01
Full Text Available Il saggio parte dalla riflessione del testo Writing Culture di Clifford-Marcus. Dopo più di 20 anni, è possibile verificare come questa critica, anziché aprire verso il futuro, ha chiuso una fase della mono-scrittura etnografica basata sul concetto di retorica e autorità. Già nella metà degli anni '80 stavano nascendo forme compositive multi-linguistiche sperimentali che applicavano una "etnografia indisciplinata" a design, architettura, pubblicità, musica, cinema, web. Si apre la sfida per una università non solo basata su Facoltà territoriali. Diverse modalità di comunicare attraverso il digitale mescolano e sincretizzano le visioni dualistiche di Benjamin su aura e riproducibilità. La mia prospettiva finale è la riproducibilità auratica digitale.Este artigo parte da reflexão sobre o texto Culture de.i Clifford-Marcus. Após 20 anos de sua publicação, é possível verificar como a crítica feita por este autor fecou uma fase da mono-escritura etnográfica baseana no conceito de retórica e autoridade. Já na metade dos anos 80 estavam nascendo formas compositivas multi-linguísticas experimentais que aplicavam um "etnografia indisciplinada" ao design, arquitetura, publicidade, música, cinema, web, abrindo uma via para universidades não somente baseadas sobre faculdades territoriais. Diversas modalidades de comunicação são digitalmente mixadas, sincretizando o dualimsno de Benjamin sobre aura e repordutibilidade. A minha perspectiva final é a reprodutibilidade aurática digital.My essay starts from a reflection on Clifford-Marcus's Writing Culture. After more than 20 years, it is possible to verify that such a critique - instead of opening toward the future - was going to close to the traditional ethnographic writing based on rhetoric and authority. In the middle of the 80's, were spreading experimental compositive patterns, applying an "undisciplined ethnography" to design, architecture, advertising, music, cinema and web
Pulsars in binary systems: probing binary stellar evolution and general relativity.
Stairs, Ingrid H
2004-04-23
Radio pulsars in binary orbits often have short millisecond spin periods as a result of mass transfer from their companion stars. They therefore act as very precise, stable, moving clocks that allow us to investigate a large set of otherwise inaccessible astrophysical problems. The orbital parameters derived from high-precision binary pulsar timing provide constraints on binary evolution, characteristics of the binary pulsar population, and the masses of neutron stars with different mass-transfer histories. These binary systems also test gravitational theories, setting strong limits on deviations from general relativity. Surveys for new pulsars yield new binary systems that increase our understanding of all these fields and may open up whole new areas of physics, as most spectacularly evidenced by the recent discovery of an extremely relativistic double-pulsar system.
Noll, K. S.
2017-12-01
The Jupiter Trojans, in the context of giant planet migration models, can be thought of as an extension of the small body populations found beyond Neptune in the Kuiper Belt. Binaries are a distinctive feature of small body populations in the Kuiper Belt with an especially high fraction apparent among the brightest Cold Classicals. The binary fraction, relative sizes, and separations in the dynamically excited populations (Scattered, Resonant) reflects processes that may have eroded a more abundant initial population. This trend continues in the Centaurs and Trojans where few binaries have been found. We review new evidence including a third resolved Trojan binary and lightcurve studies to understand how the Trojans are related to the small body populations that originated in the outer protoplanetary disk.
Luciana Alves de Souza Carvalho
2016-01-01
As anomalias craniofaciais ocasionam comprometimentos estéticos e funcionais com grande impacto na saúde e na integração social da criança, com interferência no desenvolvimento global e social. Das anomalias craniofaciais este estudo abordou as Fissuras Labiopalatinas (FLP) e o Espectro Óculo Aurículo Vertebral (EOAV). As FLP constituem malformações resultantes de falta do fechamento completo dos tecidos que compõe o lábio e o palato. O EOAV, também conhecido como Síndrome de Goldenhar, é um...
Testing the Binary Black Hole Nature of a Compact Binary Coalescence.
Krishnendu, N V; Arun, K G; Mishra, Chandra Kant
2017-09-01
We propose a novel method to test the binary black hole nature of compact binaries detectable by gravitational wave (GW) interferometers and, hence, constrain the parameter space of other exotic compact objects. The spirit of the test lies in the "no-hair" conjecture for black holes where all properties of a Kerr black hole are characterized by its mass and spin. The method relies on observationally measuring the quadrupole moments of the compact binary constituents induced due to their spins. If the compact object is a Kerr black hole (BH), its quadrupole moment is expressible solely in terms of its mass and spin. Otherwise, the quadrupole moment can depend on additional parameters (such as the equation of state of the object). The higher order spin effects in phase and amplitude of a gravitational waveform, which explicitly contains the spin-induced quadrupole moments of compact objects, hence, uniquely encode the nature of the compact binary. Thus, we argue that an independent measurement of the spin-induced quadrupole moment of the compact binaries from GW observations can provide a unique way to distinguish binary BH systems from binaries consisting of exotic compact objects.
Binary Masking & Speech Intelligibility
DEFF Research Database (Denmark)
Boldt, Jesper
The purpose of this thesis is to examine how binary masking can be used to increase intelligibility in situations where hearing impaired listeners have difficulties understanding what is being said. The major part of the experiments carried out in this thesis can be categorized as either experime......The purpose of this thesis is to examine how binary masking can be used to increase intelligibility in situations where hearing impaired listeners have difficulties understanding what is being said. The major part of the experiments carried out in this thesis can be categorized as either...... experiments under ideal conditions or as experiments under more realistic conditions useful for real-life applications such as hearing aids. In the experiments under ideal conditions, the previously defined ideal binary mask is evaluated using hearing impaired listeners, and a novel binary mask -- the target...... binary mask -- is introduced. The target binary mask shows the same substantial increase in intelligibility as the ideal binary mask and is proposed as a new reference for binary masking. In the category of real-life applications, two new methods are proposed: a method for estimation of the ideal binary...
Sahade, Jorge; Ter Haar, D
1978-01-01
Interacting Binary Stars deals with the development, ideas, and problems in the study of interacting binary stars. The book consolidates the information that is scattered over many publications and papers and gives an account of important discoveries with relevant historical background. Chapters are devoted to the presentation and discussion of the different facets of the field, such as historical account of the development in the field of study of binary stars; the Roche equipotential surfaces; methods and techniques in space astronomy; and enumeration of binary star systems that are studied
Full Ionisation In Binary-Binary Encounters With Small Positive Energies
Sweatman, W. L.
2006-08-01
Interactions between binary stars and single stars and binary stars and other binary stars play a key role in the dynamics of a dense stellar system. Energy can be transferred between the internal dynamics of a binary and the larger scale dynamics of the interacting objects. Binaries can be destroyed and created by the interaction. In a binary-binary encounter, full ionisation occurs when both of the binary stars are destroyed in the interaction to create four single stars. This is only possible when the total energy of the system is positive. For very small energies the probability of this occurring is very low and it tends towards zero as the total energy tends towards zero. Here the case is considered for which all the stars have equal masses. An asymptotic power law is predicted relating the probability of full ionisation with the total energy when this latter quantity is small. The exponent, which is approximately 2.31, is compared with the results from numerical scattering experiments. The theoretical approach taken is similar to one used previously in the three-body problem. It makes use of the fact that the most dramatic changes in scale and energies of a few-body system occur when its components pass near to a central configuration. The position, and number, of these configurations is not known for the general four-body problem, however, with equal masses there are known to be exactly five different cases. Separate consideration and comparison of the properties of orbits close to each of these five central configurations enables the prediction of the form of the cross-section for full ionisation for the case of small positive total energy. This is the relation between total energy and the probability of total ionisation described above.
CALCULATING THE HABITABLE ZONE OF BINARY STAR SYSTEMS. I. S-TYPE BINARIES
Energy Technology Data Exchange (ETDEWEB)
Kaltenegger, Lisa [MPIA, Koenigstuhl 17, D-69117 Heidelberg (Germany); Haghighipour, Nader, E-mail: kaltenegger@mpia.de [Institute for Astronomy and NASA Astrobiology Institute, University of Hawaii-Manoa, Honolulu, HI 96822 (United States)
2013-11-10
We have developed a comprehensive methodology for calculating the boundaries of the habitable zone (HZ) of planet-hosting S-type binary star systems. Our approach is general and takes into account the contribution of both stars to the location and extent of the binary HZ with different stellar spectral types. We have studied how the binary eccentricity and stellar energy distribution affect the extent of the HZ. Results indicate that in binaries where the combination of mass-ratio and orbital eccentricity allows planet formation around a star of the system to proceed successfully, the effect of a less luminous secondary on the location of the primary's HZ is generally negligible. However, when the secondary is more luminous, it can influence the extent of the HZ. We present the details of the derivations of our methodology and discuss its application to the binary HZ around the primary and secondary main-sequence stars of an FF, MM, and FM binary, as well as two known planet-hosting binaries α Cen AB and HD 196886.
CALCULATING THE HABITABLE ZONE OF BINARY STAR SYSTEMS. I. S-TYPE BINARIES
International Nuclear Information System (INIS)
Kaltenegger, Lisa; Haghighipour, Nader
2013-01-01
We have developed a comprehensive methodology for calculating the boundaries of the habitable zone (HZ) of planet-hosting S-type binary star systems. Our approach is general and takes into account the contribution of both stars to the location and extent of the binary HZ with different stellar spectral types. We have studied how the binary eccentricity and stellar energy distribution affect the extent of the HZ. Results indicate that in binaries where the combination of mass-ratio and orbital eccentricity allows planet formation around a star of the system to proceed successfully, the effect of a less luminous secondary on the location of the primary's HZ is generally negligible. However, when the secondary is more luminous, it can influence the extent of the HZ. We present the details of the derivations of our methodology and discuss its application to the binary HZ around the primary and secondary main-sequence stars of an FF, MM, and FM binary, as well as two known planet-hosting binaries α Cen AB and HD 196886
Garzón-Gutiérrez, Jennyfer Magdalia; Rodríguez-Miranda, Juan Pablo
2015-01-01
Introducción: Dada la problemática social y ambiental generada por la minería aurífera artesanal y a pequeña escala (MAAPE), se lleva a cabo en el presente documento la revisión del estado del arte en cuanto a la gestión ambiental de aguas residuales con mercurio (Hg) a nivel mundial. Materiales y métodos: La revisión se realizó a partir de artículos científicos publicados durante los últimos cinco años, encontrando que las intervenciones para abordar los impactos por Hg en la MAAPE, se han e...
Shore, S N; van den Heuvel, EPJ
1994-01-01
This volume contains lecture notes presented at the 22nd Advanced Course of the Swiss Society for Astrophysics and Astronomy. The contributors deal with symbiotic stars, cataclysmic variables, massive binaries and X-ray binaries, in an attempt to provide a better understanding of stellar evolution.
Eclipsing binaries in open clusters
DEFF Research Database (Denmark)
Southworth, John; Clausen, J.V.
2006-01-01
Stars: fundamental parameters - Stars : binaries : eclipsing - Stars: Binaries: spectroscopic - Open clusters and ass. : general Udgivelsesdato: 5 August......Stars: fundamental parameters - Stars : binaries : eclipsing - Stars: Binaries: spectroscopic - Open clusters and ass. : general Udgivelsesdato: 5 August...
CALCULATING THE HABITABLE ZONE OF BINARY STAR SYSTEMS. II. P-TYPE BINARIES
International Nuclear Information System (INIS)
Haghighipour, Nader; Kaltenegger, Lisa
2013-01-01
We have developed a comprehensive methodology for calculating the circumbinary habitable zone (HZ) in planet-hosting P-type binary star systems. We present a general formalism for determining the contribution of each star of the binary to the total flux received at the top of the atmosphere of an Earth-like planet and use the Sun's HZ to calculate the inner and outer boundaries of the HZ around a binary star system. We apply our calculations to the Kepler's currently known circumbinary planetary systems and show the combined stellar flux that determines the boundaries of their HZs. We also show that the HZ in P-type systems is dynamic and, depending on the luminosity of the binary stars, their spectral types, and the binary eccentricity, its boundaries vary as the stars of the binary undergo their orbital motion. We present the details of our calculations and discuss the implications of the results
CALCULATING THE HABITABLE ZONE OF BINARY STAR SYSTEMS. II. P-TYPE BINARIES
Energy Technology Data Exchange (ETDEWEB)
Haghighipour, Nader [Institute for Astronomy and NASA Astrobiology Institute, University of Hawaii-Manoa, Honolulu, HI 96822 (United States); Kaltenegger, Lisa [MPIA, Koenigstuhl 17, Heidelberg, D-69117 (Germany)
2013-11-10
We have developed a comprehensive methodology for calculating the circumbinary habitable zone (HZ) in planet-hosting P-type binary star systems. We present a general formalism for determining the contribution of each star of the binary to the total flux received at the top of the atmosphere of an Earth-like planet and use the Sun's HZ to calculate the inner and outer boundaries of the HZ around a binary star system. We apply our calculations to the Kepler's currently known circumbinary planetary systems and show the combined stellar flux that determines the boundaries of their HZs. We also show that the HZ in P-type systems is dynamic and, depending on the luminosity of the binary stars, their spectral types, and the binary eccentricity, its boundaries vary as the stars of the binary undergo their orbital motion. We present the details of our calculations and discuss the implications of the results.
Energy Technology Data Exchange (ETDEWEB)
Lomax, Jamie R.; Wisniewski, John P.; Hashimoto, Jun [Homer L. Dodge Department of Physics, University of Oklahoma, Norman, OK 73071 (United States); Grady, Carol A. [Exoplanets and Stellar Astrophysics Laboratory, Code 667, Goddard Space Flight Center, Greenbelt, MD 20771 (United States); McElwain, Michael W. [NASA Goddard Space Flight Center, Code 6681, Greenbelt, MD 20771 (United States); Kudo, Tomoyuki; Currie, Thayne M; Egner, Sebastian; Guyon, Olivier; Hayano, Yutaka [Subaru Telescope, National Astronomical Observatory of Japan, 650 North A’ohoku Place, Hilo, HI 96720 (United States); Kusakabe, Nobuhiko; Hayashi, Masahiko [National Astronomical Observatory of Japan, 2-21-1, Osawa, Mitaka, Tokyo, 181-8588 (Japan); Okamoto, Yoshiko K. [Institute of Astrophysics and Planetary Sciences, Faculty of Science, Ibaraki University, 2-1-1 Bunkyo, Mito, Ibaraki 310-8512 (Japan); Fukagawa, Misato [Graduate School of Science, Osaka University, 1-1 Machikaneyama, Toyonaka, Osaka 560-0043 (Japan); Abe, Lyu [Laboratoire Lagrange (UMR 7293), Universite de Nice-Sophia Antipolis, CNRS, Observatoire de la Cote d’Azur, 28 avenue Valrose, F-06108 Nice Cedex 2 (France); Brandner, Wolfgang; Feldt, Markus [Max Planck Institute for Astronomy, Königstuhl 17, D-69117 Heidelberg (Germany); Brandt, Timothy D. [Astrophysics Department, Institute for Advanced Study, Princeton, NJ 08540 (United States); Carson, Joseph C. [Department of Physics and Astronomy, College of Charleston, 58 Coming Street, Charleston, SC 29424 (United States); Goto, Miwa, E-mail: Jamie.R.Lomax@ou.edu, E-mail: wisniewski@ou.edu, E-mail: carol.a.grady@nasa.gov [Universitäts-Sternwarte München, Ludwig-Maximilians-Universität, Scheinerstr. 1, D-81679 München (Germany); and others
2016-09-01
We present a new analysis of multi-epoch, H -band, scattered light images of the AB Aur system. We use a Monte Carlo radiative transfer code to simultaneously model the system’s spectral energy distribution (SED) and H -band polarized intensity (PI) imagery. We find that a disk-dominated model, as opposed to one that is envelope-dominated, can plausibly reproduce AB Aur’s SED and near-IR imagery. This is consistent with previous modeling attempts presented in the literature and supports the idea that at least a subset of AB Aur’s spirals originate within the disk. In light of this, we also analyzed the movement of spiral structures in multi-epoch H -band total light and PI imagery of the disk. We detect no significant rotation or change in spatial location of the spiral structures in these data, which span a 5.8-year baseline. If such structures are caused by disk–planet interactions, the lack of observed rotation constrains the location of the orbit of planetary perturbers to be >47 au.
International Nuclear Information System (INIS)
Larsson-Leander, G.
1979-01-01
Studies of close binary stars are being persued more vigorously than ever, with about 3000 research papers and notes pertaining to the field being published during the triennium 1976-1978. Many major advances and spectacular discoveries were made, mostly due to increased observational efficiency and precision, especially in the X-ray, radio, and ultraviolet domains. Progress reports are presented in the following areas: observational techniques, methods of analyzing light curves, observational data, physical data, structure and models of close binaries, statistical investigations, and origin and evolution of close binaries. Reports from the Coordinates Programs Committee, the Committee for Extra-Terrestrial Observations and the Working Group on RS CVn binaries are included. (Auth./C.F.)
Massive Black Hole Binary Evolution
Directory of Open Access Journals (Sweden)
Merritt David
2005-11-01
Full Text Available Coalescence of binary supermassive black holes (SBHs would constitute the strongest sources of gravitational waves to be observed by LISA. While the formation of binary SBHs during galaxy mergers is almost inevitable, coalescence requires that the separation between binary components first drop by a few orders of magnitude, due presumably to interaction of the binary with stars and gas in a galactic nucleus. This article reviews the observational evidence for binary SBHs and discusses how they would evolve. No completely convincing case of a bound, binary SBH has yet been found, although a handful of systems (e.g. interacting galaxies; remnants of galaxy mergers are now believed to contain two SBHs at projected separations of <~ 1kpc. N-body studies of binary evolution in gas-free galaxies have reached large enough particle numbers to reproduce the slow, “diffusive” refilling of the binary’s loss cone that is believed to characterize binary evolution in real galactic nuclei. While some of the results of these simulations - e.g. the binary hardening rate and eccentricity evolution - are strongly N-dependent, others - e.g. the “damage” inflicted by the binary on the nucleus - are not. Luminous early-type galaxies often exhibit depleted cores with masses of ~ 1-2 times the mass of their nuclear SBHs, consistent with the predictions of the binary model. Studies of the interaction of massive binaries with gas are still in their infancy, although much progress is expected in the near future. Binary coalescence has a large influence on the spins of SBHs, even for mass ratios as extreme as 10:1, and evidence of spin-flips may have been observed.
Membrane interactions and biological activity of antimicrobial peptides from Australian scorpion.
Luna-Ramírez, Karen; Sani, Marc-Antoine; Silva-Sanchez, Jesus; Jiménez-Vargas, Juana María; Reyna-Flores, Fernando; Winkel, Kenneth D; Wright, Christine E; Possani, Lourival D; Separovic, Frances
2014-09-01
UyCT peptides are antimicrobial peptides isolated from the venom of the Australian scorpion. The activity of the UyCT peptides against Gram positive and Gram negative bacteria and red blood cells was determined. The membrane interactions of these peptides were evaluated by dye release (DR) of the fluorophore calcein from liposomes and isothermal titration calorimetry (ITC); and their secondary structure was determined by circular dichroism (CD). Three different lipid systems were used to mimic red blood cells, Escherichia coli and Staphylococcus aureus membranes. UyCT peptides exhibited broad spectrum antimicrobial activity with low MIC for S. aureus and multi-drug resistant Gram negative strains. Peptide combinations showed some synergy enhancing their potency but not hemolytic activity. The UyCT peptides adopted a helical structure in lipid environments and DR results confirmed that the mechanism of action is by disrupting the membrane. ITC data indicated that UyCT peptides preferred prokaryotic rather than eukaryotic membranes. The overall results suggest that UyCT peptides could be pharmaceutical leads for the treatment of Gram negative multiresistant bacterial infections, especially against Acinetobacter baumanni, and candidates for peptidomimetics to enhance their potency and minimize hemolysis. This article is part of a Special Issue entitled: Interfacially Active Peptides and Proteins. Guest Editors: William C. Wimley and Kalina Hristova. © 2013.
A RESOLVED NEAR-INFRARED IMAGE OF THE INNER CAVITY IN THE GM Aur TRANSITIONAL DISK
Energy Technology Data Exchange (ETDEWEB)
Oh, Daehyeon; Yang, Yi [Department of Astronomical Science, SOKENDAI (The Graduate University for Advanced Studies), 2-21-1 Osawa, Mitaka, Tokyo, 181-8588 (Japan); Hashimoto, Jun; Kusakabe, Nobuhiko [Astrobiology Center of NINS 2-21-1, Osawa, Mitaka, Tokyo, 181-8588 (Japan); Carson, Joseph C. [Department of Physics and Astronomy, College of Charleston 66 George Street, Charleston, SC 29424 (United States); Janson, Markus [Department of Astronomy, Stockholm University, AlbaNova University Center SE-106 91 Stockholm (Sweden); Kwon, Jungmi; Nakagawa, Takao [Institute of Space and Astronautical Science, Japan Aerospace Exploration Agency 3-1-1 Yoshinodai, Chuo, Sagamihara, Kanagawa 252-5210 (Japan); Mayama, Satoshi [The Center for the Promotion of Integrated Sciences, SOKENDAI (The Graduate University for Advanced Studies), Shonan International Village, Hayama-cho, Miura-gun, Kanagawa 240-0193 (Japan); Uyama, Taichi [Department of Astronomy, The University of Tokyo 7-3-1, Hongo, Bunkyo-ku, Tokyo, 113-0033 (Japan); Kudo, Tomoyuki; Currie, Thayne [Subaru Telescope, National Astronomical Observatory of Japan 650 North A’ohoku Place, Hilo, HI 96720 (United States); Abe, Lyu [Laboratoire Lagrange (UMR 7293), Universite de Nice-Sophia Antipolis, CNRS, Observatoire de la Coted’azur 28 avenue Valrose, F-06108 Nice Cedex 2 (France); Akiyama, Eiji [National Astronomical Observatory of Japan 2-21-1, Osawa, Mitaka, Tokyo, 181-8588 (Japan); Brandner, Wolfgang [Max Planck Institute for Astronomy, Köonigstuhl 17, D-69117 Heidelberg (Germany); Brandt, Timothy D.; Feldt, Markus [Astrophysics Department, Institute for Advanced Study Princeton, NJ (United States); Goto, Miwa [Universitats-Sternwarte Munchen, Ludwig-Maximilians-Universitat, Scheinerstr. 1, D-81679 Munchen (Germany); Grady, Carol A. [Exoplanets and Stellar Astrophysics Laboratory, Code 667, Goddard Space Flight Center Greenbelt, MD 20771 (United States); and others
2016-11-01
We present high-contrast H -band polarized intensity (PI) images of the transitional disk around the young solar-like star GM Aur. The near-infrared direct imaging of the disk was derived by polarimetric differential imaging using the Subaru 8.2 m Telescope and HiCIAO. An angular resolution and an inner working angle of 0.″07 and r ∼ 0.″05, respectively, were obtained. We clearly resolved a large inner cavity, with a measured radius of 18 ± 2 au, which is smaller than that of a submillimeter interferometric image (28 au). This discrepancy in the cavity radii at near-infrared and submillimeter wavelengths may be caused by a 3–4 M {sub Jup} planet about 20 au away from the star, near the edge of the cavity. The presence of a near-infrared inner cavity is a strong constraint on hypotheses for inner cavity formation in a transitional disk. A dust filtration mechanism has been proposed to explain the large cavity in the submillimeter image, but our results suggest that this mechanism must be combined with an additional process. We found that the PI slope of the outer disk is significantly different from the intensity slope obtained from HST /NICMOS, and this difference may indicate the grain growth process in the disk.
The fate of close encounters between binary stars and binary supermassive black holes
Wang, Yi-Han; Leigh, Nathan; Yuan, Ye-Fei; Perna, Rosalba
2018-04-01
The evolution of main-sequence binaries that reside in the Galactic Centre can be heavily influenced by the central supermassive black hole (SMBH). Due to these perturbative effects, the stellar binaries in dense environments are likely to experience mergers, collisions, or ejections through secular and/or non-secular interactions. More direct interactions with the central SMBH are thought to produce hypervelocity stars (HVSs) and tidal disruption events (TDEs). In this paper, we use N-body simulations to study the dynamics of stellar binaries orbiting a central SMBH primary with an outer SMBH secondary orbiting this inner triple. The effects of the secondary SMBH on the event rates of HVSs, TDEs, and stellar mergers are investigated, as a function of the SMBH-SMBH binary mass ratio. Our numerical experiments reveal that, relative to the isolated SMBH case, the TDE and HVS rates are enhanced for, respectively, the smallest and largest mass ratio SMBH-SMBH binaries. This suggests that the observed event rates of TDEs and HVSs have the potential to serve as a diagnostic of the mass ratio of a central SMBH-SMBH binary. The presence of a secondary SMBH also allows for the creation of hypervelocity binaries. Observations of these systems could thus constrain the presence of a secondary SMBH in the Galactic Centre.
Utomo, P.H.; Makarim, R.H.
2017-01-01
A Binary puzzle is a Sudoku-like puzzle with values in each cell taken from the set {0,1} {0,1}. Let n≥4 be an even integer, a solved binary puzzle is an n×n binary array that satisfies the following conditions: (1) no three consecutive ones and no three consecutive zeros in each row and each
Hidatidosis cardíaca primaria: quiste hidatídico en aurícula derecha con diseminación pulmonar
Directory of Open Access Journals (Sweden)
Christian Muñoz-Guijosa
2009-01-01
Full Text Available La hidatidosis es una enfermedad parasitaria producida por la larva del cestodo Echinococcus. El quiste hidatídico, la forma más habitual de presentación, es producida por la especie E. granulosus. la afectación cardíaca es muy rara, produciéndose en aproximadamente el 0,5–2% de los casos. El 65% de los casos de hidatidosis cardíaca se localizan en las cavidades izquierdas. Presentamos el caso de un paciente en el que la primera localización de la enfermedad fue la aurícula derecha (Ad, junto con diseminación pulmonar quística. La localización exclusiva en las cavidades cardíacas derechas y en la arteria pulmonar constituye una presentación clínica inusual. se ha revisado la bibliografía, prestando especial interés en la importancia de las técnicas de imagen disponibles en la actualidad para su diagnóstico, así como la necesidad de un tratamiento quirúrgico precoz para evitar sus posibles complicaciones.
Directory of Open Access Journals (Sweden)
Adolfo Eslava
2014-06-01
Full Text Available Este texto pretende avanzar en la construcción de un enfoque alternativo para mirar la realidad minera colombiana. En contraposición a la estigmatización, aquí se destaca el potencial que existe en los pobladores de territorios mineros. Para ello se toma como punto de partida el estudio de la confianza como factor desencadenante de cambios sociales, luego se describen generalidades de la economía política de la minería aurífera y también se aborda el problema del abastecimiento de oro a los joyeros para proponer soluciones cooperativas con beneficios económicos y sociales para la comunidad minera.
Directory of Open Access Journals (Sweden)
Adolfo Eslava
2014-01-01
Full Text Available Este texto pretende avanzar en la cons-trucción de un enfoque alternativo para mirar la realidad minera colombiana. En contrapo-sición a la estigmatización, aquí se destaca el potencial que existe en los pobladores de terri-torios mineros. Para ello se toma como punto de partida el estudio de la confianza como factor desencadenante de cambios sociales, luego se describen generalidades de la econo-mía política de la minería aurífera y también se aborda el problema del abastecimiento de oro a los joyeros para proponer soluciones coo-perativas con beneficios económicos y sociales para la comunidad minera.
Directory of Open Access Journals (Sweden)
Alvaro J. ldrovo
2001-06-01
Full Text Available La minería aurífera en la región de la Orinoquia colombiana ha tenido un importante crecimiento en los últimos 15 años. Esta actividad se ha convertido en un importante problema de salud pública debido a varios factores como el uso de mercurio durante el proceso de amalgamación del oro, la contaminación del ecosistema y la exposición de la población de la región. El objetivo del presente trabajo fue determinar los niveles de mercurio en cabello y sangre en una población minera del departamento del Guainía y la percepción que tiene dicha población del riesgo de usar este elemento. Para tal fin, se encuestaron 78 residentes de la región, de los cuales se obtuvieron 59 muestras de sangre y 61 de cabello. Los resultados indican un precario ambiente laboral y una falta de conocimiento del riesgo ecológico, lo cual permite la contaminación del ecosistema de la Orinoquia. Los individuos perciben la exposición al mercurio como nociva para la salud, aunque sus conocimientos al respecto son inadecuados. Los valores de mercurio en sangre entre los mineros oscilaron entre 6,9 y 168,0 ug/l (promedio=59,16 y entre los individuos indirectamente expuestos fluctuó entre 17,7 y 100,8 ug/l (promedio=53,5. Las concentraciones de mercurio total en cabello oscilaron entre 3,0 y 89,2 ug/g (promedio=26,93 en el grupo de mineros y entre 2,8 y 48,7 ug/g (promedio=22,86 entre los expuestos indirectamente. No se encontraron diferencias significativas en los niveles de mercurio entre los dos grupos estudiados. Se sugieren medidas preventivas y de control de la situación generada por el uso de mercurio en las labores de mineria aurífera de la región.
Relativistic Binaries in Globular Clusters
Directory of Open Access Journals (Sweden)
Matthew J. Benacquista
2013-03-01
Full Text Available Galactic globular clusters are old, dense star systems typically containing 10^4 – 10^6 stars. As an old population of stars, globular clusters contain many collapsed and degenerate objects. As a dense population of stars, globular clusters are the scene of many interesting close dynamical interactions between stars. These dynamical interactions can alter the evolution of individual stars and can produce tight binary systems containing one or two compact objects. In this review, we discuss theoretical models of globular cluster evolution and binary evolution, techniques for simulating this evolution that leads to relativistic binaries, and current and possible future observational evidence for this population. Our discussion of globular cluster evolution will focus on the processes that boost the production of tight binary systems and the subsequent interaction of these binaries that can alter the properties of both bodies and can lead to exotic objects. Direct N-body integrations and Fokker–Planck simulations of the evolution of globular clusters that incorporate tidal interactions and lead to predictions of relativistic binary populations are also discussed. We discuss the current observational evidence for cataclysmic variables, millisecond pulsars, and low-mass X-ray binaries as well as possible future detection of relativistic binaries with gravitational radiation.
DEFF Research Database (Denmark)
Brodal, Gerth Stølting; Moruz, Gabriel
2006-01-01
It is well-known that to minimize the number of comparisons a binary search tree should be perfectly balanced. Previous work has shown that a dominating factor over the running time for a search is the number of cache faults performed, and that an appropriate memory layout of a binary search tree...... can reduce the number of cache faults by several hundred percent. Motivated by the fact that during a search branching to the left or right at a node does not necessarily have the same cost, e.g. because of branch prediction schemes, we in this paper study the class of skewed binary search trees....... For all nodes in a skewed binary search tree the ratio between the size of the left subtree and the size of the tree is a fixed constant (a ratio of 1/2 gives perfect balanced trees). In this paper we present an experimental study of various memory layouts of static skewed binary search trees, where each...
Binary optics: Trends and limitations
Farn, Michael W.; Veldkamp, Wilfrid B.
1993-01-01
We describe the current state of binary optics, addressing both the technology and the industry (i.e., marketplace). With respect to the technology, the two dominant aspects are optical design methods and fabrication capabilities, with the optical design problem being limited by human innovation in the search for new applications and the fabrication issue being limited by the availability of resources required to improve fabrication capabilities. With respect to the industry, the current marketplace does not favor binary optics as a separate product line and so we expect that companies whose primary purpose is the production of binary optics will not represent the bulk of binary optics production. Rather, binary optics' more natural role is as an enabling technology - a technology which will directly result in a competitive advantage in a company's other business areas - and so we expect that the majority of binary optics will be produced for internal use.
Wijers, R.A.M.J.
1996-01-01
Introduction Distinguishing neutron stars and black holes Optical companions and dynamical masses X-ray signatures of the nature of a compact object Structure and evolution of black-hole binaries High-mass black-hole binaries Low-mass black-hole binaries Low-mass black holes Formation of black holes
Coevolution of Binaries and Circumbinary Gaseous Disks
Fleming, David; Quinn, Thomas R.
2018-04-01
The recent discoveries of circumbinary planets by Kepler raise questions for contemporary planet formation models. Understanding how these planets form requires characterizing their formation environment, the circumbinary protoplanetary disk, and how the disk and binary interact. The central binary excites resonances in the surrounding protoplanetary disk that drive evolution in both the binary orbital elements and in the disk. To probe how these interactions impact both binary eccentricity and disk structure evolution, we ran N-body smooth particle hydrodynamics (SPH) simulations of gaseous protoplanetary disks surrounding binaries based on Kepler 38 for 10^4 binary orbital periods for several initial binary eccentricities. We find that nearly circular binaries weakly couple to the disk via a parametric instability and excite disk eccentricity growth. Eccentric binaries strongly couple to the disk causing eccentricity growth for both the disk and binary. Disks around sufficiently eccentric binaries strongly couple to the disk and develop an m = 1 spiral wave launched from the 1:3 eccentric outer Lindblad resonance (EOLR). This wave corresponds to an alignment of gas particle longitude of periastrons. We find that in all simulations, the binary semi-major axis decays due to dissipation from the viscous disk.
BINARY CEPHEIDS: SEPARATIONS AND MASS RATIOS IN 5 M ☉ BINARIES
International Nuclear Information System (INIS)
Evans, Nancy Remage; Karovska, Margarita; Tingle, Evan; Bond, Howard E.; Schaefer, Gail H.; Mason, Brian D.
2013-01-01
Deriving the distribution of binary parameters for a particular class of stars over the full range of orbital separations usually requires the combination of results from many different observing techniques (radial velocities, interferometry, astrometry, photometry, direct imaging), each with selection biases. However, Cepheids—cool, evolved stars of ∼5 M ☉ —are a special case because ultraviolet (UV) spectra will immediately reveal any companion star hotter than early type A, regardless of the orbital separation. We have used International Ultraviolet Explorer UV spectra of a complete sample of all 76 Cepheids brighter than V = 8 to create a list of all 18 Cepheids with companions more massive than 2.0 M ☉ . Orbital periods of many of these binaries are available from radial-velocity studies, or can be estimated for longer-period systems from detected velocity variability. In an imaging survey with the Hubble Space Telescope Wide Field Camera 3, we resolved three of the companions (those of η Aql, S Nor, and V659 Cen), allowing us to make estimates of the periods out to the long-period end of the distribution. Combining these separations with orbital data in the literature, we derive an unbiased distribution of binary separations, orbital periods, and mass ratios. The distribution of orbital periods shows that the 5 M ☉ binaries have systematically shorter periods than do 1 M ☉ stars. Our data also suggest that the distribution of mass ratios depends on both binary separation and system multiplicity. The distribution of mass ratios as a function of orbital separation, however, does not depend on whether a system is a binary or a triple
Spectral properties of binary asteroids
Pajuelo, Myriam; Birlan, Mirel; Carry, Benoît; DeMeo, Francesca E.; Binzel, Richard P.; Berthier, Jérôme
2018-04-01
We present the first attempt to characterize the distribution of taxonomic class among the population of binary asteroids (15% of all small asteroids). For that, an analysis of 0.8-2.5{μ m} near-infrared spectra obtained with the SpeX instrument on the NASA/IRTF is presented. Taxonomic class and meteorite analog is determined for each target, increasing the sample of binary asteroids with known taxonomy by 21%. Most binary systems are bound in the S-, X-, and C- classes, followed by Q and V-types. The rate of binary systems in each taxonomic class agrees within uncertainty with the background population of small near-Earth objects and inner main belt asteroids, but for the C-types which are under-represented among binaries.
Directory of Open Access Journals (Sweden)
Alejandro Orjuela
Full Text Available El síndrome de aurícula paralítica es una entidad poco común y generalmente se presenta aislada o asociada a trastornos degenerativos musculares. Se ha propuesto un mecanismo de transmisión familiar por transmisión autosómica dominante. Su presentación es más frecuente en hombres jóvenes y puede manifestarse como evento cerebrovascular, falla cardiaca o fenómenos tromboembólicos. En este artículo se presenta el caso de un hombre joven con historia de síncope recurrente y quien había recibido, tiempo atrás, implante de marcapaso definitivo monocameral. Se descartaron enfermedades inflamatorias cardiacas, distrofias musculares y otras causas secundarias de su trastorno en la formación del impulso sinusal. Una vez la batería de su marcapaso se encontró cerca de su fin de vida y durante el cambio programado del generador, se realizó estudio electrofisiológico de la aurícula y no se encontró mayor actividad. Se implantó electrodo atrial y se realizó seguimiento ecocardiográfico de la función auricular, la cual mostró una discreta mejoría al cabo de seis meses post-implante, para retornar a los valores basales, razón por la que se apagó el canal atrial. Aunque algunos pacientes recuperan la función atrial posterior a la cardioversión por fibrilacion atrial, no se conoce el porcentaje de pacientes que lo hacen tras la estimulación atrial en una aurícula poco activa mecánica y eléctricamente. Esto hace útil la medición de la actividad atrial y la estimulación, antes de decidir sobre el implante de un electrodo en el atrio.Atrial palsy syndrome is an uncommon entity which generally occurs isolated or associated with degenerative muscular disorders. An autosomic dominant familiar transmission mechanism has been proposed. It appears more frequently in young males, and may be manifested as cerebro-vascular event, heart failure or thromboembolic phenomena. In this article, the case of a young man with history of
Binary Cepheids: Separations and Mass Ratios in 5 M ⊙ Binaries
Evans, Nancy Evans; Bond, Howard E.; Schaefer, Gail H.; Mason, Brian D.; Karovska, Margarita; Tingle, Evan
2013-10-01
Deriving the distribution of binary parameters for a particular class of stars over the full range of orbital separations usually requires the combination of results from many different observing techniques (radial velocities, interferometry, astrometry, photometry, direct imaging), each with selection biases. However, Cepheids—cool, evolved stars of ~5 M ⊙—are a special case because ultraviolet (UV) spectra will immediately reveal any companion star hotter than early type A, regardless of the orbital separation. We have used International Ultraviolet Explorer UV spectra of a complete sample of all 76 Cepheids brighter than V = 8 to create a list of all 18 Cepheids with companions more massive than 2.0 M ⊙. Orbital periods of many of these binaries are available from radial-velocity studies, or can be estimated for longer-period systems from detected velocity variability. In an imaging survey with the Hubble Space Telescope Wide Field Camera 3, we resolved three of the companions (those of η Aql, S Nor, and V659 Cen), allowing us to make estimates of the periods out to the long-period end of the distribution. Combining these separations with orbital data in the literature, we derive an unbiased distribution of binary separations, orbital periods, and mass ratios. The distribution of orbital periods shows that the 5 M ⊙ binaries have systematically shorter periods than do 1 M ⊙ stars. Our data also suggest that the distribution of mass ratios depends on both binary separation and system multiplicity. The distribution of mass ratios as a function of orbital separation, however, does not depend on whether a system is a binary or a triple. Based in part on observations made with the NASA/ESA Hubble Space Telescope, obtained by the Space Telescope Science Institute. STScI is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS5-26555.
Directory of Open Access Journals (Sweden)
Antonio R. Vilches
2004-02-01
Full Text Available El cuadro clínico de la tirotoxicosis incluye síntomas cardiovasculares variados. La taquicardia sinusal es el trastorno electrocardiográfico más frecuente y los trastornos de conducción son extremadamente raros como modo de presentación. Comunicamos un caso de bloqueo aurículo-ventricular de primer grado en una paciente con hipertiroidismo recién diagnosticado y que comenzó días antes de la consulta con un cuadro general inespecífico. Su evaluación ulterior demostró que se trataba de una tirotoxicosis aguda autoinmune, y su tratamiento con metimazol corrigió el trastorno totalmente. Se discuten los mecanismos fisiopatológicos involucrados y las implicancias clínicas desde el punto de vista del internista.Thyrotoxicosis may present with a variety of cardiovascular symptoms. Sinus tachycardia is the most frequently encountered electrocardiographic abnormality and conduction disturbances are extremely uncommon. We present a case of first degree atrio-ventricular block in a patient with newly diagnosed hyperthyroidism and discuss the underlying pathophysiological mechanisms and the clinical implications from the internist’s standpoint.
International Nuclear Information System (INIS)
Samsing, Johan; MacLeod, Morgan; Ramirez-Ruiz, Enrico
2014-01-01
The inspiral and merger of eccentric binaries leads to gravitational waveforms distinct from those generated by circularly merging binaries. Dynamical environments can assemble binaries with high eccentricity and peak frequencies within the LIGO band. In this paper, we study binary-single stellar scatterings occurring in dense stellar systems as a source of eccentrically inspiraling binaries. Many interactions between compact binaries and single objects are characterized by chaotic resonances in which the binary-single system undergoes many exchanges before reaching a final state. During these chaotic resonances, a pair of objects has a non-negligible probability of experiencing a very close passage. Significant orbital energy and angular momentum are carried away from the system by gravitational wave (GW) radiation in these close passages, and in some cases this implies an inspiral time shorter than the orbital period of the bound third body. We derive the cross section for such dynamical inspiral outcomes through analytical arguments and through numerical scattering experiments including GW losses. We show that the cross section for dynamical inspirals grows with increasing target binary semi-major axis a and that for equal-mass binaries it scales as a 2/7 . Thus, we expect wide target binaries to predominantly contribute to the production of these relativistic outcomes. We estimate that eccentric inspirals account for approximately 1% of dynamically assembled non-eccentric merging binaries. While these events are rare, we show that binary-single scatterings are a more effective formation channel than single-single captures for the production of eccentrically inspiraling binaries, even given modest binary fractions.
Tcheng, Ping
1989-01-01
Binary resistors in series tailored to precise value of resistance. Desired value of resistance obtained by cutting appropriate traces across resistors. Multibit, binary-based, adjustable resistor with high resolution used in many applications where precise resistance required.
Some properties of spectral binary stars
International Nuclear Information System (INIS)
Krajcheva, Z.T.; Popova, E.I.; Tutukov, A.V.; Yungel'son, L.R.; AN SSSR, Moscow. Astronomicheskij Sovet)
1978-01-01
Statistical investigations of spectra binary stars are carried out. Binary systems consisting of main sequence stars are considered. For 826 binary stars masses of components, ratios of component masses, semiaxes of orbits and orbital angular momenta are calculated. The distributions of these parameters and their correlations are analyzed. The dependences of statistical properties of spectral binary stars on their origin and evolution are discussed
Microlensing Binaries Discovered through High-magnification Channel
DEFF Research Database (Denmark)
Shin, I.-G.; Choi, J.-Y.; Park, S.-Y.
2012-01-01
Microlensing can provide a useful tool to probe binary distributions down to low-mass limits of binary companions. In this paper, we analyze the light curves of eight binary-lensing events detected through the channel of high-magnification events during the seasons from 2007 to 2010. The perturba......Microlensing can provide a useful tool to probe binary distributions down to low-mass limits of binary companions. In this paper, we analyze the light curves of eight binary-lensing events detected through the channel of high-magnification events during the seasons from 2007 to 2010...
Performance analysis and binary working fluid selection of combined flash-binary geothermal cycle
International Nuclear Information System (INIS)
Zeyghami, Mehdi
2015-01-01
Performance of the combined flash-binary geothermal power cycle for geofluid temperatures between 150 and 250 °C is studied. A thermodynamic model is developed, and the suitable binary working fluids for different geofluid temperatures are identified from a list of thirty working fluid candidates, consisting environmental friendly refrigerants and hydrocarbons. The overall system exergy destruction and Vapor Expansion Ratio across the binary cycle turbine are selected as key performance indicators. The results show that for low-temperature heat sources using refrigerants as binary working fluids result in higher overall cycle efficiency and for medium and high-temperature resources, hydrocarbons are more suitable. For combined flash-binary cycle, secondary working fluids; R-152a, Butane and Cis-butane show the best performances at geofluid temperatures 150, 200 and 250 °C respectively. The overall second law efficiency is calculated as high as 0.48, 0.55 and 0.58 for geofluid temperatures equal 150, 200 and 250 °C respectively. The flash separator pressure found to has important effects on cycle operation and performance. Separator pressure dictates the work production share of steam and binary parts of the system. And there is an optimal separator pressure at which overall exergy destruction of the cycle achieves its minimum value. - Highlights: • Performance of the combined flash-binary geothermal cycle is investigated. • Thirty different fluids are screened to find the most suitable ORC working fluid. • Optimum cycle operation conditions presented for geofluids between 150 °C and 250 °C. • Refrigerants are more suitable for the ORC at geothermal sources temperature ≤200 °C. • Hydrocarbons are more suitable for the ORC at geothermal sources temperature >200 °C
BINARY CEPHEIDS: SEPARATIONS AND MASS RATIOS IN 5 M {sub ☉} BINARIES
Energy Technology Data Exchange (ETDEWEB)
Evans, Nancy Remage; Karovska, Margarita; Tingle, Evan [Smithsonian Astrophysical Observatory, MS 4, 60 Garden Street, Cambridge, MA 02138 (United States); Bond, Howard E. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Schaefer, Gail H. [The CHARA Array, Georgia State University, P.O. Box 3965, Atlanta, GA 30302-3965 (United States); Mason, Brian D., E-mail: nevans@cfa.harvard.edu, E-mail: heb11@psu.edu, E-mail: schaefer@chara-array.org [US Naval Observatory, 3450 Massachusetts Avenue, NW, Washington, DC 20392-5420 (United States)
2013-10-01
Deriving the distribution of binary parameters for a particular class of stars over the full range of orbital separations usually requires the combination of results from many different observing techniques (radial velocities, interferometry, astrometry, photometry, direct imaging), each with selection biases. However, Cepheids—cool, evolved stars of ∼5 M {sub ☉}—are a special case because ultraviolet (UV) spectra will immediately reveal any companion star hotter than early type A, regardless of the orbital separation. We have used International Ultraviolet Explorer UV spectra of a complete sample of all 76 Cepheids brighter than V = 8 to create a list of all 18 Cepheids with companions more massive than 2.0 M {sub ☉}. Orbital periods of many of these binaries are available from radial-velocity studies, or can be estimated for longer-period systems from detected velocity variability. In an imaging survey with the Hubble Space Telescope Wide Field Camera 3, we resolved three of the companions (those of η Aql, S Nor, and V659 Cen), allowing us to make estimates of the periods out to the long-period end of the distribution. Combining these separations with orbital data in the literature, we derive an unbiased distribution of binary separations, orbital periods, and mass ratios. The distribution of orbital periods shows that the 5 M {sub ☉} binaries have systematically shorter periods than do 1 M {sub ☉} stars. Our data also suggest that the distribution of mass ratios depends on both binary separation and system multiplicity. The distribution of mass ratios as a function of orbital separation, however, does not depend on whether a system is a binary or a triple.
International Nuclear Information System (INIS)
Aboufirassi, M; Angelique, J.C.; Bizard, G.; Bougault, R.; Brou, R.; Buta, A.; Colin, J.; Cussol, D.; Durand, D.; Genoux-Lubain, A.; Horn, D.; Kerambrun, A.; Laville, J.L.; Le Brun, C.; Lecolley, J.F.; Lefebvres, F.; Lopez, O.; Louvel, M.; Meslin, C.; Metivier, V.; Nakagawa, T.; Peter, J.; Popescu, R.; Regimbart, R.; Steckmeyer, J.C.; Tamain, B.; Vient, E.; Wieloch, A.; Yuasa-Nakagawa, K.
1998-01-01
The binary character of the heavy ion collisions at intermediate energies in the exit channel has been observed under 30 MeV/n in medium and heavy systems. Measurements in light systems at energies approaching ∼ 100 MeV/nucleon as well as in very heavy systems have allowed to extend considerably the investigations of this binary process. Thus, the study of the Pb + Au system showed that the complete charge events indicated two distinct sources: the quasi-projectile and the quasi-target. The characteristics of these two sources are rather well reproduced by a trajectory computation which takes into account the Coulomb and nuclear forces and the friction appearing from the projectile-target interaction. The Wilczynski diagram is used to probe the correlation between the kinetic energy quenching and the deflecting angle. In case of the system Pb + Au at 29 MeV/nucleon the diagram indicate dissipative binary collisions typical for low energies. This binary aspect was also detected in the systems Xe + Ag at 44 MeV/nucleon, 36 Ar + 27 Al and 64 Zn + nat Ti. Thus, it was possible to reconstruct the quasi-projectile and to study its mass and excitation energy evolution as a function of the impact parameter. The dissipative binary collisions represent for the systems and energies under considerations the main contribution to the cross section. This does not implies that there are not other processes; particularly, the more or less complete fusion is also observed but with a low cross section which decreases with the increase of bombardment energy. More exclusive measurements with the INDRA detector on quasi-symmetric systems as Ar + KCl and Xe + Sn seem to confirm the importance of the binary collisions. The two source reconstruction of the Xe + Sn data at 50 MeV/nucleon reproduces the same behaviour as that observed in the system Pb + Au at 29 MeV/nucleon
Contact Binaries on Their Way Towards Merging
Gazeas, K.
2015-07-01
Contact binaries are the most frequently observed type of eclipsing star system. They are small, cool, low-mass binaries belonging to a relatively old stellar population. They follow certain empirical relationships that closely connect a number of physical parameters with each other, largely because of constraints coming from the Roche geometry. As a result, contact binaries provide an excellent test of stellar evolution, specifically for stellar merger scenarios. Observing campaigns by many authors have led to the cataloging of thousands of contact binaries and enabled statistical studies of many of their properties. A large number of contact binaries have been found to exhibit extraordinary behavior, requiring follow-up observations to study their peculiarities in detail. For example, a doubly-eclipsing quadruple system consisting of a contact binary and a detached binary is a highly constrained system offering an excellent laboratory to test evolutionary theories for binaries. A new observing project was initiated at the University of Athens in 2012 in order to investigate the possible lower limit for the orbital period of binary systems before coalescence, prior to merging.
Permutation Entropy for Random Binary Sequences
Directory of Open Access Journals (Sweden)
Lingfeng Liu
2015-12-01
Full Text Available In this paper, we generalize the permutation entropy (PE measure to binary sequences, which is based on Shannon’s entropy, and theoretically analyze this measure for random binary sequences. We deduce the theoretical value of PE for random binary sequences, which can be used to measure the randomness of binary sequences. We also reveal the relationship between this PE measure with other randomness measures, such as Shannon’s entropy and Lempel–Ziv complexity. The results show that PE is consistent with these two measures. Furthermore, we use PE as one of the randomness measures to evaluate the randomness of chaotic binary sequences.
Binary Systems and the Initial Mass Function
Malkov, O. Yu.
2017-07-01
In the present paper we discuss advantages and disadvantages of binary stars, which are important for star formation history determination. We show that to make definite conclusions of the initial mass function shape, it is necessary to study binary population well enough to correct the luminosity function for unresolved binaries; to construct the mass-luminosity relation based on wide binaries data, and to separate observational mass functions of primaries, of secondaries, and of unresolved binaries.
Accuracy of binary black hole waveform models for aligned-spin binaries
Kumar, Prayush; Chu, Tony; Fong, Heather; Pfeiffer, Harald P.; Boyle, Michael; Hemberger, Daniel A.; Kidder, Lawrence E.; Scheel, Mark A.; Szilagyi, Bela
2016-05-01
Coalescing binary black holes are among the primary science targets for second generation ground-based gravitational wave detectors. Reliable gravitational waveform models are central to detection of such systems and subsequent parameter estimation. This paper performs a comprehensive analysis of the accuracy of recent waveform models for binary black holes with aligned spins, utilizing a new set of 84 high-accuracy numerical relativity simulations. Our analysis covers comparable mass binaries (mass-ratio 1 ≤q ≤3 ), and samples independently both black hole spins up to a dimensionless spin magnitude of 0.9 for equal-mass binaries and 0.85 for unequal mass binaries. Furthermore, we focus on the high-mass regime (total mass ≳50 M⊙ ). The two most recent waveform models considered (PhenomD and SEOBNRv2) both perform very well for signal detection, losing less than 0.5% of the recoverable signal-to-noise ratio ρ , except that SEOBNRv2's efficiency drops slightly for both black hole spins aligned at large magnitude. For parameter estimation, modeling inaccuracies of the SEOBNRv2 model are found to be smaller than systematic uncertainties for moderately strong GW events up to roughly ρ ≲15 . PhenomD's modeling errors are found to be smaller than SEOBNRv2's, and are generally irrelevant for ρ ≲20 . Both models' accuracy deteriorates with increased mass ratio, and when at least one black hole spin is large and aligned. The SEOBNRv2 model shows a pronounced disagreement with the numerical relativity simulation in the merger phase, for unequal masses and simultaneously both black hole spins very large and aligned. Two older waveform models (PhenomC and SEOBNRv1) are found to be distinctly less accurate than the more recent PhenomD and SEOBNRv2 models. Finally, we quantify the bias expected from all four waveform models during parameter estimation for several recovered binary parameters: chirp mass, mass ratio, and effective spin.
Radial Velocities of 41 Kepler Eclipsing Binaries
Matson, Rachel A.; Gies, Douglas R.; Guo, Zhao; Williams, Stephen J.
2017-12-01
Eclipsing binaries are vital for directly determining stellar parameters without reliance on models or scaling relations. Spectroscopically derived parameters of detached and semi-detached binaries allow us to determine component masses that can inform theories of stellar and binary evolution. Here we present moderate resolution ground-based spectra of stars in close binary systems with and without (detected) tertiary companions observed by NASA’s Kepler mission and analyzed for eclipse timing variations. We obtain radial velocities and spectroscopic orbits for five single-lined and 35 double-lined systems, and confirm one false positive eclipsing binary. For the double-lined spectroscopic binaries, we also determine individual component masses and examine the mass ratio {M}2/{M}1 distribution, which is dominated by binaries with like-mass pairs and semi-detached classical Algol systems that have undergone mass transfer. Finally, we constrain the mass of the tertiary component for five double-lined binaries with previously detected companions.
Planets in Binary Star Systems
Haghighipour, Nader
2010-01-01
The discovery of extrasolar planets over the past decade has had major impacts on our understanding of the formation and dynamical evolution of planetary systems. There are features and characteristics unseen in our solar system and unexplainable by the current theories of planet formation and dynamics. Among these new surprises is the discovery of planets in binary and multiple-star systems. The discovery of such "binary-planetary" systems has confronted astrodynamicists with many new challenges, and has led them to re-examine the theories of planet formation and dynamics. Among these challenges are: How are planets formed in binary star systems? What would be the notion of habitability in such systems? Under what conditions can binary star systems have habitable planets? How will volatiles necessary for life appear on such planets? This volume seeks to gather the current research in the area of planets in binary and multistar systems and to familiarize readers with its associated theoretical and observation...
Theoretical studies of binaries in astrophysics
Dischler, Johann Sebastian
This thesis introduces and summarizes four papers dealing with computer simulations of astrophysical processes involving binaries. The first part gives the rational and theoretical background to these papers. In paper I and II a statistical approach to studying eclipsing binaries is described. By using population synthesis models for binaries the probabilities for eclipses are calculated for different luminosity classes of binaries. These are compared with Hipparcos data and they agree well if one uses a standard input distribution for the orbit sizes. If one uses a random pairing model, where both companions are independently picked from an IMF, one finds too feclipsing binaries by an order of magnitude. In paper III we investigate a possible scenario for the origin of the stars observed close to the centre of our galaxy, called S stars. We propose that a cluster falls radially cowards the central black hole. The binaries within the cluster can then, if they have small impact parameters, be broken up by the black hole's tidal held and one of the components of the binary will be captured by the black hole. Paper IV investigates how the onset of mass transfer in eccentric binaries depends on the eccentricity. To do this we have developed a new two-phase SPH scheme where very light particles are at tire outer edge of our simulated star. This enables us to get a much better resolution of the very small mass that is transferred in close binaries. Our simulations show that the minimum required distance between the stars to have mass transfer decreases with the eccentricity.
Mining frequent binary expressions
Calders, T.; Paredaens, J.; Kambayashi, Y.; Mohania, M.K.; Tjoa, A.M.
2000-01-01
In data mining, searching for frequent patterns is a common basic operation. It forms the basis of many interesting decision support processes. In this paper we present a new type of patterns, binary expressions. Based on the properties of a specified binary test, such as reflexivity, transitivity
Survival of planets around shrinking stellar binaries.
Muñoz, Diego J; Lai, Dong
2015-07-28
The discovery of transiting circumbinary planets by the Kepler mission suggests that planets can form efficiently around binary stars. None of the stellar binaries currently known to host planets has a period shorter than 7 d, despite the large number of eclipsing binaries found in the Kepler target list with periods shorter than a few days. These compact binaries are believed to have evolved from wider orbits into their current configurations via the so-called Lidov-Kozai migration mechanism, in which gravitational perturbations from a distant tertiary companion induce large-amplitude eccentricity oscillations in the binary, followed by orbital decay and circularization due to tidal dissipation in the stars. Here we explore the orbital evolution of planets around binaries undergoing orbital decay by this mechanism. We show that planets may survive and become misaligned from their host binary, or may develop erratic behavior in eccentricity, resulting in their consumption by the stars or ejection from the system as the binary decays. Our results suggest that circumbinary planets around compact binaries could still exist, and we offer predictions as to what their orbital configurations should be like.
Close-binary central stars of planetary nebulae
International Nuclear Information System (INIS)
Bond, H.E.; Grauer, A.D.
1987-01-01
Recent observations of PN central stars identified as binary systems are reviewed. The theoretical significance of binary central stars is discussed, and the characteristics of UU Sge, V 477 Lyr, MT Ser, LSS 2018, VW Pyx, and the central star of HFG 1 are briefly summarized. All of these binaries are shown to have periods less than 1 day, and it is estimated that about 10 percent of all binary central stars are close binaries. 27 references
Bondi-Hoyle-Lyttleton Accretion onto Binaries
Antoni, Andrea; MacLeod, Morgan; Ramírez-Ruiz, Enrico
2018-01-01
Binary stars are not rare. While only close binary stars will eventually interact with one another, even the widest binary systems interact with their gaseous surroundings. The rates of accretion and the gaseous drag forces arising in these interactions are the key to understanding how these systems evolve. This poster examines accretion flows around a binary system moving supersonically through a background gas. We perform three-dimensional hydrodynamic simulations of Bondi-Hoyle-Lyttleton accretion using the adaptive mesh refinement code FLASH. We simulate a range of values of semi-major axis of the orbit relative to the gravitational focusing impact parameter of the pair. On large scales, gas is gravitationally focused by the center-of-mass of the binary, leading to dynamical friction drag and to the accretion of mass and momentum. On smaller scales, the orbital motion imprints itself on the gas. Notably, the magnitude and direction of the forces acting on the binary inherit this orbital dependence. The long-term evolution of the binary is determined by the timescales for accretion, slow down of the center-of-mass, and decay of the orbit. We use our simulations to measure these timescales and to establish a hierarchy between them. In general, our simulations indicate that binaries moving through gaseous media will slow down before the orbit decays.
Formation and Evolution of X-ray Binaries
Shao, Y.
2017-07-01
X-ray binaries are a class of binary systems, in which the accretor is a compact star (i.e., black hole, neutron star, or white dwarf). They are one of the most important objects in the universe, which can be used to study not only binary evolution but also accretion disks and compact stars. Statistical investigations of these binaries help to understand the formation and evolution of galaxies, and sometimes provide useful constraints on the cosmological models. The goal of this thesis is to investigate the formation and evolution processes of X-ray binaries including Be/X-ray binaries, low-mass X-ray binaries (LMXBs), ultraluminous X-ray sources (ULXs), and cataclysmic variables. In Chapter 1 we give a brief review on the basic knowledge of the binary evolution. In Chapter 2 we discuss the formation of Be stars through binary interaction. In this chapter we investigate the formation of Be stars resulting from mass transfer in binaries in the Galaxy. Using binary evolution and population synthesis calculations, we find that in Be/neutron star binaries the Be stars have a lower limit of mass ˜ 8 M⊙ if they are formed by a stable (i.e., without the occurrence of common envelope evolution) and nonconservative mass transfer. We demonstrate that the isolated Be stars may originate from both mergers of two main-sequence stars and disrupted Be binaries during the supernova explosions of the primary stars, but mergers seem to play a much more important role. Finally the fraction of Be stars produced by binary interactions in all B type stars can be as high as ˜ 13%-30% , implying that most of Be stars may result from binary interaction. In Chapter 3 we show the evolution of intermediate- and low-mass X-ray binaries (I/LMXBs) and the formation of millisecond pulsars. Comparing the calculated results with the observations of binary radio pulsars, we report the following results: (1) The allowed parameter space for forming binary pulsars in the initial orbital period
Collett, David
2002-01-01
INTRODUCTION Some Examples The Scope of this Book Use of Statistical Software STATISTICAL INFERENCE FOR BINARY DATA The Binomial Distribution Inference about the Success Probability Comparison of Two Proportions Comparison of Two or More Proportions MODELS FOR BINARY AND BINOMIAL DATA Statistical Modelling Linear Models Methods of Estimation Fitting Linear Models to Binomial Data Models for Binomial Response Data The Linear Logistic Model Fitting the Linear Logistic Model to Binomial Data Goodness of Fit of a Linear Logistic Model Comparing Linear Logistic Models Linear Trend in Proportions Comparing Stimulus-Response Relationships Non-Convergence and Overfitting Some other Goodness of Fit Statistics Strategy for Model Selection Predicting a Binary Response Probability BIOASSAY AND SOME OTHER APPLICATIONS The Tolerance Distribution Estimating an Effective Dose Relative Potency Natural Response Non-Linear Logistic Regression Models Applications of the Complementary Log-Log Model MODEL CHECKING Definition of Re...
Formation and evolution of compact binaries
Sluijs, Marcel Vincent van der
2006-01-01
In this thesis we investigate the formation and evolution of compact binaries. Chapters 2 through 4 deal with the formation of luminous, ultra-compact X-ray binaries in globular clusters. We show that the proposed scenario of magnetic capture produces too few ultra-compact X-ray binaries to explain
Reiter, Megan
2017-08-01
Fewer wide-separation binaries are found in dense stellar clusters than in looser stellar associations. It is therefore unclear whether feedback in clusters prevents the formation of multiple systems or dynamical interactions destroy them. Measuring the prevalence of close, bound binary systems provide a key test to distinguish between these possibilities. Systems with separations of 10-50 AU will survive interactions in the cluster environment, and therefore are more representative of the natal population of multiple systems. By fitting a double-star PSF, we will identify visual binaries in the Orion Nebula with separations as small as 0.03. At the distance of Orion, this corresponds to a physical separation of 12 AU, effectively closing the observational gap in the binary separation distribution left between known visual and spectroscopic binaries (>65 AU or PhD thesis.
Origin of very-short orbital-period binary systems
International Nuclear Information System (INIS)
Miyaji, S.
1983-01-01
Recent observations of four close binaries have established that there is a group of very-short orbital-period (VSOP) binaries whose orbital periods are less than 60 minutes. The VSOP binaries consist of both X-ray close binaries and cataclysmic variables. Their orbital periods are too short to have a main-sequence companion. However, four binaries, none of which belongs to any globular cluster, are too abundant to be explained by the capturing mechanism of a white dwarf. Therefore it seemed to be worthwhile to present an evolutionary scenario from an original binary system which can be applied for all VSOP binaries. (Auth.)
Evans, Nancy R.; Bond, H. E.; Schaefer, G.; Mason, B. D.; Karovska, M.; Tingle, E.
2013-01-01
Cepheids (5 Msun stars) provide an excellent sample for determining the binary properties of fairly massive stars. International Ultraviolet Explorer (IUE) observations of Cepheids brighter than 8th magnitude resulted in a list of ALL companions more massive than 2.0 Msun uniformly sensitive to all separations. Hubble Space Telescope Wide Field Camera 3 (WFC3) has resolved three of these binaries (Eta Aql, S Nor, and V659 Cen). Combining these separations with orbital data in the literature, we derive an unbiased distribution of binary separations for a sample of 18 Cepheids, and also a distribution of mass ratios. The distribution of orbital periods shows that the 5 Msun binaries prefer shorter periods than 1 Msun stars, reflecting differences in star formation processes.
Astronomy of binary and multiple stars
International Nuclear Information System (INIS)
Tokovinin, A.A.
1984-01-01
Various types of binary stars and methods for their observation are described in a popular form. Some models of formation and evolution of binary and multiple star systems are presented. It is concluded that formation of binary and multiple stars is a regular stage in the process of star production
A ROSAT Survey of Contact Binary Stars
Geske, M. T.; Gettel, S. J.; McKay, T. A.
2006-01-01
Contact binary stars are common variable stars that are all believed to emit relatively large fluxes of X-rays. In this work we combine a large new sample of contact binary stars derived from the ROTSE-I telescope with X-ray data from the ROSAT All Sky Survey (RASS) to estimate the X-ray volume emissivity of contact binary stars in the Galaxy. We obtained X-ray fluxes for 140 contact binaries from the RASS, as well as two additional stars observed by the XMM-Newton observatory. From these data we confirm the emission of X-rays from all contact binary systems, with typical luminosities of approximately 1.0×1030 ergs s-1. Combining calculated luminosities with an estimated contact binary space density, we find that contact binaries do not have strong enough X-ray emission to account for a significant portion of the Galactic X-ray background.
GALAXY ROTATION AND RAPID SUPERMASSIVE BINARY COALESCENCE
Energy Technology Data Exchange (ETDEWEB)
Holley-Bockelmann, Kelly [Vanderbilt University, Nashville, TN (United States); Khan, Fazeel Mahmood, E-mail: k.holley@vanderbilt.edu [Institute of Space Technology (IST), Islamabad (Pakistan)
2015-09-10
Galaxy mergers usher the supermassive black hole (SMBH) in each galaxy to the center of the potential, where they form an SMBH binary. The binary orbit shrinks by ejecting stars via three-body scattering, but ample work has shown that in spherical galaxy models, the binary separation stalls after ejecting all the stars in its loss cone—this is the well-known final parsec problem. However, it has been shown that SMBH binaries in non-spherical galactic nuclei harden at a nearly constant rate until reaching the gravitational wave regime. Here we use a suite of direct N-body simulations to follow SMBH binary evolution in both corotating and counterrotating flattened galaxy models. For N > 500 K, we find that the evolution of the SMBH binary is convergent and is independent of the particle number. Rotation in general increases the hardening rate of SMBH binaries even more effectively than galaxy geometry alone. SMBH binary hardening rates are similar for co- and counterrotating galaxies. In the corotating case, the center of mass of the SMBH binary settles into an orbit that is in corotation resonance with the background rotating model, and the coalescence time is roughly a few 100 Myr faster than a non-rotating flattened model. We find that counterrotation drives SMBHs to coalesce on a nearly radial orbit promptly after forming a hard binary. We discuss the implications for gravitational wave astronomy, hypervelocity star production, and the effect on the structure of the host galaxy.
GALAXY ROTATION AND RAPID SUPERMASSIVE BINARY COALESCENCE
International Nuclear Information System (INIS)
Holley-Bockelmann, Kelly; Khan, Fazeel Mahmood
2015-01-01
Galaxy mergers usher the supermassive black hole (SMBH) in each galaxy to the center of the potential, where they form an SMBH binary. The binary orbit shrinks by ejecting stars via three-body scattering, but ample work has shown that in spherical galaxy models, the binary separation stalls after ejecting all the stars in its loss cone—this is the well-known final parsec problem. However, it has been shown that SMBH binaries in non-spherical galactic nuclei harden at a nearly constant rate until reaching the gravitational wave regime. Here we use a suite of direct N-body simulations to follow SMBH binary evolution in both corotating and counterrotating flattened galaxy models. For N > 500 K, we find that the evolution of the SMBH binary is convergent and is independent of the particle number. Rotation in general increases the hardening rate of SMBH binaries even more effectively than galaxy geometry alone. SMBH binary hardening rates are similar for co- and counterrotating galaxies. In the corotating case, the center of mass of the SMBH binary settles into an orbit that is in corotation resonance with the background rotating model, and the coalescence time is roughly a few 100 Myr faster than a non-rotating flattened model. We find that counterrotation drives SMBHs to coalesce on a nearly radial orbit promptly after forming a hard binary. We discuss the implications for gravitational wave astronomy, hypervelocity star production, and the effect on the structure of the host galaxy
Hidden slow pulsars in binaries
Tavani, Marco; Brookshaw, Leigh
1993-01-01
The recent discovery of the binary containing the slow pulsar PSR 1718-19 orbiting around a low-mass companion star adds new light on the characteristics of binary pulsars. The properties of the radio eclipses of PSR 1718-19 are the most striking observational characteristics of this system. The surface of the companion star produces a mass outflow which leaves only a small 'window' in orbital phase for the detection of PSR 1718-19 around 400 MHz. At this observing frequency, PSR 1718-19 is clearly observable only for about 1 hr out of the total 6.2 hr orbital period. The aim of this Letter is twofold: (1) to model the hydrodynamical behavior of the eclipsing material from the companion star of PSR 1718-19 and (2) to argue that a population of binary slow pulsars might have escaped detection in pulsar surveys carried out at 400 MHz. The possible existence of a population of partially or totally hidden slow pulsars in binaries will have a strong impact on current theories of binary evolution of neutron stars.
Pablos Martin, X; Deltenre, P; Hoonhorst, I; Markessis, E; Rossion, B; Colin, C
2007-12-01
Rhythm perception appears to be non-linear as human subjects are better at discriminating, categorizing and reproducing rhythms containing binary vs non-binary (e.a. 1:2 vs 1:3) as well as metrical vs non-metrical (e.a. 1:2 vs 1:2.5) interval ratios. This study examined the representation of binary and non-binary interval ratios within the sensory memory, thus yielding a truly sensory, pre-motor, attention-independent neural representation of rhythmical intervals. Five interval ratios, one binary, flanked by four non-binary ones, were compared on the basis of the MMN they evoked when contrasted against a common standard interval. For all five intervals, the larger the contrast was, the larger the MMN amplitude was. The binary interval evoked a significantly much shorter (by at least 23 ms) MMN latency than the other intervals, whereas no latency difference was observed between the four non-binary intervals. These results show that the privileged perceptual status of binary rhythmical intervals is already present in the sensory representations found in echoic memory at an early, automatic, pre-perceptual and pre-motor level. MMN latency can be used to study rhythm perception at a truly sensory level, without any contribution from the motor system.
International Nuclear Information System (INIS)
Prodan, Snezana; Antonini, Fabio; Perets, Hagai B.
2015-01-01
Here we discuss the evolution of binaries around massive black holes (MBHs) in nuclear stellar clusters. We focus on their secular evolution due to the perturbation by the MBHs, while simplistically accounting for their collisional evolution. Binaries with highly inclined orbits with respect to their orbits around MBHs are strongly affected by secular processes, which periodically change their eccentricities and inclinations (e.g., Kozai-Lidov cycles). During periapsis approach, dissipative processes such as tidal friction may become highly efficient, and may lead to shrinkage of a binary orbit and even to its merger. Binaries in this environment can therefore significantly change their orbital evolution due to the MBH third-body perturbative effects. Such orbital evolution may impinge on their later stellar evolution. Here we follow the secular dynamics of such binaries and its coupling to tidal evolution, as well as the stellar evolution of such binaries on longer timescales. We find that stellar binaries in the central parts of nuclear stellar clusters (NSCs) are highly likely to evolve into eccentric and/or short-period binaries, and become strongly interacting binaries either on the main sequence (at which point they may even merge), or through their later binary stellar evolution. The central parts of NSCs therefore catalyze the formation and evolution of strongly interacting binaries, and lead to the enhanced formation of blue stragglers, X-ray binaries, gravitational wave sources, and possible supernova progenitors. Induced mergers/collisions may also lead to the formation of G2-like cloud-like objects such as the one recently observed in the Galactic center
Nelemans, G.
2013-01-01
I review what eLISA will see from Galactic binaries -- double stars with orbital periods less than a few hours and white dwarf (or neutron star/black hole) components. I discuss the currently known binaries that are guaranteed (or verification) sources and explain why the expected total number of eLISA Galactic binaries is several thousand, even though there are large uncertainties in our knowledge of this population, in particular that of the interacting AM CVn systems. I very briefly sketch...
The origin of the RS CVn binaries
International Nuclear Information System (INIS)
Biermann, P.
1976-01-01
Six possible origins for the RS CVn binaries are considered based on the following possibilities. RS CVn binaries might now be either pre-main-sequence or post-main-sequence. A pre-main-sequence binary might not always have been a binary but might have resulted from fission of a rapidly rotating single pre-main-sequence star. The main-sequence counterparts might be either single stars or binaries. To decide which of the six origins is possible, the following observed data for the RS CVn binaries are considered: total mass, total angular momentum, lack of observed connection with regions of star formation, large space density, kinematical age, and the visual companion of WW Dra. In addition lifetimes and space densities of single stars and other types of binaries are considered. The only origin possible is that the RS CVn binaries are in a thermal phase following fission of a main-sequence single star. In this explanation the single star had a rapidly rotating core which became unstable due to the core contraction which made it begin to evolve off the main sequence. The present Be stars might be examples of such parent single stars. (Auth.)
International Nuclear Information System (INIS)
Tutukov, A.V.; Fedorova, A.V.; Yungel'son, L.R.
1982-01-01
The conditions of mass exchange in close binary systems with masses of components less or equal to one solar mass have been analysed for the case, when the system radiates gravitational waves. It has been shown that the mass exchange rate depends in a certain way on the mass ratio of components and on the mass of component that fills its inner critical lobe. The comparison of observed periods, masses of contact components, and mass exchange rates of observed cataclysmic binaries have led to the conclusion that the evolution of close binaries WZ Sge, OY Car, Z Cha, TT Ari, 2A 0311-227, and G 61-29 may be driven by the emission of gravitational waves [ru
Massive binaries in the vicinity of Sgr A*
Energy Technology Data Exchange (ETDEWEB)
Pfuhl, O.; Gillessen, S.; Genzel, R.; Eisenhauer, F.; Fritz, T. K.; Ott, T. [Max-Planck-Institut für Extraterrestrische Physik, D-85748 Garching (Germany); Alexander, T. [Faculty of Physics, Weizmann Institute of Science, P.O. Box 26, Rehovot 76100 (Israel); Martins, F., E-mail: pfuhl@mpe.mpg.de [LUPM, Université Montpelier 2, CNRS, Place Eugéne Bataillon, F-34095, Montpellier (France)
2014-02-20
A long-term spectroscopic and photometric survey of the most luminous and massive stars in the vicinity of the supermassive black hole Sgr A* revealed two new binaries: a long-period Ofpe/WN9 binary, IRS 16NE, with a modest eccentricity of 0.3 and a period of 224 days, and an eclipsing Wolf-Rayet binary with a period of 2.3 days. Together with the already identified binary IRS 16SW, there are now three confirmed OB/WR binaries in the inner 0.2 pc of the Galactic center. Using radial velocity change upper limits, we were able to constrain the spectroscopic binary fraction in the Galactic center to F{sub SB}=0.30{sub −0.21}{sup +0.34} at a confidence level of 95%, a massive binary fraction close to that observed in dense clusters. The fraction of eclipsing binaries with photometric amplitudes Δm > 0.4 is F{sub EB}{sup GC}=3%±2%, which is consistent with local OB star clusters (F {sub EB} = 1%). Overall, the Galactic center binary fraction seems to be similar to the binary fraction in comparable young clusters.
EVOLUTION OF THE BINARY FRACTION IN DENSE STELLAR SYSTEMS
International Nuclear Information System (INIS)
Fregeau, John M.; Ivanova, Natalia; Rasio, Frederic A.
2009-01-01
Using our recently improved Monte Carlo evolution code, we study the evolution of the binary fraction in globular clusters. In agreement with previous N-body simulations, we find generally that the hard binary fraction in the core tends to increase with time over a range of initial cluster central densities for initial binary fractions ∼<90%. The dominant processes driving the evolution of the core binary fraction are mass segregation of binaries into the cluster core and preferential destruction of binaries there. On a global scale, these effects and the preferential tidal stripping of single stars tend to roughly balance, leading to overall cluster binary fractions that are roughly constant with time. Our findings suggest that the current hard binary fraction near the half-mass radius is a good indicator of the hard primordial binary fraction. However, the relationship between the true binary fraction and the fraction of main-sequence stars in binaries (which is typically what observers measure) is nonlinear and rather complicated. We also consider the importance of soft binaries, which not only modify the evolution of the binary fraction, but can also drastically change the evolution of the cluster as a whole. Finally, we briefly describe the recent addition of single and binary stellar evolution to our cluster evolution code.
Activity coefficients of solutes in binary solvents
International Nuclear Information System (INIS)
Gokcen, N.A.
1982-01-01
The activity coefficients in dilute ternary systems are discussed in detail by using the Margules equations. Analyses of some relevant data at high temperatures show that the sparingly dissolved solutes in binary solvents follow complex behavior even when the binary solvents are very nearly ideal. It is shown that the activity data on the solute or the binary system cannot permit computation of the remaining activities except for the regular solutions. It is also shown that a fourth-order equation is usually adequate in expressing the activity coefficient of a solute in binary solvents at high temperatures. When the activity data for a binary solvent are difficult to obtain in a certain range of composition, the activity data for a sparingly dissolved solute can be used to supplement determination of the binary activities
All-optical conversion scheme: Binary to quaternary and quaternary to binary number
Chattopadhyay, Tanay; Roy, Jitendra Nath
2009-04-01
To achieve the inherent parallelism in optics a suitable number system and efficient encoding/decoding scheme for handling the data are very much essential. Binary number is accepted as the best representing number system in almost all types of existing electronic computers. But, binary number (0 and 1) is insufficient in respect to the demand of the coming generation. Multi-valued logic (with radix >2) can be viewed as an alternative approach to solve many problems in transmission, storage and processing of large amount of information in digital signal processing. Here, in this paper all-optical scheme for the conversion of binary to quaternary number and vice versa have been proposed and described. Simulation has also been done. In this all-optical scheme the numbers are represented by different discrete polarized state of light.
COSMIC probes into compact binary formation and evolution
Breivik, Katelyn
2018-01-01
The population of compact binaries in the galaxy represents the final state of all binaries that have lived up to the present epoch. Compact binaries present a unique opportunity to probe binary evolution since many of the interactions binaries experience can be imprinted on the compact binary population. By combining binary evolution simulations with catalogs of observable compact binary systems, we can distill the dominant physical processes that govern binary star evolution, as well as predict the abundance and variety of their end products.The next decades herald a previously unseen opportunity to study compact binaries. Multi-messenger observations from telescopes across all wavelengths and gravitational-wave observatories spanning several decades of frequency will give an unprecedented view into the structure of these systems and the composition of their components. Observations will not always be coincident and in some cases may be separated by several years, providing an avenue for simulations to better constrain binary evolution models in preparation for future observations.I will present the results of three population synthesis studies of compact binary populations carried out with the Compact Object Synthesis and Monte Carlo Investigation Code (COSMIC). I will first show how binary-black-hole formation channels can be understood with LISA observations. I will then show how the population of double white dwarfs observed with LISA and Gaia could provide a detailed view of mass transfer and accretion. Finally, I will show that Gaia could discover thousands black holes in the Milky Way through astrometric observations, yielding view into black-hole astrophysics that is complementary to and independent from both X-ray and gravitational-wave astronomy.
Almog, Assaf; Garlaschelli, Diego
2014-09-01
The dynamics of complex systems, from financial markets to the brain, can be monitored in terms of multiple time series of activity of the constituent units, such as stocks or neurons, respectively. While the main focus of time series analysis is on the magnitude of temporal increments, a significant piece of information is encoded into the binary projection (i.e. the sign) of such increments. In this paper we provide further evidence of this by showing strong nonlinear relations between binary and non-binary properties of financial time series. These relations are a novel quantification of the fact that extreme price increments occur more often when most stocks move in the same direction. We then introduce an information-theoretic approach to the analysis of the binary signature of single and multiple time series. Through the definition of maximum-entropy ensembles of binary matrices and their mapping to spin models in statistical physics, we quantify the information encoded into the simplest binary properties of real time series and identify the most informative property given a set of measurements. Our formalism is able to accurately replicate, and mathematically characterize, the observed binary/non-binary relations. We also obtain a phase diagram allowing us to identify, based only on the instantaneous aggregate return of a set of multiple time series, a regime where the so-called ‘market mode’ has an optimal interpretation in terms of collective (endogenous) effects, a regime where it is parsimoniously explained by pure noise, and a regime where it can be regarded as a combination of endogenous and exogenous factors. Our approach allows us to connect spin models, simple stochastic processes, and ensembles of time series inferred from partial information.
International Nuclear Information System (INIS)
Almog, Assaf; Garlaschelli, Diego
2014-01-01
The dynamics of complex systems, from financial markets to the brain, can be monitored in terms of multiple time series of activity of the constituent units, such as stocks or neurons, respectively. While the main focus of time series analysis is on the magnitude of temporal increments, a significant piece of information is encoded into the binary projection (i.e. the sign) of such increments. In this paper we provide further evidence of this by showing strong nonlinear relations between binary and non-binary properties of financial time series. These relations are a novel quantification of the fact that extreme price increments occur more often when most stocks move in the same direction. We then introduce an information-theoretic approach to the analysis of the binary signature of single and multiple time series. Through the definition of maximum-entropy ensembles of binary matrices and their mapping to spin models in statistical physics, we quantify the information encoded into the simplest binary properties of real time series and identify the most informative property given a set of measurements. Our formalism is able to accurately replicate, and mathematically characterize, the observed binary/non-binary relations. We also obtain a phase diagram allowing us to identify, based only on the instantaneous aggregate return of a set of multiple time series, a regime where the so-called ‘market mode’ has an optimal interpretation in terms of collective (endogenous) effects, a regime where it is parsimoniously explained by pure noise, and a regime where it can be regarded as a combination of endogenous and exogenous factors. Our approach allows us to connect spin models, simple stochastic processes, and ensembles of time series inferred from partial information. (paper)
PERIODIC SIGNALS IN BINARY MICROLENSING EVENTS
International Nuclear Information System (INIS)
Guo, Xinyi; Stefano, Rosanne Di; Esin, Ann; Taylor, Jeffrey
2015-01-01
Gravitational microlensing events are powerful tools for the study of stellar populations. In particular, they can be used to discover and study a variety of binary systems. A large number of binary lenses have already been found through microlensing surveys and a few of these systems show strong evidence of orbital motion on the timescale of the lensing event. We expect that more binary lenses of this kind will be detected in the future. For binaries whose orbital period is comparable to the event duration, the orbital motion can cause the lensing signal to deviate drastically from that of a static binary lens. The most striking property of such light curves is the presence of quasi-periodic features, which are produced as the source traverses the same regions in the rotating lens plane. These repeating features contain information about the orbital period of the lens. If this period can be extracted, then much can be learned about the lensing system even without performing time-consuming, detailed light-curve modeling. However, the relative transverse motion between the source and the lens significantly complicates the problem of period extraction. To resolve this difficulty, we present a modification of the standard Lomb–Scargle periodogram analysis. We test our method for four representative binary lens systems and demonstrate its efficiency in correctly extracting binary orbital periods
Improving geothermal power plants with a binary cycle
Tomarov, G. V.; Shipkov, A. A.; Sorokina, E. V.
2015-12-01
The recent development of binary geothermal technology is analyzed. General trends in the introduction of low-temperature geothermal sources are summarized. The use of single-phase low-temperature geothermal fluids in binary power plants proves possible and expedient. The benefits of power plants with a binary cycle in comparison with traditional systems are shown. The selection of the working fluid is considered, and the influence of the fluid's physicochemical properties on the design of the binary power plant is discussed. The design of binary power plants is based on the chemical composition and energy potential of the geothermal fluids and on the landscape and climatic conditions at the intended location. Experience in developing a prototype 2.5 MW Russian binary power unit at Pauzhetka geothermal power plant (Kamchatka) is outlined. Most binary systems are designed individually for a specific location. Means of improving the technology and equipment at binary geothermal power plants are identified. One option is the development of modular systems based on several binary systems that employ the heat from the working fluid at different temperatures.
Topological and categorical properties of binary trees
Directory of Open Access Journals (Sweden)
H. Pajoohesh
2008-04-01
Full Text Available Binary trees are very useful tools in computer science for estimating the running time of so-called comparison based algorithms, algorithms in which every action is ultimately based on a prior comparison between two elements. For two given algorithms A and B where the decision tree of A is more balanced than that of B, it is known that the average and worst case times of A will be better than those of B, i.e., ₸A(n ≤₸B(n and TWA (n≤TWB (n. Thus the most balanced and the most imbalanced binary trees play a main role. Here we consider them as semilattices and characterize the most balanced and the most imbalanced binary trees by topological and categorical properties. Also we define the composition of binary trees as a commutative binary operation, *, such that for binary trees A and B, A * B is the binary tree obtained by attaching a copy of B to any leaf of A. We show that (T,* is a commutative po-monoid and investigate its properties.
Optimally cloned binary coherent states
Müller, C. R.; Leuchs, G.; Marquardt, Ch.; Andersen, U. L.
2017-10-01
Binary coherent state alphabets can be represented in a two-dimensional Hilbert space. We capitalize this formal connection between the otherwise distinct domains of qubits and continuous variable states to map binary phase-shift keyed coherent states onto the Bloch sphere and to derive their quantum-optimal clones. We analyze the Wigner function and the cumulants of the clones, and we conclude that optimal cloning of binary coherent states requires a nonlinearity above second order. We propose several practical and near-optimal cloning schemes and compare their cloning fidelity to the optimal cloner.
Binaries and triples among asteroid pairs
Pravec, Petr; Scheirich, Peter; Kušnirák, Peter; Hornoch, Kamil; Galád, Adrián
2015-08-01
Despite major achievements obtained during the past two decades, our knowledge of the population and properties of small binary and multiple asteroid systems is still far from advanced. There is a numerous indirect evidence for that most small asteroid systems were formed by rotational fission of cohesionless parent asteroids that were spun up to the critical frequency presumably by YORP, but details of the process are lacking. Furthermore, as we proceed with observations of more and more binary and paired asteroids, we reveal new facts that substantially refine and sometimes change our understanding of the asteroid systems. One significant new finding we have recently obtained is that primaries of many asteroid pairs are actually binary or triple systems. The first such case found is (3749) Balam (Vokrouhlický, ApJL 706, L37, 2009). We have found 9 more binary systems among asteroid pairs within our ongoing NEOSource photometric project since October 2012. They are (6369) 1983 UC, (8306) Shoko, (9783) Tensho-kan, (10123) Fideoja, (21436) Chaoyichi, (43008) 1999 UD31, (44620) 1999 RS43, (46829) 1998 OS14 and (80218) 1999 VO123. We will review their characteristics. These paired binaries as we call them are mostly similar to binaries in the general ("background") population (of unpaired asteroids), but there are a few trends. The paired binaries tend to have larger secondaries with D_2/D_1 = 0.3 to 0.5 and they also tend to be wider systems with 8 of the 10 having orbital periods between 30 and 81 hours, than average among binaries in the general population. There may be also a larger fraction of triples; (3749) Balam is a confirmed triple, having a larger close and a smaller distant satellite, and (8306) Shoko and (10123) Fideoja are suspect triples as they show additional rotational lightcurve components with periods of 61 and 38.8 h that differ from the orbital period of 36.2 and 56.5 h, respectively. The unbound secondaries tend to be of the same size or
Detecting Malicious Code by Binary File Checking
Directory of Open Access Journals (Sweden)
Marius POPA
2014-01-01
Full Text Available The object, library and executable code is stored in binary files. Functionality of a binary file is altered when its content or program source code is changed, causing undesired effects. A direct content change is possible when the intruder knows the structural information of the binary file. The paper describes the structural properties of the binary object files, how the content can be controlled by a possible intruder and what the ways to identify malicious code in such kind of files. Because the object files are inputs in linking processes, early detection of the malicious content is crucial to avoid infection of the binary executable files.
Mass Transfer in Mira-Type Binaries
Directory of Open Access Journals (Sweden)
Mohamed S.
2012-06-01
Full Text Available Detached, symbiotic binaries are generally assumed to interact via Bondi-Hoyle-Littleton (BHL wind accretion. However, the accretion rates and outflow geometries that result from this mass-transfer mechanism cannot adequately explain the observations of the nearest and best studied symbiotic binary, Mira, or the formation of some post-AGB binaries, e.g. barium stars. We propose a new mass-transfer mode for Mira-type binaries, which we call ‘wind Roche-lobe overflow’ (WRLOF, and which we demonstrate with 3D hydrodynamic simulations. Importantly, we show that the circumstellar outflows which result from WRLOF tend to be highly aspherical and strongly focused towards the binary orbital plane. Furthermore, the subsequent mass-transfer rates are at least an order of magnitude greater than the analogous BHL values. We discuss the implications of these results for the shaping of bipolar (proto-planetary nebulae and other related systems.
RADIAL VELOCITY STUDIES OF CLOSE BINARY STARS. XIV
International Nuclear Information System (INIS)
Pribulla, Theodor; Rucinski, Slavek M.; DeBond, Heide; De Ridder, Archie; Karmo, Toomas; Thomson, J. R.; Croll, Bryce; Ogloza, Waldemar; Pilecki, Bogumil; Siwak, Michal
2009-01-01
Radial velocity (RV) measurements and sine curve fits to the orbital RV variations are presented for 10 close binary systems: TZ Boo, VW Boo, EL Boo, VZ CVn, GK Cep, RW Com, V2610 Oph, V1387 Ori, AU Ser, and FT UMa. Our spectroscopy revealed two quadruple systems, TZ Boo and V2610 Oph, while three stars showing small photometric amplitudes, EL Boo, V1387 Ori, and FT UMa, were found to be triple systems. GK Cep is a close binary with a faint third component. While most of the studied eclipsing systems are contact binaries, VZ CVn and GK Cep are detached or semidetached double-lined binaries, and EL Boo, V1387 Ori, and FT UMa are close binaries of uncertain binary type. The large fraction of triple and quadruple systems found in this sample supports the hypothesis of formation of close binaries in multiple stellar systems; it also demonstrates that low photometric amplitude binaries are a fertile ground for further discoveries of multiple systems.
Microlensing Signature of Binary Black Holes
Schnittman, Jeremy; Sahu, Kailash; Littenberg, Tyson
2012-01-01
We calculate the light curves of galactic bulge stars magnified via microlensing by stellar-mass binary black holes along the line-of-sight. We show the sensitivity to measuring various lens parameters for a range of survey cadences and photometric precision. Using public data from the OGLE collaboration, we identify two candidates for massive binary systems, and discuss implications for theories of star formation and binary evolution.
Directory of Open Access Journals (Sweden)
Franco J Vallejo
2007-12-01
Full Text Available Paciente masculino de 22 años quien ingresa por episodio de síncope. En el electrocardiograma se encuentra patrón de Wolff-Parkinson-White y signos de sobrecarga auricular e hipertrofia ventricular izquierda con bloqueo aurículo-ventricular completo. El ecocardiograma transtorácico es compatible con cardiomiopatía hipertrófica no obstructiva. Se lleva a estudio electrofisiológico donde se encuentra pre-excitación por vía accesoria y bloqueo aurículo-ventricular infrahisiano; se realiza ablación y se implanta marcapasos bicameral.A 22 years old male patient is admitted for a syncope episode. An electrocardiogram shows a Wolff-Parkinson-White pattern and signs of auricular overload with left ventricular hypertrophy and complete auriculoventricular block. The transthoracic echocardiogram is compatible with non-obstructive hypertrophic cardiomyopathy. An electrophysiological study is carried out, finding pre-excitation through an accessory way and infra-His auriculoventricular block. An ablation is performed and a bicameral pacemaker is implanted.
Formation and Evolution of X-ray Binaries
Fragkos, Anastasios
X-ray binaries - mass-transferring binary stellar systems with compact object accretors - are unique astrophysical laboratories. They carry information about many complex physical processes such as star formation, compact object formation, and evolution of interacting binaries. My thesis work involves the study of the formation and evolution of Galactic and extra-galacticX-ray binaries using both detailed and realistic simulation tools, and population synthesis techniques. I applied an innovative analysis method that allows the reconstruction of the full evolutionary history of known black hole X-ray binaries back to the time of compact object formation. This analysis takes into account all the available observationally determined properties of a system, and models in detail four of its evolutionary evolutionary phases: mass transfer through the ongoing X-ray phase, tidal evolution before the onset of Roche-lobe overflow, motion through the Galactic potential after the formation of the black hole, and binary orbital dynamics at the time of core collapse. Motivated by deep extra-galactic Chandra survey observations, I worked on population synthesis models of low-mass X-ray binaries in the two elliptical galaxies NGC3379 and NGC4278. These simulations were targeted at understanding the origin of the shape and normalization of the observed X-ray luminosity functions. In a follow up study, I proposed a physically motivated prescription for the modeling of transient neutron star low-mass X-ray binary properties, such as duty cycle, outburst duration and recurrence time. This prescription enabled the direct comparison of transient low-mass X-ray binary population synthesis models to the Chandra X-ray survey of the two ellipticals NGC3379 and NGC4278. Finally, I worked on population synthesismodels of black holeX-ray binaries in the MilkyWay. This work was motivated by recent developments in observational techniques for the measurement of black hole spin magnitudes in
Directory of Open Access Journals (Sweden)
Béatrice Quenault
2009-01-01
Full Text Available Dans cet essai, au titre provocateur « Le climat otage de la finance ou comment le marché boursicote avec les droits à polluer », l’auteur, Aurélien Bernier, ancien membre d’Attac France et chargé de mission dans le domaine de l’environnement, décrypte le fonctionnement d’un nouveau compartiment de la finance internationale, la « finance carbone » constituée d’un ensemble de marchés où s’échangent les permis d’émission négociables ou les unités de réduction d’émissions, communément appelés « ...
Detectability of Gravitational Waves from High-Redshift Binaries.
Rosado, Pablo A; Lasky, Paul D; Thrane, Eric; Zhu, Xingjiang; Mandel, Ilya; Sesana, Alberto
2016-03-11
Recent nondetection of gravitational-wave backgrounds from pulsar timing arrays casts further uncertainty on the evolution of supermassive black hole binaries. We study the capabilities of current gravitational-wave observatories to detect individual binaries and demonstrate that, contrary to conventional wisdom, some are, in principle, detectable throughout the Universe. In particular, a binary with rest-frame mass ≳10^{10}M_{⊙} can be detected by current timing arrays at arbitrarily high redshifts. The same claim will apply for less massive binaries with more sensitive future arrays. As a consequence, future searches for nanohertz gravitational waves could be expanded to target evolving high-redshift binaries. We calculate the maximum distance at which binaries can be observed with pulsar timing arrays and other detectors, properly accounting for redshift and using realistic binary waveforms.
Non-binary Entanglement-assisted Stabilizer Quantum Codes
Riguang, Leng; Zhi, Ma
2011-01-01
In this paper, we show how to construct non-binary entanglement-assisted stabilizer quantum codes by using pre-shared entanglement between the sender and receiver. We also give an algorithm to determine the circuit for non-binary entanglement-assisted stabilizer quantum codes and some illustrated examples. The codes we constructed do not require the dual-containing constraint, and many non-binary classical codes, like non-binary LDPC codes, which do not satisfy the condition, can be used to c...
Mesoscopic model for binary fluids
Echeverria, C.; Tucci, K.; Alvarez-Llamoza, O.; Orozco-Guillén, E. E.; Morales, M.; Cosenza, M. G.
2017-10-01
We propose a model for studying binary fluids based on the mesoscopic molecular simulation technique known as multiparticle collision, where the space and state variables are continuous, and time is discrete. We include a repulsion rule to simulate segregation processes that does not require calculation of the interaction forces between particles, so binary fluids can be described on a mesoscopic scale. The model is conceptually simple and computationally efficient; it maintains Galilean invariance and conserves the mass and energy in the system at the micro- and macro-scale, whereas momentum is conserved globally. For a wide range of temperatures and densities, the model yields results in good agreement with the known properties of binary fluids, such as the density profile, interface width, phase separation, and phase growth. We also apply the model to the study of binary fluids in crowded environments with consistent results.
International Nuclear Information System (INIS)
Conroy, Kyle E.; Stassun, Keivan G.; Prša, Andrej; Orosz, Jerome A.; Welsh, William F.; Fabrycky, Daniel C.
2014-01-01
We present a catalog of precise eclipse times and analysis of third-body signals among 1279 close binaries in the latest Kepler Eclipsing Binary Catalog. For these short-period binaries, Kepler's 30 minute exposure time causes significant smearing of light curves. In addition, common astrophysical phenomena such as chromospheric activity, as well as imperfections in the light curve detrending process, can create systematic artifacts that may produce fictitious signals in the eclipse timings. We present a method to measure precise eclipse times in the presence of distorted light curves, such as in contact and near-contact binaries which exhibit continuously changing light levels in and out of eclipse. We identify 236 systems for which we find a timing variation signal compatible with the presence of a third body. These are modeled for the light travel time effect and the basic properties of the third body are derived. This study complements J. A. Orosz et al. (in preparation), which focuses on eclipse timing variations of longer period binaries with flat out-of-eclipse regions. Together, these two papers provide comprehensive eclipse timings for all binaries in the Kepler Eclipsing Binary Catalog, as an ongoing resource freely accessible online to the community.
CIRCUMBINARY MAGNETOHYDRODYNAMIC ACCRETION INTO INSPIRALING BINARY BLACK HOLES
Energy Technology Data Exchange (ETDEWEB)
Noble, Scott C.; Mundim, Bruno C.; Nakano, Hiroyuki; Campanelli, Manuela; Zlochower, Yosef [Center for Computational Relativity and Gravitation, Rochester Institute of Technology, Rochester, NY 14623 (United States); Krolik, Julian H. [Physics and Astronomy Department, Johns Hopkins University, Baltimore, MD 21218 (United States); Yunes, Nicolas, E-mail: scn@astro.rit.edu [Department of Physics, Montana State University, Bozeman, MT 59717 (United States)
2012-08-10
We have simulated the magnetohydrodynamic evolution of a circumbinary disk surrounding an equal-mass binary comprising two non-spinning black holes during the period in which the disk inflow time is comparable to the binary evolution time due to gravitational radiation. Both the changing spacetime and the binary orbital evolution are described by an innovative technique utilizing high-order post-Newtonian approximations. Prior to the beginning of the inspiral, the structure of the circumbinary disk is predicted well by extrapolation from Newtonian results: a gap of roughly two binary separation radii is cleared, and matter piles up at the outer edge of this gap as inflow is retarded by torques exerted by the binary; the accretion rate is roughly half its value at large radius. During inspiral, the inner edge of the disk initially moves inward in coordination with the shrinking binary, but-as the orbital evolution accelerates-the inward motion of the disk edge falls behind the rate of binary compression. In this stage, the binary torque falls substantially, but the accretion rate decreases by only 10%-20%. When the binary separation is tens of gravitational radii, the rest-mass efficiency of disk radiation is a few percent, suggesting that supermassive binary black holes could be very luminous at this stage of their evolution. Inner disk heating is modulated at a beat frequency comparable to the binary orbital frequency. However, a disk with sufficient surface density to be luminous may be optically thick, suppressing periodic modulation of the luminosity.
Binary and Millisecond Pulsars
Directory of Open Access Journals (Sweden)
Lorimer Duncan R.
2008-11-01
Full Text Available We review the main properties, demographics and applications of binary and millisecond radio pulsars. Our knowledge of these exciting objects has greatly increased in recent years, mainly due to successful surveys which have brought the known pulsar population to over 1800. There are now 83 binary and millisecond pulsars associated with the disk of our Galaxy, and a further 140 pulsars in 26 of the Galactic globular clusters. Recent highlights include the discovery of the young relativistic binary system PSR J1906+0746, a rejuvination in globular cluster pulsar research including growing numbers of pulsars with masses in excess of 1.5M_⊙, a precise measurement of relativistic spin precession in the double pulsar system and a Galactic millisecond pulsar in an eccentric (e = 0.44 orbit around an unevolved companion.
Observations of new Wolf-Rayet binaries
International Nuclear Information System (INIS)
Niemela, V.S.
1982-01-01
The author reports here preliminary results of spectrographic observations for three southern WR stars, whose binary nature had not been previously verified: HDE 320102, CD -45 0 4482, HD 62910. The observations were carried out at the Cerro Tololo Inter-American Observatory, Chile, mostly with the Cassegrain spectrograph with IT attached to the 1-m reflector. These spectrograms were secured on Kodak IIIaJ emulsion, and have a dispersion of 45 A/mm. The results suggest that HDE 320102 must be a double-lined 05-7 + WN3 spectroscopic binary, that CD -45 0 4482 appears to be a single-lined spectroscopic binary and that HD 62910 may be a binary. (Auth.)
Moneda y banca en una economía aurífera. La Región de Antioquia (Colombia, 1850-1890
Directory of Open Access Journals (Sweden)
María Mercedes Botero Restrepo
2011-06-01
Full Text Available Desde mediados del siglo XIX Antioquia experimentó un auge de la minería que la posicionó como principal exportadora de oro al mercado externo. El desarrollo de la producción aurífera generó una mayor demanda, razón por lo cual los grandes comerciantes aumentaron la importación de mercancías extranjeras así como productos de otras partes del país. El avance de los intercambios mercantiles estuvo acompañado de un incremento en la circulación monetaria. Con el apoyo de fuentes primarias, en este trabajo pretendo explorar la forma como operó y se adecuó el sistema monetario en esta economía exportadora de oro.In the 1850s, Antioquia started showing significant commercial development resulting mostly from gold-mining expansion. New mining sites generated new markets and trade networks that joined small localities with cities and foreign markets. Based on the archives of commercial houses of the time, this essay contributes to studies of 19th century monetary issues, describing different forms of money placed into circulation that facilitated the exchange of goods and services in this mining economy.
Asteroseismic effects in close binary stars
Springer, Ofer M.; Shaviv, Nir J.
2013-09-01
Turbulent processes in the convective envelopes of the Sun and stars have been shown to be a source of internal acoustic excitations. In single stars, acoustic waves having frequencies below a certain cut-off frequency propagate nearly adiabatically and are effectively trapped below the photosphere where they are internally reflected. This reflection essentially occurs where the local wavelength becomes comparable to the pressure scale height. In close binary stars, the sound speed is a constant on equipotentials, while the pressure scale height, which depends on the local effective gravity, varies on equipotentials and may be much greater near the inner Lagrangian point (L1). As a result, waves reaching the vicinity of L1 may propagate unimpeded into low-density regions, where they tend to dissipate quickly due to non-linear and radiative effects. We study the three-dimensional propagation and enhanced damping of such waves inside a set of close binary stellar models using a WKB approximation of the acoustic field. We find that these waves can have much higher damping rates in close binaries, compared to their non-binary counterparts. We also find that the relative distribution of acoustic energy density at the visible surface of close binaries develops a ring-like feature at specific acoustic frequencies and binary separations.
Logistic chaotic maps for binary numbers generations
International Nuclear Information System (INIS)
Kanso, Ali; Smaoui, Nejib
2009-01-01
Two pseudorandom binary sequence generators, based on logistic chaotic maps intended for stream cipher applications, are proposed. The first is based on a single one-dimensional logistic map which exhibits random, noise-like properties at given certain parameter values, and the second is based on a combination of two logistic maps. The encryption step proposed in both algorithms consists of a simple bitwise XOR operation of the plaintext binary sequence with the keystream binary sequence to produce the ciphertext binary sequence. A threshold function is applied to convert the floating-point iterates into binary form. Experimental results show that the produced sequences possess high linear complexity and very good statistical properties. The systems are put forward for security evaluation by the cryptographic committees.
Leportier, Thibault; Park, Min Chul; Kim, You Seok; Kim, Taegeun
2015-02-09
In this paper, we present a three-dimensional holographic imaging system. The proposed approach records a complex hologram of a real object using optical scanning holography, converts the complex form to binary data, and then reconstructs the recorded hologram using a spatial light modulator (SLM). The conversion from the recorded hologram to a binary hologram is achieved using a direct binary search algorithm. We present experimental results that verify the efficacy of our approach. To the best of our knowledge, this is the first time that a hologram of a real object has been reconstructed using a binary SLM.
Early-type semidetached system LY Aurigae
International Nuclear Information System (INIS)
Li, Y.F.; Leung, K.C.
1985-01-01
In an effort to resolve a controversy regarding the configuration, mass ratio, and evolutionary status of the early-type close binary system LY Aur, the six bandpass OAO 2 observations of Heap and the ground-based observations combined by Eaton were analyzed. The Wilson and Devinney approach was used. The system is found to be semidetached, with the cooler and less massive component filling its Roche lobe, while the hotter component is close to its Roche surface. The system is not an early-type zero-age contact, as was suspected earlier. 20 references
EXTRASOLAR BINARY PLANETS. II. DETECTABILITY BY TRANSIT OBSERVATIONS
International Nuclear Information System (INIS)
Lewis, K. M.; Ida, S.; Ochiai, H.; Nagasawa, M.
2015-01-01
We discuss the detectability of gravitationally bound pairs of gas-giant planets (which we call “binary planets”) in extrasolar planetary systems that are formed through orbital instability followed by planet–planet dynamical tides during their close encounters, based on the results of N-body simulations by Ochiai et al. (Paper I). Paper I showed that the formation probability of a binary is as much as ∼10% for three giant planet systems that undergo orbital instability, and after post-capture long-term tidal evolution, the typical binary separation is three to five times the sum of the physical radii of the planets. The binary planets are stable during the main-sequence lifetime of solar-type stars, if the stellarcentric semimajor axis of the binary is larger than 0.3 AU. We show that detecting modulations of transit light curves is the most promising observational method to detect binary planets. Since the likely binary separations are comparable to the stellar diameter, the shape of the transit light curve is different from transit to transit, depending on the phase of the binary’s orbit. The transit durations and depth for binary planet transits are generally longer and deeper than those for the single planet case. We point out that binary planets could exist among the known inflated gas-giant planets or objects classified as false positive detections at orbital radii ≳0.3 AU, propose a binary planet explanation for the CoRoT candidate SRc01 E2 1066, and show that binary planets are likely to be present in, and could be detected using, Kepler-quality data
DEFF Research Database (Denmark)
Frandsen, Rasmus John Normand; Schütt, Claes; Lund, Birgitte W.
2011-01-01
genes, aurZ and aurS. Targeted gene replacement of aurZ resulted in the discovery that the compound YWA1, rather than nor-rubrofusarin, is the primary product of F. graminearum polyketide synthase 12 (FgPKS12). AurZ is the first representative of a novel class of dehydratases that act on hydroxylated γ...
Sesana, Alberto; Haardt, Francesco; Madau, Piero
2007-05-01
We study the long-term evolution of massive black hole binaries (MBHBs) at the centers of galaxies using detailed scattering experiments to solve the full three-body problem. Ambient stars drawn from an isotropic Maxwellian distribution unbound to the binary are ejected by the gravitational slingshot. We construct a minimal, hybrid model for the depletion of the loss cone and the orbital decay of the binary and show that secondary slingshots-stars returning on small-impact parameter orbits to have a second superelastic scattering with the MBHB-may considerably help the shrinking of the pair in the case of large binary mass ratios. In the absence of loss cone refilling by two-body relaxation or other processes, the mass ejected before the stalling of a MBHB is half the binary reduced mass. About 50% of the ejected stars are expelled in a ``burst'' lasting ~104 yr M1/46, where M6 is the binary mass in units of 106 Msolar. The loss cone is completely emptied in a few bulge crossing timescales, ~107 yr M1/46. Even in the absence of two-body relaxation or gas dynamical processes, unequal mass and/or eccentric binaries with M6>~0.1 can shrink to the gravitational wave emission regime in less than a Hubble time and are therefore ``safe'' targets for the planned Laser Interferometer Space Antenna.
Merger rate of primordial black-hole binaries
Ali-Haïmoud, Yacine; Kovetz, Ely D.; Kamionkowski, Marc
2017-12-01
Primordial black holes (PBHs) have long been a candidate for the elusive dark matter (DM), and remain poorly constrained in the ˜20 - 100 M⊙ mass range. PBH binaries were recently suggested as the possible source of LIGO's first detections. In this paper, we thoroughly revisit existing estimates of the merger rate of PBH binaries. We compute the probability distribution of orbital parameters for PBH binaries formed in the early Universe, accounting for tidal torquing by all other PBHs, as well as standard large-scale adiabatic perturbations. We then check whether the orbital parameters of PBH binaries formed in the early Universe can be significantly affected between formation and merger. Our analytic estimates indicate that the tidal field of halos and interactions with other PBHs, as well as dynamical friction by unbound standard DM particles, do not do significant work on nor torque PBH binaries. We estimate the torque due to baryon accretion to be much weaker than previous calculations, albeit possibly large enough to significantly affect the eccentricity of typical PBH binaries. We also revisit the PBH-binary merger rate resulting from gravitational capture in present-day halos, accounting for Poisson fluctuations. If binaries formed in the early Universe survive to the present time, as suggested by our analytic estimates, they dominate the total PBH merger rate. Moreover, this merger rate would be orders of magnitude larger than LIGO's current upper limits if PBHs make a significant fraction of the dark matter. As a consequence, LIGO would constrain ˜10 - 300 M⊙ PBHs to constitute no more than ˜1 % of the dark matter. To make this conclusion fully robust, though, numerical study of several complex astrophysical processes—such as the formation of the first PBH halos and how they may affect PBH binaries, as well as the accretion of gas onto an extremely eccentric binary—is needed.
MICROLENSING BINARIES DISCOVERED THROUGH HIGH-MAGNIFICATION CHANNEL
Energy Technology Data Exchange (ETDEWEB)
Shin, I.-G.; Choi, J.-Y.; Park, S.-Y.; Han, C. [Department of Physics, Institute for Astrophysics, Chungbuk National University, Cheongju 371-763 (Korea, Republic of); Gould, A.; Gaudi, B. S. [Department of Astronomy, Ohio State University, 140 W. 18th Ave., Columbus, OH 43210 (United States); Sumi, T. [Department of Earth and Space Science, Osaka University, Osaka 560-0043 (Japan); Udalski, A. [Warsaw University Observatory, Al. Ujazdowskie 4, 00-478 Warszawa (Poland); Beaulieu, J.-P. [Institut d' Astrophysique de Paris, UMR7095 CNRS-Universite Pierre and Marie Curie, 98 bis Boulevard Arago, 75014 Paris (France); Dominik, M. [School of Physics and Astronomy, SUPA, University of St. Andrews, North Haugh, St. Andrews, KY16 9SS (United Kingdom); Allen, W. [Vintage Lane Observatory, Blenheim (New Zealand); Bos, M. [Molehill Astronomical Observatory, North Shore (New Zealand); Christie, G. W. [Auckland Observatory, P.O. Box 24-180, Auckland (New Zealand); Depoy, D. L. [Department of Physics, Texas A and M University, College Station, TX (United States); Dong, S. [Institute for Advanced Study, Einstein Drive, Princeton, NJ 08540 (United States); Drummond, J. [Possum Observatory, Patutahi (New Zealand); Gal-Yam, A. [Benoziyo Center for Astrophysics, the Weizmann Institute (Israel); Hung, L.-W. [Department of Physics and Astronomy, University of California Los Angeles, Los Angeles, CA 90095 (United States); Janczak, J. [Department of Physics, Ohio State University, 191 W. Woodruff, Columbus, OH 43210 (United States); Kaspi, S. [School of Physics and Astronomy, Tel-Aviv University, Tel Aviv 69978 (Israel); Collaboration: muFUN Collaboration; MOA Collaboration; OGLE Collaboration; PLANET Collaboration; RoboNet Collaboration; MiNDSTEp Consortium; and others
2012-02-20
Microlensing can provide a useful tool to probe binary distributions down to low-mass limits of binary companions. In this paper, we analyze the light curves of eight binary-lensing events detected through the channel of high-magnification events during the seasons from 2007 to 2010. The perturbations, which are confined near the peak of the light curves, can be easily distinguished from the central perturbations caused by planets. However, the degeneracy between close and wide binary solutions cannot be resolved with a 3{sigma} confidence level for three events, implying that the degeneracy would be an important obstacle in studying binary distributions. The dependence of the degeneracy on the lensing parameters is consistent with a theoretical prediction that the degeneracy becomes severe as the binary separation and the mass ratio deviate from the values of resonant caustics. The measured mass ratio of the event OGLE-2008-BLG-510/MOA-2008-BLG-369 is q {approx} 0.1, making the companion of the lens a strong brown dwarf candidate.
Energy Technology Data Exchange (ETDEWEB)
Oelkers, Ryan J.; Stassun, Keivan G.; Dhital, Saurav, E-mail: ryan.j.oelkers@vanderbilt.edu [Vanderbilt University, Department of Physics and Astronomy, Nashville, TN 37235 (United States)
2017-06-01
The formation and evolution of binary star systems are some of the remaining key questions in modern astronomy. Wide binary pairs (separations >10{sup 3} au) are particularly intriguing because their low binding energies make it difficult for the stars to stay gravitationally bound over extended timescales, and thus to probe the dynamics of binary formation and dissolution. Our previous SLoWPoKES catalogs, I and II, provided the largest and most complete sample of wide-binary pairs of low masses. Here we present an extension of these catalogs to a broad range of stellar masses: the Gaia Assorted Mass Binaries Long Excluded from SloWPoKES (GAMBLES), comprising 8660 statistically significant wide pairs that we make available in a living online database. Within this catalog we identify a subset of 543 long-lived (dissipation timescale >1.5 Gyr) candidate binary pairs, of assorted mass, with typical separations between 10{sup 3} and 10{sup 5.5} au (0.002–1.5 pc), using the published distances and proper motions from the Tycho -Gaia Astrometric Solution and Sloan Digital Sky Survey photometry. Each pair has at most a false positive probability of 0.05; the total expectation is 2.44 false binaries in our sample. Among these, we find 22 systems with 3 components, 1 system with 4 components, and 15 pairs consisting of at least 1 possible red giant. We find the largest long-lived binary separation to be nearly 3.2 pc; even so, >76% of GAMBLES long-lived binaries have large binding energies and dissipation lifetimes longer than 1.5 Gyr. Finally, we find that the distribution of binary separations is clearly bimodal, corroborating the findings from SloWPoKES and suggesting multiple pathways for the formation and dissipation of the widest binaries in the Galaxy.
International Nuclear Information System (INIS)
Oelkers, Ryan J.; Stassun, Keivan G.; Dhital, Saurav
2017-01-01
The formation and evolution of binary star systems are some of the remaining key questions in modern astronomy. Wide binary pairs (separations >10 3 au) are particularly intriguing because their low binding energies make it difficult for the stars to stay gravitationally bound over extended timescales, and thus to probe the dynamics of binary formation and dissolution. Our previous SLoWPoKES catalogs, I and II, provided the largest and most complete sample of wide-binary pairs of low masses. Here we present an extension of these catalogs to a broad range of stellar masses: the Gaia Assorted Mass Binaries Long Excluded from SloWPoKES (GAMBLES), comprising 8660 statistically significant wide pairs that we make available in a living online database. Within this catalog we identify a subset of 543 long-lived (dissipation timescale >1.5 Gyr) candidate binary pairs, of assorted mass, with typical separations between 10 3 and 10 5.5 au (0.002–1.5 pc), using the published distances and proper motions from the Tycho -Gaia Astrometric Solution and Sloan Digital Sky Survey photometry. Each pair has at most a false positive probability of 0.05; the total expectation is 2.44 false binaries in our sample. Among these, we find 22 systems with 3 components, 1 system with 4 components, and 15 pairs consisting of at least 1 possible red giant. We find the largest long-lived binary separation to be nearly 3.2 pc; even so, >76% of GAMBLES long-lived binaries have large binding energies and dissipation lifetimes longer than 1.5 Gyr. Finally, we find that the distribution of binary separations is clearly bimodal, corroborating the findings from SloWPoKES and suggesting multiple pathways for the formation and dissipation of the widest binaries in the Galaxy.
International Nuclear Information System (INIS)
Petrov, D.A.
1986-01-01
Conditions for thermodynamical equilibrium in binary and ternary systems are considered. Main types of binary and ternary system phase diagrams are sequently constructed on the basis of general regularities on the character of transition from one equilibria to others. New statements on equilibrium line direction in the diagram triple points and their isothermal cross sections are developed. New represenations on equilibria in case of monovariant curve minimum and maximum on three-phase equilibrium formation in ternary system are introduced
Thebault, Ph.; Haghighipour, N.
2014-01-01
Spurred by the discovery of numerous exoplanets in multiple systems, binaries have become in recent years one of the main topics in planet formation research. Numerous studies have investigated to what extent the presence of a stellar companion can affect the planet formation process. Such studies have implications that can reach beyond the sole context of binaries, as they allow to test certain aspects of the planet formation scenario by submitting them to extreme environments. We review her...
Non-negative Matrix Factorization for Binary Data
DEFF Research Database (Denmark)
Larsen, Jacob Søgaard; Clemmensen, Line Katrine Harder
We propose the Logistic Non-negative Matrix Factorization for decomposition of binary data. Binary data are frequently generated in e.g. text analysis, sensory data, market basket data etc. A common method for analysing non-negative data is the Non-negative Matrix Factorization, though...... this is in theory not appropriate for binary data, and thus we propose a novel Non-negative Matrix Factorization based on the logistic link function. Furthermore we generalize the method to handle missing data. The formulation of the method is compared to a previously proposed method (Tome et al., 2015). We compare...... the performance of the Logistic Non-negative Matrix Factorization to Least Squares Non-negative Matrix Factorization and Kullback-Leibler (KL) Non-negative Matrix Factorization on sets of binary data: a synthetic dataset, a set of student comments on their professors collected in a binary term-document matrix...
Binary and Millisecond Pulsars.
Lorimer, Duncan R
2008-01-01
We review the main properties, demographics and applications of binary and millisecond radio pulsars. Our knowledge of these exciting objects has greatly increased in recent years, mainly due to successful surveys which have brought the known pulsar population to over 1800. There are now 83 binary and millisecond pulsars associated with the disk of our Galaxy, and a further 140 pulsars in 26 of the Galactic globular clusters. Recent highlights include the discovery of the young relativistic binary system PSR J1906+0746, a rejuvination in globular cluster pulsar research including growing numbers of pulsars with masses in excess of 1.5 M ⊙ , a precise measurement of relativistic spin precession in the double pulsar system and a Galactic millisecond pulsar in an eccentric ( e = 0.44) orbit around an unevolved companion. Supplementary material is available for this article at 10.12942/lrr-2008-8.
Flip-flopping binary black holes.
Lousto, Carlos O; Healy, James
2015-04-10
We study binary spinning black holes to display the long term individual spin dynamics. We perform a full numerical simulation starting at an initial proper separation of d≈25M between equal mass holes and evolve them down to merger for nearly 48 orbits, 3 precession cycles, and half of a flip-flop cycle. The simulation lasts for t=20 000M and displays a total change in the orientation of the spin of one of the black holes from an initial alignment with the orbital angular momentum to a complete antialignment after half of a flip-flop cycle. We compare this evolution with an integration of the 3.5 post-Newtonian equations of motion and spin evolution to show that this process continuously flip flops the spin during the lifetime of the binary until merger. We also provide lower order analytic expressions for the maximum flip-flop angle and frequency. We discuss the effects this dynamics may have on spin growth in accreting binaries and on the observational consequences for galactic and supermassive binary black holes.
Binary Star Fractions from the LAMOST DR4
Tian, Zhi-Jia; Liu, Xiao-Wei; Yuan, Hai-Bo; Chen, Bing-Qiu; Xiang, Mao-Sheng; Huang, Yang; Wang, Chun; Zhang, Hua-Wei; Guo, Jin-Cheng; Ren, Juan-Juan; Huo, Zhi-Ying; Yang, Yong; Zhang, Meng; Bi, Shao-Lan; Yang, Wu-Ming; Liu, Kang; Zhang, Xian-Fei; Li, Tan-Da; Wu, Ya-Qian; Zhang, Jing-Hua
2018-05-01
Stellar systems composed of single, double, triple or higher-order systems are rightfully regarded as the fundamental building blocks of the Milky Way. Binary stars play an important role in formation and evolution of the Galaxy. Through comparing the radial velocity variations from multi-epoch observations, we analyze the binary fraction of dwarf stars observed with LAMOST. Effects of different model assumptions, such as orbital period distributions on the estimate of binary fractions, are investigated. The results based on log-normal distribution of orbital periods reproduce the previous complete analyses better than the power-law distribution. We find that the binary fraction increases with T eff and decreases with [Fe/H]. We first investigate the relation between α-elements and binary fraction in such a large sample as provided by LAMOST. The old stars with high [α/Fe] dominate with a higher binary fraction than young stars with low [α/Fe]. At the same mass, earlier forming stars possess a higher binary fraction than newly forming ones, which may be related with evolution of the Galaxy.
WHITE-LIGHT FLARES ON CLOSE BINARIES OBSERVED WITH KEPLER
International Nuclear Information System (INIS)
Gao, Qing; Xin, Yu; Liu, Ji-Feng; Zhang, Xiao-Bin; Gao, Shuang
2016-01-01
Based on Kepler data, we present the results of a search for white light flares on 1049 close binaries. We identify 234 flare binaries, of which 6818 flares are detected. We compare the flare-binary fraction in different binary morphologies (“detachedness”). The result shows that the fractions in over-contact and ellipsoidal binaries are approximately 10%–20% lower than those in detached and semi-detached systems. We calculate the binary flare activity level (AL) of all the flare binaries, and discuss its variations along the orbital period ( P orb ) and rotation period ( P rot , calculated for only detached binaries). We find that the AL increases with decreasing P orb or P rot , up to the critical values at P orb ∼ 3 days or P rot ∼ 1.5 days, and thereafter the AL starts decreasing no matter how fast the stars rotate. We examine the flaring rate as a function of orbital phase in two eclipsing binaries on which a large number of flares are detected. It appears that there is no correlation between flaring rate and orbital phase in these two binaries. In contrast, when we examine the function with 203 flares on 20 non-eclipse ellipsoidal binaries, bimodal distribution of amplitude-weighted flare numbers shows up at orbital phases 0.25 and 0.75. Such variation could be larger than what is expected from the cross section modification.
Evolution and merging of binaries with compact objects
International Nuclear Information System (INIS)
Bethe, Hans A.; Brown, Gerald E.; Lee, Chang-Hwan
2007-01-01
In the light of recent observations in which short γ-ray bursts are interpreted as arising from black-hole(BH), neutron-star(NS) or NS-NS mergings we would like to review our research on the evolution of compact binaries, especially those containing NS's. These were carried out with predictions for LIGO in mind, but are directly applicable to short γ-ray bursts in the interpretation above. Most important in our review is that we show that the standard scenario for evolving NS-NS binaries always ends up with a low-mass BH (LMBH), NS binary. Bethe and Brown [1998, Astrophys. J. 506, 780] showed that this fate could be avoided if the two giants in the progenitor binary burned He at the same time, and that in this way the binary could avoid the common envelope evolution of the NS with red giant companion which sends the first born NS into a BH in the standard scenario. The burning of He at the same time requires, for the more massive giants such as the progenitors of the Hulse-Taylor binary NS that the two giants be within 4% of each other in zero age main sequence (ZAMS) mass. Applying this criterion to all binaries results in a factor ∼5 of LMBH-NS binaries as compared with NS-NS binaries. Although this factor is substantially less than the originally claimed factor of 20 which Bethe and Brown (1998) estimated, largely because a careful evolution has been carried through here, our factor 5 is augmented by a factor of ∼8 arising from the higher rate of star formation in the earlier Galaxy from which the BH-NS binaries came from. Furthermore, here we calculate the mergers for short-hard gamma-ray bursts, whereas Bethe and Brown's factor 20 included a factor of 2 for the higher chirp masses in a BH-NS binary as compared with NS-NS one. In short, we end up with an estimate of factor ∼40 over that calculated with NS-NS binary mergers in our Galaxy alone. Our total rate is estimated to be about one merging of compact objects per year. Our scenario of NS-NS binaries
Rotational properties of the binary and non-binary populations in the Trans-Neptunian belt
Thirouin, Audrey; Noll, Keith S.; Ortiz Moreno, Jose Luis; Morales , Nicolas
2014-11-01
An exhaustive study about short-term variability as well as derived properties from lightcurves allowed us to draw some conclusions for the Trans-Neptunian belt binary population. Based on Maxwellian fit distributions of the spin rate, we suggested that the binary population rotates slower than the non-binary one. This slowing-down can be attributed to tidal effects between the satellite and the primary, as expected. We showed that no system in this work is tidally locked, but the primary despinning process may have already affected the primary rate (as well as the satellite rotational rate). We used the Gladman et al. (1996) formula to compute the time required to tidally lock the systems, but this formula is based on several assumptions and approximations that do not always hold. The computed times are reasonable in most cases and confirm that none of the systems is tidally locked, assuming that the satellite densities are low and have a high rigidity or have a higher dissipation than usually assumed. The rotational properties of small bodies provide information about important physical properties, such as shape, density, and cohesion (Pravec & Harris 2000; Holsapple 2001, 2004; Thirouin et al. 2010, 2012). For binaries it is also possible to derive several physical parameters of the system components, such as diameters of the primary/secondary and albedo under some assumptions. We compare our results as well as our technique for deriving this information from the lightcurve with other methods, such as: i) thermal or thermophysical modeling, ii) from the mutual orbit of the binary component, iii) from direct imaging or iv) from stellar occultation by Trans-Neptunian Objects (TNOs). Finally, by studying the specific angular momentum of the sample, we proposed possible formation models for several binary TNOs. In several cases, we obtained hints of the formation mechanism from the angular momentum, but for other cases we do not have enough information about the
Texture classification by texton: statistical versus binary.
Directory of Open Access Journals (Sweden)
Zhenhua Guo
Full Text Available Using statistical textons for texture classification has shown great success recently. The maximal response 8 (Statistical_MR8, image patch (Statistical_Joint and locally invariant fractal (Statistical_Fractal are typical statistical texton algorithms and state-of-the-art texture classification methods. However, there are two limitations when using these methods. First, it needs a training stage to build a texton library, thus the recognition accuracy will be highly depended on the training samples; second, during feature extraction, local feature is assigned to a texton by searching for the nearest texton in the whole library, which is time consuming when the library size is big and the dimension of feature is high. To address the above two issues, in this paper, three binary texton counterpart methods were proposed, Binary_MR8, Binary_Joint, and Binary_Fractal. These methods do not require any training step but encode local feature into binary representation directly. The experimental results on the CUReT, UIUC and KTH-TIPS databases show that binary texton could get sound results with fast feature extraction, especially when the image size is not big and the quality of image is not poor.
Absolute Dimensions of Contact Binary Stars in Baade Window
Directory of Open Access Journals (Sweden)
Young Woon Kang
1999-12-01
Full Text Available The light curves of the representative 6 contact binary stars observed by OGLE Project of searching for dark matter in our Galaxy have been analyzed by the method of the Wilson and Devinney Differential Correction to find photometric solutions. The orbital inclinations of these binaries are in the range of 52 deg - 69 deg which is lower than that of the solar neighborhood binaries. The Roche lobe filling factor of these binaries are distributed in large range of 0.12 - 0.90. Since absence of spectroscopic observations for these binaries we have found masses of the 6 binary systems based on the intersection between Kepler locus and locus derived from Vandenberg isochrones in the mass - luminosity plane. Then absolute dimensions and distances have been found by combining the masses and the photometric solutions. The distances of the 6 binary systems are distributed in the range of 1 kpc - 6 kpc. This distance range is the limiting range where the contact binaries which have period shorter than a day are visible. Most contact binaries discovered in the Baade window do not belong to the Galactic bulge.
Orbital motion in pre-main sequence binaries
Energy Technology Data Exchange (ETDEWEB)
Schaefer, G. H. [The CHARA Array of Georgia State University, Mount Wilson Observatory, Mount Wilson, CA 91023 (United States); Prato, L. [Lowell Observatory, 1400 West Mars Hill Road, Flagstaff, AZ 86001 (United States); Simon, M. [Department of Physics and Astronomy, Stony Brook University, Stony Brook, NY 11794 (United States); Patience, J., E-mail: schaefer@chara-array.org [Astrophysics Group, School of Physics, University of Exeter, Exeter, EX4 4QL (United Kingdom)
2014-06-01
We present results from our ongoing program to map the visual orbits of pre-main sequence (PMS) binaries in the Taurus star forming region using adaptive optics imaging at the Keck Observatory. We combine our results with measurements reported in the literature to analyze the orbital motion for each binary. We present preliminary orbits for DF Tau, T Tau S, ZZ Tau, and the Pleiades binary HBC 351. Seven additional binaries show curvature in their relative motion. Currently, we can place lower limits on the orbital periods for these systems; full solutions will be possible with more orbital coverage. Five other binaries show motion that is indistinguishable from linear motion. We suspect that these systems are bound and might show curvature with additional measurements in the future. The observations reported herein lay critical groundwork toward the goal of measuring precise masses for low-mass PMS stars.
Binary catalogue of exoplanets
Schwarz, Richard; Bazso, Akos; Zechner, Renate; Funk, Barbara
2016-02-01
Since 1995 there is a database which list most of the known exoplanets (The Extrasolar Planets Encyclopaedia at http://exoplanet.eu/). With the growing number of detected exoplanets in binary and multiple star systems it became more important to mark and to separate them into a new database, which is not available in the Extrasolar Planets Encyclopaedia. Therefore we established an online database (which can be found at: http://www.univie.ac.at/adg/schwarz/multiple.html) for all known exoplanets in binary star systems and in addition for multiple star systems, which will be updated regularly and linked to the Extrasolar Planets Encyclopaedia. The binary catalogue of exoplanets is available online as data file and can be used for statistical purposes. Our database is divided into two parts: the data of the stars and the planets, given in a separate list. We describe also the different parameters of the exoplanetary systems and present some applications.
Serial binary interval ratios improve rhythm reproduction
Directory of Open Access Journals (Sweden)
Xiang eWu
2013-08-01
Full Text Available Musical rhythm perception is a natural human ability that involves complex cognitive processes. Rhythm refers to the organization of events in time, and musical rhythms have an underlying hierarchical metrical structure. The metrical structure induces the feeling of a beat and the extent to which a rhythm induces the feeling of a beat is referred to as its metrical strength. Binary ratios are the most frequent interval ratio in musical rhythms. Rhythms with hierarchical binary ratios are better discriminated and reproduced than rhythms with hierarchical non-binary ratios. However, it remains unclear whether a superiority of serial binary over non-binary ratios in rhythm perception and reproduction exists. In addition, how different types of serial ratios influence the metrical strength of rhythms remains to be elucidated. The present study investigated serial binary vs. non-binary ratios in a reproduction task. Rhythms formed with exclusively binary (1:2:4:8, non-binary integer (1:3:5:6, and non-integer (1:2.3:5.3:6.4 ratios were examined within a constant meter. The results showed that the 1:2:4:8 rhythm type was more accurately reproduced than the 1:3:5:6 and 1:2.3:5.3:6.4 rhythm types, and the 1:2.3:5.3:6.4 rhythm type was more accurately reproduced than the 1:3:5:6 rhythm type. Further analyses showed that reproduction performance was better predicted by the distribution pattern of event occurrences within an inter-beat interval, than by the coincidence of events with beats, or the magnitude and complexity of interval ratios. Whereas rhythm theories and empirical data emphasize the role of the coincidence of events with beats in determining metrical strength and predicting rhythm performance, the present results suggest that rhythm processing may be better understood when the distribution pattern of event occurrences is taken into account. These results provide new insights into the mechanisms underlining musical rhythm perception.
Serial binary interval ratios improve rhythm reproduction.
Wu, Xiang; Westanmo, Anders; Zhou, Liang; Pan, Junhao
2013-01-01
Musical rhythm perception is a natural human ability that involves complex cognitive processes. Rhythm refers to the organization of events in time, and musical rhythms have an underlying hierarchical metrical structure. The metrical structure induces the feeling of a beat and the extent to which a rhythm induces the feeling of a beat is referred to as its metrical strength. Binary ratios are the most frequent interval ratio in musical rhythms. Rhythms with hierarchical binary ratios are better discriminated and reproduced than rhythms with hierarchical non-binary ratios. However, it remains unclear whether a superiority of serial binary over non-binary ratios in rhythm perception and reproduction exists. In addition, how different types of serial ratios influence the metrical strength of rhythms remains to be elucidated. The present study investigated serial binary vs. non-binary ratios in a reproduction task. Rhythms formed with exclusively binary (1:2:4:8), non-binary integer (1:3:5:6), and non-integer (1:2.3:5.3:6.4) ratios were examined within a constant meter. The results showed that the 1:2:4:8 rhythm type was more accurately reproduced than the 1:3:5:6 and 1:2.3:5.3:6.4 rhythm types, and the 1:2.3:5.3:6.4 rhythm type was more accurately reproduced than the 1:3:5:6 rhythm type. Further analyses showed that reproduction performance was better predicted by the distribution pattern of event occurrences within an inter-beat interval, than by the coincidence of events with beats, or the magnitude and complexity of interval ratios. Whereas rhythm theories and empirical data emphasize the role of the coincidence of events with beats in determining metrical strength and predicting rhythm performance, the present results suggest that rhythm processing may be better understood when the distribution pattern of event occurrences is taken into account. These results provide new insights into the mechanisms underlining musical rhythm perception.
BHDD: Primordial black hole binaries code
Kavanagh, Bradley J.; Gaggero, Daniele; Bertone, Gianfranco
2018-06-01
BHDD (BlackHolesDarkDress) simulates primordial black hole (PBH) binaries that are clothed in dark matter (DM) halos. The software uses N-body simulations and analytical estimates to follow the evolution of PBH binaries formed in the early Universe.
Tidal and magnetic interactions in close binary stars
International Nuclear Information System (INIS)
Campbell, C.G.
1983-03-01
The thesis investigates the nature of non-synchronous motions in members of close binary stars under the influence of gravitational and magnetic fields existing in these systems, and the evolution of such motions in different classes of binaries. Largely convective stars are considered and a solution is found for the fluid flow associated with the non-synchronous rotation of such a secondary in a close binary system, taking tidal and rotational forces into account. The tidal velocity field is calculated for a low mass white dwarf secondary star in a twin - degenerate binary. It is found that the synchronisation times can be comparable to the lifetime of the binary so that some asynchronism may remain present. (U.K.)
Dynamical Formation and Merger of Binary Black Holes
Stone, Nicholas
2017-01-01
The advent of gravitational wave (GW) astronomy began with Advanced LIGO's 2015 discovery of GWs from coalescing black hole (BH) binaries. GW astronomy holds great promise for testing general relativity, but also for investigating open astrophysical questions not amenable to traditional electromagnetic observations. One such question concerns the origin of stellar mass BH binaries in the universe: do these form primarily from evolution of isolated binaries of massive stars, or do they form through more exotic dynamical channels? The best studied dynamical formation channel involves multibody interactions of BHs and stars in dense globular cluster environments, but many other dynamical scenarios have recently been proposed, ranging from the Kozai effect in hierarchical triple systems to BH binary formation in the outskirts of Toomre-unstable accretion disks surrounding supermassive black holes. The BH binaries formed through these processes will have different distributions of observable parameters (e.g. mass ratios, spins) than BH binaries formed through the evolution of isolated binary stars. In my talk I will overview these and other dynamical formation scenarios, and summarize the key observational tests that will enable Advanced LIGO or other future detectors to determine what formation pathway creates the majority of binary BHs in the universe. NCS thanks NASA, which has funded his work through Einstein postdoctoral grant PF5-160145.
Black Hole/Pulsar Binaries in the Galaxy
Shao, Yong; Li, Xiang-Dong
2018-04-01
We have performed population synthesis calculation on the formation of binaries containing a black hole (BH) and a neutron star (NS) in the Galactic disk. Some of important input parameters, especially for the treatment of common envelope evolution, are updated in the calculation. We have discussed the uncertainties from the star formation rate of the Galaxy and the velocity distribution of NS kicks on the birthrate (˜ 0.6-13 Myr^{-1}) of BH/NS binaries. From incident BH/NS binaries, by modelling the orbital evolution duo to gravitational wave radiation and the NS evolution as radio pulsars, we obtain the distributions of the observable parameters such as the orbital period, eccentricity and pulse period of the BH/pulsar binaries. We estimate that there may be ˜3 - 80 BH/pulsar binaries in the Galactic disk and around 10% of them could be detected by the Five-hundred-meter Aperture Spherical radio Telescope.
Investigating Dark Energy with Black Hole Binaries
International Nuclear Information System (INIS)
Mersini-Houghton, Laura; Kelleher, Adam
2009-01-01
The accelerated expansion of the universe is ascribed to the existence of dark energy. Black holes accrete dark energy. The accretion induces a mass change proportional to the energy density and pressure of the background dark energy fluid. The time scale during which the mass of black holes changes considerably is long relative to the age of the universe, thus beyond detection possibilities. We propose to take advantage of the modified black hole masses for exploring the equation of state w[z] of dark energy, by investigating the evolution of supermassive black hole binaries on a dark energy background. Deriving the signatures of dark energy accretion on the evolution of binaries, we find that dark energy imprints on the emitted gravitational radiation and on the changes in the orbital radius of the binary can be within detection limits for certain supermassive black hole binaries. This talk describes how binaries can provide a useful tool in obtaining complementary information on the nature of dark energy.
Black hole/pulsar binaries in the Galaxy
Shao, Yong; Li, Xiang-Dong
2018-06-01
We have performed population synthesis calculation on the formation of binaries containing a black hole (BH) and a neutron star (NS) in the Galactic disc. Some of important input parameters, especially for the treatment of common envelope evolution, are updated in the calculation. We have discussed the uncertainties from the star formation rate of the Galaxy and the velocity distribution of NS kicks on the birthrate (˜ 0.6-13 M yr^{-1}) of BH/NS binaries. From incident BH/NS binaries, by modelling the orbital evolution due to gravitational wave radiation and the NS evolution as radio pulsars, we obtain the distributions of the observable parameters such as the orbital period, eccentricity, and pulse period of the BH/pulsar binaries. We estimate that there may be ˜3-80 BH/pulsar binaries in the Galactic disc and around 10 per cent of them could be detected by the Five-hundred-metre Aperture Spherical radio Telescope.
Star formation history: Modeling of visual binaries
Gebrehiwot, Y. M.; Tessema, S. B.; Malkov, O. Yu.; Kovaleva, D. A.; Sytov, A. Yu.; Tutukov, A. V.
2018-05-01
Most stars form in binary or multiple systems. Their evolution is defined by masses of components, orbital separation and eccentricity. In order to understand star formation and evolutionary processes, it is vital to find distributions of physical parameters of binaries. We have carried out Monte Carlo simulations in which we simulate different pairing scenarios: random pairing, primary-constrained pairing, split-core pairing, and total and primary pairing in order to get distributions of binaries over physical parameters at birth. Next, for comparison with observations, we account for stellar evolution and selection effects. Brightness, radius, temperature, and other parameters of components are assigned or calculated according to approximate relations for stars in different evolutionary stages (main-sequence stars, red giants, white dwarfs, relativistic objects). Evolutionary stage is defined as a function of system age and component masses. We compare our results with the observed IMF, binarity rate, and binary mass-ratio distributions for field visual binaries to find initial distributions and pairing scenarios that produce observed distributions.
THE ELM SURVEY. V. MERGING MASSIVE WHITE DWARF BINARIES
International Nuclear Information System (INIS)
Brown, Warren R.; Kenyon, Scott J.; Kilic, Mukremin; Gianninas, A.; Allende Prieto, Carlos
2013-01-01
We present the discovery of 17 low-mass white dwarfs (WDs) in short-period (P ≤ 1 day) binaries. Our sample includes four objects with remarkable log g ≅ 5 surface gravities and orbital solutions that require them to be double degenerate binaries. All of the lowest surface gravity WDs have metal lines in their spectra implying long gravitational settling times or ongoing accretion. Notably, six of the WDs in our sample have binary merger times 0.9 M ☉ companions. If the companions are massive WDs, these four binaries will evolve into stable mass transfer AM CVn systems and possibly explode as underluminous supernovae. If the companions are neutron stars, then these may be millisecond pulsar binaries. These discoveries increase the number of detached, double degenerate binaries in the ELM Survey to 54; 31 of these binaries will merge within a Hubble time.
THE ELM SURVEY. V. MERGING MASSIVE WHITE DWARF BINARIES
Energy Technology Data Exchange (ETDEWEB)
Brown, Warren R.; Kenyon, Scott J. [Smithsonian Astrophysical Observatory, 60 Garden St, Cambridge, MA 02138 (United States); Kilic, Mukremin; Gianninas, A. [Homer L. Dodge Department of Physics and Astronomy, University of Oklahoma, 440 W. Brooks St., Norman, OK, 73019 (United States); Allende Prieto, Carlos, E-mail: wbrown@cfa.harvard.edu, E-mail: skenyon@cfa.harvard.edu, E-mail: kilic@ou.edu, E-mail: alexg@nhn.ou.edu, E-mail: callende@iac.es [Instituto de Astrofisica de Canarias, E-38205, La Laguna, Tenerife (Spain)
2013-05-20
We present the discovery of 17 low-mass white dwarfs (WDs) in short-period (P {<=} 1 day) binaries. Our sample includes four objects with remarkable log g {approx_equal} 5 surface gravities and orbital solutions that require them to be double degenerate binaries. All of the lowest surface gravity WDs have metal lines in their spectra implying long gravitational settling times or ongoing accretion. Notably, six of the WDs in our sample have binary merger times <10 Gyr. Four have {approx}>0.9 M{sub Sun} companions. If the companions are massive WDs, these four binaries will evolve into stable mass transfer AM CVn systems and possibly explode as underluminous supernovae. If the companions are neutron stars, then these may be millisecond pulsar binaries. These discoveries increase the number of detached, double degenerate binaries in the ELM Survey to 54; 31 of these binaries will merge within a Hubble time.
Eliciting Subjective Probabilities with Binary Lotteries
DEFF Research Database (Denmark)
Harrison, Glenn W.; Martínez-Correa, Jimmy; Swarthout, J. Todd
objective probabilities. Drawing a sample from the same subject population, we find evidence that the binary lottery procedure induces linear utility in a subjective probability elicitation task using the Quadratic Scoring Rule. We also show that the binary lottery procedure can induce direct revelation...
Variance in binary stellar population synthesis
Breivik, Katelyn; Larson, Shane L.
2016-03-01
In the years preceding LISA, Milky Way compact binary population simulations can be used to inform the science capabilities of the mission. Galactic population simulation efforts generally focus on high fidelity models that require extensive computational power to produce a single simulated population for each model. Each simulated population represents an incomplete sample of the functions governing compact binary evolution, thus introducing variance from one simulation to another. We present a rapid Monte Carlo population simulation technique that can simulate thousands of populations in less than a week, thus allowing a full exploration of the variance associated with a binary stellar evolution model.
"Binary" and "non-binary" detection tasks: are current performance measures optimal?
Gur, David; Rockette, Howard E; Bandos, Andriy I
2007-07-01
We have observed that a very large fraction of responses for several detection tasks during the performance of observer studies are in the extreme ranges of lower than 11% or higher than 89% regardless of the actual presence or absence of the abnormality in question or its subjectively rated "subtleness." This observation raises questions regarding the validity and appropriateness of using multicategory rating scales for such detection tasks. Monte Carlo simulation of binary and multicategory ratings for these tasks demonstrate that the use of the former (binary) often results in a less biased and more precise summary index and hence may lead to a higher statistical power for determining differences between modalities.
MARVELS Radial Velocity Solutions to Seven Kepler Eclipsing Binaries
Heslar, Michael Francis; Thomas, Neil B.; Ge, Jian; Ma, Bo; Herczeg, Alec; Reyes, Alan; SDSS-III MARVELS Team
2016-01-01
Eclipsing binaries serve momentous purposes to improve the basis of understanding aspects of stellar astrophysics, such as the accurate calculation of the physical parameters of stars and the enigmatic mass-radius relationship of M and K dwarfs. We report the investigation results of 7 eclipsing binary candidates, initially identified by the Kepler mission, overlapped with the radial velocity observations from the SDSS-III Multi-Object APO Radial-Velocity Exoplanet Large-Area Survey (MARVELS). The RV extractions and spectroscopic solutions of these eclipsing binaries were generated by the University of Florida's 1D data pipeline with a median RV precision of ~60-100 m/s, which was utilized for the DR12 data release. We performed the cross-reference fitting of the MARVELS RV data and the Kepler photometric fluxes obtained from the Kepler Eclipsing Binary Catalog (V2) and modelled the 7 eclipsing binaries in the BinaryMaker3 and PHOEBE programs. This analysis accurately determined the absolute physical and orbital parameters of each binary. Most of the companion stars were determined to have masses of K and M dwarf stars (0.3-0.8 M⊙), and allowed for an investigation into the mass-radius relationship of M and K dwarfs. Among the cases are KIC 9163796, a 122.2 day period "heartbeat star", a recently-discovered class of eccentric binaries known for tidal distortions and pulsations, with a high eccentricity (e~0.75) and KIC 11244501, a 0.29 day period, contact binary with a double-lined spectrum and mass ratio (q~0.45). We also report on the possible reclassification of 2 Kepler eclipsing binary candidates as background eclipsing binaries based on the analysis of the flux measurements, flux ratios of the spectroscopic and photometric solutions, the differences in the FOVs, the image processing of Kepler, and RV and spectral analysis of MARVELS.
Compact stars and the evolution of binary systems
van den Heuvel, E.P.J.
2011-01-01
The Chandrasekhar limit is of key importance for the evolution of white dwarfs in binary systems and for the formation of neutron stars and black holes in binaries. Mass transfer can drive a white dwarf in a binary over the Chandrasekhar limit, which may lead to a Type Ia supernova (in case of a CO
WHITE-DWARF-MAIN-SEQUENCE BINARIES IDENTIFIED FROM THE LAMOST PILOT SURVEY
International Nuclear Information System (INIS)
Ren Juanjuan; Luo Ali; Li Yinbi; Wei Peng; Zhao Jingkun; Zhao Yongheng; Song Yihan; Zhao Gang
2013-01-01
We present a set of white-dwarf-main-sequence (WDMS) binaries identified spectroscopically from the Large sky Area Multi-Object fiber Spectroscopic Telescope (LAMOST, also called the Guo Shou Jing Telescope) pilot survey. We develop a color selection criteria based on what is so far the largest and most complete Sloan Digital Sky Survey (SDSS) DR7 WDMS binary catalog and identify 28 WDMS binaries within the LAMOST pilot survey. The primaries in our binary sample are mostly DA white dwarfs except for one DB white dwarf. We derive the stellar atmospheric parameters, masses, and radii for the two components of 10 of our binaries. We also provide cooling ages for the white dwarf primaries as well as the spectral types for the companion stars of these 10 WDMS binaries. These binaries tend to contain hot white dwarfs and early-type companions. Through cross-identification, we note that nine binaries in our sample have been published in the SDSS DR7 WDMS binary catalog. Nineteen spectroscopic WDMS binaries identified by the LAMOST pilot survey are new. Using the 3σ radial velocity variation as a criterion, we find two post-common-envelope binary candidates from our WDMS binary sample
BROWN DWARF BINARIES FROM DISINTEGRATING TRIPLE SYSTEMS
Energy Technology Data Exchange (ETDEWEB)
Reipurth, Bo [Institute for Astronomy and NASA Astrobiology Institute University of Hawaii, 640 N. Aohoku Place, Hilo, HI 96720 (United States); Mikkola, Seppo, E-mail: reipurth@ifa.hawaii.edu, E-mail: Seppo.Mikkola@utu.fi [Tuorla Observatory, University of Turku, Väisäläntie 20, Piikkiö (Finland)
2015-04-15
Binaries in which both components are brown dwarfs (BDs) are being discovered at an increasing rate, and their properties may hold clues to their origin. We have carried out 200,000 N-body simulations of three identical stellar embryos with masses drawn from a Chabrier IMF and embedded in a molecular core. The bodies are initially non-hierarchical and undergo chaotic motions within the cloud core, while accreting using Bondi–Hoyle accretion. The coupling of dynamics and accretion often leads to one or two dominant bodies controlling the center of the cloud core, while banishing the other(s) to the lower-density outskirts, leading to stunted growth. Eventually each system transforms either to a bound hierarchical configuration or breaks apart into separate single and binary components. The orbital motion is followed for 100 Myr. In order to illustrate 200,000 end-states of such dynamical evolution with accretion, we introduce the “triple diagnostic diagram,” which plots two dimensionless numbers against each other, representing the binary mass ratio and the mass ratio of the third body to the total system mass. Numerous freefloating BD binaries are formed in these simulations, and statistical properties are derived. The separation distribution function is in good correspondence with observations, showing a steep rise at close separations, peaking around 13 AU and declining more gently, reaching zero at separations greater than 200 AU. Unresolved BD triple systems may appear as wider BD binaries. Mass ratios are strongly peaked toward unity, as observed, but this is partially due to the initial assumptions. Eccentricities gradually increase toward higher values, due to the lack of viscous interactions in the simulations, which would both shrink the orbits and decrease their eccentricities. Most newborn triple systems are unstable and while there are 9209 ejected BD binaries at 1 Myr, corresponding to about 4% of the 200,000 simulations, this number has grown to
BROWN DWARF BINARIES FROM DISINTEGRATING TRIPLE SYSTEMS
International Nuclear Information System (INIS)
Reipurth, Bo; Mikkola, Seppo
2015-01-01
Binaries in which both components are brown dwarfs (BDs) are being discovered at an increasing rate, and their properties may hold clues to their origin. We have carried out 200,000 N-body simulations of three identical stellar embryos with masses drawn from a Chabrier IMF and embedded in a molecular core. The bodies are initially non-hierarchical and undergo chaotic motions within the cloud core, while accreting using Bondi–Hoyle accretion. The coupling of dynamics and accretion often leads to one or two dominant bodies controlling the center of the cloud core, while banishing the other(s) to the lower-density outskirts, leading to stunted growth. Eventually each system transforms either to a bound hierarchical configuration or breaks apart into separate single and binary components. The orbital motion is followed for 100 Myr. In order to illustrate 200,000 end-states of such dynamical evolution with accretion, we introduce the “triple diagnostic diagram,” which plots two dimensionless numbers against each other, representing the binary mass ratio and the mass ratio of the third body to the total system mass. Numerous freefloating BD binaries are formed in these simulations, and statistical properties are derived. The separation distribution function is in good correspondence with observations, showing a steep rise at close separations, peaking around 13 AU and declining more gently, reaching zero at separations greater than 200 AU. Unresolved BD triple systems may appear as wider BD binaries. Mass ratios are strongly peaked toward unity, as observed, but this is partially due to the initial assumptions. Eccentricities gradually increase toward higher values, due to the lack of viscous interactions in the simulations, which would both shrink the orbits and decrease their eccentricities. Most newborn triple systems are unstable and while there are 9209 ejected BD binaries at 1 Myr, corresponding to about 4% of the 200,000 simulations, this number has grown to
Directory of Open Access Journals (Sweden)
Arbutina Bojan
2011-01-01
Full Text Available AM CVn-type stars and ultra-compact X-ray binaries are extremely interesting semi-detached close binary systems in which the Roche lobe filling component is a white dwarf transferring mass to another white dwarf, neutron star or a black hole. Earlier theoretical considerations show that there is a maximum mass ratio of AM CVn-type binary systems (qmax ≈ 2/3 below which the mass transfer is stable. In this paper we derive slightly different value for qmax and more interestingly, by applying the same procedure, we find the maximum expected white dwarf mass in ultra-compact X-ray binaries.
Non-binary or genderqueer genders.
Richards, Christina; Bouman, Walter Pierre; Seal, Leighton; Barker, Meg John; Nieder, Timo O; T'Sjoen, Guy
2016-01-01
Some people have a gender which is neither male nor female and may identify as both male and female at one time, as different genders at different times, as no gender at all, or dispute the very idea of only two genders. The umbrella terms for such genders are 'genderqueer' or 'non-binary' genders. Such gender identities outside of the binary of female and male are increasingly being recognized in legal, medical and psychological systems and diagnostic classifications in line with the emerging presence and advocacy of these groups of people. Population-based studies show a small percentage--but a sizable proportion in terms of raw numbers--of people who identify as non-binary. While such genders have been extant historically and globally, they remain marginalized, and as such--while not being disorders or pathological in themselves--people with such genders remain at risk of victimization and of minority or marginalization stress as a result of discrimination. This paper therefore reviews the limited literature on this field and considers ways in which (mental) health professionals may assist the people with genderqueer and non-binary gender identities and/or expressions they may see in their practice. Treatment options and associated risks are discussed.
The Young Visual Binary Survey
Prato, Lisa; Avilez, Ian; Lindstrom, Kyle; Graham, Sean; Sullivan, Kendall; Biddle, Lauren; Skiff, Brian; Nofi, Larissa; Schaefer, Gail; Simon, Michal
2018-01-01
Differences in the stellar and circumstellar properties of the components of young binaries provide key information about star and disk formation and evolution processes. Because objects with separations of a few to a few hundred astronomical units share a common environment and composition, multiple systems allow us to control for some of the factors which play into star formation. We are completing analysis of a rich sample of about 100 pre-main sequence binaries and higher order multiples, primarily located in the Taurus and Ophiuchus star forming regions. This poster will highlight some of out recent, exciting results. All reduced spectra and the results of our analysis will be publicly available to the community at http://jumar.lowell.edu/BinaryStars/. Support for this research was provided in part by NSF award AST-1313399 and by NASA Keck KPDA funding.
A Survey of Binary Similarity and Distance Measures
Directory of Open Access Journals (Sweden)
Seung-Seok Choi
2010-02-01
Full Text Available The binary feature vector is one of the most common representations of patterns and measuring similarity and distance measures play a critical role in many problems such as clustering, classification, etc. Ever since Jaccard proposed a similarity measure to classify ecological species in 1901, numerous binary similarity and distance measures have been proposed in various fields. Applying appropriate measures results in more accurate data analysis. Notwithstanding, few comprehensive surveys on binary measures have been conducted. Hence we collected 76 binary similarity and distance measures used over the last century and reveal their correlations through the hierarchical clustering technique.
The binary white dwarf LHS 3236
Energy Technology Data Exchange (ETDEWEB)
Harris, Hugh C.; Dahn, Conard C.; Canzian, Blaise; Guetter, Harry H.; Levine, Stephen E.; Luginbuhl, Christian B.; Monet, Alice K. B.; Stone, Ronald C.; Subasavage, John P.; Tilleman, Trudy; Walker, Richard L. [US Naval Observatory, 10391 West Naval Observatory Road, Flagstaff, AZ 86001-8521 (United States); Dupuy, Trent J.; Liu, Michael C. [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Hartkopf, William I. [US Naval Observatory, 3450 Massachusetts Avenue, N.W., Washington, DC 20392-5420 (United States); Ireland, Michael J. [Department of Physics and Astronomy, Macquarie University, New South Wales, NSW 2109 (Australia); Leggett, S. K., E-mail: hch@nofs.navy.mil [Gemini Observatory, 670 N. Aohoku Place, Hilo, HI 96720 (United States)
2013-12-10
The white dwarf LHS 3236 (WD1639+153) is shown to be a double-degenerate binary, with each component having a high mass. Astrometry at the U.S. Naval Observatory gives a parallax and distance of 30.86 ± 0.25 pc and a tangential velocity of 98 km s{sup –1}, and reveals binary orbital motion. The orbital parameters are determined from astrometry of the photocenter over more than three orbits of the 4.0 yr period. High-resolution imaging at the Keck Observatory resolves the pair with a separation of 31 and 124 mas at two epochs. Optical and near-IR photometry give a set of possible binary components. Consistency of all data indicates that the binary is a pair of DA stars with temperatures near 8000 and 7400 K and with masses of 0.93 and 0.91 M {sub ☉}; also possible is a DA primary and a helium DC secondary with temperatures near 8800 and 6000 K and with masses of 0.98 and 0.69 M {sub ☉}. In either case, the cooling ages of the stars are ∼3 Gyr and the total ages are <4 Gyr. The combined mass of the binary (1.66-1.84 M {sub ☉}) is well above the Chandrasekhar limit; however, the timescale for coalescence is long.
Understanding the Anti-Access and Area Denial Threat: An Army Perspective
2015-05-21
65Van Tol, et al, 32-40. 66Eric V. Larson, Derek Eaton, Paul Elrick, Theodore Karasik, Robert Klein , Sherrill Lingel, Brian Nichiporuk, Robert Uy...Davis, Lynn E., Stacie L. Pettyjohn, Melanie W. Sisson, Stephen M. Worman, and Michael J. McNerney. US Overseas Military Presence: What are the...Robert Klein , Sherrill Lingel, Brian Nichiporuk, Robert Uy, and John Zavadil. Assuring Access in Key Strategic Regions: Toward a Long-Term Strategy
Binary and Millisecond Pulsars
Directory of Open Access Journals (Sweden)
Lorimer Duncan R.
2005-11-01
Full Text Available We review the main properties, demographics and applications of binary and millisecond radio pulsars. Our knowledge of these exciting objects has greatly increased in recent years, mainly due to successful surveys which have brought the known pulsar population to over 1700. There are now 80 binary and millisecond pulsars associated with the disk of our Galaxy, and a further 103 pulsars in 24 of the Galactic globular clusters. Recent highlights have been the discovery of the first ever double pulsar system and a recent flurry of discoveries in globular clusters, in particular Terzan 5.
Eclipsing binary stars with a δ Scuti component
Kahraman Aliçavuş, F.; Soydugan, E.; Smalley, B.; Kubát, J.
2017-09-01
Eclipsing binaries with a δ Sct component are powerful tools to derive the fundamental parameters and probe the internal structure of stars. In this study, spectral analysis of six primary δ Sct components in eclipsing binaries has been performed. Values of Teff, v sin I, and metallicity for the stars have been derived from medium-resolution spectroscopy. Additionally, a revised list of δ Sct stars in eclipsing binaries is presented. In this list, we have only given the δ Sct stars in eclipsing binaries to show the effects of the secondary components and tidal-locking on the pulsations of primary δ Sct components. The stellar pulsation, atmospheric and fundamental parameters (e.g. mass, radius) of 92 δ Sct stars in eclipsing binaries have been gathered. Comparison of the properties of single and eclipsing binary member δ Sct stars has been made. We find that single δ Sct stars pulsate in longer periods and with higher amplitudes than the primary δ Sct components in eclipsing binaries. The v sin I of δ Sct components is found to be significantly lower than that of single δ Sct stars. Relationships between the pulsation periods, amplitudes and stellar parameters in our list have been examined. Significant correlations between the pulsation periods and the orbital periods, Teff, log g, radius, mass ratio, v sin I and the filling factor have been found.
Tidal Disruption of Inclined or Eccentric Binaries by Massive Black Holes
Brown, Harriet; Kobayashi, Shiho; Rossi, Elena M.; Sari, Re'em
2018-04-01
Binary stars that are on close orbits around massive black holes (MBH) such as Sgr A* in the centre of the Milky Way are liable to undergo tidal disruption and eject a hypervelocity star. We study the interaction between such a MBH and circular binaries for general binary orientations and penetration depths (i.e. binaries penetrate into the tidal radius around the BH). We show that for very deep penetrators, almost all binaries are disrupted when the binary rotation axis is roughly oriented toward the BH or it is in the opposite direction. The surviving chance becomes significant when the angle between the binary rotation axis and the BH direction is between 0.15π and 0.85π. The surviving chance is as high as ˜20% when the binary rotation axis is perpendicular to the BH direction. However, for shallow penetrators, the highest disruption chance is found in such a perpendicular case, especially in the prograde case. This is because the dynamics of shallow penetrators is more sensitive to the relative orientation of the binary and orbital angular momenta. We provide numerical fits to the disruption probability and energy gain at the the BH encounter as a function of the penetration depth. The latter can be simply rescaled in terms of binary masses, their initial separation and the binary-to-BH mass ratio to evaluate the ejection velocity of a binary members in various systems. We also investigate the disruption of coplanar, eccentric binaries by a MBH. It is shown that for highly eccentric binaries retrograde orbits have a significantly increased disruption probability and ejection velocities compared to the circular binaries.
Evolution of binaries with compact objects in globular clusters
Ivanova, Natalia
2017-01-01
Dynamical interactions that take place between objects in dense stellar systems lead to frequent formation of exotic stellar objects, unusual binaries, and systems of higher multiplicity. They are most important for the formation of binaries with neutron stars and black holes, which are usually observationally revealed in mass-transferring binaries. Here we review the current understanding of compact object's retention, of the metallicity dependence on the formation of low-mass X-ray binaries...
Non-Binary Protograph-Based LDPC Codes: Analysis,Enumerators and Designs
Sun, Yizeng
2013-01-01
Non-binary LDPC codes can outperform binary LDPC codes using sum-product algorithm with higher computation complexity. Non-binary LDPC codes based on protographs have the advantage of simple hardware architecture. In the first part of this thesis, we will use EXIT chart analysis to compute the thresholds of different protographs over GF(q). Based on threshold computation, some non-binary protograph-based LDPC codes are designed and their frame error rates are compared with binary LDPC codes. ...
Reconciliation with non-binary species trees.
Vernot, Benjamin; Stolzer, Maureen; Goldman, Aiton; Durand, Dannie
2008-10-01
Reconciliation extracts information from the topological incongruence between gene and species trees to infer duplications and losses in the history of a gene family. The inferred duplication-loss histories provide valuable information for a broad range of biological applications, including ortholog identification, estimating gene duplication times, and rooting and correcting gene trees. While reconciliation for binary trees is a tractable and well studied problem, there are no algorithms for reconciliation with non-binary species trees. Yet a striking proportion of species trees are non-binary. For example, 64% of branch points in the NCBI taxonomy have three or more children. When applied to non-binary species trees, current algorithms overestimate the number of duplications because they cannot distinguish between duplication and incomplete lineage sorting. We present the first algorithms for reconciling binary gene trees with non-binary species trees under a duplication-loss parsimony model. Our algorithms utilize an efficient mapping from gene to species trees to infer the minimum number of duplications in O(|V(G) | x (k(S) + h(S))) time, where |V(G)| is the number of nodes in the gene tree, h(S) is the height of the species tree and k(S) is the size of its largest polytomy. We present a dynamic programming algorithm which also minimizes the total number of losses. Although this algorithm is exponential in the size of the largest polytomy, it performs well in practice for polytomies with outdegree of 12 or less. We also present a heuristic which estimates the minimal number of losses in polynomial time. In empirical tests, this algorithm finds an optimal loss history 99% of the time. Our algorithms have been implemented in NOTUNG, a robust, production quality, tree-fitting program, which provides a graphical user interface for exploratory analysis and also supports automated, high-throughput analysis of large data sets.
Alnazari, Mansour; Zanaty, Marc; Ajib, Khaled; El-Hakim, Assaad; Zorn, Kevin C
2017-12-22
We aimed to evaluate the risk factors of acute urinary retention (AUR) following robot-assisted radical prostatectomy (RARP), as well as the relationship of AUR with early continence outcomes. The records of 740 consecutive patients who underwent RARP by two experienced surgeons at our institution were retrospectively reviewed from a prospectively collected database. Multiple factors, including age, body mass index (BMI), international prostate symptom score (IPSS), prostate volume, presence of median lobe, nerve preservation status, anastomosis time, and catheter removal time (Day 4 vs. 7), were evaluated as risk factors for AUR using univariate and multivariate analysis. The relation between AUR and early return of continence (one and three months) post-RARP was also evaluated. The incidence of clinically significant vesico-urethral anastomotic (VUA) leak and AUR following catheter removal were 0.9% and 2.2% (17/740), respectively. In men who developed AUR, there was no significant relationship with regards to age, BMI, IPSS, prostatic volume, median lobe, nerve preservation, or anastomosis time; however, the incidence of AUR was significantly higher for men with catheter removal at Day 4 (4.5% [16/351]) vs. Day 7 (0.2% [1/389]) (p=0.004). Moreover, patients with early removal of the catheter (Day 4) who developed AUR had an earlier one-month return of 0-pad continence 87.5% (14/16) compared to patients without AUR 45.6% (153/335), with no significant difference at three months. While AUR is an uncommon complication of RARP, its incidence is much higher than VUA leakage. Further, it is often not well-discussed during patient counselling preoperatively. Moreover, earlier return of urinary continence was observed in patients experiencing AUR following RARP exclusively with catheter removal at Day 4. Future studies are warranted to validate the long-term impact of AUR on continence outcomes.
Influence of non-binary effects on intranuclear cascade method
International Nuclear Information System (INIS)
Gomes, E.H.C.
1985-01-01
The importance of non binary process effects in the intranuclear cascade method is analysed. It is shown that, in the higher density steps, the non binary collisions lead to baryon density distribution and rapidity differents from the one obtained using the usual intranuclear cascade method (limited to purely binary collisions). The validity of the applications of binary intranuclear cascade method to the simulation of the thermal equilibrium, nuclear transparency and particle production, is discussed. (M.C.K.) [pt
THE CLOSE BINARY FRACTION OF DWARF M STARS
International Nuclear Information System (INIS)
Clark, Benjamin M.; Blake, Cullen H.; Knapp, Gillian R.
2012-01-01
We describe a search for close spectroscopic dwarf M star binaries using data from the Sloan Digital Sky Survey to address the question of the rate of occurrence of multiplicity in M dwarfs. We use a template-fitting technique to measure radial velocities from 145,888 individual spectra obtained for a magnitude-limited sample of 39,543 M dwarfs. Typically, the three or four spectra observed for each star are separated in time by less than four hours, but for ∼17% of the stars, the individual observations span more than two days. In these cases we are sensitive to large-amplitude radial velocity variations on timescales comparable to the separation between the observations. We use a control sample of objects having observations taken within a four-hour period to make an empirical estimate of the underlying radial velocity error distribution and simulate our detection efficiency for a wide range of binary star systems. We find the frequency of binaries among the dwarf M stars with a < 0.4 AU to be 3%-4%. Comparison with other samples of binary stars demonstrates that the close binary fraction, like the total binary fraction, is an increasing function of primary mass.
THE CLOSE BINARY FRACTION OF DWARF M STARS
Energy Technology Data Exchange (ETDEWEB)
Clark, Benjamin M. [Penn Manor High School, 100 East Cottage Avenue, Millersville, PA 17551 (United States); Blake, Cullen H.; Knapp, Gillian R. [Princeton University, Department of Astrophysical Sciences, Peyton Hall, Ivy Lane, Princeton, NJ 08544 (United States)
2012-01-10
We describe a search for close spectroscopic dwarf M star binaries using data from the Sloan Digital Sky Survey to address the question of the rate of occurrence of multiplicity in M dwarfs. We use a template-fitting technique to measure radial velocities from 145,888 individual spectra obtained for a magnitude-limited sample of 39,543 M dwarfs. Typically, the three or four spectra observed for each star are separated in time by less than four hours, but for {approx}17% of the stars, the individual observations span more than two days. In these cases we are sensitive to large-amplitude radial velocity variations on timescales comparable to the separation between the observations. We use a control sample of objects having observations taken within a four-hour period to make an empirical estimate of the underlying radial velocity error distribution and simulate our detection efficiency for a wide range of binary star systems. We find the frequency of binaries among the dwarf M stars with a < 0.4 AU to be 3%-4%. Comparison with other samples of binary stars demonstrates that the close binary fraction, like the total binary fraction, is an increasing function of primary mass.
Binary Cockroach Swarm Optimization for Combinatorial Optimization Problem
Directory of Open Access Journals (Sweden)
Ibidun Christiana Obagbuwa
2016-09-01
Full Text Available The Cockroach Swarm Optimization (CSO algorithm is inspired by cockroach social behavior. It is a simple and efficient meta-heuristic algorithm and has been applied to solve global optimization problems successfully. The original CSO algorithm and its variants operate mainly in continuous search space and cannot solve binary-coded optimization problems directly. Many optimization problems have their decision variables in binary. Binary Cockroach Swarm Optimization (BCSO is proposed in this paper to tackle such problems and was evaluated on the popular Traveling Salesman Problem (TSP, which is considered to be an NP-hard Combinatorial Optimization Problem (COP. A transfer function was employed to map a continuous search space CSO to binary search space. The performance of the proposed algorithm was tested firstly on benchmark functions through simulation studies and compared with the performance of existing binary particle swarm optimization and continuous space versions of CSO. The proposed BCSO was adapted to TSP and applied to a set of benchmark instances of symmetric TSP from the TSP library. The results of the proposed Binary Cockroach Swarm Optimization (BCSO algorithm on TSP were compared to other meta-heuristic algorithms.
A binary mixture operated heat pump
International Nuclear Information System (INIS)
Hihara, E.; Saito, T.
1991-01-01
This paper evaluates the performance of possible binary mixtures as working fluids in high- temperature heat pump applications. The binary mixtures, which are potential alternatives of fully halogenated hydrocarbons, include HCFC142b/HCFC22, HFC152a/HCFC22, HFC134a/HCFC22. The performance of the mixtures is estimated by a thermodynamic model and a practical model in which the heat transfer is considered in heat exchangers. One of the advantages of binary mixtures is a higher coefficient of performance, which is caused by the small temperature difference between the heat-sink/-source fluid and the refrigerant. The mixture HCFC142b/HCFC22 is promising from the stand point of thermodynamic performance
Wide- and contact-binary formation in substructured young stellar clusters
Dorval, J.; Boily, C. M.; Moraux, E.; Roos, O.
2017-02-01
We explore with collisional gravitational N-body models the evolution of binary stars in initially fragmented and globally subvirial clusters of stars. Binaries are inserted in the (initially) clumpy configurations so as to match the observed distributions of the field-binary-stars' semimajor axes a and binary fraction versus primary mass. The dissolution rate of wide binaries is very high at the start of the simulations, and is much reduced once the clumps are eroded by the global infall. The transition between the two regimes is sharper as the number of stars N is increased, from N = 1.5 k up to 80 k. The fraction of dissolved binary stars increases only mildly with N, from ≈15 per cent to ≈25 per cent for the same range in N. We repeated the calculation for two initial system mean number densities of 6 per pc3 (low) and 400 per pc3 (high). We found that the longer free-fall time of the low-density runs allows for prolonged binary-binary interactions inside clumps and the formation of very tight (a ≈ 0.01 au) binaries by exchange collisions. This is an indication that the statistics of such compact binaries bear a direct link to their environment at birth. We also explore the formation of wide (a ≳ 5 × 104 au) binaries and find a low (≈0.01 per cent) fraction mildly bound to the central star cluster. The high-precision astrometric mission Gaia could identify them as outflowing shells or streams.
An Efficient Binary Differential Evolution with Parameter Adaptation
Directory of Open Access Journals (Sweden)
Dongli Jia
2013-04-01
Full Text Available Differential Evolution (DE has been applied to many scientific and engineering problems for its simplicity and efficiency. However, the standard DE cannot be used in a binary search space directly. This paper proposes an adaptive binary Differential Evolution algorithm, or ABDE, that has a similar framework as the standard DE but with an improved binary mutation strategy in which the best individual participates. To further enhance the search ability, the parameters of the ABDE are slightly disturbed in an adaptive manner. Experiments have been carried out by comparing ABDE with two binary DE variants, normDE and BDE, and the most used binary search technique, GA, on a set of 13 selected benchmark functions and the classical 0-1 knapsack problem. Results show that the ABDE performs better than, or at least comparable to, the other algorithms in terms of search ability, convergence speed, and solution accuracy.
Beyond binaries : a way forward for comparativeeducation
Directory of Open Access Journals (Sweden)
Marianne Larsen
2012-09-01
Full Text Available Binary discourses shape and produce the stories we construct about the field of comparative education. In the first part of this article, I review a set of binary discourses that have characterized social science research since the Enlightenment, including: quantitative-qualitative, nomotheticidiographic, inductive-deductive, and practice-theory. We can think of each of these binaries at opposite ends of a set of spectrums. In the second section of the paper, I show some of the ways in which these binaries have influenced the ways that we write and talk about research within the field of comparative education. I refer to the notion of binary discourses and the productive capacity of these discourses to shape our field. I then outline some critiques of these binaries to demonstrate the inherent limitations of binary discourses, and why we need to move beyond binaries in our research, and in the histories about our field. Finally, I present some tentative conclusions on ways to get ourselves out of the trap of binary thinking.Los discursos binarios moldean y producen los argumentos que construimos sobre la disciplina de la Educación Comparada. En la primera parte de este artículo, analizo un conjunto de discursos binarios que han caracterizado la investigación en Ciencias Sociales desde la Ilustración, incluyendo la cuantitativa-cualitativa, nomotética-idiográfica, inductivadeductiva, y la práctica-teoría. Podemos pensar sobre cada uno de estos discursos binarios como argumentos en los polos de un conjunto de posibilidades. En la segunda sección del artículo, revelo algunos modos en los que estos discursos binarios han influenciado las formas a través de las cuales escribimos y analizamos la investigación en el ámbito de la Educación Comparada. Analizo la noción de discursos binarios y la capacidad productiva de estos discursos de impactar nuestra ciencia. Seguidamente expongo algunas críticas de estos discursos binarios con el
Grammar-Based Specification and Parsing of Binary File Formats
Directory of Open Access Journals (Sweden)
William Underwood
2012-03-01
Full Text Available The capability to validate and view or play binary file formats, as well as to convert binary file formats to standard or current file formats, is critically important to the preservation of digital data and records. This paper describes the extension of context-free grammars from strings to binary files. Binary files are arrays of data types, such as long and short integers, floating-point numbers and pointers, as well as characters. The concept of an attribute grammar is extended to these context-free array grammars. This attribute grammar has been used to define a number of chunk-based and directory-based binary file formats. A parser generator has been used with some of these grammars to generate syntax checkers (recognizers for validating binary file formats. Among the potential benefits of an attribute grammar-based approach to specification and parsing of binary file formats is that attribute grammars not only support format validation, but support generation of error messages during validation of format, validation of semantic constraints, attribute value extraction (characterization, generation of viewers or players for file formats, and conversion to current or standard file formats. The significance of these results is that with these extensions to core computer science concepts, traditional parser/compiler technologies can potentially be used as a part of a general, cost effective curation strategy for binary file formats.
Comments on the evolution and origin of cataclysmic binaries
International Nuclear Information System (INIS)
Whyte, C.A.; Eggleton, P.P.
1980-01-01
Aspects of the observational data on cataclysmic binaries are discussed and possible correlations between type of behaviour and binary period are noted. A gap between 2 and 3 hr in binary periods is judged to be real. A simple numerical procedure for evolving Roche-lobe-filling stars is described, and applied to white dwarf-red dwarf binaries for various mass loss and angular momentum loss mechanisms, and initial conditions. The results, in which the short-time-scale behaviour of the systems is ignored, are classified into four modes of evolution: normal, nuclear evolution dominated, angular momentum loss dominated and hydrodynamical. The clustering below 2 hr is interpreted in terms of evolution following the hydrodynamical mode, and it is suggested that both stars in such systems are of low mass. This may be the commonest type of cataclysmic binary. A possible explanation for the apparent clustering of classical novae to periods of 3 to 5 hr is given, and evolutionary schemes for cataclysmic binaries outlined. It is suggested that the short-period systems (approximately < 2 hr) arise mainly from late case B mass transfer in the original binary and the longer period systems mainly from case C. (author)
Non-binary or genderqueer genders
Richards, Christina; Bouman, Walter Pierre; Seal, Leighton; Barker, Meg John; Nieder, Timo O; T'Sjoen, Guy
2016-01-01
Some people have a gender which is neither male nor female and may identify as both male and female at one time, as different genders at different times, as no gender at all, or dispute the very idea of only two genders. The umbrella terms for such genders are genderqueer' or non-binary' genders. Such gender identities outside of the binary of female and male are increasingly being recognized in legal, medical and psychological systems and diagnostic classifications in line with the emerging ...
Statistical Analysis of a Comprehensive List of Visual Binaries
Directory of Open Access Journals (Sweden)
Kovaleva D.
2015-12-01
Full Text Available Visual binary stars are the most abundant class of observed binaries. The most comprehensive list of data on visual binaries compiled recently by cross-matching the largest catalogues of visual binaries allowed a statistical investigation of observational parameters of these systems. The dataset was cleaned by correcting uncertainties and misclassifications, and supplemented with available parallax data. The refined dataset is free from technical biases and contains 3676 presumably physical visual pairs of luminosity class V with known angular separations, magnitudes of the components, spectral types, and parallaxes. We also compiled a restricted sample of 998 pairs free from observational biases due to the probability of binary discovery. Certain distributions of observational and physical parameters of stars of our dataset are discussed.
Main Memory Implementations for Binary Grouping
May, Norman; Moerkotte, Guido
2005-01-01
An increasing number of applications depend on efficient storage and analysis features for XML data. Hence, query optimization and efficient evaluation techniques for the emerging XQuery standard become more and more important. Many XQuery queries require nested expressions. Unnesting them often introduces binary grouping. We introduce several algorithms implementing binary grouping and analyze their time and space complexity. Experiments demonstrate their performance.
Distinguishing Between Formation Channels for Binary Black Holes with LISA
Breivik, Katelyn; Rodriguez, Carl L.; Larson, Shane L.; Kalogera, Vassiliki; Rasio, Frederic A.
2017-01-01
The recent detections of GW150914 and GW151226 imply an abundance of stellar-mass binary-black-hole mergers in the local universe. While ground-based gravitational-wave detectors are limited to observing the final moments before a binary merges, space-based detectors, such as the Laser Interferometer Space Antenna (LISA), can observe binaries at lower orbital frequencies where such systems may still encode information about their formation histories. In particular, the orbital eccentricity and mass of binary black holes in the LISA frequency band can be used together to discriminate between binaries formed in isolation in galactic fields and those formed in dense stellar environments such as globular clusters. In this letter, we explore the orbital eccentricity and mass of binary-black-hole populations as they evolve through the LISA frequency band. Overall we find that there are two distinct populations discernible by LISA. We show that up to ~90% of binaries formed either dynamically or in isolation have eccentricities measurable by LISA. Finally, we note how measured eccentricities of low-mass binary black holes evolved in isolation could provide detailed constraints on the physics of black-hole natal kicks and common-envelope evolution.
Optical three-step binary-logic-gate-based MSD arithmetic
Fyath, R. S.; Alsaffar, A. A. W.; Alam, M. S.
2003-11-01
A three-step modified signed-digit (MSD) adder is proposed which can be optically implmented using binary logic gates. The proposed scheme depends on encoding each MSD digits into a pair of binary digits using a two-state and multi-position based encoding scheme. The design algorithm depends on constructing the addition truth table of binary-coded MSD numbers and then using Karnaugh map to achieve output minimization. The functions associated with the optical binary logic gates are achieved by simply programming the decoding masks of an optical shadow-casting logic system.
The cool surfaces of binary near-Earth asteroids
Delbo, Marco; Walsh, Kevin; Mueller, Michael; Harris, Alan W.; Howell, Ellen S.
2011-03-01
Here we show results from thermal-infrared observations of km-sized binary near-Earth asteroids (NEAs). We combine previously published thermal properties for NEAs with newly derived values for three binary NEAs. The η value derived from the near-Earth asteroid thermal model (NEATM) for each object is then used to estimate an average thermal inertia for the population of binary NEAs and compared against similar estimates for the population of non-binaries. We find that these objects have, in general, surface temperatures cooler than the average values for non-binary NEAs as suggested by elevated η values. We discuss how this may be evidence of higher-than-average surface thermal inertia. This latter physical parameter is a sensitive indicator of the presence or absence of regolith: bodies covered with fine regolith, such as the Earth’s moon, have low thermal inertia, whereas a surface with little or no regolith displays high thermal inertia. Our results are suggestive of a binary formation mechanism capable of altering surface properties, possibly removing regolith: an obvious candidate is the YORP effect. We present also newly determined sizes and geometric visible albedos derived from thermal-infrared observations of three binary NEAs: (5381) Sekhmet, (153591) 2001 SN263, and (164121) 2003 YT1. The diameters of these asteroids are 1.41 ± 0.21 km, 1.56 ± 0.31 km, and 2.63 ± 0.40 km, respectively. Their albedos are 0.23 ± 0.13, 0.24 ± 0.16, and 0.048 ± 0.015, respectively.
Dynamic Inertia Weight Binary Bat Algorithm with Neighborhood Search
Directory of Open Access Journals (Sweden)
Xingwang Huang
2017-01-01
Full Text Available Binary bat algorithm (BBA is a binary version of the bat algorithm (BA. It has been proven that BBA is competitive compared to other binary heuristic algorithms. Since the update processes of velocity in the algorithm are consistent with BA, in some cases, this algorithm also faces the premature convergence problem. This paper proposes an improved binary bat algorithm (IBBA to solve this problem. To evaluate the performance of IBBA, standard benchmark functions and zero-one knapsack problems have been employed. The numeric results obtained by benchmark functions experiment prove that the proposed approach greatly outperforms the original BBA and binary particle swarm optimization (BPSO. Compared with several other heuristic algorithms on zero-one knapsack problems, it also verifies that the proposed algorithm is more able to avoid local minima.
Asymmetric supernova explosions and the origin of binary pulsars
International Nuclear Information System (INIS)
Sutantyo, W.
1978-01-01
The author investigates the effect of asymmetric supernova explosions on the orbital parameters of binary systems with a compact component. Such explosions are related to the origin of binary pulsars. The degree of asymmetry of the explosion is represented by the kick velocity gained by the exploding star due to the asymmetric mass ejection. The required kick velocity to produce the observed parameters of the binary pulsar PSR 1913 + 16 should be larger than approximately 80 km s -1 if the mass of the exploding star is larger than approximately 4 solar masses. The mean survival probability of the binary system ( ) is examined for various degrees of asymmetry in the explosion. The rare occurrence of a binary pulsar does not neccessarily imply that such a probability is low since not all pulsars have originated in a binary system. Assuming the birth rate of pulsars by Taylor and Manchester (1977), it is derived that would be as high as 0.25. Such values of can be obtained if the mass of the exploding stars is, in general, not large (< approximately 10 solar masses). (Auth.)
General simulation algorithm for autocorrelated binary processes.
Serinaldi, Francesco; Lombardo, Federico
2017-02-01
The apparent ubiquity of binary random processes in physics and many other fields has attracted considerable attention from the modeling community. However, generation of binary sequences with prescribed autocorrelation is a challenging task owing to the discrete nature of the marginal distributions, which makes the application of classical spectral techniques problematic. We show that such methods can effectively be used if we focus on the parent continuous process of beta distributed transition probabilities rather than on the target binary process. This change of paradigm results in a simulation procedure effectively embedding a spectrum-based iterative amplitude-adjusted Fourier transform method devised for continuous processes. The proposed algorithm is fully general, requires minimal assumptions, and can easily simulate binary signals with power-law and exponentially decaying autocorrelation functions corresponding, for instance, to Hurst-Kolmogorov and Markov processes. An application to rainfall intermittency shows that the proposed algorithm can also simulate surrogate data preserving the empirical autocorrelation.
Mass loss from interacting close binary systems
Plavec, M. J.
1981-01-01
The three well-defined classes of evolved binary systems that show evidence of present and/or past mass loss are the cataclysmic variables, the Algols, and Wolf-Rayet stars. It is thought that the transformation of supergiant binary systems into the very short-period cataclysmic variables must have been a complex process. The new evidence that has recently been obtained from the far ultraviolet spectra that a certain subclass of the Algols (the Serpentids) are undergoing fairly rapid evolution is discussed. It is thought probable that the remarkable mass outflow observed in them is connected with a strong wind powered by accretion. The origin of the circumbinary clouds or flat disks that probably surround many strongly interacting binaries is not clear. Attention is also given to binary systems with hot white dwarf or subdwarf components, such as the symbiotic objects and the BQ stars; it is noted that in them both components may be prone to an enhanced stellar wind.
General simulation algorithm for autocorrelated binary processes
Serinaldi, Francesco; Lombardo, Federico
2017-02-01
The apparent ubiquity of binary random processes in physics and many other fields has attracted considerable attention from the modeling community. However, generation of binary sequences with prescribed autocorrelation is a challenging task owing to the discrete nature of the marginal distributions, which makes the application of classical spectral techniques problematic. We show that such methods can effectively be used if we focus on the parent continuous process of beta distributed transition probabilities rather than on the target binary process. This change of paradigm results in a simulation procedure effectively embedding a spectrum-based iterative amplitude-adjusted Fourier transform method devised for continuous processes. The proposed algorithm is fully general, requires minimal assumptions, and can easily simulate binary signals with power-law and exponentially decaying autocorrelation functions corresponding, for instance, to Hurst-Kolmogorov and Markov processes. An application to rainfall intermittency shows that the proposed algorithm can also simulate surrogate data preserving the empirical autocorrelation.
Espectro óculo-aurículo-vertebral em pacientes com defeitos cardíacos congênitos
Directory of Open Access Journals (Sweden)
Rafael Fabiano Machado Rosa
2010-10-01
Full Text Available FUNDAMENTO: Há poucos estudos avaliando a frequência do espectro óculo-aurículo-vertebral (EOAV nos pacientes com defeitos cardíacos congênitos (DCC. OBJETIVO: Verificar a frequência do EOAV em uma amostra de pacientes com malformações cardíacas graves. MÉTODOS: Avaliamos uma coorte prospectiva de pacientes com DCC, admitidos em uma unidade de terapia intensiva (UTI cardiopediátrica no Brasil. O diagnóstico de EOAV foi feito com base em dados clínicos, considerando critérios padrões. Os pacientes que preenchiam esses critérios foram submetidos ao cariótipo de alta resolução com bandamento GTG e hibridização fluorescente in situ para a microdeleção 22q11.2. O teste exato de Fisher (P < 0,05 foi usado para as análises estatísticas. RESULTADOS: Durante o período de avaliação, 330 pacientes foram hospitalizados pela primeira vez na UTI, mas trinta deles não participaram deste estudo. Dos 300 pacientes que constituíram a amostragem final, o EOAV foi verificado em três casos (1%. Todos apresentaram estudos citogenéticos normais. CONCLUSÃO: O EOAV parece ser uma condição frequente em pacientes com DCC. Contudo, não podemos excluir a possibilidade de que a frequência de EOAV encontrada em nosso estudo possa ter sido subestimada devido à baixa taxa de detecção pré-natal de DCC e ao acesso limitado dos pacientes ao tratamento médico apropriado em nosso meio. Estudos prospectivos futuros com critérios clínicos bem definidos e pacientes com defeitos leves e graves serão importantes para avaliar o papel do EOAV na população em geral de indivíduos com malformações cardíacas.
The Discovery of the Most Accelerated Binary Pulsar
Cameron, A. D.; Champion, D. J.; Kramer, M.; Bailes, M.; Barr, E. D.; Bassa, C. G.; Bhandari, S.; Bhat, N. D. R.; Burgay, M.; Burke-Spolaor, S.; Eatough, R. P.; Flynn, C. M. L.; Freire, P. C. C.; Jameson, A.; Johnston, S.
2018-01-01
Pulsars in relativistic binary systems have emerged as fantastic natural laboratories for testing theories of gravity, the most prominent example being the double pulsar, PSR J0737$-$3039. The HTRU-South Low Latitude pulsar survey represents one of the most sensitive blind pulsar surveys taken of the southern Galactic plane to date, and its primary aim has been the discovery of new relativistic binary pulsars. Here we present our binary pulsar searching strategy and report on the survey's fla...
Shrinking of Binaries in a WIMPY Background at the Galactic Center
Hills, J. G.
2001-12-01
The nature of the dark matter in the Galactic Halo is still not clear. Constraints can be placed on it; e.g., it cannot be in baryons less massive than about 1022 grams (Hills, 1986, Astron. J. 92, 595). It may be in elementary weakly interacting massive particles, WIMPS. Apart from providing most of the mass of the Galaxy, the only known significant dynamical effect of WIMPS is to cause a gradual shrinking of tightly bound binaries (Hills 1983, Astron. J. 88, 1269) as they interact with the background soup of WIMPS. This effect may be observable in binaries close to the Galactic Center if a significant fraction of the mass density near the central black hole is from WIMPS. The requisite binaries would have to have orbital velocities greater than the local velocity dispersion of the WIMPS relative to the binary. The velocity dispersion increases near the black hole. The binary cannot be too close to the black hole or its tidal field will breakup the binary. If the local WIMP density is 107 g/cm3, the fractional rate of reduction in the binary orbital period is about 5 x 10-10/yr for a binary having a semimajor axis equal to 3 solar radii in a soup of WIMPS having a velocity dispersion of 200 km/s relative to the binary. This gradual erosion of the binary period may be detectable, particularly, if one of the binary components is a pulsar.
Optimized reversible binary-coded decimal adders
DEFF Research Database (Denmark)
Thomsen, Michael Kirkedal; Glück, Robert
2008-01-01
Abstract Babu and Chowdhury [H.M.H. Babu, A.R. Chowdhury, Design of a compact reversible binary coded decimal adder circuit, Journal of Systems Architecture 52 (5) (2006) 272-282] recently proposed, in this journal, a reversible adder for binary-coded decimals. This paper corrects and optimizes...... their design. The optimized 1-decimal BCD full-adder, a 13 × 13 reversible logic circuit, is faster, and has lower circuit cost and less garbage bits. It can be used to build a fast reversible m-decimal BCD full-adder that has a delay of only m + 17 low-power reversible CMOS gates. For a 32-decimal (128-bit....... Keywords: Reversible logic circuit; Full-adder; Half-adder; Parallel adder; Binary-coded decimal; Application of reversible logic synthesis...
PROSPECTS FOR DETECTING ASTEROSEISMIC BINARIES IN KEPLER DATA
Energy Technology Data Exchange (ETDEWEB)
Miglio, A.; Chaplin, W. J.; Elsworth, Y.; Handberg, R. [School of Physics and Astronomy, University of Birmingham, Edgbaston, Birmingham, B15 2TT (United Kingdom); Farmer, R.; Kolb, U. [Department of Physical Sciences, The Open University, Walton Hall, Milton Keynes MK7 6AA (United Kingdom); Girardi, L. [INAF-Osservatorio Astronomico di Padova, Vicolo dell' Osservatorio 5, I-35122 Padova (Italy); Appourchaux, T. [Institut d' Astrophysique Spatiale, UMR8617, Université Paris XI, Bâtiment 121, F-91405 Orsay Cedex (France)
2014-03-20
Asteroseismology may in principle be used to detect unresolved stellar binary systems comprised of solar-type stars and/or red giants. This novel method relies on the detection of the presence of two solar-like oscillation spectra in the frequency spectrum of a single light curve. Here, we make predictions of the numbers of systems that may be detectable in data already collected by the NASA Kepler Mission. Our predictions, which are based upon TRILEGAL and BiSEPS simulations of the Kepler field of view, indicate that as many as 200 or more ''asteroseismic binaries'' may be detectable in this manner. Most of these binaries should be comprised of two He-core-burning red giants. Owing largely to the limited numbers of targets with the requisite short-cadence Kepler data, we expect only a small number of detected binaries containing solar-type stars. The predicted yield of detections is sensitive to the assumed initial mass ratio distribution (IMRD) of the binary components and therefore represents a sensitive calibration of the much debated IMRD near mass ratio unity.
FORMATION OF BLACK HOLE X-RAY BINARIES IN GLOBULAR CLUSTERS
International Nuclear Information System (INIS)
Ivanova, N.; Heinke, C. O.; Woods, T. E.; Chaichenets, S.; Fregeau, J.; Lombardi, J. C.
2010-01-01
Inspired by the recent identification in extragalactic globular clusters of the first candidate black hole-white dwarf (BH-WD) X-ray binaries, where the compact accretors may be stellar-mass black holes (BHs), we explore how such binaries could be formed in a dynamical environment. We provide analyses of the formation rates via well-known formation channels like binary exchange and physical collisions and propose that the only possibility of forming BH-WD binaries is via coupling these usual formation channels with subsequent hardening and/or triple formation. In particular, we find that the most important mechanism for the creation of a BH-WD X-ray binary from an initially dynamically formed BH-WD binary is mass transfer induced in a triple system via the Kozai mechanism. Furthermore, we find that BH-WD binaries that evolve into X-ray sources can be formed by exchanges of a BH into a WD-WD binary or possibly by collisions of a BH and a giant star. If BHs undergo significant evaporation from the cluster or form a completely detached subcluster of BHs, then we cannot match the observationally inferred production rates even using the most optimistic estimates of formation rates. To explain the observations with stellar-mass BH-WD binaries, at least 1% of all formed BHs, or presumably 10% of the BHs present in the core now, must be involved in interactions with the rest of the core stellar population.
Evolution in close binary systems
International Nuclear Information System (INIS)
Yungel'son, L.R.; Masevich, A.G.
1983-01-01
Duality is the property most typical of stars. If one investigates how prevalent double stars are, making due allowance for selection effects, one finds that as many as 90 percent of all stars are paired. Contrary to tradition it is single stars that are out of the ordinary, and as will be shown presently even some of these may have been formed by coalescence of the members of binary systems. This review deals with the evolution of close binaries, defined as double-star systems whose evolution entails exchange of material between the two components
The gravitational-wave memory from eccentric binaries
International Nuclear Information System (INIS)
Favata, Marc
2011-01-01
The nonlinear gravitational-wave memory causes a time-varying but nonoscillatory correction to the gravitational-wave polarizations. It arises from gravitational-waves that are sourced by gravitational-waves. Previous considerations of the nonlinear memory effect have focused on quasicircular binaries. Here I consider the nonlinear memory from Newtonian orbits with arbitrary eccentricity. Expressions for the waveform polarizations and spin-weighted spherical-harmonic modes are derived for elliptic, hyperbolic, parabolic, and radial orbits. In the hyperbolic, parabolic, and radial cases the nonlinear memory provides a 2.5 post-Newtonian (PN) correction to the leading-order waveforms. This is in contrast to the elliptical and quasicircular cases, where the nonlinear memory corrects the waveform at leading (0PN) order. This difference in PN order arises from the fact that the memory builds up over a short ''scattering'' time scale in the hyperbolic case, as opposed to a much longer radiation-reaction time scale in the elliptical case. The nonlinear memory corrections presented here complete our knowledge of the leading-order (Peters-Mathews) waveforms for elliptical orbits. These calculations are also relevant for binaries with quasicircular orbits in the present epoch which had, in the past, large eccentricities. Because the nonlinear memory depends sensitively on the past evolution of a binary, I discuss the effect of this early-time eccentricity on the value of the late-time memory in nearly circularized binaries. I also discuss the observability of large ''memory jumps'' in a binary's past that could arise from its formation in a capture process. Lastly, I provide estimates of the signal-to-noise ratio of the linear and nonlinear memories from hyperbolic and parabolic binaries.
Proposed experiment to test fundamentally binary theories
Kleinmann, Matthias; Vértesi, Tamás; Cabello, Adán
2017-09-01
Fundamentally binary theories are nonsignaling theories in which measurements of many outcomes are constructed by selecting from binary measurements. They constitute a sensible alternative to quantum theory and have never been directly falsified by any experiment. Here we show that fundamentally binary theories are experimentally testable with current technology. For that, we identify a feasible Bell-type experiment on pairs of entangled qutrits. In addition, we prove that, for any n , quantum n -ary correlations are not fundamentally (n -1 ) -ary. For that, we introduce a family of inequalities that hold for fundamentally (n -1 ) -ary theories but are violated by quantum n -ary correlations.
Coalescence of Black Hole-Neutron Star Binaries
Directory of Open Access Journals (Sweden)
Masaru Shibata
2011-08-01
Full Text Available We review the current status of general relativistic studies for the coalescence of black hole-neutron star (BH-NS binaries. First, procedures for a solution of BH-NS binaries in quasi-equilibrium circular orbits and the numerical results, such as quasi-equilibrium sequence and mass-shedding limit, of the high-precision computation, are summarized. Then, the current status of numerical-relativity simulations for the merger of BH-NS binaries is described. We summarize our understanding for the merger and/or tidal disruption processes, the criterion for tidal disruption, the properties of the remnant formed after the tidal disruption, gravitational waveform, and gravitational-wave spectrum.
Dielectric properties of binary solutions a data handbook
Akhadov, Y Y
1980-01-01
Dielectric Properties of Binary Solutions focuses on the investigation of the dielectric properties of solutions, as well as the molecular interactions and mechanisms of molecular processes that occur in liquids. The book first discusses the fundamental formulas describing the dielectric properties of liquids and dielectric data for binary systems of non-aqueous solutions. Topics include permittivity and dielectric dispersion parameters of non-aqueous solutions of organic and inorganic compounds. The text also tackles dielectric data for binary systems of aqueous solutions, including permittiv
RELATIONSHIP BETWEEN FLASH POINTS OF SOME BINARY ...
African Journals Online (AJOL)
B. S. Chandravanshi
Miscellaneous binary blends containing solvent neutral-150 (SN-150), ... viscosity, the flash point test has always been a standard part of a lubricant's specification. ... between structure and flash points of organic compounds [5-12] and fuels [13, 14]. ... in binary mixtures, the gaps between flash points would be high enough.
Short-term variability of binary and non-binary Trans-Neptunian Objects
Thirouin, Audrey; Noll, K. S.; Campo Bagatin, A.; Ortiz Moreno, J. L.; Morales, N.
2013-10-01
Since 1992, more than 1400 Trans-Neptunian Objects (TNOs) have been discovered. Our approach to understand such objects is to study their rotations by monitoring their brightness variations. By studying the rotational properties of the TNOs a wealth of information can be obtained on their physics. So, the study of the spins and shapes of TNOs is a powerful method of gaining information on the formation and evolution of our Solar System. We have observed most of the brightest TNOs and centaurs, and compiled one of the largest lightcurves samples. The main purpose was to increase the number of objects whose short-term variability has been studied and present a homogeneous dataset trying to avoid observational biases. A dataset composed of 54 TNOs/Centaurs is reported and analyzed. Amplitudes and rotational periods have been derived for 45 of them with different degrees of reliability. For 9 objects, only an estimation of the amplitude is reported. Because most of the TNOs/Centaurs have low amplitude lightcurves, it is difficult to distinguish between single- and double-peaked lightcurves. Based on our results and the literature, following Binzel et al. (1989) study about asteroids rotational frequency distribution, we studied the TNOs spin rate distributions. We performed several Maxwellian fits to various histograms obtained considering that the lightcurves are single- or double-peaked. We tested lightcurve amplitude limits to distinguish if the lightcurve is albedo- or shape-dominated. Such a consideration introduces important changes in the distribution. We derived that an amplitude limit of 0.15mag gave a good fit to Maxwellian distribution. So, it seems that 0.15mag is a good measure of the typical variability caused by albedo. We studied the short-term variability of binary TNOs thanks to unresolved lightcurves. Based on our results and those from the literature, we come up with a sample of 32 systems with a rotational period and/or lightcurve amplitude value
Binary Black Hole Mergers from Globular Clusters: Implications for Advanced LIGO.
Rodriguez, Carl L; Morscher, Meagan; Pattabiraman, Bharath; Chatterjee, Sourav; Haster, Carl-Johan; Rasio, Frederic A
2015-07-31
The predicted rate of binary black hole mergers from galactic fields can vary over several orders of magnitude and is extremely sensitive to the assumptions of stellar evolution. But in dense stellar environments such as globular clusters, binary black holes form by well-understood gravitational interactions. In this Letter, we study the formation of black hole binaries in an extensive collection of realistic globular cluster models. By comparing these models to observed Milky Way and extragalactic globular clusters, we find that the mergers of dynamically formed binaries could be detected at a rate of ∼100 per year, potentially dominating the binary black hole merger rate. We also find that a majority of cluster-formed binaries are more massive than their field-formed counterparts, suggesting that Advanced LIGO could identify certain binaries as originating from dense stellar environments.
Prša, Andrej; Batalha, Natalie; Slawson, Robert W.; Doyle, Laurance R.; Welsh, William F.; Orosz, Jerome A.; Seager, Sara; Rucker, Michael; Mjaseth, Kimberly; Engle, Scott G.; Conroy, Kyle; Jenkins, Jon; Caldwell, Douglas; Koch, David; Borucki, William
2011-03-01
The Kepler space mission is devoted to finding Earth-size planets orbiting other stars in their habitable zones. Its large, 105 deg2 field of view features over 156,000 stars that are observed continuously to detect and characterize planet transits. Yet, this high-precision instrument holds great promise for other types of objects as well. Here we present a comprehensive catalog of eclipsing binary stars observed by Kepler in the first 44 days of operation, the data being publicly available through MAST as of 2010 June 15. The catalog contains 1879 unique objects. For each object, we provide its Kepler ID (KID), ephemeris (BJD0, P 0), morphology type, physical parameters (T eff, log g, E(B - V)), the estimate of third light contamination (crowding), and principal parameters (T 2/T 1, q, fillout factor, and sin i for overcontacts, and T 2/T 1, (R 1 + R 2)/a, esin ω, ecos ω, and sin i for detached binaries). We present statistics based on the determined periods and measure the average occurrence rate of eclipsing binaries to be ~1.2% across the Kepler field. We further discuss the distribution of binaries as a function of galactic latitude and thoroughly explain the application of artificial intelligence to obtain principal parameters in a matter of seconds for the whole sample. The catalog was envisioned to serve as a bridge between the now public Kepler data and the scientific community interested in eclipsing binary stars.
International Nuclear Information System (INIS)
Prsa, Andrej; Engle, Scott G.; Conroy, Kyle; Batalha, Natalie; Rucker, Michael; Mjaseth, Kimberly; Slawson, Robert W.; Doyle, Laurance R.; Welsh, William F.; Orosz, Jerome A.; Seager, Sara; Jenkins, Jon; Caldwell, Douglas; Koch, David; Borucki, William
2011-01-01
The Kepler space mission is devoted to finding Earth-size planets orbiting other stars in their habitable zones. Its large, 105 deg 2 field of view features over 156,000 stars that are observed continuously to detect and characterize planet transits. Yet, this high-precision instrument holds great promise for other types of objects as well. Here we present a comprehensive catalog of eclipsing binary stars observed by Kepler in the first 44 days of operation, the data being publicly available through MAST as of 2010 June 15. The catalog contains 1879 unique objects. For each object, we provide its Kepler ID (KID), ephemeris (BJD 0 , P 0 ), morphology type, physical parameters (T eff , log g, E(B - V)), the estimate of third light contamination (crowding), and principal parameters (T 2 /T 1 , q, fillout factor, and sin i for overcontacts, and T 2 /T 1 , (R 1 + R 2 )/a, esin ω, ecos ω, and sin i for detached binaries). We present statistics based on the determined periods and measure the average occurrence rate of eclipsing binaries to be ∼1.2% across the Kepler field. We further discuss the distribution of binaries as a function of galactic latitude and thoroughly explain the application of artificial intelligence to obtain principal parameters in a matter of seconds for the whole sample. The catalog was envisioned to serve as a bridge between the now public Kepler data and the scientific community interested in eclipsing binary stars.
Binary evolution and observational constraints
International Nuclear Information System (INIS)
Loore, C. de
1984-01-01
The evolution of close binaries is discussed in connection with problems concerning mass and angular momentum losses. Theoretical and observational evidence for outflow of matter, leaving the system during evolution is given: statistics on total masses and mass ratios, effects of the accretion of the mass gaining component, the presence of streams, disks, rings, circumstellar envelopes, period changes, abundance changes in the atmosphere. The effects of outflowing matter on the evolution is outlined, and estimates of the fraction of matter expelled by the loser, and leaving the system, are given. The various time scales involved with evolution and observation are compared. Examples of non conservative evolution are discussed. Problems related to contact phases, on mass and energy losses, in connection with entropy changes are briefly analysed. For advanced stages the disruption probabilities for supernova explosions are examined. A global picture is given for the evolution of massive close binaries, from ZAMS, through WR phases, X-ray phases, leading to runaway pulsars or to a binary pulsar and later to a millisecond pulsar. (Auth.)
International Nuclear Information System (INIS)
Apparao, K.M.V.
1977-01-01
Reference is made to the radio binary systems CC Cas, AR Lac, β Per (Algol), β Lyr, b Per and Cyg X-1. It is stated that a thermal interpretation of the radiation from Algol requires a much larger x-ray flux than the observed value of 3.8 x 10 -11 erg/cm 2 /sec/keV in the 2 to 6 keV energy range. Observations of some non-thermal flares, together with the small size of the radio source in Algol, indicate that the radio emission is non-thermal in nature. The radio emission is interpreted as synchrotron radiation and it is suggested that the observed x-ray emission is due to inverse Compton scattering of the light of the primary star by the radio electrons. The x-ray emission from other radio binaries is also calculated using this model. The energy for the radio electrons can arise from annihilation of magnetic lines connecting the binary stars, twisted by the rotation of the stars. (U.K.)
Binarity and Variable Stars in the Open Cluster NGC 2126
Chehlaeh, Nareemas; Mkrtichian, David; Kim, Seung-Lee; Lampens, Patricia; Komonjinda, Siramas; Kusakin, Anatoly; Glazunova, Ljudmila
2018-04-01
We present the results of an analysis of photometric time-series observations for NGC 2126 acquired at the Thai National Observatory (TNO) in Thailand and the Mount Lemmon Optical Astronomy Observatory (LOAO) in USA during the years 2004, 2013 and 2015. The main purpose is to search for new variable stars and to study the light curves of binary systems as well as the oscillation spectra of pulsating stars. NGC 2126 is an intermediate-age open cluster which has a population of stars inside the δ Scuti instability strip. Several variable stars are reported including three eclipsing binary stars, one of which is an eclipsing binary star with a pulsating component (V551 Aur). The Wilson-Devinney technique was used to analyze its light curves and to determine a new set of the system’s parameters. A frequency analysis of the eclipse-subtracted light curve was also performed. Eclipsing binaries which are members of open clusters are capable of delivering strong constraints on the cluster’s properties which are in turn useful for a pulsational analysis of their pulsating components. Therefore, high-resolution, high-quality spectra will be needed to derive accurate component radial velocities of the faint eclipsing binaries which are located in the field of NGC 2126. The new Devasthal Optical Telescope, suitably equipped, could in principle do this.
Binary Relations as a Foundation of Mathematics
Kuper, Jan; Barendsen, E.; Capretta, V.; Geuvers, H.; Niqui, M.
2007-01-01
We describe a theory for binary relations in the Zermelo-Fraenkel style. We choose for ZFCU, a variant of ZFC Set theory in which the Axiom of Foundation is replaced by an axiom allowing for non-wellfounded sets. The theory of binary relations is shown to be equi-consistent ZFCU by constructing a
DEFF Research Database (Denmark)
Bruntt, Hans; Southworth, J.; Penny, A. J.
2006-01-01
Stars: fundamental parameters, binaries: close, eclipsing, techniques: photometric Udgivelsesdato: Sep.......Stars: fundamental parameters, binaries: close, eclipsing, techniques: photometric Udgivelsesdato: Sep....
Hybrid Black-Hole Binary Initial Data
Mundim, Bruno C.; Kelly, Bernard J.; Nakano, Hiroyuki; Zlochower, Yosef; Campanelli, Manuela
2010-01-01
"Traditional black-hole binary puncture initial data is conformally flat. This unphysical assumption is coupled with a lack of radiation signature from the binary's past life. As a result, waveforms extracted from evolutions of this data display an abrupt jump. In Kelly et al. [Class. Quantum Grav. 27:114005 (2010)], a new binary black-hole initial data with radiation contents derived in the post-Newtonian (PN) calculations was adapted to puncture evolutions in numerical relativity. This data satisfies the constraint equations to the 2.5PN order, and contains a transverse-traceless "wavy" metric contribution, violating the standard assumption of conformal flatness. Although the evolution contained less spurious radiation, there were undesired features; the unphysical horizon mass loss and the large initial orbital eccentricity. Introducing a hybrid approach to the initial data evaluation, we significantly reduce these undesired features."
ADDITIONAL MASSIVE BINARIES IN THE CYGNUS OB2 ASSOCIATION
International Nuclear Information System (INIS)
Kiminki, Daniel C.; Kobulnicky, Henry A.; Ewing, Ian; Lundquist, Michael; Alexander, Michael; Vargas-Alvarez, Carlos; Choi, Heather; Bagley Kiminki, Megan M.; Henderson, C. B.
2012-01-01
We report the discovery and orbital solutions for two new OB binaries in the Cygnus OB2 Association, MT311 (B2V + B3V) and MT605 (B0.5V + B2.5:V). We also identify the system MT429 as a probable triple system consisting of a tight eclipsing 2.97 day B3V+B6V pair and a B0V at a projected separation of 138 AU. We further provide the first spectroscopic orbital solutions to the eclipsing, double-lined, O-star binary MT696 (O9.5V + B1:V), the double-lined, early B binary MT720 (B0-1V + B1-2V), and the double-lined, O-star binary MT771 (O7V + O9V). These systems exhibit orbital periods between 1.5 days and 12.3 days, with the majority having P <6 days. The two new binary discoveries and six spectroscopic solutions bring the total number of known massive binaries in the central region of the Cygnus OB2 Association to 20, with all but two having full orbital solutions.
ADDITIONAL MASSIVE BINARIES IN THE CYGNUS OB2 ASSOCIATION
Energy Technology Data Exchange (ETDEWEB)
Kiminki, Daniel C.; Kobulnicky, Henry A.; Ewing, Ian; Lundquist, Michael; Alexander, Michael; Vargas-Alvarez, Carlos; Choi, Heather [Department of Physics and Astronomy, University of Wyoming, Laramie, WY 82070 (United States); Bagley Kiminki, Megan M. [Department of Astronomy, University of Arizona, Tucson, AZ 85721 (United States); Henderson, C. B. [Department of Astronomy, Ohio State University, Columbus, OH 43210 (United States)
2012-03-01
We report the discovery and orbital solutions for two new OB binaries in the Cygnus OB2 Association, MT311 (B2V + B3V) and MT605 (B0.5V + B2.5:V). We also identify the system MT429 as a probable triple system consisting of a tight eclipsing 2.97 day B3V+B6V pair and a B0V at a projected separation of 138 AU. We further provide the first spectroscopic orbital solutions to the eclipsing, double-lined, O-star binary MT696 (O9.5V + B1:V), the double-lined, early B binary MT720 (B0-1V + B1-2V), and the double-lined, O-star binary MT771 (O7V + O9V). These systems exhibit orbital periods between 1.5 days and 12.3 days, with the majority having P <6 days. The two new binary discoveries and six spectroscopic solutions bring the total number of known massive binaries in the central region of the Cygnus OB2 Association to 20, with all but two having full orbital solutions.
Physics of Relativistic Objects in Compact Binaries: From Birth to Coalescence
Colpi, Monica; Gorini, Vittorio; Moschella, Ugo; Possenti, Andrea
2009-01-01
This book provides a comprehensive, authoritative and timely review of the astrophysical approach to the investigation of gravity theories. Particular attention is paid to strong-field tests of general relativity and alternative theories of gravity, performed using collapsed objects (neutron stars, black holes and white dwarfs) in relativistic binaries as laboratories. The book starts with an introduction which gives the background linking experimental gravity in cosmic laboratories to astrophysics and fundamental physics. Subsequent chapters cover observational and theoretical aspects of the following topics: from binaries as test-beds of gravity theories to binary pulsars as cosmic laboratories; from binary star evolution to the formation of relativistic binaries; from short gamma-ray bursts to low mass X-ray binaries; from stellar-mass black hole binaries to coalescing super-massive black holes in galaxy mergers. The book will be useful to researchers, PhD and graduate students in Astrophysics, Cosmology, ...
Optical studies of massive X-ray binaries
International Nuclear Information System (INIS)
Zuiderwijk, E.J.
1979-01-01
Photometric and spectroscopic studies of several optical counterparts of massive X-ray binaries are presented. Subjects of study were the binary systems:HD77581/4U0900-40 (Vela X-1), HD153919/4U1700-37, Wray 977/4U1223-62 and Sk160/4U0115-74 (=SMC X-1). (Auth.)
Binary pairs of supermassive black holes - Formation in merging galaxies
Energy Technology Data Exchange (ETDEWEB)
Valtaoja, L.; Valtonen, M.J.; Byrd, G.G. (Turku Univ. (Finland); Alabama Univ., Tuscaloosa (USA))
1989-08-01
A process in which supermassive binary blackholes are formed in nuclei of supergiant galaxies due to galaxy mergers is examined. There is growing evidence that mergers of galaxies are common and that supermassive black holes in center of galaxies are also common. Consequently, it is expected that binary black holes should arise in connection with galaxy mergers. The merger process in a galaxy modeled after M87 is considered. The capture probability of a companion is derived as a function of its mass. Assuming a correlation between the galaxy mass and the blackholes mass, the expected mass ratio in binary black holes is calculated. The binary black holes formed in this process are long lived, surviving longer than the Hubble time unless they are perturbed by black holes from successive mergers. The properties of these binaries agree with Gaskell's (1988) observational work on quasars and its interpretation in terms of binary black holes. 39 refs.
International Nuclear Information System (INIS)
Geier, S.; Schaffenroth, V.; Drechsel, H.; Heber, U.; Kupfer, T.; Tillich, A.; Oestensen, R. H.; Smolders, K.; Degroote, P.; Maxted, P. F. L.; Barlow, B. N.; Gaensicke, B. T.; Marsh, T. R.; Napiwotzki, R.
2011-01-01
Hot subdwarf B stars (sdBs) are extreme horizontal branch stars believed to originate from close binary evolution. Indeed about half of the known sdB stars are found in close binaries with periods ranging from a few hours to a few days. The enormous mass loss required to remove the hydrogen envelope of the red-giant progenitor almost entirely can be explained by common envelope ejection. A rare subclass of these binaries are the eclipsing HW Vir binaries where the sdB is orbited by a dwarf M star. Here, we report the discovery of an HW Vir system in the course of the MUCHFUSS project. A most likely substellar object (≅0.068 M sun ) was found to orbit the hot subdwarf J08205+0008 with a period of 0.096 days. Since the eclipses are total, the system parameters are very well constrained. J08205+0008 has the lowest unambiguously measured companion mass yet found in a subdwarf B binary. This implies that the most likely substellar companion has not only survived the engulfment by the red-giant envelope, but also triggered its ejection and enabled the sdB star to form. The system provides evidence that brown dwarfs may indeed be able to significantly affect late stellar evolution.
Binaries traveling through a gaseous medium: dynamical drag forces and internal torques
Energy Technology Data Exchange (ETDEWEB)
Sánchez-Salcedo, F. J. [Instituto de Astronomía, Universidad Nacional Autónoma de México, Ciudad Universitaria, Apt. Postal 70 264, C.P. 04510, Mexico City (Mexico); Chametla, Raul O., E-mail: jsanchez@astro.unam.mx [Escuela Superior de Física y Matemáticas, Instituto Politécnico Nacional, UP Adolfo López Mateos, Mexico City (Mexico)
2014-10-20
Using time-dependent linear theory, we investigate the morphology of the gravitational wake induced by a binary, whose center of mass moves at velocity V{sub cm} against a uniform background of gas. For simplicity, we assume that the components of the binary are on circular orbits about their common center of mass. The consequences of dynamical friction is twofold. First, gas dynamical friction may drag the center of mass of the binary and cause the binary to migrate. Second, drag forces also induce a braking torque, which causes the orbits of the components of the binary to shrink. We compute the drag forces acting on one component of the binary due to the gravitational interaction with its own wake. We show that the dynamical friction force responsible for decelerating the center of mass of the binary is smaller than it is in the point-mass case because of the loss of gravitational focusing. We show that the braking internal torque depends on the Mach numbers of each binary component about their center of mass, and also on the Mach number of the center of mass of the binary. In general, the internal torque decreases with increasing the velocity of the binary relative to the ambient gas cloud. However, this is not always the case. We also mention the relevance of our results to the period distribution of binaries.
Close Binaries in the 21st Century: New Opportunities and Challenges
Giménez, Àlvaro; Niarchos, Panagiotis; Rucinski, Slavek
2006-01-01
An International Conference entitled "Close Binaries in the 21st Century: New Opportunities and Challenges", was held in Syros island, Greece, from 27 to 30 June, 2005. There are many binary star systems whose components are so close together, that they interact in various ways. Stars in such systems do not pass through all stages of their evolution independently of each other; in fact their evolutionary path is significantly affected by their companions. Processes of interaction include gravitational effects, mutual irradiation, mass exchange, mass loss from the system, phenomena of extended atmospheres, semi-transparent atmospheric clouds, variable thickness disks and gas streams. The zoo of Close Binary Systems includes: Close Eclipsing Binaries (Detached, Semi-detached, Contact), High and Low-Mass X-ray Binaries, Cataclysmic Variables, RS CVn systems, Pulsar Binaries and Symbiotic Stars. The study of these binaries triggered the development of new branches of astrophysics dealing with the structure and ev...
A DEEPLY ECLIPSING DETACHED DOUBLE HELIUM WHITE DWARF BINARY
International Nuclear Information System (INIS)
Parsons, S. G.; Marsh, T. R.; Gaensicke, B. T.; Drake, A. J.; Koester, D.
2011-01-01
Using Liverpool Telescope+RISE photometry we identify the 2.78 hr period binary star CSS 41177 as a detached eclipsing double white dwarf binary with a 21,100 K primary star and a 10,500 K secondary star. This makes CSS 41177 only the second known eclipsing double white dwarf binary after NLTT 11748. The 2 minute long primary eclipse is 40% deep and the secondary eclipse 10% deep. From Gemini+GMOS spectroscopy, we measure the radial velocities of both components of the binary from the Hα absorption line cores. These measurements, combined with the light curve information, yield white dwarf masses of M 1 = 0.283 ± 0.064 M sun and M 2 = 0.274 ± 0.034 M sun , making them both helium core white dwarfs. As an eclipsing, double-lined spectroscopic binary, CSS 41177 is ideally suited to measuring precise, model-independent masses and radii. The two white dwarfs will merge in roughly 1.1 Gyr to form a single sdB star.
Binary Biometric Representation through Pairwise Adaptive Phase Quantization
Chen, C.; Veldhuis, Raymond N.J.
Extracting binary strings from real-valued biometric templates is a fundamental step in template compression and protection systems, such as fuzzy commitment, fuzzy extractor, secure sketch, and helper data systems. Quantization and coding is the straightforward way to extract binary representations
Diffusion in ordered binary solid systems
International Nuclear Information System (INIS)
Stolwijk, N.A.
1980-01-01
This thesis contains contributions to the field of diffusion in ordered binary solid systems. An extensive experimental investigation of the self diffusion in CoGa is presented. The results of these diffusion measurements strongly suggest that a substantial part of the atomic migration is caused by a new type of defect. A quantitative description of the atomic displacements via this defect is given. Finally computer simulations are presented of diffusion and ordering in binary solid systems. (Auth.)
An Introduction to Binary Decision Diagrams
DEFF Research Database (Denmark)
Andersen, Henrik Reif
1996-01-01
This note is a short introduction to Binary Decision Diagrams (BDDs). It provides some background knowledge and describes the core algorithms. It is used in the course "C4340 Advanced Algorithms" at the Technical University of Denmark, autumn 1996.......This note is a short introduction to Binary Decision Diagrams (BDDs). It provides some background knowledge and describes the core algorithms. It is used in the course "C4340 Advanced Algorithms" at the Technical University of Denmark, autumn 1996....
Energy Technology Data Exchange (ETDEWEB)
Hrivnak, Bruce J.; Lu, Wenxian [Department of Physics and Astronomy, Valparaiso University, Valparaiso, IN 46383 (United States); Steene, Griet Van de [Royal Observatory of Belgium, Astronomy and Astrophysics, Ringlaan 3, Brussels (Belgium); Winckel, Hans Van [Instituut voor Sterrenkunde, K.U. Leuven University, Celestijnenlaan 200 D, B-3001 Leuven (Belgium); Sperauskas, Julius [Vilnius University Observatory, Ciurlionio 29 Vilnius 2009 (Lithuania); Bohlender, David, E-mail: bruce.hrivnak@valpo.edu, E-mail: wen.lu@valpo.edu, E-mail: g.vandesteene@oma.be, E-mail: Hans.VanWinckel@ster.kuleuven.be, E-mail: julius.sperauskas@ff.vu.lt, E-mail: David.Bohlender@nrc-cnrc.gc.ca [National Research Council of Canada, Herzberg Astronomy and Astrophysics, 5071 West Saanich Road, Victoria, BC V9E 2E7 (Canada)
2017-09-10
We present the results of an expanded, long-term radial velocity search (25 years) for evidence of binarity in a sample of seven bright proto-planetary nebulae (PPNe). The goal is to investigate the widely held view that the bipolar or point-symmetric shapes of planetary nebulae (PNe) and PPNe are due to binary interactions. Observations from three observatories were combined from 2007 to 2015 to search for variations on the order of a few years and then combined with earlier observations from 1991 to 1995 to search for variations on the order of decades. All seven show velocity variations due to periodic pulsation in the range of 35–135 days. However, in only one PPN, IRAS 22272+5435, did we find even marginal evidence for multi-year variations that might be due to a binary companion. This object shows marginally significant evidence of a two-year period of low semi-amplitude, which could be due to a low-mass companion, and it also displays some evidence of a much longer period of >30 years. The absence of evidence in the other six objects for long-period radial velocity variations due to a binary companion sets significant constraints on the properties of any undetected binary companions: they must be of low mass, ≤0.2 M {sub ⊙}, or long period, >30 years. Thus the present observations do not provide direct support for the binary hypothesis to explain the shapes of PNe and PPNe and severely constrains the properties of any such undetected companions.
Gravitational waves from spinning eccentric binaries
Csizmadia, Péter; Debreczeni, Gergely; Rácz, István; Vasúth, Mátyás
2012-12-01
This paper is to introduce a new software called CBwaves which provides a fast and accurate computational tool to determine the gravitational waveforms yielded by generic spinning binaries of neutron stars and/or black holes on eccentric orbits. This is done within the post-Newtonian (PN) framework by integrating the equations of motion and the spin precession equations, while the radiation field is determined by a simultaneous evaluation of the analytic waveforms. In applying CBwaves various physically interesting scenarios have been investigated. In particular, we have studied the appropriateness of the adiabatic approximation, and justified that the energy balance relation is indeed insensitive to the specific form of the applied radiation reaction term. By studying eccentric binary systems, it is demonstrated that circular template banks are very ineffective in identifying binaries even if they possess tiny residual orbital eccentricity, thus confirming a similar result obtained by Brown and Zimmerman (2010 Phys. Rev. D 81 024007). In addition, by investigating the validity of the energy balance relation we show that, contrary to the general expectations, the PN approximation should not be applied once the PN parameter gets beyond the critical value ˜0.08 - 0.1. Finally, by studying the early phase of the gravitational waves emitted by strongly eccentric binary systems—which could be formed e.g. in various many-body interactions in the galactic halo—we have found that they possess very specific characteristics which may be used to identify these type of binary systems. This paper is dedicated to the memory of our colleague and friend Péter Csizmadia a young physicist, computer expert and one of the best Hungarian mountaineers who disappeared in China’s Sichuan near the Ren Zhong Feng peak of the Himalayas on 23 Oct. 2009. We started to develop CBwaves jointly with Péter a couple of months before he left for China.
Rotation invariant deep binary hashing for fast image retrieval
Dai, Lai; Liu, Jianming; Jiang, Aiwen
2017-07-01
In this paper, we study how to compactly represent image's characteristics for fast image retrieval. We propose supervised rotation invariant compact discriminative binary descriptors through combining convolutional neural network with hashing. In the proposed network, binary codes are learned by employing a hidden layer for representing latent concepts that dominate on class labels. A loss function is proposed to minimize the difference between binary descriptors that describe reference image and the rotated one. Compared with some other supervised methods, the proposed network doesn't have to require pair-wised inputs for binary code learning. Experimental results show that our method is effective and achieves state-of-the-art results on the CIFAR-10 and MNIST datasets.
The Frequency of Binary Stars in the Globular Cluster M71
Barden, S. C.; Armandroff, T. E.; Pryor, C. P.
1994-12-01
The frequency of binary stars is a fundamental property of a stellar population. A comparison of the frequency of binaries in globular clusters with those in the field halo and disk populations tests the similarity of star formation in those environments. Binary stars in globular clusters also act as an energy source which ``heats" the cluster through super-elastic encounters with other stars and binaries. Such encounters can not only profoundly affect the dynamical evolution of the cluster, they can disrupt the widely separated binaries and catalyze the formation of exotic objects such as blue stragglers, x-ray binaries, and milli-second pulsars. We have used the KPNO 4-m and the multi-fiber instruments Nessie and Hydra to measure radial velocities at 4 epochs over two years for a sample of 126 stars in the globular cluster M71. Velocity errors are under 1 km s(-1) for the brighter stars and under 2 km s(-1) for the majority of our data set. These velocities will be valuable for studying the kinematics of M71, but here we focus on searching for binaries. The faintest stars are at V=17, or just above the main sequence turnoff. Our sample is thus deeper than any published globular cluster binary search utilizing spectroscopic techniques. By observing smaller stars, we double the number of decades of binary periods sampled compared to previous studies and come within a factor of 4 of the shortest possible periods for turnoff stars. This wider period window has produced the largest known sample of binaries in a globular cluster. Four stars show velocity ranges larger than 20 km s(-1) , nine have ranges larger than 10 km s(-1) , and others are clearly variable. We will compare the radial distribution of these stars to that predicted by theory and derive the main-sequence binary fraction.
Binary black holes on a budget: simulations using workstations
International Nuclear Information System (INIS)
Marronetti, Pedro; Tichy, Wolfgang; Bruegmann, Bernd; Gonzalez, Jose; Hannam, Mark; Husa, Sascha; Sperhake, Ulrich
2007-01-01
Binary black hole simulations have traditionally been computationally very expensive: current simulations are performed in supercomputers involving dozens if not hundreds of processors, thus systematic studies of the parameter space of binary black hole encounters still seem prohibitive with current technology. Here we show how the multi-layered refinement level code BAM can be used on dual processor workstations to simulate certain binary black hole systems. BAM, based on the moving punctures method, provides grid structures composed of boxes of increasing resolution near the centre of the grid. In the case of binaries, the highest resolution boxes are placed around each black hole and they track them in their orbits until the final merger when a single set of levels surrounds the black hole remnant. This is particularly useful when simulating spinning black holes since the gravitational fields gradients are larger. We present simulations of binaries with equal mass black holes with spins parallel to the binary axis and intrinsic magnitude of S/m 2 = 0.75. Our results compare favourably to those of previous simulations of this particular system. We show that the moving punctures method produces stable simulations at maximum spatial resolutions up to M/160 and for durations of up to the equivalent of 20 orbital periods
Energy Technology Data Exchange (ETDEWEB)
Hsu, Yi-Chao [Division of Regenerative Medicine, Institute of Cellular and System Medicine, National Health Research Institutes, Miaoli, Taiwan (China); Institute of Biomedical Sciences, Mackay Medical College, New Taipei City, Taiwan (China); Kao, Chien-Yu [Division of Regenerative Medicine, Institute of Cellular and System Medicine, National Health Research Institutes, Miaoli, Taiwan (China); Graduate Program of Biotechnology in Medicine, Institute of Biotechnology and Department of Life Science, National Tsing Hua University, Hsinchu, Taiwan (China); Chung, Yu-Fen; Lee, Don-Ching [Division of Regenerative Medicine, Institute of Cellular and System Medicine, National Health Research Institutes, Miaoli, Taiwan (China); Liu, Jen-Wei [Division of Regenerative Medicine, Institute of Cellular and System Medicine, National Health Research Institutes, Miaoli, Taiwan (China); Department of Life Sciences, National Chung Hsing University, Taichung, Taiwan (China); Chiu, Ing-Ming, E-mail: ingming@nhri.org.tw [Division of Regenerative Medicine, Institute of Cellular and System Medicine, National Health Research Institutes, Miaoli, Taiwan (China); Graduate Program of Biotechnology in Medicine, Institute of Biotechnology and Department of Life Science, National Tsing Hua University, Hsinchu, Taiwan (China); Department of Life Sciences, National Chung Hsing University, Taichung, Taiwan (China)
2016-06-10
Fibroblast growth factor 1 (FGF1) binds and activates FGF receptors, thereby regulating cell proliferation and neurogenesis. Human FGF1 gene 1B promoter (−540 to +31)-driven SV40 T antigen has been shown to result in tumorigenesis in the brains of transgenic mice. FGF1B promoter (−540 to +31)-driven green fluorescent protein (F1BGFP) has also been used in isolating neural stem cells (NSCs) with self-renewal and multipotency from developing and adult mouse brains. In this study, we provide six lines of evidence to demonstrate that FGF1/FGFR signaling is implicated in the expression of Aurora A (AurA) and the activation of its kinase domain (Thr288 phosphorylation) in the maintenance of glioblastoma (GBM) cells and NSCs. First, treatment of FGF1 increases AurA expression in human GBM cell lines. Second, using fluorescence-activated cell sorting, we observed that F1BGFP reporter facilitates the isolation of F1BGFP(+) GBM cells with higher expression levels of FGFR and AurA. Third, both FGFR inhibitor (SU5402) and AurA inhibitor (VX680) could down-regulate F1BGFP-dependent AurA activity. Fourth, inhibition of AurA activity by two different AurA inhibitors (VX680 and valproic acid) not only reduced neurosphere formation but also induced neuronal differentiation of F1BGFP(+) GBM cells. Fifth, flow cytometric analyses demonstrated that F1BGFP(+) GBM cells possessed different NSC cell surface markers. Finally, inhibition of AurA by VX680 reduced the neurosphere formation of different types of NSCs. Our results show that activation of AurA kinase through FGF1/FGFR signaling axis sustains the stem cell characteristics of GBM cells. Implications: This study identified a novel mechanism for the malignancy of GBM, which could be a potential therapeutic target for GBM. - Highlights: • We report that FGF1 treatment can stimulate AurA kinase expression in human GBM cells. • FGF1/FGFR signaling is involved in the activation of AurA kinase. • FGF1 sustains the self
International Nuclear Information System (INIS)
Hsu, Yi-Chao; Kao, Chien-Yu; Chung, Yu-Fen; Lee, Don-Ching; Liu, Jen-Wei; Chiu, Ing-Ming
2016-01-01
Fibroblast growth factor 1 (FGF1) binds and activates FGF receptors, thereby regulating cell proliferation and neurogenesis. Human FGF1 gene 1B promoter (−540 to +31)-driven SV40 T antigen has been shown to result in tumorigenesis in the brains of transgenic mice. FGF1B promoter (−540 to +31)-driven green fluorescent protein (F1BGFP) has also been used in isolating neural stem cells (NSCs) with self-renewal and multipotency from developing and adult mouse brains. In this study, we provide six lines of evidence to demonstrate that FGF1/FGFR signaling is implicated in the expression of Aurora A (AurA) and the activation of its kinase domain (Thr288 phosphorylation) in the maintenance of glioblastoma (GBM) cells and NSCs. First, treatment of FGF1 increases AurA expression in human GBM cell lines. Second, using fluorescence-activated cell sorting, we observed that F1BGFP reporter facilitates the isolation of F1BGFP(+) GBM cells with higher expression levels of FGFR and AurA. Third, both FGFR inhibitor (SU5402) and AurA inhibitor (VX680) could down-regulate F1BGFP-dependent AurA activity. Fourth, inhibition of AurA activity by two different AurA inhibitors (VX680 and valproic acid) not only reduced neurosphere formation but also induced neuronal differentiation of F1BGFP(+) GBM cells. Fifth, flow cytometric analyses demonstrated that F1BGFP(+) GBM cells possessed different NSC cell surface markers. Finally, inhibition of AurA by VX680 reduced the neurosphere formation of different types of NSCs. Our results show that activation of AurA kinase through FGF1/FGFR signaling axis sustains the stem cell characteristics of GBM cells. Implications: This study identified a novel mechanism for the malignancy of GBM, which could be a potential therapeutic target for GBM. - Highlights: • We report that FGF1 treatment can stimulate AurA kinase expression in human GBM cells. • FGF1/FGFR signaling is involved in the activation of AurA kinase. • FGF1 sustains the self
DEFF Research Database (Denmark)
Hagman, Marie; Helge, Eva Wulff; Hornstrup, Therese
2018-01-01
001) BMD in all femoral regions and total proximal femur in both legs compared to UY. The whole-body DXA scan confirmed these results, with FTE showing similar whole-body BMD and 7.9% higher (p 0.05) leg BMD compared to UY, and with FTY having 9.6% higher (p 001) whole-body BMD and 18.2...... men. Methods: One hundred and forty healthy, non-smoking men participated in the study, including lifelong trained football players (FTE, n = 35) aged 65-80 years, elite football players (FTY, n = 35) aged 18-30 years, as well as untrained age-matched elderly (UE, n = 35) and young (UY, n = 35) men....... All participants underwent a regional Dual-Energy X-ray Absorptiometry (DXA) scan of the proximal femur and a whole-body DXA scan to determine BMD. From a resting blood sample, the bone turnover markers (BTMs) osteocalcin, carboxy-terminal type-1 collagen crosslinks (CTX-1), procollagen type-1 amino...
Compact Binary Progenitors of Short Gamma-Ray Bursts
Giacomazzo, Bruno; Perna, Rosalba; Rezzolla, Luciano; Troja, Eleonora; Lazzati, Davide
2013-01-01
In recent years, detailed observations and accurate numerical simulations have provided support to the idea that mergers of compact binaries containing either two neutron stars (NSs) or an NS and a black hole (BH) may constitute the central engine of short gamma-ray bursts (SGRBs). The merger of such compact binaries is expected to lead to the production of a spinning BH surrounded by an accreting torus. Several mechanisms can extract energy from this system and power the SGRBs. Here we connect observations and numerical simulations of compact binary mergers, and use the current sample of SGRBs with measured energies to constrain the mass of their powering tori. By comparing the masses of the tori with the results of fully general-relativistic simulations, we are able to infer the properties of the binary progenitors that yield SGRBs. By assuming a constant efficiency in converting torus mass into jet energy epsilon(sub jet) = 10%, we find that most of the tori have masses smaller than 0.01 Solar M, favoring "high-mass" binary NSs mergers, i.e., binaries with total masses approx >1.5 the maximum mass of an isolated NS. This has important consequences for the gravitational wave signals that may be detected in association with SGRBs, since "high-mass" systems do not form a long-lived hypermassive NS after the merger. While NS-BH systems cannot be excluded to be the engine of at least some of the SGRBs, the BH would need to have an initial spin of approx. 0.9 or higher.
Young and Waltzing Binary Stars
2001-10-01
ADONIS Observes Low-mass Eclipsing System in Orion Summary A series of very detailed images of a binary system of two young stars have been combined into a movie . In merely 3 days, the stars swing around each other. As seen from the earth, they pass in front of each other twice during a full revolution, producing eclipses during which their combined brightness diminishes . A careful analysis of the orbital motions has now made it possible to deduce the masses of the two dancing stars . Both turn out to be about as heavy as our Sun. But while the Sun is about 4500 million years old, these two stars are still in their infancy. They are located some 1500 light-years away in the Orion star-forming region and they probably formed just 10 million years ago . This is the first time such an accurate determination of the stellar masses could be achieved for a young binary system of low-mass stars . The new result provides an important piece of information for our current understanding of how young stars evolve. The observations were obtained by a team of astronomers from Italy and ESO [1] using the ADaptive Optics Near Infrared System (ADONIS) on the 3.6-m telescope at the ESO La Silla Observatory. PR Photo 29a/01 : The RXJ 0529.4+0041 system before primary eclipse PR Photo 29b/01 : The RXJ 0529.4+0041 system at mid-primary eclipse PR Photo 29c/01 : The RXJ 0529.4+0041 system after primary eclipse PR Photo 29d/01 : The RXJ 0529.4+0041 system before secondary eclipse PR Photo 29e/01 : The RXJ 0529.4+0041 system at mid-secondary eclipse PR Photo 29f/01 : The RXJ 0529.4+0041 system after secondary eclipse PR Video Clip 06/01 : Video of the RXJ 0529.4+0041 system Binary stars and stellar masses Since some time, astronomers have noted that most stars seem to form in binary or multiple systems. This is quite fortunate, as the study of binary stars is the only way in which it is possible to measure directly one of the most fundamental quantities of a star, its mass. The mass of a
Long-term captures of low-mass intruders by binary stars
International Nuclear Information System (INIS)
Hills, J.G.
1983-01-01
Intensive computer simulations were made of three families of encounters between a binary star and a low-mass intruder which previous work indicated have a high probability of producing long-lived triple-star systems. For comparison, a fourth family which produces few long-lived trinaries was also studied. In the first two families, the binary components are equally massive and the closest approach of the intruder to the center of mass of the binary is about two times its semimajor axis, a 0 . In Family 1, the orbit of the original binary is circular, e = 0, while in Family 2, e 0 = 0.95. In Family 3 one binary component is 100 times as massive as the other, the orbit is circular, and the low-mass intruder enters the binary at nearly zero impact parameter. The probability that the intruder is trapped for at least one revolution around the binary is 0.24, 0.46, and 0.51, respectively, for these three families of encounters. The fraction of the intruders surviving successive revolutions drops rapidly. However, one encounter in Family 1 and two in Family 3 resulted in the intruder making more than 300 revolutions around the inner binary before escaping. Some intruders remained bound for more than 20 000 revolutions of the inner binary. The longest duration captures occur when the intruder is thrown into an orbit with a very large semimajor axis. About 20% of the encounters in the three families result in the intruder being thrown into an orbit with a semimajor axis a>100 a 0 , while about 2% result in the intruder going into an orbit with a>1000 a 0 . Intruders thrown into these large semimajor axis orbits have the best chance of having their orbits stabilized by passing stars
THE BINARY FRACTION OF LOW-MASS WHITE DWARFS
International Nuclear Information System (INIS)
Brown, Justin M.; Kilic, Mukremin; Brown, Warren R.; Kenyon, Scott J.
2011-01-01
We describe spectroscopic observations of 21 low-mass (≤0.45 M sun ) white dwarfs (WDs) from the Palomar-Green survey obtained over four years. We use both radial velocities and infrared photometry to identify binary systems, and find that the fraction of single, low-mass WDs is ≤30%. We discuss the potential formation channels for these single stars including binary mergers of lower-mass objects. However, binary mergers are not likely to explain the observed number of single low-mass WDs. Thus, additional formation channels, such as enhanced mass loss due to winds or interactions with substellar companions, are likely.
Formation of the wide asynchronous binary asteroid population
International Nuclear Information System (INIS)
Jacobson, Seth A.; Scheeres, Daniel J.; McMahon, Jay
2014-01-01
We propose and analyze a new mechanism for the formation of the wide asynchronous binary population. These binary asteroids have wide semimajor axes relative to most near-Earth and main belt asteroid systems. Confirmed members have rapidly rotating primaries and satellites that are not tidally locked. Previously suggested formation mechanisms from impact ejecta, from planetary flybys, and directly from rotational fission events cannot satisfy all of the observations. The newly hypothesized mechanism works as follows: (1) these systems are formed from rotational fission, (2) their satellites are tidally locked, (3) their orbits are expanded by the binary Yarkovsky-O'Keefe-Radzievskii-Paddack (BYORP) effect, (4) their satellites desynchronize as a result of the adiabatic invariance between the libration of the secondary and the mutual orbit, and (5) the secondary avoids resynchronization because of the YORP effect. This seemingly complex chain of events is a natural pathway for binaries with satellites that have particular shapes, which define the BYORP effect torque that acts on the system. After detailing the theory, we analyze each of the wide asynchronous binary members and candidates to assess their most likely formation mechanism. Finally, we suggest possible future observations to check and constrain our hypothesis.
Construction of binary status information system using PC network
International Nuclear Information System (INIS)
Kurnianto, K.; Azriani, A.; Teddy, S.
1998-01-01
Binary status information system is a part of establishing reactor parameter with Pc that function as MPR-30 Process Computer. Binary Alarm system, consist of interface hardware and input binary module terminal, prepare the information that be displayed in text message and graphical form. Monitor software give facilities that binary status of RSG-GAS components can be monitored using computer network (LAN). This program consist of two part : reside in server computer and reside in user computer. Program in server acquire data from interface and than store it in data base (Access file). Than, user computer read this file and display it in Dynamic Process and Instrumentation Diagram. The number of user computer can be more then one because data base was designed for multi-user operation
Massive Black-Hole Binary Mergers: Dynamics, Environments & Expected Detections
Kelley, Luke Zoltan
2018-05-01
This thesis studies the populations and dynamics of massive black-hole binaries and their mergers, and explores the implications for electromagnetic and gravitational-wave signals that will be detected in the near future. Massive black-holes (MBH) reside in the centers of galaxies, and when galaxies merge, their MBH interact and often pair together. We base our study on the populations of MBH and galaxies from the `Illustris' cosmological hydrodynamic simulations. The bulk of the binary merger dynamics, however, are unresolved in cosmological simulations. We implement a suite of comprehensive physical models for the merger process, like dynamical friction and gravitational wave emission, which are added in post-processing. Contrary to many previous studies, we find that the most massive binaries with near equal-mass companions are the most efficient at coalescing; though the process still typically takes gigayears.From the data produced by these MBH binary populations and their dynamics, we calculate the expected gravitational wave (GW) signals: both the stochastic, GW background of countless unresolved sources, and the GW foreground of individually resolvable binaries which resound above the noise. Ongoing experiments, called pulsar timing arrays, are sensitive to both of these types of signals. We find that, while the current lack of detections is unsurprising, both the background and foreground will plausibly be detected in the next decade. Unlike previous studies which have predicted the foreground to be significantly harder to detect than the background, we find their typical amplitudes are comparable.With traditional electromagnetic observations, there has also been a dearth of confirmed detections of MBH binary systems. We use our binaries, combined with models of emission from accreting MBH systems, to make predictions for the occurrence rate of systems observable using photometric, periodic-variability surveys. These variables should be detectable in
Formation and Evolution of Contact Binaries
Directory of Open Access Journals (Sweden)
Peter P. Eggleton
2012-06-01
Full Text Available describe a series of processes, including hierarchical fragmentation, gravitational scattering, Kozai cycles within triple systems, tidal friction and magnetic braking, that I believe are responsible for producing the modest but significant fraction of stars that are observed as contact binaries. I also discuss further processes, namely heat transport, mass transport, nuclear evolution, thermal relaxation oscillations, and further magnetic braking with tidal friction, that influence the evolution during contact. The endpoint, for contact, is that the two components merge into a single star, as recently was observed in the remarkable system V1309 Sco. The single star probably throws off some mass and rotates rapidly at first, and then slows by magnetic braking to become a rather inconspicuous but normal dwarf or subgiant. If however the contact binary was part of a triple system originally–as I suggested above was rather likely–then the result could be a widish binary with apparently non-coeval components. There are several such known.
Compact binary hashing for music retrieval
Seo, Jin S.
2014-03-01
With the huge volume of music clips available for protection, browsing, and indexing, there is an increased attention to retrieve the information contents of the music archives. Music-similarity computation is an essential building block for browsing, retrieval, and indexing of digital music archives. In practice, as the number of songs available for searching and indexing is increased, so the storage cost in retrieval systems is becoming a serious problem. This paper deals with the storage problem by extending the supervector concept with the binary hashing. We utilize the similarity-preserving binary embedding in generating a hash code from the supervector of each music clip. Especially we compare the performance of the various binary hashing methods for music retrieval tasks on the widely-used genre dataset and the in-house singer dataset. Through the evaluation, we find an effective way of generating hash codes for music similarity estimation which improves the retrieval performance.
Receptive fields selection for binary feature description.
Fan, Bin; Kong, Qingqun; Trzcinski, Tomasz; Wang, Zhiheng; Pan, Chunhong; Fua, Pascal
2014-06-01
Feature description for local image patch is widely used in computer vision. While the conventional way to design local descriptor is based on expert experience and knowledge, learning-based methods for designing local descriptor become more and more popular because of their good performance and data-driven property. This paper proposes a novel data-driven method for designing binary feature descriptor, which we call receptive fields descriptor (RFD). Technically, RFD is constructed by thresholding responses of a set of receptive fields, which are selected from a large number of candidates according to their distinctiveness and correlations in a greedy way. Using two different kinds of receptive fields (namely rectangular pooling area and Gaussian pooling area) for selection, we obtain two binary descriptors RFDR and RFDG .accordingly. Image matching experiments on the well-known patch data set and Oxford data set demonstrate that RFD significantly outperforms the state-of-the-art binary descriptors, and is comparable with the best float-valued descriptors at a fraction of processing time. Finally, experiments on object recognition tasks confirm that both RFDR and RFDG successfully bridge the performance gap between binary descriptors and their floating-point competitors.
Planetary Formation and Dynamics in Binary Systems
Xie, J. W.
2013-01-01
As of today, over 500 exoplanets have been detected since the first exoplanet was discovered around a solar-like star in 1995. The planets in binaries could be common as stars are usually born in binary or multiple star systems. Although current observations show that the planet host rate in multiple star systems is around 17%, this fraction should be considered as a lower limit because of noticeable selection effects against binaries in planet searches. Most of the current known planet-bearing binary systems are S-types, meaning the companion star acts as a distant satellite, typically orbiting the inner star-planet system over 100 AU away. Nevertheless, there are four systems with a smaller separation of 20 AU, including the Gamma Cephei, GJ 86, HD 41004, and HD 196885. In addition to the planets in circumprimary (S-type) orbits discussed above, planets in circumbinary (P-type) orbits have been found in only two systems. In this thesis, we mainly study the planet formation in the S-type binary systems. In chapter 1, we first summarize current observational facts of exoplanets both in single-star and binary systems, then review the theoretical models of planet formation, with special attention to the application in binary systems. Perturbative effects from stellar companions render the planet formation process in binary systems even more complex than that in single-star systems. The perturbations from a binary companion can excite planetesimal orbits, and increase their mutual impact velocities to the values that might exceed their escape velocity or even the critical velocity for the onset of eroding collisions. The intermediate stage of the formation process---from planetesimals to planetary embryos---is thus the most problematic. In the following chapters, we investigate whether and how the planet formation goes through such a problematic stage. In chapter 2, we study the effects of gas dissipation on the planetesimals' mutual accretion. We find that in a
Binary classification posed as a quadratically constrained quadratic ...
Indian Academy of Sciences (India)
Binary classification is posed as a quadratically constrained quadratic problem and solved using the proposed method. Each class in the binary classification problem is modeled as a multidimensional ellipsoid to forma quadratic constraint in the problem. Particle swarms help in determining the optimal hyperplane or ...
The Cool Surfaces of Binaries Near-Earth Asteroids
Delbo, Marco; Walsh, K.; Mueller, M.
2008-01-01
We present results from thermal-infrared observations of binary near-Earth asteroids (NEAs). These objects, in general, have surface temperatures cooler than the average values for non-binary NEAs. We discuss how this may be evidence of higher-than-average surface thermal inertia. The comparison of
The Mass-Ratio Distribution of Visual Binary Stars
Hogeveen, S.J.
1990-01-01
The selection effects that govern the observations of Visual Binary Stars are in- vestigated, in order to obtain a realistic statistical distribution of the mass-ratio q = Msec=Mprim. To this end a numerical simulation programme has been developed, which `generates' binary stars and `looks' at
Evolution of close binaries and the formation of pulsars
International Nuclear Information System (INIS)
Van Den Heuvel, E.P.J.
1981-01-01
The various ways in which compact objects (neutron stars and black holes) may be formed in interacting binary systems are examined. Attention is given to the final evolution of the primary star in a close binary system as a function of the time of Roche-lobe overflow relative to the onset of helium burning, and conditions on primary mass and orbital period leading to the appearance of a compact remnant are noted. Consideration of the fate of the stellar envelope in stars that directly evolve to core collapse indicates that binaries that evolve with conservation of total mass and orbital angular momentum will eventually become systems of two runaway pulsars. In cases of nonconservative evolution, the final state is expected to be a young runaway pulsar with a low- or moderate mass runaway star companion, or a low-mass population I X-ray binary with high space velocity. Compact objects may also be formed when a white dwarf of suitable chemical composition is driven over the Chandrasehkar limit by accretion, resulting in a low-mass X-ray binary
Binary classification of items of interest in a repeatable process
Abell, Jeffrey A.; Spicer, John Patrick; Wincek, Michael Anthony; Wang, Hui; Chakraborty, Debejyo
2014-06-24
A system includes host and learning machines in electrical communication with sensors positioned with respect to an item of interest, e.g., a weld, and memory. The host executes instructions from memory to predict a binary quality status of the item. The learning machine receives signals from the sensor(s), identifies candidate features, and extracts features from the candidates that are more predictive of the binary quality status relative to other candidate features. The learning machine maps the extracted features to a dimensional space that includes most of the items from a passing binary class and excludes all or most of the items from a failing binary class. The host also compares the received signals for a subsequent item of interest to the dimensional space to thereby predict, in real time, the binary quality status of the subsequent item of interest.
Minimum period and the gap in periods of Cataclysmic binaries
International Nuclear Information System (INIS)
Paczynski, B.; Sienkiewicz, R.
1983-01-01
The 81 minute cutoff to the orbital periods of hydrogen-rich cataclysmic binaries is consistent with evolution of those systems being dominated by angular momentum losses due to gravitational radiation. Unfortunately, many uncertainties, mainly poorly known atmospheric opacities below 2000 K, make is physically impossible to verify the quadrupole formula for gravitational radiation by using the observed cutoff at 81 minutes. The upper boundary of the gap in orbital periods observed at about 3 hours is almost certainly due to enhanced angular momentum losses from cataclysmic binaries which have longer periods. The physical mechanism of those losses is not identified, but a possible importance of stellar winds is pointed out. The lower boundary of the gap may be explained with the oldest cataclysmic binaries, whose periods evolved past the minimum at 81 minutes and reached the value of 2 hours within about 12 x 10 9 years after the binary had formed. Those binaries should have secondary components of only 0.02 solar masses, and their periods could be used to estimate ages of the oldest cataclysmic stars, and presumably the age of Galaxy. An alternative explanation for the gap requires that binaries should be detached while crossing the gap. A possible mechanism for this phenomenon is discussed. It requires the secondary components to be about 0.2 solar masses in the binaries just below the gap
Directory of Open Access Journals (Sweden)
Bruce J. Hrivnak
2012-03-01
Full Text Available Binary companions are often invoked to explain the axial and point symmetry seen in the majority of planetary nebulae and proto-planetary nebulae (PPNs. To explore this hypothesis, we have undertaken a long-term (20 year study of light and velocity variations in PPNs. From the photometric study of 24 PPNs, we find that all vary in brightness, and from a subset of 12 carbon-rich PPNs of F-G spectral type we find periods of 35-155 days, with the cooler having the longer periods. The variations are seen to be due to pulsation; no photometric evidence for binarity is seen. A radial velocity study of a sub-sample of seven of the brightest of these shows that they all vary with the pulsation periods. Only one shows evidence of a longer-term variation that we tentatively identify as being due to a binary companion. We conclude that the present evidence for the binary nature of these PPNs is meager and that any undetected companions of these PPNs must be of low mass ( 30 years.
International Nuclear Information System (INIS)
Vallee, R.L.
1968-01-01
The study of binary groups under their mathematical aspects constitutes the matter of binary analysis, the purpose of which consists in developing altogether simple, rigorous and practical methods needed by the technicians, the engineers and all those who may be mainly concerned by digital processing. This subject, fast extending if not determining, however tends actually to play a main part in nuclear electronics as well as in several other research areas. (authors) [fr
Excess molar volumes and isentropic compressibilities of binary
Indian Academy of Sciences (India)
Excess molar volumes (E) and deviation in isentropic compressibilities (s) have been investigated from the density and speed of sound measurements of six binary liquid mixtures containing -alkanes over the entire range of composition at 298.15 K. Excess molar volume exhibits inversion in sign in one binary ...
Misaligned disks in the binary protostar IRS 43
DEFF Research Database (Denmark)
Brinch, Christian; Jørgensen, Jes Kristian; Hogerheijde, Michiel R.
2016-01-01
and position angle and also with respect to the binary orbital plane. Each stellar component has an associated circumstellar disk while the binary is surrounded by a circumbinary disk. Together with archival VLA measurements of the stellar positions over 25 years, and assuming a circular orbit, we use our...
Binary spectral minutiae representation with multi-sample fusion for fingerprint recognition
Xu, H.; Veldhuis, Raymond N.J.
Biometric fusion is the approach to improve the biometric system performance by combining multiple sources of biometric information. The binary spectral minutiae representation is a method to represent a fingerprint minutiae set as a fixed-length binary string. This binary representation has the
A Search for Exoplanets in Short-Period Binary Star Systems
Directory of Open Access Journals (Sweden)
Ronald Kaitchuck
2012-03-01
Full Text Available This paper reports the progress of a search for exoplanets with S-type orbits in short-period binary star systems. The selected targets have stellar orbital periods of just a few days. These systems are eclipsing binaries so that exoplanet transits, if planets exist, will be highly likely. We report the results for seven binary star systems.
KIC 7177553: A QUADRUPLE SYSTEM OF TWO CLOSE BINARIES
Energy Technology Data Exchange (ETDEWEB)
Lehmann, H. [Thüringer Landessternwarte Tautenburg, Sternwarte 5, D-07778 Tautenburg (Germany); Borkovits, T. [Baja Astronomical Observatory of Szeged University, H-6500 Baja, Szegedi út, Kt. 766 (Hungary); Rappaport, S. A. [Massachusetts Institute of Technology, Department of Physics, 77 Massachusetts Avenue, Cambridge, MA 02139-4307 (United States); Ngo, H. [California Institute of Technology, Division of Geological and Planetary Sciences, 1200 E. California Boulevard, MC 150-21, Pasadena, CA 91125 (United States); Mawet, D. [California Institute of Technology, Astronomy Dept. MC 249-17, 1200 E. California Boulevard, Pasadena, CA 91125 (United States); Csizmadia, Sz. [German Aerospace Center (DLR), Institut für Planeten-forschung, Rutherfordstraße 2, D-12489 Berlin (Germany); Forgács-Dajka, E., E-mail: lehm@tls-tautenburg.de, E-mail: borko@electra.bajaobs.hu, E-mail: sar@mit.edu, E-mail: hngo@caltech.edu, E-mail: dmawet@astro.caltech.edu, E-mail: szilard.csizmadia@dlr.de, E-mail: e.forgacs-dajka@astro.elte.hu [Astronomical Department, Eötvös University, H-1118 Budapest, Pázmány Péter stny. 1/A (Hungary)
2016-03-01
KIC 7177553 was observed by the Kepler satellite to be an eclipsing eccentric binary star system with an 18-day orbital period. Recently, an eclipse timing study of the Kepler binaries has revealed eclipse timing variations (ETVs) in this object with an amplitude of ∼100 s and an outer period of 529 days. The implied mass of the third body is that of a super-Jupiter, but below the mass of a brown dwarf. We therefore embarked on a radial velocity (RV) study of this binary to determine its system configuration and to check the hypothesis that it hosts a giant planet. From the RV measurements, it became immediately obvious that the same Kepler target contains another eccentric binary, this one with a 16.5-day orbital period. Direct imaging using adaptive optics reveals that the two binaries are separated by 0.″4 (∼167 AU) and have nearly the same magnitude (to within 2%). The close angular proximity of the two binaries and very similar γ velocities strongly suggest that KIC 7177553 is one of the rare SB4 systems consisting of two eccentric binaries where at least one system is eclipsing. Both systems consist of slowly rotating, nonevolved, solar-like stars of comparable masses. From the orbital separation and the small difference in γ velocity, we infer that the period of the outer orbit most likely lies in the range of 1000–3000 yr. New images taken over the next few years, as well as the high-precision astrometry of the Gaia satellite mission, will allow us to set much narrower constraints on the system geometry. Finally, we note that the observed ETVs in the Kepler data cannot be produced by the second binary. Further spectroscopic observations on a longer timescale will be required to prove the existence of the massive planet.
Geier, S.; Heber, U.; Kupfer, T.; Napiwotzki, R.
2010-01-01
Aims. The ESO SN Ia Progenitor Survey (SPY) aims at finding merging double degenerate binaries as candidates for supernova type Ia (SN Ia) explosions. A white dwarf merger has also been suggested to explain the formation of rare types of stars like R CrB, extreme helium or He sdO stars. Here we present the hot subdwarf B binary GD 687, which will merge in less than a Hubble time. Methods. The orbital parameters of the close binary have been determined from time resolved spectroscopy. Since GD...
The incidence of acute urinary retention secondary to BPH is increasing among California men.
Groves, H K; Chang, D; Palazzi, K; Cohen, S; Parsons, J K
2013-09-01
Current epidemiological patterns of adverse events of clinical BPH remain unclear. We investigated trends in acute urinary retention (AUR) associated with BPH in a large, population-based cohort. We utilized the California Office of Statewide Health Planning and Development Database to examine 3 724 016 emergency room (ER) visits in California among men aged 50 years from 2007 to 2010. Outcomes included AUR for which BPH was the primary diagnosis, AUR for which BPH was a secondary diagnosis and urethral catheterization for AUR. We generated adjusted odds ratios (ORadj) using multivariate logistic regression to determine longitudinal trends. A total of 17 023 men presented with a diagnosis of BPH-associated AUR, the unadjusted incidence of which increased from 4.00 per 1000 ER visits in 2007 to 5.23 per 1000 ER visits in 2010 (PBPH-associated AUR increased substantially in a large and ethnically diverse male population of the United States.
Turner, Rebecca; Price, A.; Henden, A.
2009-05-01
The IYA 2009 working group on Research Experiences for Students, Teachers, and Citizen-Scientists is planning a multi-year project involving the bright star Eps Aur. The project will go beyond simple observing and also include a major data analysis component. The goal is to introduce the participant to the full scientific process from background research to paper writing for a peer-reviewed journal. It begins with a 10 Star Training Program of several types of binary and transient variable stars that are easy to observe from suburban locations with the naked eye. Participants will be trained both in observing and also in basic data analysis of photometric datasets (light curve and period analysis). Eventually it will lead to a capstone project: monitoring the rare and mysterious 2009-2011 eclipse of Epsilon Aurigae. In the summer of IYA 2009, third-magnitude Eps Aur will experience its next eclipse, which occurs every 27.1 years and lasts 714 days, nearly two years. The star is bright enough to be seen with the naked eye from most urban areas. If fully funded, the project will also involve two public workshops on observing and data analysis in the summers of 2009 and 2010, respectively.
Control of broadband optically generated ultrasound pulses using binary amplitude holograms.
Brown, Michael D; Jaros, Jiri; Cox, Ben T; Treeby, Bradley E
2016-04-01
In this work, the use of binary amplitude holography is investigated as a mechanism to focus broadband acoustic pulses generated by high peak-power pulsed lasers. Two algorithms are described for the calculation of the binary holograms; one using ray-tracing, and one using an optimization based on direct binary search. It is shown using numerical simulations that when a binary amplitude hologram is excited by a train of laser pulses at its design frequency, the acoustic field can be focused at a pre-determined distribution of points, including single and multiple focal points, and line and square foci. The numerical results are validated by acoustic field measurements from binary amplitude holograms, excited by a high peak-power laser.
Binary black hole in a double magnetic monopole field
Rodriguez, Maria J.
2018-01-01
Ambient magnetic fields are thought to play a critical role in black hole jet formation. Furthermore, dual electromagnetic signals could be produced during the inspiral and merger of binary black hole systems. In this paper, we derive the exact solution for the electromagnetic field occurring when a static, axisymmetric binary black hole system is placed in the field of two magnetic or electric monopoles. As a by-product of this derivation, we also find the exact solution of the binary black hole configuration in a magnetic or electric dipole field. The presence of conical singularities in the static black hole binaries represent the gravitational attraction between the black holes that also drag the external two monopole field. We show that these off-balance configurations generate no energy outflows.
Binary black hole in a double magnetic monopole field
Energy Technology Data Exchange (ETDEWEB)
Rodriguez, Maria J. [Utah State University, Department of Physics, Logan, UT (United States); Max Planck Institute for Gravitational Physics, Potsdam (Germany)
2018-01-15
Ambient magnetic fields are thought to play a critical role in black hole jet formation. Furthermore, dual electromagnetic signals could be produced during the inspiral and merger of binary black hole systems. In this paper, we derive the exact solution for the electromagnetic field occurring when a static, axisymmetric binary black hole system is placed in the field of two magnetic or electric monopoles. As a by-product of this derivation, we also find the exact solution of the binary black hole configuration in a magnetic or electric dipole field. The presence of conical singularities in the static black hole binaries represent the gravitational attraction between the black holes that also drag the external two monopole field. We show that these off-balance configurations generate no energy outflows. (orig.)
Population of Nuclei Via 7Li-Induced Binary Reactions
International Nuclear Information System (INIS)
Clark, Rodney M.; Phair, Larry W.; Descovich, M.; Cromaz, Mario; Deleplanque, M.A.; Fall on, Paul; Lee, I-Yang; Macchiavelli, A.O.; McMahan, Margaret A.; Moretto, Luciano G.; Rodriguez-Vieitez, E.; Sinha, Shrabani; Stephens, Frank S.; Ward, David; Wiedeking, Mathis
2005-01-01
The authors have investigated the population of nuclei formed in binary reactions involving 7 Li beams on targets of 160 Gd and 184 W. The 7 Li + 184 W data were taken in the first experiment using the LIBERACE Ge-array in combination with the STARS Si ΔE-E telescope system at the 88-Inch Cyclotron of the Lawrence Berkeley National Laboratory. By using the Wilczynski binary transfer model, in combination with a standard evaporation model, they are able to reproduce the experimental results. This is a useful method for predicting the population of neutron-rich heavy nuclei formed in binary reactions involving beams of weakly bound nuclei formed in binary reactions involving beams of weakly bound nuclei and will be of use in future spectroscopic studies
Numerical Simulations of Wind Accretion in Symbiotic Binaries
de Val-Borro, M.; Karovska, M.; Sasselov, D.
2009-08-01
About half of the binary systems are close enough to each other for mass to be exchanged between them at some point in their evolution, yet the accretion mechanism in wind accreting binaries is not well understood. We study the dynamical effects of gravitational focusing by a binary companion on winds from late-type stars. In particular, we investigate the mass transfer and formation of accretion disks around the secondary in detached systems consisting of an asymptotic giant branch (AGB) mass-losing star and an accreting companion. The presence of mass outflows is studied as a function of mass-loss rate, wind temperature, and binary orbital parameters. A two-dimensional hydrodynamical model is used to study the stability of mass transfer in wind accreting symbiotic binary systems. In our simulations we use an adiabatic equation of state and a modified version of the isothermal approximation, where the temperature depends on the distance from the mass losing star and its companion. The code uses a block-structured adaptive mesh refinement method that allows us to have high resolution at the position of the secondary and resolve the formation of bow shocks and accretion disks. We explore the accretion flow between the components and formation of accretion disks for a range of orbital separations and wind parameters. Our results show the formation of stream flow between the stars and accretion disks of various sizes for certain orbital configurations. For a typical slow and massive wind from an AGB star the flow pattern is similar to a Roche lobe overflow with accretion rates of 10% of the mass loss from the primary. Stable disks with exponentially decreasing density profiles and masses of the order 10-4 solar masses are formed when wind acceleration occurs at several stellar radii. The disks are geometrically thin with eccentric streamlines and close to Keplerian velocity profiles. The formation of tidal streams and accretion disks is found to be weakly dependent on
NUMERICAL SIMULATIONS OF WIND ACCRETION IN SYMBIOTIC BINARIES
International Nuclear Information System (INIS)
De Val-Borro, M.; Karovska, M.; Sasselov, D.
2009-01-01
About half of the binary systems are close enough to each other for mass to be exchanged between them at some point in their evolution, yet the accretion mechanism in wind accreting binaries is not well understood. We study the dynamical effects of gravitational focusing by a binary companion on winds from late-type stars. In particular, we investigate the mass transfer and formation of accretion disks around the secondary in detached systems consisting of an asymptotic giant branch (AGB) mass-losing star and an accreting companion. The presence of mass outflows is studied as a function of mass-loss rate, wind temperature, and binary orbital parameters. A two-dimensional hydrodynamical model is used to study the stability of mass transfer in wind accreting symbiotic binary systems. In our simulations we use an adiabatic equation of state and a modified version of the isothermal approximation, where the temperature depends on the distance from the mass losing star and its companion. The code uses a block-structured adaptive mesh refinement method that allows us to have high resolution at the position of the secondary and resolve the formation of bow shocks and accretion disks. We explore the accretion flow between the components and formation of accretion disks for a range of orbital separations and wind parameters. Our results show the formation of stream flow between the stars and accretion disks of various sizes for certain orbital configurations. For a typical slow and massive wind from an AGB star the flow pattern is similar to a Roche lobe overflow with accretion rates of 10% of the mass loss from the primary. Stable disks with exponentially decreasing density profiles and masses of the order 10 -4 solar masses are formed when wind acceleration occurs at several stellar radii. The disks are geometrically thin with eccentric streamlines and close to Keplerian velocity profiles. The formation of tidal streams and accretion disks is found to be weakly dependent
Dynamical evolution of a fictitious population of binary Neptune Trojans
Brunini, Adrián
2018-03-01
We present numerical simulations of the evolution of a synthetic population of Binary Neptune Trojans, under the influence of the solar perturbations and tidal friction (the so-called Kozai cycles and tidal friction evolution). Our model includes the dynamical influence of the four giant planets on the heliocentric orbit of the binary centre of mass. In this paper, we explore the evolution of initially tight binaries around the Neptune L4 Lagrange point. We found that the variation of the heliocentric orbital elements due to the libration around the Lagrange point introduces significant changes in the orbital evolution of the binaries. Collisional processes would not play a significant role in the dynamical evolution of Neptune Trojans. After 4.5 × 109 yr of evolution, ˜50 per cent of the synthetic systems end up separated as single objects, most of them with slow diurnal rotation rate. The final orbital distribution of the surviving binary systems is statistically similar to the one found for Kuiper Belt Binaries when collisional evolution is not included in the model. Systems composed by a primary and a small satellite are more fragile than the ones composed by components of similar sizes.
EFFICIENT MERGER OF BINARY SUPERMASSIVE BLACK HOLES IN MERGING GALAXIES
International Nuclear Information System (INIS)
Khan, Fazeel Mahmood; Just, Andreas; Merritt, David
2011-01-01
In spherical galaxies, binary supermassive black holes (SMBHs) have difficulty reaching sub-parsec separations due to depletion of stars on orbits that intersect the massive binary-the 'final parsec problem'. Galaxies that form via major mergers are substantially non-spherical, and it has been argued that the centrophilic orbits in triaxial galaxies might provide stars to the massive binary at a high enough rate to avoid stalling. Here we test that idea by carrying out fully self-consistent merger simulations of galaxies containing central SMBHs. We find hardening rates of the massive binaries that are indeed much higher than in spherical models and essentially independent of the number of particles used in the simulations. Binary eccentricities remain high throughout the simulations. Our results constitute a fully stellar-dynamical solution to the final parsec problem and imply a potentially high rate of events for low-frequency gravitational wave detectors like LISA.
Applications Of Binary Image Analysis Techniques
Tropf, H.; Enderle, E.; Kammerer, H. P.
1983-10-01
After discussing the conditions where binary image analysis techniques can be used, three new applications of the fast binary image analysis system S.A.M. (Sensorsystem for Automation and Measurement) are reported: (1) The human view direction is measured at TV frame rate while the subject's head is free movable. (2) Industrial parts hanging on a moving conveyor are classified prior to spray painting by robot. (3) In automotive wheel assembly, the eccentricity of the wheel is minimized by turning the tyre relative to the rim in order to balance the eccentricity of the components.
UNUSUALLY WIDE BINARIES: ARE THEY WIDE OR UNUSUAL?
International Nuclear Information System (INIS)
Kraus, Adam L.; Hillenbrand, Lynne A.
2009-01-01
We describe an astrometric and spectroscopic campaign to confirm the youth and association of a complete sample of candidate wide companions in Taurus and Upper Sco. Our survey found 15 new binary systems (three in Taurus and 12 in Upper Sco) with separations of 3''-30'' (500-5000 AU) among all of the known members with masses of 2.5-0.012 M sun . The total sample of 49 wide systems in these two regions conforms to only some expectations from field multiplicity surveys. Higher mass stars have a higher frequency of wide binary companions, and there is a marked paucity of wide binary systems near the substellar regime. However, the separation distribution appears to be log-flat, rather than declining as in the field, and the mass ratio distribution is more biased toward similar-mass companions than the initial mass function or the field G-dwarf distribution. The maximum separation also shows no evidence of a limit at ∼ sun . We attribute this result to the post-natal dynamical sculpting that occurs for most field systems; our binary systems will escape to the field intact, but most field stars are formed in denser clusters and undergo significant dynamical evolution. In summary, only wide binary systems with total masses ∼ sun appear to be 'unusually wide'.
High-energy gamma-ray emission in compact binaries
International Nuclear Information System (INIS)
Cerutti, Benoit
2010-01-01
Four gamma-ray sources have been associated with binary systems in our Galaxy: the micro-quasar Cygnus X-3 and the gamma-ray binaries LS I +61 degrees 303, LS 5039 and PSR B1259-63. These systems are composed of a massive companion star and a compact object of unknown nature, except in PSR B1259-63 where there is a young pulsar. I propose a comprehensive theoretical model for the high-energy gamma-ray emission and variability in gamma-ray emitting binaries. In this model, the high-energy radiation is produced by inverse Compton scattering of stellar photons on ultra-relativistic electron-positron pairs injected by a young pulsar in gamma-ray binaries and in a relativistic jet in micro-quasars. Considering anisotropic inverse Compton scattering, pair production and pair cascade emission, the TeV gamma-ray emission is well explained in LS 5039. Nevertheless, this model cannot account for the gamma-ray emission in LS I +61 degrees 303 and PSR B1259-63. Other processes should dominate in these complex systems. In Cygnus X-3, the gamma-ray radiation is convincingly reproduced by Doppler-boosted Compton emission of pairs in a relativistic jet. Gamma-ray binaries and micro-quasars provide a novel environment for the study of pulsar winds and relativistic jets at very small spatial scales. (author)
International Nuclear Information System (INIS)
Bardalez Gagliuffi, Daniella C.; Burgasser, Adam J.; Nicholls, Christine P.; Gelino, Christopher R.; Looper, Dagny L.; Schmidt, Sarah J.; Cruz, Kelle; West, Andrew A.; Gizis, John E.; Metchev, Stanimir
2014-01-01
Multiplicity is a key statistic for understanding the formation of very low mass (VLM) stars and brown dwarfs. Currently, the separation distribution of VLM binaries remains poorly constrained at small separations (≤1 AU), leading to uncertainty in the overall binary fraction. We approach this problem by searching for late-M/early-L plus T dwarf spectral binaries whose combined light spectra exhibit distinct peculiarities, allowing for separation-independent identification. We define a set of spectral indices designed to identify these systems, and we use a spectral template fitting method to confirm and characterize spectral binary candidates from a library of 815 spectra from the SpeX Prism Spectral Libraries. We present 11 new binary candidates, confirm 3 previously reported candidates, and rule out 2 previously identified candidates, all with primary and secondary spectral types in the range M7-L7 and T1-T8, respectively. We find that subdwarfs and blue L dwarfs are the primary contaminants in our sample and propose a method for segregating these sources. If confirmed by follow-up observations, these systems may add to the growing list of tight separation binaries, whose orbital properties may yield further insight into brown dwarf formation scenarios.
Gravitational waveforms for neutron star binaries from binary black hole simulations
Barkett, Kevin; Scheel, Mark; Haas, Roland; Ott, Christian; Bernuzzi, Sebastiano; Brown, Duncan; Szilagyi, Bela; Kaplan, Jeffrey; Lippuner, Jonas; Muhlberger, Curran; Foucart, Francois; Duez, Matthew
2016-03-01
Gravitational waves from binary neutron star (BNS) and black-hole/neutron star (BHNS) inspirals are primary sources for detection by the Advanced Laser Interferometer Gravitational-Wave Observatory. The tidal forces acting on the neutron stars induce changes in the phase evolution of the gravitational waveform, and these changes can be used to constrain the nuclear equation of state. Current methods of generating BNS and BHNS waveforms rely on either computationally challenging full 3D hydrodynamical simulations or approximate analytic solutions. We introduce a new method for computing inspiral waveforms for BNS/BHNS systems by adding the post-Newtonian (PN) tidal effects to full numerical simulations of binary black holes (BBHs), effectively replacing the non-tidal terms in the PN expansion with BBH results. Comparing a waveform generated with this method against a full hydrodynamical simulation of a BNS inspiral yields a phase difference of < 1 radian over ~ 15 orbits. The numerical phase accuracy required of BNS simulations to measure the accuracy of the method we present here is estimated as a function of the tidal deformability parameter λ.
Creation of an anti-imaging system using binary optics
Wang, Haifeng; Lin, Jian; Zhang, Dawei; Wang, Yang; Gu, Min; Urbach, H. P.; Gan, Fuxi; Zhuang, Songlin
2016-01-01
We present a concealing method in which an anti-point spread function (APSF) is generated using binary optics, which produces a large-scale dark area in the focal region that can hide any object located within it. This result is achieved by generating two identical PSFs of opposite signs, one consisting of positive electromagnetic waves from the zero-phase region of the binary optical element and the other consisting of negative electromagnetic waves from the pi-phase region of the binary optical element. PMID:27620068
Non-binary Hybrid LDPC Codes: Structure, Decoding and Optimization
Sassatelli, Lucile; Declercq, David
2007-01-01
In this paper, we propose to study and optimize a very general class of LDPC codes whose variable nodes belong to finite sets with different orders. We named this class of codes Hybrid LDPC codes. Although efficient optimization techniques exist for binary LDPC codes and more recently for non-binary LDPC codes, they both exhibit drawbacks due to different reasons. Our goal is to capitalize on the advantages of both families by building codes with binary (or small finite set order) and non-bin...
Improvement of Binary Analysis Components in Automated Malware Analysis Framework
2017-02-21
AFRL-AFOSR-JP-TR-2017-0018 Improvement of Binary Analysis Components in Automated Malware Analysis Framework Keiji Takeda KEIO UNIVERSITY Final...TYPE Final 3. DATES COVERED (From - To) 26 May 2015 to 25 Nov 2016 4. TITLE AND SUBTITLE Improvement of Binary Analysis Components in Automated Malware ...analyze malicious software ( malware ) with minimum human interaction. The system autonomously analyze malware samples by analyzing malware binary program
ILLUMINATING BLACK HOLE BINARY FORMATION CHANNELS WITH SPINS IN ADVANCED LIGO
Energy Technology Data Exchange (ETDEWEB)
Rodriguez, Carl L. [MIT-Kavli Institute for Astrophysics and Space Research, 77 Massachusetts Avenue, 37-664H, Cambridge, MA 02139 (United States); Zevin, Michael; Pankow, Chris; Kalogera, Vasilliki; Rasio, Frederic A. [Center for Interdisciplinary Exploration and Research in Astrophysics (CIERA) and Department of Physics and Astronomy, Northwestern University, 2145 Sheridan Road, Evanston, IL 60208 (United States)
2016-11-20
The recent detections of the binary black hole mergers GW150914 and GW151226 have inaugurated the field of gravitational-wave astronomy. For the two main formation channels that have been proposed for these sources, isolated binary evolution in galactic fields and dynamical formation in dense star clusters, the predicted masses and merger rates overlap significantly, complicating any astrophysical claims that rely on measured masses alone. Here, we examine the distribution of spin–orbit misalignments expected for binaries from the field and from dense star clusters. Under standard assumptions for black hole natal kicks, we find that black hole binaries similar to GW150914 could be formed with significant spin–orbit misalignment only through dynamical processes. In particular, these heavy-black hole binaries can only form with a significant spin–orbit anti -alignment in the dynamical channel. Our results suggest that future detections of merging black hole binaries with measurable spins will allow us to identify the main formation channel for these systems.
White dwarf-red dwarf binaries in the Galaxy
Besselaar, E.J.M. van den
2007-01-01
This PhD thesis shows several studies on white dwarf - red dwarf binaries. White dwarfs are the end products of most stars and red dwarfs are normal hydrogen burning low-mass stars. White dwarf - red dwarf binaries are both blue (white dwarf) and red (red dwarf). Together with the fact that they are
Kalogera, Vassiliki; Webbink, Ronald F.
1998-01-01
We study the formation of low-mass X-ray binaries (LMXBs) through helium star supernovae in binary systems that have each emerged from a common envelope phase. LMXB progenitors must satisfy a large number of evolutionary and structural constraints, including survival through common envelope evolution, through the post-common envelope phase, where the precursor of the neutron star becomes a Wolf-Rayet star, and survival through the supernova event. Furthermore, the binaries that survive the explosion must reach interaction within a Hubble time and must satisfy stability criteria for mass transfer. These constraints, imposed under the assumption of a symmetric supernova explosion, prohibit the formation of short-period LMXBs transferring mass at sub-Eddington rates through any channel in which the intermediate progenitor of the neutron star is not completely degenerate. Barring accretion-induced collapse, the existence of such systems therefore requires that natal kicks be imparted to neutron stars. We use an analytical method to synthesize the distribution of nascent LMXBs over donor masses and orbital periods and evaluate their birthrate and systemic velocity dispersion. Within the limitations imposed by observational incompleteness and selection effects, and our neglect of secular evolution in the LMXB state, we compare our results with observations. However, our principal objective is to evaluate how basic model parameters (common envelope ejection efficiency, rms kick velocity, primordial mass ratio distribution) influence these results. We conclude that the characteristics of newborn LMXBs are primarily determined by age and stability constraints and the efficiency of magnetic braking and are largely independent of the primordial binary population and the evolutionary history of LMXB progenitors (except for extreme values of the average kick magnitude or of the common envelope ejection efficiency). Theoretical estimates of total LMXB birthrates are not credible
Multi-Messenger Astronomy: White Dwarf Binaries, LISA and GAIA
Bueno, Michael; Breivik, Katelyn; Larson, Shane L.
2017-01-01
The discovery of gravitational waves has ushered in a new era in astronomy. The low-frequency band covered by the future LISA detector provides unprecedented opportunities for multi-messenger astronomy. With the Global Astrometric Interferometer for Astrophysics (GAIA) mission, we expect to discover about 1,000 eclipsing binary systems composed of a WD and a main sequence star - a sizeable increase from the approximately 34 currently known binaries of this type. In advance of the first GAIA data release and the launch of LISA within the next decade, we used the Binary Stellar Evolution (BSE) code simulate the evolution of White Dwarf Binaries (WDB) in a fixed galaxy population of about 196,000 sources. Our goal is to assess the detectability of a WDB by LISA and GAIA using the parameters from our population synthesis, we calculate GW strength h, and apparent GAIA magnitude G. We can then use a scale factor to make a prediction of how many multi- messenger sources we expect to be detectable by both LISA and GAIA in a galaxy the size of the Milky Way. We create binaries 10 times to ensure randomness in distance assignment and average our results. We then determined whether or not astronomical chirp is the difference between the total chirp and the GW chirp. With Astronomical chirp and simulations of mass transfer and tides, we can gather more information about the internal astrophysics of stars in ultra-compact binary systems.
STRUCTURE AND EVOLUTION OF CIRCUMBINARY DISKS AROUND SUPERMASSIVE BLACK HOLE BINARIES
International Nuclear Information System (INIS)
Rafikov, Roman R.
2013-01-01
We explore properties of circumbinary disks around supermassive black hole (SMBH) binaries in centers of galaxies by reformulating standard viscous disk evolution in terms of the viscous angular momentum flux F J . If the binary stops gas inflow and opens a cavity in the disk, then the inner disk evolves toward a constant-F J (rather than a constant M-dot ) state. We compute disk properties in different physical regimes relevant for SMBH binaries, focusing on the gas-assisted evolution of systems starting at separations 10 –4 – 10 –2 pc, and find the following. (1) Mass pileup at the inner disk edge caused by the tidal barrier accelerates binary inspiral. (2) Binaries can be forced to merge even by a disk with a mass below that of the secondary. (3) Torque on the binary is set non-locally, at radii far larger than the binary semi-major axis; its magnitude does not reflect disk properties in the vicinity of the binary. (4) Binary inspiral exhibits hysteresis—it depends on the past evolution of the disk. (5) The Eddington limit can be important for circumbinary disks even if they accrete at sub-Eddington rates, but only at late stages of the inspiral. (6) Gas overflow across the orbit of the secondary can be important for low secondary mass, high- M-dot systems, but mainly during the inspiral phase dominated by the gravitational wave emission. (7) Circumbinary disks emit more power and have harder spectra than constant M-dot disks; their spectra are very sensitive to the amount of overflow across the secondary orbit
DOUBLE-LINED SPECTROSCOPIC BINARY STARS IN THE RAVE SURVEY
International Nuclear Information System (INIS)
Matijevic, G.; Zwitter, T.; Munari, U.; Siviero, A.; Bienayme, O.; Siebert, A.; Binney, J.; Bland-Hawthorn, J.; Boeche, C.; Steinmetz, M.; Campbell, R.; Freeman, K. C.; Gibson, B.; Gilmore, G.; Grebel, E. K.; Helmi, A.; Navarro, J. F.; Parker, Q. A.; Seabroke, G. M.; Watson, F. G.
2010-01-01
We devise a new method for the detection of double-lined binary stars in a sample of the Radial Velocity Experiment (RAVE) survey spectra. The method is both tested against extensive simulations based on synthetic spectra and compared to direct visual inspection of all RAVE spectra. It is based on the properties and shape of the cross-correlation function, and is able to recover ∼80% of all binaries with an orbital period of order 1 day. Systems with periods up to 1 yr are still within the detection reach. We have applied the method to 25,850 spectra of the RAVE second data release and found 123 double-lined binary candidates, only eight of which are already marked as binaries in the SIMBAD database. Among the candidates, there are seven that show spectral features consistent with the RS CVn type (solar type with active chromosphere) and seven that might be of W UMa type (over-contact binaries). One star, HD 101167, seems to be a triple system composed of three nearly identical G-type dwarfs. The tested classification method could also be applicable to the data of the upcoming Gaia mission.
EVOLUTION OF A RING AROUND THE PLUTO–CHARON BINARY
Energy Technology Data Exchange (ETDEWEB)
Bromley, Benjamin C. [Department of Physics and Astronomy, University of Utah, 115 S 1400 E, Rm 201, Salt Lake City, UT 84112 (United States); Kenyon, Scott J., E-mail: bromley@physics.utah.edu, E-mail: skenyon@cfa.harvard.edu [Smithsonian Astrophysical Observatory, 60 Garden St., Cambridge, MA 02138 (United States)
2015-08-10
We consider the formation of satellites around the Pluto–Charon binary. An early collision between the two partners likely produced the binary and a narrow ring of debris, out of which arose the moons Styx, Nix, Kerberos, and Hydra. How the satellites emerged from the compact ring is uncertain. Here we show that a particle ring spreads from physical collisions and collective gravitational scattering, similar to migration. Around a binary, these processes take place in the reference frames of “most circular” orbits, akin to circular ones in a Keplerian potential. Ring particles damp to these orbits and avoid destructive collisions. Damping and diffusion also help particles survive dynamical instabilities driven by resonances with the binary. In some situations, particles become trapped near resonances that sweep outward with the tidal evolution of the Pluto–Charon binary. With simple models and numerical experiments, we show how the Pluto–Charon impact ring may have expanded into a broad disk, out of which grew the circumbinary moons. In some scenarios, the ring can spread well beyond the orbit of Hydra, the most distant moon, to form a handful of smaller satellites. If these small moons exist, New Horizons will find them.
Wide Binaries in TGAS: Search Method and First Results
Andrews, Jeff J.; Chanamé, Julio; Agüeros, Marcel A.
2018-04-01
Half of all stars reside in binary systems, many of which have orbital separations in excess of 1000 AU. Such binaries are typically identified in astrometric catalogs by matching the proper motions vectors of close stellar pairs. We present a fully Bayesian method that properly takes into account positions, proper motions, parallaxes, and their correlated uncertainties to identify widely separated stellar binaries. After applying our method to the >2 × 106 stars in the Tycho-Gaia astrometric solution from Gaia DR1, we identify over 6000 candidate wide binaries. For those pairs with separations less than 40,000 AU, we determine the contamination rate to be ~5%. This sample has an orbital separation (a) distribution that is roughly flat in log space for separations less than ~5000 AU and follows a power law of a -1.6 at larger separations.
Detecting unresolved binary stars in Euclid VIS images
Kuntzer, T.; Courbin, F.
2017-10-01
Measuring a weak gravitational lensing signal to the level required by the next generation of space-based surveys demands exquisite reconstruction of the point-spread function (PSF). However, unresolved binary stars can significantly distort the PSF shape. In an effort to mitigate this bias, we aim at detecting unresolved binaries in realistic Euclid stellar populations. We tested methods in numerical experiments where (I) the PSF shape is known to Euclid requirements across the field of view; and (II) the PSF shape is unknown. We drew simulated catalogues of PSF shapes for this proof-of-concept paper. Following the Euclid survey plan, the objects were observed four times. We propose three methods to detect unresolved binary stars. The detection is based on the systematic and correlated biases between exposures of the same object. One method is a simple correlation analysis, while the two others use supervised machine-learning algorithms (random forest and artificial neural network). In both experiments, we demonstrate the ability of our methods to detect unresolved binary stars in simulated catalogues. The performance depends on the level of prior knowledge of the PSF shape and the shape measurement errors. Good detection performances are observed in both experiments. Full complexity, in terms of the images and the survey design, is not included, but key aspects of a more mature pipeline are discussed. Finding unresolved binaries in objects used for PSF reconstruction increases the quality of the PSF determination at arbitrary positions. We show, using different approaches, that we are able to detect at least binary stars that are most damaging for the PSF reconstruction process. The code corresponding to the algorithms used in this work and all scripts to reproduce the results are publicly available from a GitHub repository accessible via http://lastro.epfl.ch/software
What fraction of white dwarfs are members of binary systems?
International Nuclear Information System (INIS)
Holberg, J B
2009-01-01
White dwarfs were originally discovered as the subordinate faint companions of bright nearby stars (i.e. Sirius B and 40 Eri B). Several general categories of binary systems involving white dwarfs are recognized: Sirius-like systems, where the white dwarf may be difficult to detect, binary systems containing white dwarfs and low mass stars, where the white dwarf is often readily discerned; and double degenerate systems. Different modes of white dwarf discovery influence our perception of both the overall binary fraction and the nature of these systems; proper motion surveys emphasize resolved systems, while photometric surveys emphasize unresolved systems containing relatively hot white dwarfs. Recent studies of the local white dwarf population offer some hope of achieving realistic estimates of the relative number of binary systems containing white dwarfs. A sample of 132 white dwarfs within 20 pc indicates that an individual white dwarf has a probability of 32 ± 8% of occurring within a binary or multiple star system.
Near-Infrared Polarimetry of the GG Tauri A Binary System
Itoh, Yoichi; Oasa, Yumiko; Kudo, Tomoyuki; Kusakabe, Nobuhiko; Hashimoto, Jun; Abe, Lyu; Brandner, Wolfgang; Brandt, Timothy D.; Carson, Joseph C.; Egner, Sebastian;
2014-01-01
A high angular resolution near-infrared image that shows the intensity of polarization for the GG Tau A binary system was obtained with the Subaru Telescope. The image shows a circumbinary disk scattering the light from the central binary. The azimuthal profile of the intensity of polarization for the circumbinary disk is roughly reproduced by a simple disk model with the Henyey-Greenstein phase function and the Rayleigh function, indicating there are small dust grains at the surface of the disk. Combined with a previous observation of the circumbinary disk, our image indicates that the gap structure in the circumbinary disk orbits counterclockwise, but material in the disk orbits clockwise. We propose that there is a shadow caused by material located between the central binary and the circumbinary disk. The separations and position angles of the stellar components of the binary in the past 20 yr are consistent with the binary orbit with a = 33.4 AU and e = 0.34.
Presence of mixed modes in red giants in binary systems
Directory of Open Access Journals (Sweden)
Themeßl Nathalie
2017-01-01
Full Text Available The frequencies of oscillation modes in stars contain valueable information about the stellar properties. In red giants the frequency spectrum also contains mixed modes, with both pressure (p and gravity (g as restoring force, which are key to understanding the physical conditions in the stellar core. We observe a high fraction of red giants in binary systems, for which g-dominated mixed modes are not pronounced. This trend leads us to investigate whether this is specific for binary systems or a more general feature. We do so by comparing the fraction of stars with only p-dominated mixed modes in binaries and in a larger set of stars from the APOKASC sample. We find only p-dominated mixed modes in about 50% of red giants in detached eclipsing binaries compared to about 4% in the large sample. This could indicate that this phenomenon is tightly related to binarity and that the binary fraction in the APOKASC sample is about 8%.
Estimation of the Ideal Binary Mask using Directional Systems
DEFF Research Database (Denmark)
Boldt, Jesper; Kjems, Ulrik; Pedersen, Michael Syskind
2008-01-01
The ideal binary mask is often seen as a goal for time-frequency masking algorithms trying to increase speech intelligibility, but the required availability of the unmixed signals makes it difficult to calculate the ideal binary mask in any real-life applications. In this paper we derive the theory...... and the requirements to enable calculations of the ideal binary mask using a directional system without the availability of the unmixed signals. The proposed method has a low complexity and is verified using computer simulation in both ideal and non-ideal setups showing promising results....
Binary Stochastic Representations for Large Multi-class Classification
Gerald, Thomas
2017-10-23
Classification with a large number of classes is a key problem in machine learning and corresponds to many real-world applications like tagging of images or textual documents in social networks. If one-vs-all methods usually reach top performance in this context, these approaches suffer of a high inference complexity, linear w.r.t. the number of categories. Different models based on the notion of binary codes have been proposed to overcome this limitation, achieving in a sublinear inference complexity. But they a priori need to decide which binary code to associate to which category before learning using more or less complex heuristics. We propose a new end-to-end model which aims at simultaneously learning to associate binary codes with categories, but also learning to map inputs to binary codes. This approach called Deep Stochastic Neural Codes (DSNC) keeps the sublinear inference complexity but do not need any a priori tuning. Experimental results on different datasets show the effectiveness of the approach w.r.t. baseline methods.
A BiCMOS Binary Hysteresis Chaos Generator
Ahmadi, S.; Newcomb, R. W.
A previous op-amp RC circuit which was proven to give chaotic signals is converted to a BiCMOS design more suitable to integrated circuit realization. The structure results from a degree two differential equation which includes binary hysteresis as its nonlinearity. The circuit is realized by differential (voltage to current) pairs feeding two capacitors, which carry the dynamics, with the key component being a (voltage to current) binary hysteresis circuit due to Linares.
BINARY CANDIDATES IN THE JOVIAN TROJAN AND HILDA POPULATIONS FROM NEOWISE LIGHT CURVES
Energy Technology Data Exchange (ETDEWEB)
Sonnett, S.; Mainzer, A.; Masiero, J.; Bauer, J. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Grav, T., E-mail: Sarah.Sonnett@jpl.nasa.gov [Planetary Science Institute, Tucson, AZ (United States)
2015-02-01
Determining the binary fraction for a population of asteroids, particularly as a function of separation between the two components, helps describe the dynamical environment at the time the binaries formed, which in turn offers constraints on the dynamical evolution of the solar system. We searched the NEOWISE archival data set for close and contact binary Trojans and Hildas via their diagnostically large light curve amplitudes. We present 48 out of 554 Hilda and 34 out of 953 Trojan binary candidates in need of follow-up to confirm their large light curve amplitudes and subsequently constrain the binary orbit and component sizes. From these candidates, we calculate a preliminary estimate of the binary fraction without confirmation or debiasing of 14%-23% for Trojans larger than ∼12 km and 30%-51% for Hildas larger than ∼4 km. Once the binary candidates have been confirmed, it should be possible to infer the underlying, debiased binary fraction through estimation of survey biases.
Binary encounter electron production in ion-atom collisions
International Nuclear Information System (INIS)
Grabbe, S.; Bhalla, C.P.; Shingal, R.
1993-01-01
The binary encounter electrons are produced by hard collisions between the target electrons and the energetic projectiles. Richard et al. found the measured double differential cross section for BEe production at zero degree laboratory scattering angle, in collisions of F q+ with H 2 and He targets, to increase as the charge state of the projectile was decreased. The binary encounter electron production has recently been a subject of detailed investigations. We have calculated the differential elastic scattering cross sections of electrons from several ions incorporating the exchange contribution of the continuum and the bound orbitals in addition to the static potential. The double differential binary encounter electron production cross sections are presented using the impulse approximation
DSIbin : Identifying dynamic data structures in C/C++ binaries
Rupprecht, Thomas; Chen, Xi; White, David H.; Boockmann, Jan H.; Luttgen, Gerald; Bos, Herbert
2017-01-01
Reverse engineering binary code is notoriously difficult and, especially, understanding a binary's dynamic data structures. Existing data structure analyzers are limited wrt. program comprehension: they do not detect complex structures such as skip lists, or lists running through nodes of different
Particle acceleration in binaries
Directory of Open Access Journals (Sweden)
Sinitsyna V.G.
2017-01-01
Full Text Available Cygnus X-3 massive binary system is one of the powerful sources of radio and X-ray emission consisting of an accreting compact object, probably a black hole, with a Wolf-Rayet star companion. Based on the detections of ultra high energy gamma-rays by Kiel and Havera Park, Cygnus X-3 has been proposed to be one of the most powerful sources of charged cosmic ray particles in the Galaxy. The results of long-term observations of the Cyg X-3 binary at energies 800 GeV–85 TeV detected by SHALON in 1995 are presented with images, integral spectra and spectral energy distribution. The identification of source with Cygnus X-3 detected by SHALON was secured by the detection of its 4.8 hour orbital period in TeV gamma-rays. During the whole observation period of Cyg X-3 with SHALON significant flux increases were detected at energies above 0.8 TeV. These TeV flux increases are correlated with flaring activity at a lower energy range of X-ray and/or at observations of Fermi LAT as well as with radio emission from the relativistic jets of Cygnus X-3. The variability of very high-energy gamma-radiation and correlation of radiation activity in the wide energy range can provide essential information on particle mechanism production up to very high energies. Whereas, modulation of very high energy emission connected to the orbital motion of the binary system, provides an understanding of the emission processes, nature and location of particle acceleration.
Photometric Analysis and Modeling of Five Mass-Transferring Binary Systems
Geist, Emily; Beaky, Matthew; Jamison, Kate
2018-01-01
In overcontact eclipsing binary systems, both stellar components have overfilled their Roche lobes, resulting in a dumbbell-shaped shared envelope. Mass transfer is common in overcontact binaries, which can be observed as a slow change on the rotation period of the system.We studied five overcontact eclipsing binary systems with evidence of period change, and thus likely mass transfer between the components, identified by Nelson (2014): V0579 Lyr, KN Vul, V0406 Lyr, V2240 Cyg, and MS Her. We used the 31-inch NURO telescope at Lowell Observatory in Flagstaff, Arizona to obtain images in B,V,R, and I filters for V0579 Lyr, and the 16-inch Meade LX200GPS telescope with attached SBIG ST-8XME CCD camera at Juniata College in Huntingdon, Pennsylvania to image KN Vul, V0406 Lyr, V2240 Cyg, and MS Her, also in B,V,R, and I.After data reduction, we created light curves for each of the systems and modeled the eclipsing binaries using the BinaryMaker3 and PHOEBE programs to determine their fundamental physical parameters for the first time. Complete light curves and preliminary models for each of these neglected eclipsing binary systems will be presented.
A New Orbit for the Eclipsing Binary V577 Oph
Energy Technology Data Exchange (ETDEWEB)
Jeffery, Elizabeth J. [Physics Department, California Polytechnic State University, San Luis Obispo, CA 93407 (United States); Barnes, Thomas G. III; Montemayor, Thomas J. [The University of Texas at Austin, McDonald Observatory, 1 University Station, C1402, Austin, TX 78712-0259 (United States); Skillen, Ian, E-mail: ejjeffer@calpoly.edu, E-mail: tgb@astro.as.utexas.edu, E-mail: tm@astro.as.utexas.edu, E-mail: wji@ing.iac.es [Isaac Newton Group, Apartado de Correos 321, E-38700 Santa Cruz de La Palma, Canary Islands (Spain)
2017-09-01
Pulsating stars in eclipsing binary systems are unique objects for providing constraints on stellar models. To fully leverage the information available from the binary system, full orbital radial velocity curves must be obtained. We report 23 radial velocities for components of the eclipsing binary V577 Oph, whose primary star is a δ Sct variable. The velocities cover a nearly complete orbit and a time base of 20 years. We computed orbital elements for the binary and compared them to the ephemeris computed by Creevey et al. The comparison shows marginally different results. In particular, a change in the systemic velocity by −2 km s{sup −1} is suggested by our results. We compare this systemic velocity difference to that expected due to reflex motion of the binary in response to the third body in the system. The systemic velocity difference is consistent with reflex motion, given our mass determination for the eclipsing binary and the orbital parameters determined by Volkov and Volkova for the three-body orbit. We see no evidence for the third body in our spectra, but we do see strong interstellar Na D lines that are consistent in strength with the direction and expected distance of V577 Oph.
A New Orbit for the Eclipsing Binary V577 Oph
Jeffery, Elizabeth J.; Barnes, Thomas G., III; Skillen, Ian; Montemayor, Thomas J.
2017-09-01
Pulsating stars in eclipsing binary systems are unique objects for providing constraints on stellar models. To fully leverage the information available from the binary system, full orbital radial velocity curves must be obtained. We report 23 radial velocities for components of the eclipsing binary V577 Oph, whose primary star is a δ Sct variable. The velocities cover a nearly complete orbit and a time base of 20 years. We computed orbital elements for the binary and compared them to the ephemeris computed by Creevey et al. The comparison shows marginally different results. In particular, a change in the systemic velocity by -2 km s-1 is suggested by our results. We compare this systemic velocity difference to that expected due to reflex motion of the binary in response to the third body in the system. The systemic velocity difference is consistent with reflex motion, given our mass determination for the eclipsing binary and the orbital parameters determined by Volkov & Volkova for the three-body orbit. We see no evidence for the third body in our spectra, but we do see strong interstellar Na D lines that are consistent in strength with the direction and expected distance of V577 Oph.
Expanding the catalog of binary black-hole simulations: aligned-spin configurations
Chu, Tony; Pfeiffer, Harald; Scheel, Mark; Szilagyi, Bela; SXS Collaboration
2015-04-01
A major goal of numerical relativity is to model the inspiral and merger of binary black holes through sufficiently accurate and long simulations, to enable the successful detection of gravitational waves. However, covering the full parameter space of binary configurations is a computationally daunting task. The SXS Collaboration has made important progress in this direction recently, with a catalog of 174 publicly available binary black-hole simulations [black-holes.org/waveforms]. Nevertheless, the parameter-space coverage remains sparse, even for non-precessing binaries. In this talk, I will describe an addition to the SXS catalog to improve its coverage, consisting of 95 new simulations of aligned-spin binaries with moderate mass ratios and dimensionless spins as high as 0.9. Some applications of these new simulations will also be mentioned.
Absolute dimensions of eclipsing binaries XXVII. V1130 tauri
DEFF Research Database (Denmark)
Clausen, Jens Viggo; Olsen, E, H.; Helt, B. E.
2010-01-01
stars: evolution / stars: fundamental parameters / stars: individual: V1130¿Tau / binaries: eclipsing / techniques: photometric / techniques: radial velocities Udgivelsesdato: 17 Feb.......stars: evolution / stars: fundamental parameters / stars: individual: V1130¿Tau / binaries: eclipsing / techniques: photometric / techniques: radial velocities Udgivelsesdato: 17 Feb....
APPLICATION OF GAS DYNAMICAL FRICTION FOR PLANETESIMALS. II. EVOLUTION OF BINARY PLANETESIMALS
Energy Technology Data Exchange (ETDEWEB)
Grishin, Evgeni; Perets, Hagai B. [Physics Department, Technion—Israel Institute of Technology, Haifa, 3200003 (Israel)
2016-04-01
One of the first stages of planet formation is the growth of small planetesimals and their accumulation into large planetesimals and planetary embryos. This early stage occurs long before the dispersal of most of the gas from the protoplanetary disk. At this stage gas–planetesimal interactions play a key role in the dynamical evolution of single intermediate-mass planetesimals (m{sub p} ∼ 10{sup 21}–10{sup 25} g) through gas dynamical friction (GDF). A significant fraction of all solar system planetesimals (asteroids and Kuiper-belt objects) are known to be binary planetesimals (BPs). Here, we explore the effects of GDF on the evolution of BPs embedded in a gaseous disk using an N-body code with a fiducial external force accounting for GDF. We find that GDF can induce binary mergers on timescales shorter than the disk lifetime for masses above m{sub p} ≳ 10{sup 22} g at 1 au, independent of the binary initial separation and eccentricity. Such mergers can affect the structure of merger-formed planetesimals, and the GDF-induced binary inspiral can play a role in the evolution of the planetesimal disk. In addition, binaries on eccentric orbits around the star may evolve in the supersonic regime, where the torque reverses and the binary expands, which would enhance the cross section for planetesimal encounters with the binary. Highly inclined binaries with small mass ratios, evolve due to the combined effects of Kozai–Lidov (KL) cycles with GDF which lead to chaotic evolution. Prograde binaries go through semi-regular KL evolution, while retrograde binaries frequently flip their inclination and ∼50% of them are destroyed.
Sputtering yield calculation for binary target
International Nuclear Information System (INIS)
Jimenez-Rodriguez, J.J.; Rodriguez-Vidal, M.; Valles-Abarca, J.A.
1979-01-01
The generalization for binary targets, of the ideas proposed by Sigmund for monoatomic targets, leads to a set of coupled intergrodifferential equations for the sputtering functions. After moment decomposition, the final formulae are obtained by the standard method based on the Laplace Transform, where the inverse transform is made with the aid of asymptotic expansions in the limit of very high projectile energy as compared to the surface binding energy. The possible loss of stoichiometry for binary targets is analyzed. Comparison of computed values of sputtering yield for normal incidence, with experimental results shows good agreement. (author)
Pulsed Accretion in the T Tauri Binary TWA 3A
Energy Technology Data Exchange (ETDEWEB)
Tofflemire, Benjamin M.; Mathieu, Robert D. [Department of Astronomy, University of Wisconsin–Madison, 475 North Charter Street, Madison, WI 53706 (United States); Herczeg, Gregory J. [The Kavli Institute for Astronomy and Astrophysics, Peking University, Beijing 100871 (China); Akeson, Rachel L.; Ciardi, David R. [NASA Exoplanet Science Institute, IPAC/Caltech, Pasadena, CA 91125 (United States)
2017-06-20
TWA 3A is the most recent addition to a small group of young binary systems that both actively accrete from a circumbinary disk and have spectroscopic orbital solutions. As such, it provides a unique opportunity to test binary accretion theory in a well-constrained setting. To examine TWA 3A’s time-variable accretion behavior, we have conducted a two-year, optical photometric monitoring campaign, obtaining dense orbital phase coverage (∼20 observations per orbit) for ∼15 orbital periods. From U -band measurements we derive the time-dependent binary mass accretion rate, finding bursts of accretion near each periastron passage. On average, these enhanced accretion events evolve over orbital phases 0.85 to 1.05, reaching their peak at periastron. The specific accretion rate increases above the quiescent value by a factor of ∼4 on average but the peak can be as high as an order of magnitude in a given orbit. The phase dependence and amplitude of TWA 3A accretion is in good agreement with numerical simulations of binary accretion with similar orbital parameters. In these simulations, periastron accretion bursts are fueled by periodic streams of material from the circumbinary disk that are driven by the binary orbit. We find that TWA 3A’s average accretion behavior is remarkably similar to DQ Tau, another T Tauri binary with similar orbital parameters, but with significantly less variability from orbit to orbit. This is only the second clear case of orbital-phase-dependent accretion in a T Tauri binary.
On the Lack of Circumbinary Planets Orbiting Isolated Binary Stars
Fleming, David P.; Barnes, Rory; Graham, David E.; Luger, Rodrigo; Quinn, Thomas R.
2018-05-01
We outline a mechanism that explains the observed lack of circumbinary planets (CBPs) via coupled stellar–tidal evolution of isolated binary stars. Tidal forces between low-mass, short-period binary stars on the pre-main sequence slow the stellar rotations transferring rotational angular momentum to the orbit as the stars approach the tidally locked state. This transfer increases the binary orbital period, expanding the region of dynamical instability around the binary, and destabilizing CBPs that tend to preferentially orbit just beyond the initial dynamical stability limit. After the stars tidally lock, we find that angular momentum loss due to magnetic braking can significantly shrink the binary orbit, and hence the region of dynamical stability, over time, impacting where surviving CBPs are observed relative to the boundary. We perform simulations over a wide range of parameter space and find that the expansion of the instability region occurs for most plausible initial conditions and that, in some cases, the stability semimajor axis doubles from its initial value. We examine the dynamical and observable consequences of a CBP falling within the dynamical instability limit by running N-body simulations of circumbinary planetary systems and find that, typically, at least one planet is ejected from the system. We apply our theory to the shortest-period Kepler binary that possesses a CBP, Kepler-47, and find that its existence is consistent with our model. Under conservative assumptions, we find that coupled stellar–tidal evolution of pre-main sequence binary stars removes at least one close-in CBP in 87% of multi-planet circumbinary systems.
Effect of binary fraction on color-magnitude diagram of NGC 1904
Li, Zhongmu; Deng, Yangyang
2018-05-01
The age of a southern globular cluster in Milky Way, NGC 1904, was shown to be larger than the typical age of the universe, around 13.7 Gyr, by some photometric studies which assumed all stars as single stars. Besides the uncertainties in photometry, isochrone and fitting technique, the neglect of binary stars possibly distorted the result. We study the effect of binary fraction on the color-magnitude diagram (CMD) of NGC 1904, via a new tool for CMD studies, Powerful CMD, which can determine binary fraction, age, metallicity, distance modulus, color excess, rotating star fraction and star formation history simultaneously. We finally obtain the youngest age of 14.1±2.1 Gyr with a zero-age binary fraction of 60 percent for cluster NGC 1904. The result is consistent with the age of the universe. Although our result suggests that binary fraction affects the determination of age slightly, it can improve the fitting to observed CMD, in particular blue stragglers. This suggests us to consider the effect of binaries in the studies of star clusters.
Microlensing discovery of a population of very tight, very low mass binary brown dwarfs
DEFF Research Database (Denmark)
Choi, J.-Y.; Han, C.; Udalski, A.
2013-01-01
the discovery via gravitational microlensing of two very low mass, very tight binary systems. These binaries have directly and precisely measured total system masses of 0.025 M ☉ and 0.034 M ☉, and projected separations of 0.31 AU and 0.19 AU, making them the lowest-mass and tightest field BD binaries known....... The discovery of a population of such binaries indicates that BD binaries can robustly form at least down to masses of ~0.02 M ☉. Future microlensing surveys will measure a mass-selected sample of BD binary systems, which can then be directly compared to similar samples of stellar binaries....
International Nuclear Information System (INIS)
Morales Mendoza, N.; Goyanes, S.; Chiliotte, C.; Bekeris, V.; Rubiolo, G.; Candal, R.
2012-01-01
Magnetic binary nanofillers containing multiwall carbon nanotubes (MWCNT) and hercynite were synthesized by Chemical Vapor Deposition (CVD) on Fe/AlOOH prepared by the sol-gel method. The catalyst precursor was fired at 450 °C, ground and sifted through different meshes. Two powders were obtained with different particle sizes: sample A (50-75 μm) and sample B (smaller than 50 μm). These powders are composed of iron oxide particles widely dispersed in the non-crystalline matrix of aluminum oxide and they are not ferromagnetic. After reduction process the powders are composed of α-Fe nanoparticles inside hercynite matrix. These nanofillers are composed of hercynite containing α-Fe nanoparticles and MWCNT. The binary magnetic nanofillers were slightly ferromagnetic. The saturation magnetization of the nanofillers depended on the powder particle size. The nanofiller obtained from powder particles in the range 50-75 μm showed a saturation magnetization 36% higher than the one formed from powder particles smaller than 50 μm. The phenomenon is explained in terms of changes in the magnetic environment of the particles as consequence of the presence of MWCNT.
Energy Technology Data Exchange (ETDEWEB)
Morales Mendoza, N. [INQUIMAE, CONICET-UBA, Ciudad Universitaria, Pab2, (C1428EHA) Bs As (Argentina); LPyMC, Dep. De Fisica, FCEN-UBA and IFIBA -CONICET, Ciudad Universitaria, Cap. Fed. (Argentina); Goyanes, S. [LPyMC, Dep. De Fisica, FCEN-UBA and IFIBA -CONICET, Ciudad Universitaria, Cap. Fed. (Argentina); Chiliotte, C.; Bekeris, V. [LBT, Dep. De Fisica, FCEN-UBA. Ciudad Universitaria, Pab1, C1428EGA CABA (Argentina); Rubiolo, G. [LPyMC, Dep. De Fisica, FCEN-UBA and IFIBA -CONICET, Ciudad Universitaria, Cap. Fed. (Argentina); Unidad de Actividad Materiales, CNEA, Av Gral. Paz 1499, San Martin (1650), Prov. de Bs As (Argentina); Candal, R., E-mail: candal@qi.fcen.uba.ar [INQUIMAE, CONICET-UBA, Ciudad Universitaria, Pab2, (C1428EHA) Bs As (Argentina); Escuela de Ciencia y Tecnologia, 3iA, Universidad de Gral. San Martin, San Martin, Prov. Bs As (Argentina)
2012-08-15
Magnetic binary nanofillers containing multiwall carbon nanotubes (MWCNT) and hercynite were synthesized by Chemical Vapor Deposition (CVD) on Fe/AlOOH prepared by the sol-gel method. The catalyst precursor was fired at 450 Degree-Sign C, ground and sifted through different meshes. Two powders were obtained with different particle sizes: sample A (50-75 {mu}m) and sample B (smaller than 50 {mu}m). These powders are composed of iron oxide particles widely dispersed in the non-crystalline matrix of aluminum oxide and they are not ferromagnetic. After reduction process the powders are composed of {alpha}-Fe nanoparticles inside hercynite matrix. These nanofillers are composed of hercynite containing {alpha}-Fe nanoparticles and MWCNT. The binary magnetic nanofillers were slightly ferromagnetic. The saturation magnetization of the nanofillers depended on the powder particle size. The nanofiller obtained from powder particles in the range 50-75 {mu}m showed a saturation magnetization 36% higher than the one formed from powder particles smaller than 50 {mu}m. The phenomenon is explained in terms of changes in the magnetic environment of the particles as consequence of the presence of MWCNT.
White dwarf-main sequence binaries from LAMOST: the DR5 catalogue
Ren, J.-J.; Rebassa-Mansergas, A.; Parsons, S. G.; Liu, X.-W.; Luo, A.-L.; Kong, X.; Zhang, H.-T.
2018-03-01
We present the data release (DR) 5 catalogue of white dwarf-main sequence (WDMS) binaries from the Large Area Multi-Object fiber Spectroscopic Telescope (LAMOST). The catalogue contains 876 WDMS binaries, of which 757 are additions to our previous LAMOST DR1 sample and 357 are systems that have not been published before. We also describe a LAMOST-dedicated survey that aims at obtaining spectra of photometrically-selected WDMS binaries from the Sloan Digital Sky Survey (SDSS) that are expected to contain cool white dwarfs and/or early type M dwarf companions. This is a population under-represented in previous SDSS WDMS binary catalogues. We determine the stellar parameters (white dwarf effective temperatures, surface gravities and masses, and M dwarf spectral types) of the LAMOST DR5 WDMS binaries and make use of the parameter distributions to analyse the properties of the sample. We find that, despite our efforts, systems containing cool white dwarfs remain under-represented. Moreover, we make use of LAMOST DR5 and SDSS DR14 (when available) spectra to measure the Na I λλ 8183.27, 8194.81 absorption doublet and/or Hα emission radial velocities of our systems. This allows identifying 128 binaries displaying significant radial velocity variations, 76 of which are new. Finally, we cross-match our catalogue with the Catalina Surveys and identify 57 systems displaying light curve variations. These include 16 eclipsing systems, two of which are new, and nine binaries that are new eclipsing candidates. We calculate periodograms from the photometric data and measure (estimate) the orbital periods of 30 (15) WDMS binaries.
Studying Variance in the Galactic Ultra-compact Binary Population
Larson, Shane; Breivik, Katelyn
2017-01-01
In the years preceding LISA, Milky Way compact binary population simulations can be used to inform the science capabilities of the mission. Galactic population simulation efforts generally focus on high fidelity models that require extensive computational power to produce a single simulated population for each model. Each simulated population represents an incomplete sample of the functions governing compact binary evolution, thus introducing variance from one simulation to another. We present a rapid Monte Carlo population simulation technique that can simulate thousands of populations on week-long timescales, thus allowing a full exploration of the variance associated with a binary stellar evolution model.
Formation of planetary nebulae with close binary nuclei
Energy Technology Data Exchange (ETDEWEB)
Livio, M; Salzman, J; Shaviv, G [Tel Aviv Univ. (Israel). Dept. of Physics and Astronomy
1979-07-01
A model for the formation of planetary nebulae with a close binary as a nucleus is presented. The model is based on mass loss instability at L/sub 2/. The instability is demonstrated. The conditions on the mass loss are formulated and analysed. The observational consequence of the model is described briefly and its relation to symbiotic stars and cataclysmic binaries discussed.
Context based Coding of Binary Shapes by Object Boundary Straightness Analysis
DEFF Research Database (Denmark)
Aghito, Shankar Manuel; Forchhammer, Søren
2004-01-01
A new lossless compression scheme for bilevel images targeted at binary shapes of image and video objects is presented. The scheme is based on a local analysis of the digital straightness of the causal part of the object boundary, which is used in the context definition for arithmetic encoding....... Tested on individual images of binary shapes and binary layers of digital maps the algorithm outperforms PWC, JBIG and MPEG-4 CAE. On the binary shapes the code lengths are reduced by 21%, 25%, and 42%, respectively. On the maps the reductions are 34%, 32%, and 59%, respectively. The algorithm is also...
A Catalog of 1022 Bright Contact Binary Stars
Gettel, S. J.; Geske, M. T.; McKay, T. A.
2006-01-01
In this work we describe a large new sample of contact binary stars extracted in a uniform manner from sky patrol data taken by the ROTSE-I telescope. Extensive ROTSE-I light-curve data are combined with J-, H-, and K-band near-infrared data taken from the Two Micron All Sky Survey to add color information. Contact binary candidates are selected using the observed period-color relation. Candidates are confirmed by visual examination of the light curves. To enhance the utility of this catalog, we derive a new J-H period-color-luminosity relation and use this to estimate distances for the entire catalog. From these distance estimates we derive an estimated contact binary space density of (1.7+/-0.6)×10-5 pc-3.
Microstructure and properties of Mg-Al binary alloys
Directory of Open Access Journals (Sweden)
ZHENG Wei-chao
2006-11-01
Full Text Available The effects of different amounts of added Al, ranging from 1 % to 9 %, on the microstructure and properties of Mg-Al binary alloys were investigated. The results showed that when the amount of added Al is less than 5%, the grain size of the Mg-Al binary alloys decreases dramatically from 3 097 μm to 151 μm with increasing addition of Al. Further addition of Al up to 9% makes the grain size decrease slowly to 111 μm. The α-Mg dendrite arms are also refined. Increasing the amount of added Al decreases the hot cracking susceptibility of the Mg-Al binary alloys remarkably, and enhances the micro-hardness of the α-Mg matrix.
WIYN Open Cluster Study: Tidal Interactions in Solar type Binaries
Meibom, S.; Mathieu, R. D.
2003-01-01
We present an ongoing study on tidal interactions in late-type close binary stars. New results on tidal circularization are combined with existing data to test and constrain theoretical predictions of tidal circularization in the pre-main-sequence (PMS) phase and throughout the main-sequence phase of stellar evolution. Current data suggest that tidal circularization during the PMS phase sets the tidal cutoff period for binary populations younger than ~1 Gyr. Binary populations older than ~1 G...
Magnetic braking in Solar-type close binaries
Maceroni, C.; Rucinski, S. M.
In tidally locked binaries the angular momentum loss by magnetic braking affects the orbital period. While this effect is too small to be detected in individual systems, its signature can be seen in shape of the orbital period distribution of suitable samples. As a consequence information on the braking mechanisms can be obtained - at least in principle - from the analysis of the distributions, the main problems being the selection of a large and homogeneous sample of binaries and the appropriate treatment of the observational biases. New large databases of variable stars are becoming available as by-products of microlensing projects, which have the advantage of joining, for the first time, sample richness and homogeneity. We report the main results of the analysis of the eclipsing binaries in OGLE-I catalog, that contains several thousands variables detected in a pencil-beam search volume towards the Baade's Window. By means of an automatic filtering algorithm we extracted a sample of 74 detached, equal-mass, main-sequence binary stars with short orbital periods (i.e., in the range 0.19 braking law. The results suggest an AML braking law very close to the "saturated" one, with a very weak dependence on the period. However we are still far from constraining the precise value of the slope, because of the important role played by the observational bias.
Face Alignment via Regressing Local Binary Features.
Ren, Shaoqing; Cao, Xudong; Wei, Yichen; Sun, Jian
2016-03-01
This paper presents a highly efficient and accurate regression approach for face alignment. Our approach has two novel components: 1) a set of local binary features and 2) a locality principle for learning those features. The locality principle guides us to learn a set of highly discriminative local binary features for each facial landmark independently. The obtained local binary features are used to jointly learn a linear regression for the final output. This approach achieves the state-of-the-art results when tested on the most challenging benchmarks to date. Furthermore, because extracting and regressing local binary features are computationally very cheap, our system is much faster than previous methods. It achieves over 3000 frames per second (FPS) on a desktop or 300 FPS on a mobile phone for locating a few dozens of landmarks. We also study a key issue that is important but has received little attention in the previous research, which is the face detector used to initialize alignment. We investigate several face detectors and perform quantitative evaluation on how they affect alignment accuracy. We find that an alignment friendly detector can further greatly boost the accuracy of our alignment method, reducing the error up to 16% relatively. To facilitate practical usage of face detection/alignment methods, we also propose a convenient metric to measure how good a detector is for alignment initialization.
ON NEUTRAL ABSORPTION AND SPECTRAL EVOLUTION IN X-RAY BINARIES
International Nuclear Information System (INIS)
Miller, J. M.; Cackett, E. M.; Reis, R. C.
2009-01-01
Current X-ray observatories make it possible to follow the evolution of transient and variable X-ray binaries across a broad range in luminosity and source behavior. In such studies, it can be unclear whether evolution in the low-energy portion of the spectrum should be attributed to evolution in the source, or instead to evolution in neutral photoelectric absorption. Dispersive spectrometers make it possible to address this problem. We have analyzed a small but diverse set of X-ray binaries observed with the Chandra High Energy Transmission Grating Spectrometer across a range in luminosity and different spectral states. The column density in individual photoelectric absorption edges remains constant with luminosity, both within and across source spectral states. This finding suggests that absorption in the interstellar medium strongly dominates the neutral column density observed in spectra of X-ray binaries. Consequently, evolution in the low-energy spectrum of X-ray binaries should properly be attributed to evolution in the source spectrum. We discuss our results in the context of X-ray binary spectroscopy with current and future X-ray missions.
Absolute dimensions of solar-type eclipsing binaries III. EW orionis
DEFF Research Database (Denmark)
Clausen, Jens Viggo; Bruntt, H.; Olsen, E. H.
2010-01-01
stars: evolution / stars: fundamental parameters / stars: abundances / binaries: eclipsing / techniques: photometric / techniques: spectroscopic Udgivelsesdato: 23 Feb.......stars: evolution / stars: fundamental parameters / stars: abundances / binaries: eclipsing / techniques: photometric / techniques: spectroscopic Udgivelsesdato: 23 Feb....
Binary Sparse Phase Retrieval via Simulated Annealing
Directory of Open Access Journals (Sweden)
Wei Peng
2016-01-01
Full Text Available This paper presents the Simulated Annealing Sparse PhAse Recovery (SASPAR algorithm for reconstructing sparse binary signals from their phaseless magnitudes of the Fourier transform. The greedy strategy version is also proposed for a comparison, which is a parameter-free algorithm. Sufficient numeric simulations indicate that our method is quite effective and suggest the binary model is robust. The SASPAR algorithm seems competitive to the existing methods for its efficiency and high recovery rate even with fewer Fourier measurements.
ON THE APPARENT LACK OF Be X-RAY BINARIES WITH BLACK HOLES
International Nuclear Information System (INIS)
Belczynski, Krzysztof; Ziolkowski, Janusz
2009-01-01
In our Galaxy there are 64 Be X-ray binaries known to date. Out of these, 42 host a neutron star (NS), and for the remainder the nature of the companion is unknown. None, so far, are known to host a black hole (BH). There seems to be no apparent mechanism that would prevent formation or detection of Be stars with BHs. This disparity is referred to as a missing Be-BH X-ray binary problem. We point out that current evolutionary scenarios that lead to the formation of Be X-ray binaries predict that the ratio of binaries with NSs to the ones with BHs is rather high, F NStoBH ∼ 10-50, with the more likely formation models providing the values at the high end. The ratio is a natural outcome of (1) the stellar initial mass function that produces more NSs than BHs and (2) common envelope evolution (i.e., a major mechanism involved in the formation of interacting binaries) that naturally selects progenitors of Be X-ray binaries with NSs (binaries with comparable mass components have more likely survival probabilities) over ones with BHs (which are much more likely to be common envelope mergers). A comparison of this ratio (i.e., F NStoBH ∼ 30) with the number of confirmed Be-NS X-ray binaries (42) indicates that the expected number of Be-BH X-ray binaries is of the order of only ∼0-2. This is entirely consistent with the observed Galactic sample.
A New Equilibrium State for Singly Synchronous Binary Asteroids
Golubov, Oleksiy; Unukovych, Vladyslav; Scheeres, Daniel J.
2018-04-01
The evolution of rotation states of small asteroids is governed by the Yarkovsky–O’Keefe–Radzievskii–Paddack (YORP) effect, nonetheless some asteroids can stop their YORP evolution by attaining a stable equilibrium. The same is true for binary asteroids subjected to the binary YORP (BYORP) effect. Here we discuss a new type of equilibrium that combines these two, which is possible in a singly synchronous binary system. This equilibrium occurs when the normal YORP, the tangential YORP, and the BYORP compensate each other, and tidal torques distribute the angular momentum between the components of the system and dissipate energy. If unperturbed, such a system would remain singly synchronous in perpetuity with constant spin and orbit rates, as the tidal torques dissipate the incoming energy from impinging sunlight at the same rate. The probability of the existence of this kind of equilibrium in a binary system is found to be on the order of a few percent.
Modeling AGN outbursts from supermassive black hole binaries
Directory of Open Access Journals (Sweden)
Tanaka T.
2012-12-01
Full Text Available When galaxies merge to assemble more massive galaxies, their nuclear supermassive black holes (SMBHs should form bound binaries. As these interact with their stellar and gaseous environments, they will become increasingly compact, culminating in inspiral and coalescence through the emission of gravitational radiation. Because galaxy mergers and interactions are also thought to fuel star formation and nuclear black hole activity, it is plausible that such binaries would lie in gas-rich environments and power active galactic nuclei (AGN. The primary difference is that these binaries have gravitational potentials that vary – through their orbital motion as well as their orbital evolution – on humanly tractable timescales, and are thus excellent candidates to give rise to coherent AGN variability in the form of outbursts and recurrent transients. Although such electromagnetic signatures would be ideally observed concomitantly with the binary’s gravitational-wave signatures, they are also likely to be discovered serendipitously in wide-field, high-cadence surveys; some may even be confused for stellar tidal disruption events. I discuss several types of possible “smoking gun” AGN signatures caused by the peculiar geometry predicted for accretion disks around SMBH binaries.
Graph theory and binary alloys passivated by nickel
International Nuclear Information System (INIS)
McCafferty, E.
2005-01-01
The passivity of a nickel binary alloy is considered in terms of a network of -Ni-O-Ni- bridges in the oxide film, where Ni is the component of the binary alloy which produces passivity. The structure of the oxide is represented by a mathematical graph, and graph theory is used to calculate the connectivity of the oxide, given by the product of the number of edges in the graph and the Randic index. A stochastic calculation is employed to insert ions of the second metal into the oxide film so as to disrupt the connectivity of the -Ni-O-Ni- network. This disruption occurs at a critical ionic concentration of the oxide film. Mathematical relationships are developed for the introduction of a general ion B +n into the oxide film, and critical ionic compositions are calculated for oxide films on the nickel binary alloys. The notation B refers to any metal B which produces B +n ions in the oxide film, where +n is the oxidation number of the ion. The results of this analysis for Fe-Ni and Cu-Ni binary alloys are in good agreement with experimental results
Searching for Signatures of Supermassive Black Hole Binaries
Ayers, Megan; Gezari, Suvi; Liu, Tingting
2018-01-01
Theoretical studies suggest that supermassive black hole binaries (SMBHBs) are an inevitable consequence of major galaxy mergers. Additionally, as SMBHBs coalesce they are expected to be sources of tremendous gravitational wave emission. Interest in these sources motivates the search for detection of the first definitive SMBHB and observational signatures to methodize the search. We present spectral energy distributions (SEDs) for a sample of candidate SMBHBs selected from quasars demonstrating optical periodic variability from the Pan-STARRS1 Medium Deep Survey. The SEDs were constructed using existing archival data spanning from radio to X-ray emission. For each candidate SMBHB, we also present models of the theoretical spectrum emitted from the circumbinary and minidisks of the SMBHB system using the predictions of Roedig et al. (2014) and inferred parameters of the candidates (combined mass, mass ratio, binary separation, accretion rate). We compare the observational SED for each source to its respective binary model as well as to the expected mean SED of a normal non-binary system quasar to look for supporting evidence of a SMBHB system. This project was supported in part by the NSF REU grant AST-1358980 and by the Nantucket Maria Mitchell Association.
HD271791: dynamical versus binary-supernova ejection scenario
Gvaramadze, V. V.
2009-05-01
The atmosphere of the extremely high-velocity (530-920kms-1) early B-type star HD271791 is enriched in α-process elements, which suggests that this star is a former secondary component of a massive tight binary system and that its surface was polluted by the nucleosynthetic products after the primary star exploded in a supernova. It was proposed that the (asymmetric) supernova explosion unbind the system and that the secondary star (HD271791) was released at its orbital velocity in the direction of Galactic rotation. In this Letter, we show that to explain the Galactic rest-frame velocity of HD271791 within the framework of the binary-supernova scenario, the stellar remnant of the supernova explosion (a =750-1200kms-1. We therefore consider the binary-supernova scenario as highly unlikely and instead propose that HD271791 attained its peculiar velocity in the course of a strong dynamical three- or four-body encounter in the dense core of the parent star cluster. Our proposal implies that by the moment of encounter HD271791 was a member of a massive post-supernova binary.
Iscaife, Alexandre; Dos Anjos, Gabriel; Barbosa, Cristovão; Nahas, Willian Carlos; Srougi, Miguel; Antunes, Alberto Azoubel
2018-03-15
The urinary bladder diverticula (BD) secondary to benign prostatic hyperplasia (BPH) is a complication that can lead to urinary stasis, stone, urinary tract infection (UTI) and tumors. It's role in acute urinary retention (AUR) is not totally understood. To determine the effect of BD size on AUR rates in patients with BPH candidates to surgery. We performed a retrospective cohort study of 47 patients with BPH and BD who underwent BPH surgery associated to complete bladder diverticulectomy from 2006 to 2016. We analyzed risk factors for AUR in patients with BD using univariate, multivariate and correlation analysis. There was a difference in the size of the diverticula, with 6.8 cm vs. 4.5 cm among patients with and without AUR respectively (p=0.005). The ROC curve showed a correlation between the size of BD and the risk of AUR. The value of 5.15 cm presented a sensitivity of 73% and a specificity of 72%. The area under the curve was 0.75 (p=0.01). Comparing groups with BD >5.0 cm vs. ≤5.0 cm, the AUR incidence was 74% and 27.8% respectively with an OR of 2.65 (1.20-5.85) (p=0.005). In the multivariate analysis, only the size of the diverticula reached statistical significance (p=0.012). The diameter of BD is an independent risk factor for AUR in patients with BPH and BD who are candidates to surgery. A diameter greater than 5.15 cm increases the risk of AUR. Copyright® by the International Brazilian Journal of Urology.
Broekhuis, H.; Verkuyl, H.J
2014-01-01
The present paper adopts as its point of departure the claim by Te Winkel (1866) and Verkuyl (2008) that mental temporal representations are built on the basis of three binary oppositions: Present/Past, Synchronous/Posterior and Imperfect/Perfect. Te Winkel took the second opposition in terms of the
Equational binary decision diagrams
J.F. Groote (Jan Friso); J.C. van de Pol (Jaco)
2000-01-01
textabstractWe incorporate equations in binary decision diagrams (BDD). The resulting objects are called EQ-BDDs. A straightforward notion of ordered EQ-BDDs (EQ-OBDD) is defined, and it is proved that each EQ-BDD is logically equivalent to an EQ-OBDD. Moreover, on EQ-OBDDs satisfiability and
Directory of Open Access Journals (Sweden)
Ríos Giovanny
2012-06-01
Full Text Available La anomalía total del retorno venoso sistémico tiene gran variedad de presentaciones; sin embargo, la patología de más baja frecuencia es el drenaje de vena cava superior derecha a la aurícula izquierda, hecho de peso para que en el mundo se reporten pocos casos. En la Fundación Clínica Abood Shaio se trató el caso de una paciente de seis años de edad con drenaje venoso total de cava superior derecha a la aurícula izquierda, mediante la técnica de movilización de cava superior y anastomosis cavo-atrial, y se obtuvieron buenos resultados. El caso es mención corresponde al número 21 en la literatura mundial.Total anomalous systemic venous return has a variety of presentations, being the drainage of right superior vena cava into the left atrium a low frequency condition. There are few reported cases in the world. In Shaio Clinic Foundation we have handled a case of total venous drainage of the right superior vena cava into the left atrium in a 6-year old girl, using the superior vena cava mobilization technique and cavo-atrial anastomosis, with good results. This case is reported as case number 21 in the world.
TIDAL NOVAE IN COMPACT BINARY WHITE DWARFS
International Nuclear Information System (INIS)
Fuller, Jim; Lai Dong
2012-01-01
Compact binary white dwarfs (WDs) undergoing orbital decay due to gravitational radiation can experience significant tidal heating prior to merger. In these WDs, the dominant tidal effect involves the excitation of outgoing gravity waves in the inner stellar envelope and the dissipation of these waves in the outer envelope. As the binary orbit decays, the WDs are synchronized from outside in (with the envelope synchronized first, followed by the core). We examine the deposition of tidal heat in the envelope of a carbon-oxygen WD and study how such tidal heating affects the structure and evolution of the WD. We show that significant tidal heating can occur in the star's degenerate hydrogen layer. This layer heats up faster than it cools, triggering runaway nuclear fusion. Such 'tidal novae' may occur in all WD binaries containing a CO WD, at orbital periods between 5 minutes and 20 minutes, and precede the final merger by 10 5 -10 6 years.
Topology of black hole binary-single interactions
Samsing, Johan; Ilan, Teva
2018-05-01
We present a study on how the outcomes of binary-single interactions involving three black holes (BHs) distribute as a function of the initial conditions; a distribution we refer to as the topology. Using a N-body code that includes BH finite sizes and gravitational wave (GW) emission in the equation of motion (EOM), we perform more than a million binary-single interactions to explore the topology of both the Newtonian limit and the limit at which general relativistic (GR) effects start to become important. From these interactions, we are able to describe exactly under which conditions BH collisions and eccentric GW capture mergers form, as well as how GR in general modifies the Newtonian topology. This study is performed on both large- and microtopological scales. We further describe how the inclusion of GW emission in the EOM naturally leads to scenarios where the binary-single system undergoes two successive GW mergers.
Observations of binary stars by speckle interferometry
International Nuclear Information System (INIS)
Morgan, B.L.; Beckmann, G.K.; Scaddan, R.J.
1980-01-01
This is the second paper in a series describing observations of binary stars using the technique of speckle interferometry. Observations were made using the 2.5-m Isaac Newton Telescope and the 1-m telescope of the Royal Greenwich Observatory and the 1.9-m telescope of the South African Astronomical Observatory. The classical Rayleigh diffraction limits are 0.050 arcsec for the 2.5-m telescope, 0.065 arcsec for the 1.9-m telescope and 0.125 arcsec for the 1-m telescope, at a wavelength of 500 nm. The results of 29 measurements of 26 objects are presented. The objects include long period spectroscopic binaries from the 6th Catalogue of Batten, close visual binary systems from the 3rd Catalogue of Finsen and Worley and variable stars. Nine of the objects have not been previously resolved by speckle interferometry. New members are detected in the systems β Cep, p Vel and iota UMa. (author)
Coupled binary embedding for large-scale image retrieval.
Zheng, Liang; Wang, Shengjin; Tian, Qi
2014-08-01
Visual matching is a crucial step in image retrieval based on the bag-of-words (BoW) model. In the baseline method, two keypoints are considered as a matching pair if their SIFT descriptors are quantized to the same visual word. However, the SIFT visual word has two limitations. First, it loses most of its discriminative power during quantization. Second, SIFT only describes the local texture feature. Both drawbacks impair the discriminative power of the BoW model and lead to false positive matches. To tackle this problem, this paper proposes to embed multiple binary features at indexing level. To model correlation between features, a multi-IDF scheme is introduced, through which different binary features are coupled into the inverted file. We show that matching verification methods based on binary features, such as Hamming embedding, can be effectively incorporated in our framework. As an extension, we explore the fusion of binary color feature into image retrieval. The joint integration of the SIFT visual word and binary features greatly enhances the precision of visual matching, reducing the impact of false positive matches. Our method is evaluated through extensive experiments on four benchmark datasets (Ukbench, Holidays, DupImage, and MIR Flickr 1M). We show that our method significantly improves the baseline approach. In addition, large-scale experiments indicate that the proposed method requires acceptable memory usage and query time compared with other approaches. Further, when global color feature is integrated, our method yields competitive performance with the state-of-the-arts.
Binary model for the coma cluster of galaxies
International Nuclear Information System (INIS)
Valtonen, M.J.; Byrd, G.G.
1979-01-01
We study the dynamics of galaxies in the Coma cluster and find that the cluster is probably dominated by a central binary of galaxies NGC 4874--NGC4889. We estimate their total mass to be about 3 x 10 14 M/sub sun/ by two independent methods (assuming in Hubble constant of 100 km s -1 Mpc -1 ). This binary is efficient in dynamically ejecting smaller galaxies, some of of which are seen in projection against the inner 3 0 radius of the cluster and which, if erroneously considered as bound members, cause a serious overestimate of the mass of the entire cluster. Taking account of the ejected galaxies, we estimate the total cluster mass to be 4--9 x 10 14 M/sub sun/, with a corresponding mass-to-light ratio for a typical galaxy in the range of 20--120 solar units. The origin of the secondary maximum observed in the radial surface density profile is studied. We consider it to be a remnant of a shell of galaxies which formed around the central binary. This shell expanded, then collapsed into the binary, and is now reexpanding. This is supported by the coincidence of the minimum in the cluster eccentricity and radical velocity dispersion at the same radial distance as the secondary maximum. Numerical simulations of a cluster model with a massive central binary and a spherical shell of test particles are performed, and they reproduce the observed shape, galaxy density, and radial velocity distributions in the Coma cluster fairly well. Consequences of extending the model to other clusters are discussed
Evolution of massive close binary stars
International Nuclear Information System (INIS)
Masevich, A.G.; Tutukov, A.V.
1982-01-01
Some problems of the evolution of massive close binary stars are discussed. Most of them are nonevolutionized stars with close masses of components. After filling the Roche cavity and exchange of matter between the components the Wolf-Rayet star is formed. As a result of the supernovae explosion a neutron star or a black hole is formed in the system. The system does not disintegrate but obtains high space velocity owing to the loss of the supernovae envelope. The satellite of the neutron star or black hole - the star of the O or B spectral class loses about 10 -6 of the solar mass for a year. Around the neighbouring component a disc of this matter is formed the incidence of which on a compact star leads to X radiation appearance. The neutron star cannot absorb the whole matter of the widening component and the binary system submerges into the common envelope. As a result of the evolution of massive close binary systems single neutron stars can appear which after the lapse of some time become radiopulsars. Radiopulsars with such high space velocities have been found in our Galaxy [ru
GridRun: A lightweight packaging and execution environment forcompact, multi-architecture binaries
Energy Technology Data Exchange (ETDEWEB)
Shalf, John; Goodale, Tom
2004-02-01
GridRun offers a very simple set of tools for creating and executing multi-platform binary executables. These ''fat-binaries'' archive native machine code into compact packages that are typically a fraction the size of the original binary images they store, enabling efficient staging of executables for heterogeneous parallel jobs. GridRun interoperates with existing distributed job launchers/managers like Condor and the Globus GRAM to greatly simplify the logic required launching native binary applications in distributed heterogeneous environments.
Where Kinsey, Christ, and Tila Tequila meet: discourse and the sexual (non)-binary.
Callis, April S
2014-01-01
Drawing on 80 interviews and 17 months of participant observation in Lexington, Kentucky, this article details how individuals drew on three areas of national and local discourse to conceptualize sexuality. Media, popular science, and religious discourses can be viewed as portraying sexuality bifocally--as both a binary of heterosexual/homosexual and as a non-binary that encompasses fluidity. However, individuals in Lexington drew on each of these areas of discourse differently. Religion was thought to produce a binary vision of sexuality, whereas popular science accounts were understood as both binary and not. The media was understood as portraying non-binary identities that were not viable, thus strengthening the sexual binary. These differing points of view led identities such as bisexual and queer to lack cultural intelligibility.
The spectrographic orbit of the eclipsing binary HH Carinae
International Nuclear Information System (INIS)
Mandrini, C.H.; Mendez, R.H.; Niemela, V.S.; Ferrer, O.E.
1985-01-01
We present a radial velocity study of the eclipsing binary system HH Carinae, and determine for the first time its spectrographic orbital elements. Using the results of a previous photometric study by Soderhjelm, we also determine the values of the masses and dimensions of the binary components. (author)
Genders and Individual Treatment Progress in (Non-)Binary Trans Individuals.
Koehler, Andreas; Eyssel, Jana; Nieder, Timo O
2018-01-01
Health care for transgender and transsexual (ie, trans) individuals has long been based on a binary understanding of gender (ie, feminine vs masculine). However, the existence of non-binary or genderqueer (NBGQ) genders is increasingly recognized by academic and/or health care professionals. To gain insight into the individual health care experiences and needs of binary and NBGQ individuals to improve their health care outcomes and experience. Data were collected using an online survey study on experiences with trans health care. The non-clinical sample consisted of 415 trans individuals. An individual treatment progress score was calculated to report and compare participants' individual progress toward treatment completion and consider the individual treatment needs and definitions of completed treatment (ie, amount and types of different treatments needed to complete one's medical transition). Main outcome measures were (i) general and trans-related sociodemographic data and (ii) received and planned treatments. Participants reported binary (81.7%) and different NBGQ (18.3%) genders. The 2 groups differed significantly in basic demographic data (eg, mean age; P < .05). NBGQ participants reported significantly fewer received treatments compared with binary participants. For planned treatments, binary participants reported more treatments related to primary sex characteristics only. Binary participants required more treatments for a completed treatment than NBGQ participants (6.0 vs 4.0). There were no differences with regard to individual treatment progress score. Because traditional binary-focused treatment practice could have hindered NBGQ individuals from accessing trans health care or sufficiently articulating their needs, health care professionals are encouraged to provide a holistic and individual treatment approach and acknowledge genders outside the gender binary to address their needs appropriately. Because the study was made inclusive for non
Massive Binary Black Holes in the Cosmic Landscape
Colpi, Monica; Dotti, Massimo
2011-02-01
Binary black holes occupy a special place in our quest for understanding the evolution of galaxies along cosmic history. If massive black holes grow at the center of (pre-)galactic structures that experience a sequence of merger episodes, then dual black holes form as inescapable outcome of galaxy assembly, and can in principle be detected as powerful dual quasars. But, if the black holes reach coalescence, during their inspiral inside the galaxy remnant, then they become the loudest sources of gravitational waves ever in the universe. The Laser Interferometer Space Antenna is being developed to reveal these waves that carry information on the mass and spin of these binary black holes out to very large look-back times. Nature seems to provide a pathway for the formation of these exotic binaries, and a number of key questions need to be addressed: How do massive black holes pair in a merger? Depending on the properties of the underlying galaxies, do black holes always form a close Keplerian binary? If a binary forms, does hardening proceed down to the domain controlled by gravitational wave back reaction? What is the role played by gas and/or stars in braking the black holes, and on which timescale does coalescence occur? Can the black holes accrete on flight and shine during their pathway to coalescence? After outlining key observational facts on dual/binary black holes, we review the progress made in tracing their dynamics in the habitat of a gas-rich merger down to the smallest scales ever probed with the help of powerful numerical simulations. N-Body/hydrodynamical codes have proven to be vital tools for studying their evolution, and progress in this field is expected to grow rapidly in the effort to describe, in full realism, the physics of stars and gas around the black holes, starting from the cosmological large scale of a merger. If detected in the new window provided by the upcoming gravitational wave experiments, binary black holes will provide a deep view
Accuracy of inference on the physics of binary evolution from gravitational-wave observations
Barrett, Jim W.; Gaebel, Sebastian M.; Neijssel, Coenraad J.; Vigna-Gómez, Alejandro; Stevenson, Simon; Berry, Christopher P. L.; Farr, Will M.; Mandel, Ilya
2018-04-01
The properties of the population of merging binary black holes encode some of the uncertain physics underlying the evolution of massive stars in binaries. The binary black hole merger rate and chirp-mass distribution are being measured by ground-based gravitational-wave detectors. We consider isolated binary evolution, and explore how accurately the physical model can be constrained with such observations by applying the Fisher information matrix to the merging black hole population simulated with the rapid binary-population synthesis code COMPAS. We investigate variations in four COMPAS parameters: common-envelope efficiency, kick-velocity dispersion, and mass-loss rates during the luminous blue variable and Wolf-Rayet stellar-evolutionary phases. We find that ˜1000 observations would constrain these model parameters to a fractional accuracy of a few per cent. Given the empirically determined binary black hole merger rate, we can expect gravitational-wave observations alone to place strong constraints on the physics of stellar and binary evolution within a few years. Our approach can be extended to use other observational data sets; combining observations at different evolutionary stages will lead to a better understanding of stellar and binary physics.
Armas Padilla, M.
2013-01-01
The discovery of the first X-ray binary, Scorpius X-1, by Giacconi et al. (1962), marked the birth of X-ray astronomy. Following that discovery, many additional X-ray sources where found with the first generation of X-ray rockets and observatories (e.g., UHURU and Einstein). The short-timescale
Strong binary pulsar constraints on Lorentz violation in gravity.
Yagi, Kent; Blas, Diego; Yunes, Nicolás; Barausse, Enrico
2014-04-25
Binary pulsars are excellent laboratories to test the building blocks of Einstein's theory of general relativity. One of these is Lorentz symmetry, which states that physical phenomena appear the same for all inertially moving observers. We study the effect of violations of Lorentz symmetry in the orbital evolution of binary pulsars and find that it induces a much more rapid decay of the binary's orbital period due to the emission of dipolar radiation. The absence of such behavior in recent observations allows us to place the most stringent constraints on Lorentz violation in gravity, thus verifying one of the cornerstones of Einstein's theory much more accurately than any previous gravitational observation.
Massive Black Hole Binaries: Dynamical Evolution and Observational Signatures
Directory of Open Access Journals (Sweden)
M. Dotti
2012-01-01
Full Text Available The study of the dynamical evolution of massive black hole pairs in mergers is crucial in the context of a hierarchical galaxy formation scenario. The timescales for the formation and the coalescence of black hole binaries are still poorly constrained, resulting in large uncertainties in the expected rate of massive black hole binaries detectable in the electromagnetic and gravitational wave spectra. Here, we review the current theoretical understanding of the black hole pairing in galaxy mergers, with a particular attention to recent developments and open issues. We conclude with a review of the expected observational signatures of massive binaries and of the candidates discussed in literature to date.
The BANANA Survey: Spin-Orbit Alignment in Binary Stars
Albrecht, Simon; Winn, J. N.; Fabrycky, D. C.; Torres, G.; Setiawan, J.
2012-04-01
Binaries are not always neatly aligned. Previous observations of the DI Herculis system showed that the spin axes of both stars are highly inclined with respect to one another and the orbital axis. Here, we report on our ongoing survey to measure relative orientations of spin-axes in a number of eclipsing binary systems. These observations will hopefully lead to new insights into star and planet formation, as different formation scenarios predict different degrees of alignment and different dependencies on the system parameters. Measurements of spin-orbit angles in close binary systems will also create a basis for comparison for similar measurements involving close-in planets.
SPECKLE INTERFEROMETRY OF SECONDARY COMPONENTS IN NEARBY VISUAL BINARIES
International Nuclear Information System (INIS)
Tokovinin, Andrei; Horch, Elliott P.
2016-01-01
Statistical characterization of secondary subsystems in binaries helps to distinguish between various scenarios of multiple-star formation. The Differential Speckle Survey Instrument was used at the Gemini-N telescope for several hours in 2015 July to probe the binarity of 25 secondary components in nearby solar-type binaries. Six new subsystems were resolved, with meaningful detection limits for the remaining targets. The large incidence of secondary subsystems agrees with other similar studies. The newly resolved subsystem HIP 115417 Ba,Bb causes deviations in the observed motion of the outer binary from which an astrometric orbit of Ba,Bb with a period of 117 years is deduced.
Strong Binary Pulsar Constraints on Lorentz Violation in Gravity
Yagi, Kent; Yunes, Nicolas; Barausse, Enrico
2014-01-01
Binary pulsars are excellent laboratories to test the building blocks of Einstein's theory of General Relativity. One of these is Lorentz symmetry which states that physical phenomena appear the same for all inertially moving observers. We study the effect of violations of Lorentz symmetry in the orbital evolution of binary pulsars and find that it induces a much more rapid decay of the binary's orbital period due to the emission of dipolar radiation. The absence of such behavior in recent observations allows us to place the most stringent constraints on Lorentz violation in gravity, thus verifying one of the cornerstones of Einstein's theory much more accurately than any previous gravitational observation.
Binary GCD like Algorithms for Some Complex Quadratic Rings
DEFF Research Database (Denmark)
Agarwal, Saurabh; Frandsen, Gudmund Skovbjerg
2004-01-01
On the lines of the binary gcd algorithm for rational integers, algorithms for computing the gcd are presented for the ring of integers in where . Thus a binary gcd like algorithm is presented for a unique factorization domain which is not Euclidean (case d=-19). Together with the earlier known b...
Merger of binary neutron stars: Gravitational waves and electromagnetic counterparts
Energy Technology Data Exchange (ETDEWEB)
Shibata, Masaru
2016-12-15
Late inspiral and merger phases of binary neutron stars are the valuable new experimental fields for exploring nuclear physics because (i) gravitational waves from them will bring information for the neutron-star equation of state and (ii) the matter ejected after the onset of the merger could be the main site for the r-process nucleosynthesis. We will summarize these aspects of the binary neutron stars, describing the current understanding for the merger process of binary neutron stars that has been revealed by numerical-relativity simulations.
Extrasolar binary planets. I. Formation by tidal capture during planet-planet scattering
International Nuclear Information System (INIS)
Ochiai, H.; Nagasawa, M.; Ida, S.
2014-01-01
We have investigated (1) the formation of gravitationally bounded pairs of gas-giant planets (which we call 'binary planets') from capturing each other through planet-planet dynamical tide during their close encounters and (2) the subsequent long-term orbital evolution due to planet-planet and planet-star quasi-static tides. For the initial evolution in phase 1, we carried out N-body simulations of the systems consisting of three Jupiter-mass planets taking into account the dynamical tide. The formation rate of the binary planets is as much as 10% of the systems that undergo orbital crossing, and this fraction is almost independent of the initial stellarcentric semimajor axes of the planets, while ejection and merging rates sensitively depend on the semimajor axes. As a result of circularization by the planet-planet dynamical tide, typical binary separations are a few times the sum of the physical radii of the planets. After the orbital circularization, the evolution of the binary system is governed by long-term quasi-static tide. We analytically calculated the quasi-static tidal evolution in phase 2. The binary planets first enter the spin-orbit synchronous state by the planet-planet tide. The planet-star tide removes angular momentum of the binary motion, eventually resulting in a collision between the planets. However, we found that the binary planets survive the tidal decay for the main-sequence lifetime of solar-type stars (∼10 Gyr), if the binary planets are beyond ∼0.3 AU from the central stars. These results suggest that the binary planets can be detected by transit observations at ≳ 0.3 AU.
Energy Technology Data Exchange (ETDEWEB)
Sen, Tanushree; Mishra, Satyendra [University Institute of Chemical Technology, North Maharashtra University, Jalgaon 425001, Maharashtra (India); Shimpi, Navinchandra G., E-mail: navin_shimpi@rediffmail.com [Department of Chemistry, University of Mumbai, Kalina, Mumbai 400098, Maharashtra (India)
2017-06-15
Highlights: • A binary dopant based on β-cyclodextrin has been proposed for PANI. • The binary dopant provided long term stability to electrically conducting PANI. • The β-cyclodextrin based binary dopant rendered PANI sensitive towards CO at RT. - Abstract: The effect of hydrochloric acid/β-cyclodextrin (HCl/β-CD) binary dopant on the morphological, thermal, electrical, and sensing properties of PANI was investigated and compared with those of the conventionally doped PANI. The PANI samples were characterized using FTIR, UV–Vis, {sup 1}H NMR, and FESEM. Significant changes were observed in the structural, thermal, and electrical character of PANI doped with the HCl/β-CD binary dopant. A higher doping level was obtained for the PANI-binary dopant system, as observed from its {sup 1}H NMR spectra. Moreover, the binary dopant imparted long-term stability to the sensor in its conductive form. In addition, the PANI-binary dopant system exhibited a significantly high gas response towards carbon monoxide gas at room temperature.
International Nuclear Information System (INIS)
Muterspaugh, Matthew W.; O'Connell, J.; Hartkopf, William I.; Lane, Benjamin F.; Williamson, M.; Kulkarni, S. R.; Konacki, Maciej; Burke, Bernard F.; Colavita, M. M.; Shao, M.; Wiktorowicz, Sloane J.
2010-01-01
Differential astrometry measurements from the Palomar High-precision Astrometric Search for Exoplanet Systems have been combined with lower precision single-aperture measurements covering a much longer timespan (from eyepiece measurements, speckle interferometry, and adaptive optics) to determine improved visual orbits for 20 binary stars. In some cases, radial velocity observations exist to constrain the full three-dimensional orbit and determine component masses. The visual orbit of one of these binaries-α Com (HD 114378)-shows that the system is likely to have eclipses, despite its very long period of 26 years. The next eclipse is predicted to be within a week of 2015 January 24.
Binary Arithmetic From Hariot (CA, 1600 A.D.) to the Computer Age.
Glaser, Anton
This history of binary arithmetic begins with details of Thomas Hariot's contribution and includes specific references to Hariot's manuscripts kept at the British Museum. A binary code developed by Sir Francis Bacon is discussed. Briefly mentioned are contributions to binary arithmetic made by Leibniz, Fontenelle, Gauss, Euler, Benzout, Barlow,…
Maintaining Arc Consistency in Non-Binary Dynamic CSPs using Simple Tabular Reduction
DEFF Research Database (Denmark)
Queva, Matthieu Stéphane Benoit; Probst, Christian W.; Ricci, Laurent
2010-01-01
CSPs use filtering techniques such as arc consistency, which also have been adapted to handle DCSPs with binary constraints. However, there exists only one algorithm targeting non-binary DCSPs (DnGAC4). In this paper we present a new algorithm DnSTR for maintaining arc consistency in DCSPs with non-binary...
Energy Technology Data Exchange (ETDEWEB)
Treiner, C. (Universite Pierre et Marie Curie, Paris (France)); Nortz, M.; Vaution, C. (Faculte de Pharmacie de Paris-sud, Chatenay-Malabry (France))
1990-07-01
The apparent partition coefficient P of barbituric acids between micelles and water has been determined in mixed binary surfactant solutions from solubility measurements in the whole micellar composition range. The binary systems chosen ranged from the strongly interacting system dodecyltrimethylammonium chloride + sodium dodecyl sulfate to weakly interacting systems such as benzyldimethyltetradecylammonium chloride + tetradecyltrimethyammonium chloride. In all cases studied, mixed micelle formation is unfavorable to micellar solubilization. A correlation is found between the unlike surfactants interaction energy, as measured by the regular solution parameter {beta} and the solute partition coefficient change upon surfactant mixing. By use of literature data on micellar solubilization in binary surfactant solutions, it is shown that the change of P for solutes which are solubilized by surface adsorption is generally governed by the sign and amplitude of the interaction parameter {beta}.
Gravitational Radiation from Post-Newtonian Sources and Inspiralling Compact Binaries
Directory of Open Access Journals (Sweden)
Luc Blanchet
2014-02-01
Full Text Available To be observed and analyzed by the network of gravitational wave detectors on ground (LIGO, VIRGO, etc. and by the future detectors in space (eLISA, etc., inspiralling compact binaries -- binary star systems composed of neutron stars and/or black holes in their late stage of evolution -- require high-accuracy templates predicted by general relativity theory. The gravitational waves emitted by these very relativistic systems can be accurately modelled using a high-order post-Newtonian gravitational wave generation formalism. In this article, we present the current state of the art on post-Newtonian methods as applied to the dynamics and gravitational radiation of general matter sources (including the radiation reaction back onto the source and inspiralling compact binaries. We describe the post-Newtonian equations of motion of compact binaries and the associated Lagrangian and Hamiltonian formalisms, paying attention to the self-field regularizations at work in the calculations. Several notions of innermost circular orbits are discussed. We estimate the accuracy of the post-Newtonian approximation and make a comparison with numerical computations of the gravitational self-force for compact binaries in the small mass ratio limit. The gravitational waveform and energy flux are obtained to high post-Newtonian order and the binary's orbital phase evolution is deduced from an energy balance argument. Some landmark results are given in the case of eccentric compact binaries -- moving on quasi-elliptical orbits with non-negligible eccentricity. The spins of the two black holes play an important role in the definition of the gravitational wave templates. We investigate their imprint on the equations of motion and gravitational wave phasing up to high post-Newtonian order (restricting to spin-orbit effects which are linear in spins, and analyze the post-Newtonian spin precession equations as well as the induced precession of the orbital plane.
Searching for Solar System Wide Binaries with Pan-STARRS-1
Holman, Matthew J.; Protopapas, P.; Tholen, D. J.
2007-10-01
Roughly 60% of the observing time of the Pan-STARRS-1 (PS1) telescope will be dedicated to a "3pi steradian" survey with an observing cadence that is designed for the detection of near-Earth asteroids and slow-moving solar system bodies. Over this course of its 3.5 year cience mission, this unprecedented survey will discover nearly every asteroid, Trojan, Centaur, long-period comet, short-period comet, and trans-neptunian object (TNO) brighter than magnitude R=23. This census will be used to address a large number of questions regarding the physical and dynamical properties of the various small body populations of the solar system. Roughly 1-2% of TNOs are wide binaries with companions at separations greater than 1 arcsec and brightness differences less than 2 magnitudes (Kern & Elliot 2006; Noll et al 2007). These can be readily detected by PS1; we will carry out such a search with PS1 data. To do so, we will modify the Pan-STARRS Moving Object Processing System (MOPS) such that it will associate the components of resolved or marginally resolved binaries, link such pairs of detections obtained at different epochs, and the estimate the relative orbit of the binary. We will also determine the efficiency with which such binaries are detected as a function of the binary's relative orbit and the relative magnitudes of the components. Based on an estimated 7000 TNOs that PS1 will discover, we anticipate finding 70-140 wide binaries. The PS1 data, 60 epochs over three years, is naturally suited to determining the orbits of these objects. Our search will accurately determine the binary fraction for a variety of subclasses of TNOs.
Measuring Parameters of Massive Black Hole Binaries with Partially-Aligned Spins
Lang, Ryan N.; Hughes, Scott A.; Cornish, Neil J.
2010-01-01
It is important to understand how well the gravitational-wave observatory LISA can measure parameters of massive black hole binaries. It has been shown that including spin precession in the waveform breaks degeneracies and produces smaller expected parameter errors than a simpler, precession-free analysis. However, recent work has shown that gas in binaries can partially align the spins with the orbital angular momentum, thus reducing the precession effect. We show how this degrades the earlier results, producing more pessimistic errors in gaseous mergers. However, we then add higher harmonics to the signal model; these also break degeneracies, but they are not affected by the presence of gas. The harmonics often restore the errors in partially-aligned binaries to the same as, or better than/ those that are obtained for fully precessing binaries with no harmonics. Finally, we investigate what LISA measurements of spin alignment can tell us about the nature of gas around a binary,
International conference entitled Zdeněk Kopal’s Binary Star Legacy
Drechsel, Horst; ZDENEK KOPAL’S BINARY STAR LEGACY
2005-01-01
An international conference entitled "Zdenek Kopal's Binary Star Legacy" was held on the occasion of the late Professor Kopal's 90th birthday in his home town of Litomyšl/Czech Republic and dedicated to the memory of one of the leading astronomers of the 20th century. Professor Kopal, who devoted 60 years of his scientific life to the exploration of close binary systems, initiated a breakthrough in this field with his description of binary components as non-spherical stars deformed by gravity, with surfaces following Roche equipotentials. Such knowledge triggered the development of new branches of astrophysics dealing with the structure and evolution of close binaries and the interaction effects displayed by exciting objects such as cataclysmic variables, symbiotic stars or X-ray binaries. Contributions to this conference included praise of the achievements of a great astronomer and personal reminiscences brought forward by Kopal's former students and colleagues, and reflected the state of the art of the dyn...
Exact Algorithms for Duplication-Transfer-Loss Reconciliation with Non-Binary Gene Trees.
Kordi, Misagh; Bansal, Mukul S
2017-06-01
Duplication-Transfer-Loss (DTL) reconciliation is a powerful method for studying gene family evolution in the presence of horizontal gene transfer. DTL reconciliation seeks to reconcile gene trees with species trees by postulating speciation, duplication, transfer, and loss events. Efficient algorithms exist for finding optimal DTL reconciliations when the gene tree is binary. In practice, however, gene trees are often non-binary due to uncertainty in the gene tree topologies, and DTL reconciliation with non-binary gene trees is known to be NP-hard. In this paper, we present the first exact algorithms for DTL reconciliation with non-binary gene trees. Specifically, we (i) show that the DTL reconciliation problem for non-binary gene trees is fixed-parameter tractable in the maximum degree of the gene tree, (ii) present an exponential-time, but in-practice efficient, algorithm to track and enumerate all optimal binary resolutions of a non-binary input gene tree, and (iii) apply our algorithms to a large empirical data set of over 4700 gene trees from 100 species to study the impact of gene tree uncertainty on DTL-reconciliation and to demonstrate the applicability and utility of our algorithms. The new techniques and algorithms introduced in this paper will help biologists avoid incorrect evolutionary inferences caused by gene tree uncertainty.
A simple model for binary star evolution
International Nuclear Information System (INIS)
Whyte, C.A.; Eggleton, P.P.
1985-01-01
A simple model for calculating the evolution of binary stars is presented. Detailed stellar evolution calculations of stars undergoing mass and energy transfer at various rates are reported and used to identify the dominant physical processes which determine the type of evolution. These detailed calculations are used to calibrate the simple model and a comparison of calculations using the detailed stellar evolution equations and the simple model is made. Results of the evolution of a few binary systems are reported and compared with previously published calculations using normal stellar evolution programs. (author)
A study of non-binary discontinuity wavelet
International Nuclear Information System (INIS)
Lin Hai; Liu Lianshou
2006-01-01
This paper gives a study of non-binary discontinuity wavelet, put forward the theory and method of constituting basic wavelet functions, and has constituted concretely a wavelet function using λ=3.4 as an example. It also conducts a theoretical inference on the decomposition algorithm and reconstruction algorithm of non-binary wavelet, and gives a concrete study of the change of matrix in connection with λ=3.4. In the end, it shows the future of application of the result to the study of high energy collision. (authors)
Directory of Open Access Journals (Sweden)
Marie Hagman
2018-04-01
Full Text Available Purpose: The purpose of the present controlled cross-sectional study was to investigate proximal femur and whole-body bone mineral density (BMD, as well as bone turnover profile, in lifelong trained elderly male football players and young elite football players compared with untrained age-matched men. Methods: One hundred and forty healthy, non-smoking men participated in the study, including lifelong trained football players (FTE, n = 35 aged 65–80 years, elite football players (FTY, n = 35 aged 18–30 years, as well as untrained age-matched elderly (UE, n = 35 and young (UY, n = 35 men. All participants underwent a regional dual-energy X-ray Absorptiometry (DXA scan of the proximal femur and a whole-body DXA scan to determine BMD. From a resting blood sample, the bone turnover markers (BTMs osteocalcin, carboxy-terminal type-1 collagen crosslinks (CTX-1, procollagen type-1 amino-terminal propeptide (P1NP, and sclerostin were measured. Results: FTE had 7.3%–12.9% higher (p < 0.05 BMD of the femoral neck, wards, shaft, and total proximal femur in both legs compared to UE, and 9.3%–9.7% higher (p < 0.05 BMD in femoral trochanter in both legs compared to UY. FTY had 24.3%–37.4% higher (p < 0.001 BMD in all femoral regions and total proximal femur in both legs compared to UY. The whole-body DXA scan confirmed these results, with FTE showing similar whole-body BMD and 7.9% higher (p < 0.05 leg BMD compared to UY, and with FTY having 9.6% higher (p < 0.001 whole-body BMD and 18.2% higher (p < 0.001 leg BMD compared to UY. The plasma concentration of osteocalcin, CTX-1, and P1NP were 29%, 53%, and 52% higher (p < 0.01, respectively, in FTY compared to UY. Conclusion: BMD of the proximal femur and whole-body BMD are markedly higher in lifelong trained male football players aged 65–80 years and young elite football players aged 18–30 years compared to age-matched untrained men. Elderly football
Stochastic Gravitational-Wave Background due to Primordial Binary Black Hole Mergers.
Mandic, Vuk; Bird, Simeon; Cholis, Ilias
2016-11-11
Recent Advanced LIGO detections of binary black hole mergers have prompted multiple studies investigating the possibility that the heavy GW150914 binary system was of primordial origin, and hence could be evidence for dark matter in the form of black holes. We compute the stochastic background arising from the incoherent superposition of such primordial binary black hole systems in the Universe and compare it to the similar background spectrum due to binary black hole systems of stellar origin. We investigate the possibility of detecting this background with future gravitational-wave detectors, and conclude that constraining the dark matter component in the form of black holes using stochastic gravitational-wave background measurements will be very challenging.
The birth of a supermassive black hole binary
Pfister, Hugo; Lupi, Alessandro; Capelo, Pedro R.; Volonteri, Marta; Bellovary, Jillian M.; Dotti, Massimo
2017-11-01
We study the dynamical evolution of supermassive black holes, in the late stage of galaxy mergers, from kpc to pc scales. In particular, we capture the formation of the binary, a necessary step before the final coalescence, and trace back the main processes causing the decay of the orbit. We use hydrodynamical simulations of galaxy mergers with different resolutions, from 20 pc down to 1 pc, in order to study the effects of the resolution on our results, remove numerical effects, and assess that resolving the influence radius of the orbiting black hole is a minimum condition to fully capture the formation of the binary. Our simulations include the relevant physical processes, namely star formation, supernova feedback, accretion on to the black holes and the ensuing feedback. We find that, in these mergers, dynamical friction from the smooth stellar component of the nucleus is the main process that drives black holes from kpc to pc scales. Gas does not play a crucial role and even clumps do not induce scattering or perturb the orbits. We compare the time needed for the formation of the binary to analytical predictions and suggest how to apply such analytical formalism to obtain estimates of binary formation times in lower resolution simulations.
High speed non-latching squid binary ripple counter
International Nuclear Information System (INIS)
Silver, A.H.; Phillips, R.R.; Sandell, R.D.
1985-01-01
High speed, single flux quantum (SFQ) binary scalers are important components in superconducting analog-to-digital converters (ADC). This paper reviews the concept for a SQUID ADC and the design of an SFQ binary ripple counter, and reports the simulation of key components, and fabrication and performance of non-latching SQUID scalers and SFQ binary ripple counters. The SQUIDs were fabricated with Nb/Nb 2 O 5 /PbIn junctions and interconnected by monolithic superconducting transmission lines and isolation resistors. Each SQUID functioned as a bistable flip-flop with the input connected to the center of the device and the output across one junction. All junctions were critically damped to optimize the pulse response. Operation was verified by observing the dc I-V curves of successive SQUIDs driven by a cw pulse train generated on the same chip. Each SQUID exhibited constant-voltage current steps at 1/2 the voltage of the preceding device as expected from the Josephson voltage-to-frequency relation. Steps were observed only for the same voltage polarity of successive devices and for proper phase bias of the SQUID. Binary frequency division was recorded up to 40GHz for devices designed to operate to 28GHz
La biolixiviación como pretratamiento de menas auríferas refractarias en matriz de sulfuros
Directory of Open Access Journals (Sweden)
Iglesias, N.
1998-02-01
Full Text Available In this paper the effectiveness of bacterial leaching as a pretreatment of gold ores bearing sulphide minerals is analysed. Three kinds of matrixes are studied: pyrite, arsenopyrite and copper sulphides. It is concluded that bacterial leaching is an effective pretreatment for these refractory gold-bearing ores. In the case of a pyrite matrix a direct contact between the mineral and the microorganisms is necessary. In the case of copper or/and arsenic sulphide matrix, bacterial leaching may be carried out by indirect contact mechanism with effects separation, thus allowing faster kinetics than conventional bioleaching processes. This kinetic improvement reduces operation times and so the capital and operating costs. In a future, this fact may result in the enlargement of the profitable gold ore reserves, incorporating minerals that, at present, are not considered gold ores since there is not a technology, feasible from an economic point of view, for their treatment.
En este trabajo se analiza la eficacia de la biolixiviación en el pretratamiento de un conjunto de minerales auríferos en los que la refractariedad viene provocada por la presencia de sulfuros metálicos. Se estudian tres tipos de matrices: pirita, arsenopirita y sulfuros de cobre. Se concluye que la biolixiviación es un pretratamiento eficaz para estos tipos de menas refractarias de oro. En el caso de menas en matriz de pirita es necesario el contacto directo entre el sulfuro y los microorganismos. En el caso de menas en matriz de sulfuros de cobre y/o de sulfuros de arsénico, la biolixiviación puede realizarse por un mecanismo de contacto indirecto con separación de efectos, lo que permite alcanzar una cinética mucho más rápida que la de los procesos convencionales de biolixiviación. Esta mejora cinética reduce los tiempos de operación con el consecuente abaratamiento de instalaciones y coste de operación. Este hecho, en un futuro, puede significar la ampliaci
Towards binary robust fast features using the comparison of pixel blocks
International Nuclear Information System (INIS)
Oszust, Mariusz
2016-01-01
Binary descriptors have become popular in many vision-based applications, as a fast and efficient replacement of floating point, heavy counterparts. They achieve a short computation time and low memory footprint due to many simplifications. Consequently, their robustness against a variety of image transformations is lowered, since they rely on pairwise pixel intensity comparisons. This observation has led to the emergence of techniques performing tests on intensities of predefined pixel regions. These approaches, despite a visible improvement in the quality of the obtained results, suffer from a long computation time, and their patch partitioning strategies produce long binary strings requiring the use of salient bit detection techniques. In this paper, a novel binary descriptor is proposed to address these shortcomings. The approach selects image patches around a keypoint, divides them into a small number of pixel blocks and performs binary tests on gradients which are determined for the blocks. The size of each patch depends on the keypoint’s scale. The robustness and distinctiveness of the descriptor are evaluated according to five demanding image benchmarks. The experimental results show that the proposed approach is faster to compute, produces a short binary string and offers a better performance than state-of-the-art binary and floating point descriptors. (paper)
Probabilistic seismic history matching using binary images
Davolio, Alessandra; Schiozer, Denis Jose
2018-02-01
Currently, the goal of history-matching procedures is not only to provide a model matching any observed data but also to generate multiple matched models to properly handle uncertainties. One such approach is a probabilistic history-matching methodology based on the discrete Latin Hypercube sampling algorithm, proposed in previous works, which was particularly efficient for matching well data (production rates and pressure). 4D seismic (4DS) data have been increasingly included into history-matching procedures. A key issue in seismic history matching (SHM) is to transfer data into a common domain: impedance, amplitude or pressure, and saturation. In any case, seismic inversions and/or modeling are required, which can be time consuming. An alternative to avoid these procedures is using binary images in SHM as they allow the shape, rather than the physical values, of observed anomalies to be matched. This work presents the incorporation of binary images in SHM within the aforementioned probabilistic history matching. The application was performed with real data from a segment of the Norne benchmark case that presents strong 4D anomalies, including softening signals due to pressure build up. The binary images are used to match the pressurized zones observed in time-lapse data. Three history matchings were conducted using: only well data, well and 4DS data, and only 4DS. The methodology is very flexible and successfully utilized the addition of binary images for seismic objective functions. Results proved the good convergence of the method in few iterations for all three cases. The matched models of the first two cases provided the best results, with similar well matching quality. The second case provided models presenting pore pressure changes according to the expected dynamic behavior (pressurized zones) observed on 4DS data. The use of binary images in SHM is relatively new with few examples in the literature. This work enriches this discussion by presenting a new
An axion-like scalar field environment effect on binary black hole merger
Yang, Qing; Ji, Li-Wei; Hu, Bin; Cao, Zhou-Jian; Cai, Rong-Gen
2018-06-01
The environment, such as an accretion disk, could modify the signal of the gravitational wave from astrophysical black hole binaries. In this article, we model the matter field around intermediate-mass binary black holes by means of an axion-like scalar field and investigate their joint evolution. In detail, we consider equal mass binary black holes surrounded by a shell of axion-like scalar field both in spherically symmetric and non-spherically symmetric cases, and with different strengths of the scalar field. Our result shows that the environmental scalar field could essentially modify the dynamics. Firstly, in the spherically symmetric case, with increase of the scalar field strength, the number of circular orbits for the binary black hole is reduced. This means that the scalar field could significantly accelerate the merger process. Secondly, once the scalar field strength exceeds a certain critical value, the scalar field could collapse into a third black hole with its mass being larger than that of the binary. Consequently, the new black hole that collapses from the environmental scalar field could accrete the binary promptly and the binary collides head-on with each other. In this process, there is almost no quadrupole signal produced, and, consequently, the gravitational wave is greatly suppressed. Thirdly, when the scalar field strength is relatively smaller than the critical value, the black hole orbit could develop eccentricity through accretion of the scalar field. Fourthly, during the initial stage of the inspiral, the gravitational attractive force from the axion-like scalar field could induce a sudden turn in the binary orbits, hence resulting in a transient wiggle in the gravitational waveform. Finally, in the non-spherical case, the scalar field could gravitationally attract the binary moving toward the center of mass for the scalar field and slow down the merger process.
Directory of Open Access Journals (Sweden)
Marcus J Drake
Full Text Available The emergence of urinary retention (UR, specifically acute urinary retention (AUR, has been a concern when treating men with lower urinary tract symptoms (LUTS with antimuscarinic drugs.In NEPTUNE (12-week, double-blind, men (≥45 years with LUTS were randomized to receive tamsulosin oral-controlled absorption system (TOCAS 0.4 mg, fixed-dose combination (FDC of solifenacin (Soli 6 mg + TOCAS 0.4 mg, FDC Soli 9 mg + TOCAS 0.4 mg, or placebo. In NEPTUNE II (40-week, open-label extension of NEPTUNE, continuing patients received 4-week FDC Soli 6 mg + TOCAS, then FDC Soli 6 mg or 9 mg + TOCAS for the remainder of the study, switchable every 3 months.Across both studies, 1208 men received ≥1 dose of FDC Soli 6 mg or 9 mg + TOCAS for up to 52 weeks; 1199 men completed NEPTUNE and 1066 received ≥1 dose in NEPTUNE II. In total, 13 men (1.1%; 95% CI, 0.6%-1.8% reported a UR event while receiving FDC, eight of which were AUR (0.7%; 95% CI, 0.3%-1.3%, incidence 7/1000 man-years. Six men reported UR events while taking Soli 6 mg + TOCAS (three AUR, and seven men reported a UR event while taking Soli 9 mg + TOCAS (five AUR. One man developed AUR while taking TOCAS alone and four reported UR (three AUR during placebo run-in. Most AUR/UR events occurred within 4 months of treatment initiation.FDC Soli and TOCAS was associated with a low rate of UR and AUR in men with LUTS.
Misclassification in binary choice models
Czech Academy of Sciences Publication Activity Database
Meyer, B. D.; Mittag, Nikolas
2017-01-01
Roč. 200, č. 2 (2017), s. 295-311 ISSN 0304-4076 Institutional support: RVO:67985998 Keywords : measurement error * binary choice models * program take-up Subject RIV: AH - Economics OBOR OECD: Economic Theory Impact factor: 1.633, year: 2016
Fast optimization of binary clusters using a novel dynamic lattice searching method
International Nuclear Information System (INIS)
Wu, Xia; Cheng, Wen
2014-01-01
Global optimization of binary clusters has been a difficult task despite of much effort and many efficient methods. Directing toward two types of elements (i.e., homotop problem) in binary clusters, two classes of virtual dynamic lattices are constructed and a modified dynamic lattice searching (DLS) method, i.e., binary DLS (BDLS) method, is developed. However, it was found that the BDLS can only be utilized for the optimization of binary clusters with small sizes because homotop problem is hard to be solved without atomic exchange operation. Therefore, the iterated local search (ILS) method is adopted to solve homotop problem and an efficient method based on the BDLS method and ILS, named as BDLS-ILS, is presented for global optimization of binary clusters. In order to assess the efficiency of the proposed method, binary Lennard-Jones clusters with up to 100 atoms are investigated. Results show that the method is proved to be efficient. Furthermore, the BDLS-ILS method is also adopted to study the geometrical structures of (AuPd) 79 clusters with DFT-fit parameters of Gupta potential
Abbott, B. P.; Abbott, R.; Adhikari, R. X.; Ananyeva, A.; Anderson, S. B.; Appert, S.; Arai, K.; Araya, M. C.; Barayoga, J. C.; Barish, B. C.; Berger, B. K.; Billingsley, G.; Biscans, S.; Blackburn, J. K.; Blair, C. D.
2018-01-01
The LIGO Scientific and Virgo Collaborations have announced the event GW170817, the first detection of gravitational waves from the coalescence of two neutron stars. The merger rate of binary neutron stars estimated from this event suggests that distant, unresolvable binary neutron stars create a significant astrophysical stochastic gravitational-wave background. The binary neutron star component will add to the contribution from binary black holes, increasing the amplitude of the total astro...
Tidal effects in twin-degenerate binaries
International Nuclear Information System (INIS)
Campbell, C.G.
1984-01-01
The tidal velocity field is calculated for an initially non-rotating low mass white dwarf secondary in a twin-degenerate binary. These motions are used to find the tidal torque on the secondary, to first order in the orbital frequency, and an expression is derived for the synchronization time. For a lobe-filling secondary the synchronization time has a weak dependence on the mass and luminosity of the star, and for the binary G61-29 is found to be of the same order as the estimated lifetime of the system. It is emphasized, however, that tidal excitation of non-radial oscillatory modes in the secondary may significantly shorten the synchronization time. (author)
Putting Continuous Metaheuristics to Work in Binary Search Spaces
Directory of Open Access Journals (Sweden)
Broderick Crawford
2017-01-01
Full Text Available In the real world, there are a number of optimization problems whose search space is restricted to take binary values; however, there are many continuous metaheuristics with good results in continuous search spaces. These algorithms must be adapted to solve binary problems. This paper surveys articles focused on the binarization of metaheuristics designed for continuous optimization.
Study of zirconium-addition binary systems
International Nuclear Information System (INIS)
Wozniakova, B.; Kuchar, L.
1975-01-01
The curves are given of the solid and the liquid of binary zirconium-addition systems. Most additions reduce the melting temperature of zirconium. The only known additions to increase the melting temperature are nitrogen, oxygen and hafnium. Also given are the transformation curves of the systems and the elements are given which reduce or raise the temperature of α-β transformation. From the Mendeleev table into which are plotted the curves of the solid and the liquid of binary systems it is possible to predict the properties of unknown binary systems. For the calculations of the curves of the solid and the liquid, 1860 degC was taken as the temperature of zirconium melting. For the calculations of transformation curves, 865 degC was taken as the temperature of α-β transformation. The equations are given of the curves of the solid and the liquid and of the transformation curves of some Zr-addition systems. Also given are the calculated equilibrium distribution coefficients and the equilibrium distribution coefficients of the transformation of additions in Zr and their limit values for temperatures approximating the melting point or the temperature of the transformation of pure Zr, and the values pertaining to eutectic and peritectic or eutectoid and peritectoid temperatures. (J.B.)
Photometric Study of Fourteen Low-mass Binaries
International Nuclear Information System (INIS)
Korda, D.; Zasche, P.; Wolf, M.; Kučáková, H.; Vraštil, J.; Hoňková, K.
2017-01-01
New CCD photometric observations of fourteen short-period low-mass eclipsing binaries (LMBs) in the photometric filters I, R, and V were used for a light curve analysis. A discrepancy remains between observed radii and those derived from the theoretical modeling for LMBs, in general. Mass calibration of all observed LMBs was performed using only the photometric indices. The light curve modeling of these selected systems was completed, yielding the new derived masses and radii for both components. We compared these systems with the compilation of other known double-lined LMB systems with uncertainties of masses and radii less then 5%, which includes 66 components of binaries where both spectroscopy and photometry were combined together. All of our systems are circular short-period binaries, and for some of them, the photospheric spots were also used. A purely photometric study of the light curves without spectroscopy seems unable to achieve high enough precision and accuracy in the masses and radii to act as meaningful test of the M–R relation for low-mass stars.
Photometric Study of Fourteen Low-mass Binaries
Energy Technology Data Exchange (ETDEWEB)
Korda, D.; Zasche, P.; Wolf, M.; Kučáková, H.; Vraštil, J. [Astronomical Institute, Charles University, Faculty of Mathematics and Physics, CZ-180 00, Praha 8, V Holešovičkách 2 (Czech Republic); Hoňková, K., E-mail: korda@sirrah.troja.mff.cuni.cz [Variable Star and Exoplanet Section of Czech Astronomical Society, Vsetínská 941/78, CZ-757 01, Valašské Meziříčí (Czech Republic)
2017-07-01
New CCD photometric observations of fourteen short-period low-mass eclipsing binaries (LMBs) in the photometric filters I, R, and V were used for a light curve analysis. A discrepancy remains between observed radii and those derived from the theoretical modeling for LMBs, in general. Mass calibration of all observed LMBs was performed using only the photometric indices. The light curve modeling of these selected systems was completed, yielding the new derived masses and radii for both components. We compared these systems with the compilation of other known double-lined LMB systems with uncertainties of masses and radii less then 5%, which includes 66 components of binaries where both spectroscopy and photometry were combined together. All of our systems are circular short-period binaries, and for some of them, the photospheric spots were also used. A purely photometric study of the light curves without spectroscopy seems unable to achieve high enough precision and accuracy in the masses and radii to act as meaningful test of the M–R relation for low-mass stars.
Circumstellar disks around binary stars in Taurus
International Nuclear Information System (INIS)
Akeson, R. L.; Jensen, E. L. N.
2014-01-01
We have conducted a survey of 17 wide (>100 AU) young binary systems in Taurus with the Atacama Large Millimeter Array (ALMA) at two wavelengths. The observations were designed to measure the masses of circumstellar disks in these systems as an aid to understanding the role of multiplicity in star and planet formation. The ALMA observations had sufficient resolution to localize emission within the binary system. Disk emission was detected around all primaries and 10 secondaries, with disk masses as low as 10 –4 M ☉ . We compare the properties of our sample to the population of known disks in Taurus and find that the disks from this binary sample match the scaling between stellar mass and millimeter flux of F mm ∝M ∗ 1.5--2.0 to within the scatter found in previous studies. We also compare the properties of the primaries to those of the secondaries and find that the secondary/primary stellar and disk mass ratios are not correlated; in three systems, the circumsecondary disk is more massive than the circumprimary disk, counter to some theoretical predictions.
Constraining the Statistics of Population III Binaries
Stacy, Athena; Bromm, Volker
2012-01-01
We perform a cosmological simulation in order to model the growth and evolution of Population III (Pop III) stellar systems in a range of host minihalo environments. A Pop III multiple system forms in each of the ten minihaloes, and the overall mass function is top-heavy compared to the currently observed initial mass function in the Milky Way. Using a sink particle to represent each growing protostar, we examine the binary characteristics of the multiple systems, resolving orbits on scales as small as 20 AU. We find a binary fraction of approx. 36, with semi-major axes as large as 3000 AU. The distribution of orbital periods is slightly peaked at approx. < 900 yr, while the distribution of mass ratios is relatively flat. Of all sink particles formed within the ten minihaloes, approx. 50 are lost to mergers with larger sinks, and 50 of the remaining sinks are ejected from their star-forming disks. The large binary fraction may have important implications for Pop III evolution and nucleosynthesis, as well as the final fate of the first stars.
Simulations of nearly extremal binary black holes
Giesler, Matthew; Scheel, Mark; Hemberger, Daniel; Lovelace, Geoffrey; Kuper, Kevin; Boyle, Michael; Szilagyi, Bela; Kidder, Lawrence; SXS Collaboration
2015-04-01
Astrophysical black holes could have nearly extremal spins; therefore, nearly extremal black holes could be among the binaries that current and future gravitational-wave observatories will detect. Predicting the gravitational waves emitted by merging black holes requires numerical-relativity simulations, but these simulations are especially challenging when one or both holes have mass m and spin S exceeding the Bowen-York limit of S /m2 = 0 . 93 . Using improved methods we simulate an unequal-mass, precessing binary black hole coalescence, where the larger black hole has S /m2 = 0 . 99 . We also use these methods to simulate a nearly extremal non-precessing binary black hole coalescence, where both black holes have S /m2 = 0 . 994 , nearly reaching the Novikov-Thorne upper bound for holes spun up by thin accretion disks. We demonstrate numerical convergence and estimate the numerical errors of the waveforms; we compare numerical waveforms from our simulations with post-Newtonian and effective-one-body waveforms; and we compare the evolution of the black-hole masses and spins with analytic predictions.
Modeling of formation of binary-phase hollow nanospheres from metallic solid nanospheres
International Nuclear Information System (INIS)
Svoboda, J.; Fischer, F.D.; Vollath, D.
2009-01-01
Spontaneous formation of binary-phase hollow nanospheres by reaction of a metallic nanosphere with a non-metallic component in the surrounding atmosphere is observed for many systems. The kinetic model describing this phenomenon is derived by application of the thermodynamic extremal principle. The necessary condition of formation of the binary-phase hollow nanospheres is that the diffusion coefficient of the metallic component in the binary phase is higher than that of the non-metallic component (Kirkendall effect occurs in the correct direction). The model predictions of the time to formation of the binary-phase hollow nanospheres agree with the experimental observations
Evolution of Binary Supermassive Black Holes in Rotating Nuclei
Energy Technology Data Exchange (ETDEWEB)
Rasskazov, Alexander; Merritt, David [School of Physics and Astronomy and Center for Computational Relativity and Gravitation, Rochester Institute of Technology, Rochester, NY 14623 (United States)
2017-03-10
The interaction of a binary supermassive black hole with stars in a galactic nucleus can result in changes to all the elements of the binary’s orbit, including the angles that define its orientation. If the nucleus is rotating, the orientation changes can be large, causing large changes in the binary’s orbital eccentricity as well. We present a general treatment of this problem based on the Fokker–Planck equation for f , defined as the probability distribution for the binary’s orbital elements. First- and second-order diffusion coefficients are derived for the orbital elements of the binary using numerical scattering experiments, and analytic approximations are presented for some of these coefficients. Solutions of the Fokker–Planck equation are then derived under various assumptions about the initial rotational state of the nucleus and the binary hardening rate. We find that the evolution of the orbital elements can become qualitatively different when we introduce nuclear rotation: (1) the orientation of the binary’s orbit evolves toward alignment with the plane of rotation of the nucleus and (2) binary orbital eccentricity decreases for aligned binaries and increases for counteraligned ones. We find that the diffusive (random-walk) component of a binary’s evolution is small in nuclei with non-negligible rotation, and we derive the time-evolution equations for the semimajor axis, eccentricity, and inclination in that approximation. The aforementioned effects could influence gravitational wave production as well as the relative orientation of host galaxies and radio jets.
A Fast Optimization Method for General Binary Code Learning.
Shen, Fumin; Zhou, Xiang; Yang, Yang; Song, Jingkuan; Shen, Heng; Tao, Dacheng
2016-09-22
Hashing or binary code learning has been recognized to accomplish efficient near neighbor search, and has thus attracted broad interests in recent retrieval, vision and learning studies. One main challenge of learning to hash arises from the involvement of discrete variables in binary code optimization. While the widely-used continuous relaxation may achieve high learning efficiency, the pursued codes are typically less effective due to accumulated quantization error. In this work, we propose a novel binary code optimization method, dubbed Discrete Proximal Linearized Minimization (DPLM), which directly handles the discrete constraints during the learning process. Specifically, the discrete (thus nonsmooth nonconvex) problem is reformulated as minimizing the sum of a smooth loss term with a nonsmooth indicator function. The obtained problem is then efficiently solved by an iterative procedure with each iteration admitting an analytical discrete solution, which is thus shown to converge very fast. In addition, the proposed method supports a large family of empirical loss functions, which is particularly instantiated in this work by both a supervised and an unsupervised hashing losses, together with the bits uncorrelation and balance constraints. In particular, the proposed DPLM with a supervised `2 loss encodes the whole NUS-WIDE database into 64-bit binary codes within 10 seconds on a standard desktop computer. The proposed approach is extensively evaluated on several large-scale datasets and the generated binary codes are shown to achieve very promising results on both retrieval and classification tasks.
Energy Technology Data Exchange (ETDEWEB)
Oskinova, L. M.; Hamann, W.-R.; Shenar, T.; Sander, A. A. C.; Todt, H.; Hainich, R. [Institute for Physics and Astronomy, University Potsdam, D-14476 Potsdam (Germany); Huenemoerder, D. P. [Massachusetts Institute of Technology, Kavli Institute for Astrophysics and Space Research, 70 Vassar St., Cambridge, MA 02139 (United States); Ignace, R., E-mail: lida@astro.physik.uni-potsdam.de [Department of Physics and Astronomy, East Tennessee State University, Johnson City, TN 37663 (United States)
2017-08-10
The blue hypergiant Cyg OB2 12 (B3Ia{sup +}) is a representative member of the class of very massive stars in a poorly understood evolutionary stage. We obtained its high-resolution X-ray spectrum using the Chandra observatory. PoWR model atmospheres were calculated to provide realistic wind opacities and to establish the wind density structure. We find that collisional de-excitation is the dominant mechanism depopulating the metastable upper levels of the forbidden lines of the He-like ions Si xiv and Mg xii. Comparison between the model and observations reveals that X-ray emission is produced in a dense plasma, which could reside only at the photosphere or in a colliding wind zone between binary components. The observed X-ray spectra are well-fitted by thermal plasma models, with average temperatures in excess of 10 MK. The wind speed in Cyg OB2 12 is not high enough to power such high temperatures, but the collision of two winds in a binary system can be sufficient. We used archival data to investigate the X-ray properties of other blue hypergiants. In general, stars of this class are not detected as X-ray sources. We suggest that our new Chandra observations of Cyg OB2 12 can be best explained if Cyg OB2 12 is a colliding wind binary possessing a late O-type companion. This makes Cyg OB2 12 only the second binary system among the 16 known Galactic hypergiants. This low binary fraction indicates that the blue hypergiants are likely products of massive binary evolution during which they either accreted a significant amount of mass or already merged with their companions.
International Nuclear Information System (INIS)
Li, Min; Kao, Hongtao; Wu, Zhishen; Tan, Jinmiao
2011-01-01
This study prepared a series of binary phase change materials by mixing decanoic acid, dodecanoic acid, hexadecanoic acid and octadecanoic acid each other. The phase-transition temperature of binary fatty acid and its corresponding mixing proportion are calculated with phase diagram thermodynamic method. The results are verified by the experimental result of the heat absorption curve and the Differential Scanning Calorimetry (DSC) analysis curve. The results show that the calculation method of phase diagram thermodynamic calculation can be taken as a basis for mixing proportion of binary fatty acid phase change materials. In addition, the decanoic-dodecanoic acid/diatomite composite phase change material (PCM) are prepared and its microstructure, thermal property and thermal reliability are characterized. The result shows that the decanoic-dodecanoic acid is uniformly adsorbed into diatomite and the form-stable PCM are formed. The phase-transition temperature and the latent heat of the decanoic-dodecanoic acid/diatomite composite PCMs is 16.74 o C and 66.8114 J/g, respectively.
Binary co-generative plants with height temperature SOFC fuel cells
International Nuclear Information System (INIS)
Tashevski, D; Dimitrov, K.; Armenski, S.
2005-01-01
In this paper, a field of binary co-generative plants with height temperature SOFC fuel cells is presented. Special attention of application of height temperature SOFC fuel cells and binary co-generative units has been given. These units made triple electricity and heat. Principle of combination of fuel cells with binary cycles has been presented. A model and computer programme for calculation of BKPFC, has been created. By using the program, all the important characteristic-results are calculated: power, efficiency, emission, dimension and economic analysis. On base of results, conclusions and recommendations has been given. (Author)
Binary co-generative plants with height temperature SOFC fuel cells
International Nuclear Information System (INIS)
Tashevski, D; Dimitrov, K.; Armenski, S.
2006-01-01
In this paper, a field of binary co-generative plants with height temperature SOFC fuel cells is presented. Special attention of application of height temperature SOFC fuel cells and binary co-generative units has been given. These units made triple electricity and heat. Principle of combination of fuel cells with binary cycles has been presented. A model and computer programme for calculation of BKPFC, has been created. By using the program, all the important characteristic-results are calculated: power, efficiency, emission, dimension and economic analysis. On base of results, conclusions and recommendations has been given. (Author)
Finding binaries from phase modulation of pulsating stars with Kepler
Shibahashi, Hiromoto; Murphy, Simon; Bedding, Tim
2017-09-01
Binary orbital motion causes a periodic variation in the path length travelled by light emitted from a star towards us. Hence, if the star is pulsating, the observed phase of the pulsation varies over the orbit. Conversely, once we have observed such phase variation, we can extract information about the binary orbit from photometry alone. Continuous and precise space-based photometry has made it possible to measure these light travel time effects on the pulsating stars in binary systems. This opens up a new way of finding unseen brown dwarfs, planets, or massive compact stellar remnants: neutron stars and black holes.
EXPECTED LARGE SYNOPTIC SURVEY TELESCOPE (LSST) YIELD OF ECLIPSING BINARY STARS
International Nuclear Information System (INIS)
Prsa, Andrej; Pepper, Joshua; Stassun, Keivan G.
2011-01-01
In this paper, we estimate the Large Synoptic Survey Telescope (LSST) yield of eclipsing binary stars, which will survey ∼20,000 deg 2 of the southern sky during a period of 10 years in six photometric passbands to r ∼ 24.5. We generate a set of 10,000 eclipsing binary light curves sampled to the LSST time cadence across the whole sky, with added noise as a function of apparent magnitude. This set is passed to the analysis-of-variance period finder to assess the recoverability rate for the periods, and the successfully phased light curves are passed to the artificial-intelligence-based pipeline ebai to assess the recoverability rate in terms of the eclipsing binaries' physical and geometric parameters. We find that, out of ∼24 million eclipsing binaries observed by LSST with a signal-to-noise ratio >10 in mission lifetime, ∼28% or 6.7 million can be fully characterized by the pipeline. Of those, ∼25% or 1.7 million will be double-lined binaries, a true treasure trove for stellar astrophysics.
Stock Picking via Nonsymmetrically Pruned Binary Decision Trees
Anton Andriyashin
2008-01-01
Stock picking is the field of financial analysis that is of particular interest for many professional investors and researchers. In this study stock picking is implemented via binary classification trees. Optimal tree size is believed to be the crucial factor in forecasting performance of the trees. While there exists a standard method of tree pruning, which is based on the cost-complexity tradeoff and used in the majority of studies employing binary decision trees, this paper introduces a no...
Close-In Substellar Companions and the Formation of sdB-Type Close Binary Stars
Directory of Open Access Journals (Sweden)
L. Y. Zhu
2015-02-01
Full Text Available The sdB-type close binaries are believed to have experienced a common-envelope phase and may evolve into cataclysmic binaries (CVs. About 10% of all known sdB binaries are eclipsing binaries consisting of very hot subdwarf primaries and low-mass companions with short orbital periods. The eclipse profiles of these systems are very narrow and deep, which benefits the determination of high precise eclipsing times and makes the detection of small and close-in tertiary bodies possible. Since 2006 we have monitored some sdB-type eclipsing binaries to search for the close-in substellar companions by analyzing the light travel time effect. Here some progresses of the program are reviewed and the formation of sdB-type binary is discussed.
International Nuclear Information System (INIS)
Zapatrin, R.R.
1992-01-01
Given a finite ortholattice L, the *-semigroup is explicitly built whose annihilator ortholattice is isomorphic to L. Thus, it is shown that any finite quantum logic is the additive part of a binary logic. Some areas of possible applications are outlined. 7 refs
Hexagonal pixel detector with time encoded binary readout
International Nuclear Information System (INIS)
Hoedlmoser, H.; Varner, G.; Cooney, M.
2009-01-01
The University of Hawaii is developing continuous acquisition pixel (CAP) detectors for vertexing applications in lepton colliding experiments such as SuperBelle or ILC. In parallel to the investigation of different technology options such as MAPS or SOI, both analog and binary readout concepts have been tested. First results with a binary readout scheme in which the hit information is time encoded by means of a signal shifting mechanism have recently been published. This paper explains the hit reconstruction for such a binary detector with an emphasis on fake hit reconstruction probabilities in order to evaluate the rate capability in a high background environment such as the planned SuperB factory at KEK. The results show that the binary concept is at least comparable to any analog readout strategy if not better in terms of occupancy. Furthermore, we present a completely new binary readout strategy in which the pixel cells are arranged in a hexagonal grid allowing the use of three independent output directions to reduce reconstruction ambiguities. The new concept uses the same signal shifting mechanism for time encoding, however, in dedicated transfer lines on the periphery of the detector, which enables higher shifting frequencies. Detailed Monte Carlo simulations of full size pixel matrices including hit and BG generation, signal generation, and data reconstruction show that by means of multiple signal transfer lines on the periphery the pixel can be made smaller (higher resolution), the number of output channels and the data volume per triggered event can be reduced dramatically, fake hit reconstruction is lowered to a minimum and the resulting effective occupancies are less than 10 -4 . A prototype detector has been designed in the AMS 0.35μm Opto process and is currently under fabrication.
Trans*versing the DMZ: A Non-Binary Autoethnographic Exploration of Gender and Masculinity
Stewart, Dafina-Lazarus
2017-01-01
Using an abductive, critical-poststructuralist autoethnographic approach, I consider the ways in which masculine of centre, non-binary/genderqueer trans* identities transverse the poles of socializing binary gender systems, structures, and norms which inform higher education. In this paper, I assert that non-binary genderqueer identities are…
Learning and generalization errors for the 2D binary perceptron
Klymovskiy, A.
2005-01-01
The statistical mechanics model of the binary perceptron learning is considered. It is proved that under the regularity conditions learning and generalization errors for the binary perceptron with two inputs tend to 0 at the average; the first term of the asymptotics is provided; its behavior with
Mass accretion rate fluctuations in black hole X-ray binaries
Rapisarda, S.
2017-01-01
This thesis is about the first systematic and quantitative application of propagating mass accretion rate fluctuations models to black hole X-ray binaries. Black hole X-ray binaries are systems consisting of a solar mass star orbiting around a stellar mass black hole. Eventually, the black hole
International Nuclear Information System (INIS)
Antonini, Fabio; Perets, Hagai B.
2012-01-01
The environment near supermassive black holes (SMBHs) in galactic nuclei contains a large number of stars and compact objects. A fraction of these are likely to be members of binaries. Here we discuss the binary population of stellar black holes and neutron stars near SMBHs and focus on the secular evolution of such binaries, due to the perturbation by the SMBH. Binaries with highly inclined orbits with respect to their orbit around the SMBH are strongly affected by secular Kozai processes, which periodically change their eccentricities and inclinations (Kozai cycles). During periapsis approach, at the highest eccentricities during the Kozai cycles, gravitational wave (GW) emission becomes highly efficient. Some binaries in this environment can inspiral and coalesce at timescales much shorter than a Hubble time and much shorter than similar binaries that do not reside near an SMBH. The close environment of SMBHs could therefore serve as a catalyst for the inspiral and coalescence of binaries and strongly affect their orbital properties. Such compact binaries would be detectable as GW sources by the next generation of GW detectors (e.g., advanced-LIGO). Our analysis shows that ∼0.5% of such nuclear merging binaries will enter the LIGO observational window while on orbits that are still very eccentric (e ∼> 0.5). The efficient GW analysis for such systems would therefore require the use of eccentric templates. We also find that binaries very close to the SMBH could evolve through a complex dynamical (non-secular) evolution, leading to emission of several GW pulses during only a few years (though these are likely to be rare). Finally, we note that the formation of close stellar binaries, X-ray binaries, and their merger products could be induced by similar secular processes, combined with tidal friction rather than GW emission as in the case of compact object binaries.
Formation and Evolution of Neutron Star Binaries: Masses of Neutron Stars
Directory of Open Access Journals (Sweden)
Lee Chang-Hwan
2012-02-01
Full Text Available Neutron star (NS is one of the most interesting astrophysical compact objects for hardronic physics. It is believed that the central density of NS can reach several times the normal nuclear matter density (ρ0. Hence, the inner part of NS is the ultimate testing place for the physics of dense matter. Recently, the mass of NS in a NS-white dwarf (WD binary PSR J1614-2230 has been estimated to be 1.97 ± 0.04M๏ [1]. Since this estimate is based on the observed Shapiro delay, it can give the lower limit of the maximum NS mass and rules out many soft equations of state. On the other hand, all the well-measured NS masses in NS-NS binaries are smaller than 1.5M๏. In this work, by introducing the supercritical accretion during the binary evolution, we propose a possibility of forming higher mass NS in NS-WD binaries. In this scenario, the lifetimes of NS and WD progenitors are significantly different, and NS in NS-WD binary can accrete > 0.5M๏ after NS formation during the giant phase of the progenitor of WD. On the other hand, for the binary system with NS and heavier (> 8M๏ giants, the first-born NS will accrete more from the companion and can collapse into black hole. The only way to avoid the supercritical accretion is that the initial masses of progenitors of NS binary should be very close so that they evolve almost at the same time and don’t have time to accrete after NS formation.
Randomized trials, generalizability, and meta-analysis: Graphical insights for binary outcomes
Directory of Open Access Journals (Sweden)
Kramer Barnett S
2003-06-01
Full Text Available Abstract Background Randomized trials stochastically answer the question. "What would be the effect of treatment on outcome if one turned back the clock and switched treatments in the given population?" Generalizations to other subjects are reliable only if the particular trial is performed on a random sample of the target population. By considering an unobserved binary variable, we graphically investigate how randomized trials can also stochastically answer the question, "What would be the effect of treatment on outcome in a population with a possibly different distribution of an unobserved binary baseline variable that does not interact with treatment in its effect on outcome?" Method For three different outcome measures, absolute difference (DIF, relative risk (RR, and odds ratio (OR, we constructed a modified BK-Plot under the assumption that treatment has the same effect on outcome if either all or no subjects had a given level of the unobserved binary variable. (A BK-Plot shows the effect of an unobserved binary covariate on a binary outcome in two treatment groups; it was originally developed to explain Simpsons's paradox. Results For DIF and RR, but not OR, the BK-Plot shows that the estimated treatment effect is invariant to the fraction of subjects with an unobserved binary variable at a given level. Conclusion The BK-Plot provides a simple method to understand generalizability in randomized trials. Meta-analyses of randomized trials with a binary outcome that are based on DIF or RR, but not OR, will avoid bias from an unobserved covariate that does not interact with treatment in its effect on outcome.
TWO NEW LONG-PERIOD HOT SUBDWARF BINARIES WITH DWARF COMPANIONS
Energy Technology Data Exchange (ETDEWEB)
Barlow, Brad N.; Wade, Richard A. [Department of Astronomy and Astrophysics, Pennsylvania State University, 525 Davey Lab, University Park, PA 16802 (United States); Liss, Sandra E. [Department of Astronomy, University of Virginia, P.O. Box 400325, Charlottesville, VA 22904-4325 (United States); Green, Elizabeth M., E-mail: bbarlow@psu.edu [Steward Observatory, University of Arizona, 933 N. Cherry Avenue, Tucson, AZ 85721 (United States)
2013-07-01
Hot subdwarf stars with F-K main sequence binary companions have been known for decades, but the first orbital periods for such systems were published just recently. Current observations suggest that most have long periods, on the order of years, and that some are or once were hierarchical triple systems. As part of a survey with the Hobby-Eberly Telescope, we have been monitoring the radial velocities of several composite-spectra binaries since 2005 in order to determine their periods, velocities, and eccentricities. Here we present observations and orbital solutions for two of these systems, PG 1449+653 and PG 1701+359. Similar to the other sdB+F/G/K binaries with solved orbits, their periods are long, 909 and 734 days, respectively, and pose a challenge to current binary population synthesis models of hot subdwarf stars. Intrigued by their relatively large systemic velocities, we also present a kinematical analysis of both targets and find that neither is likely a member of the Galactic thin disk.
TWO NEW LONG-PERIOD HOT SUBDWARF BINARIES WITH DWARF COMPANIONS
International Nuclear Information System (INIS)
Barlow, Brad N.; Wade, Richard A.; Liss, Sandra E.; Green, Elizabeth M.
2013-01-01
Hot subdwarf stars with F-K main sequence binary companions have been known for decades, but the first orbital periods for such systems were published just recently. Current observations suggest that most have long periods, on the order of years, and that some are or once were hierarchical triple systems. As part of a survey with the Hobby-Eberly Telescope, we have been monitoring the radial velocities of several composite-spectra binaries since 2005 in order to determine their periods, velocities, and eccentricities. Here we present observations and orbital solutions for two of these systems, PG 1449+653 and PG 1701+359. Similar to the other sdB+F/G/K binaries with solved orbits, their periods are long, 909 and 734 days, respectively, and pose a challenge to current binary population synthesis models of hot subdwarf stars. Intrigued by their relatively large systemic velocities, we also present a kinematical analysis of both targets and find that neither is likely a member of the Galactic thin disk.
Accuracy of Binary Black Hole Waveform Models for Advanced LIGO
Kumar, Prayush; Fong, Heather; Barkett, Kevin; Bhagwat, Swetha; Afshari, Nousha; Chu, Tony; Brown, Duncan; Lovelace, Geoffrey; Pfeiffer, Harald; Scheel, Mark; Szilagyi, Bela; Simulating Extreme Spacetimes (SXS) Team
2016-03-01
Coalescing binaries of compact objects, such as black holes and neutron stars, are the primary targets for gravitational-wave (GW) detection with Advanced LIGO. Accurate modeling of the emitted GWs is required to extract information about the binary source. The most accurate solution to the general relativistic two-body problem is available in numerical relativity (NR), which is however limited in application due to computational cost. Current searches use semi-analytic models that are based in post-Newtonian (PN) theory and calibrated to NR. In this talk, I will present comparisons between contemporary models and high-accuracy numerical simulations performed using the Spectral Einstein Code (SpEC), focusing at the questions: (i) How well do models capture binary's late-inspiral where they lack a-priori accurate information from PN or NR, and (ii) How accurately do they model binaries with parameters outside their range of calibration. These results guide the choice of templates for future GW searches, and motivate future modeling efforts.
Probing evolution of binaries influenced by the spin–orbit resonances
International Nuclear Information System (INIS)
Gupta, A; Gopakumar, A
2014-01-01
We evolve isolated comparable mass spinning compact binaries experiencing Schnittman’s post-Newtonian spin–orbit resonances in an inertial frame associated with j 0 , the initial direction of the total angular momentum. We argue that accurate gravitational wave (GW) measurements of the initial orientations of the two spins and orbital angular momentum from j 0 should allow us to distinguish between the two possible families of spin–orbit resonances. Therefore, these measurements have the potential to provide direct observational evidence of possible binary formation scenarios. The above statements should also apply for binaries that do not remain in a resonant plane when they become detectable by GW interferometers. The resonant plane, characterized by the vanishing scalar triple product involving the two spins and the orbital angular momentum, naturally appears in the one parameter family of equilibrium solutions, discovered by Schnittman. We develop a prescription to compute the time-domain inspiral templates for binaries residing in these resonant configurations and explore their preliminary data analysis consequences. (paper)
eLISA eccentricity measurements as tracers of binary black hole formation
Nishizawa, Atsushi; Berti, Emanuele; Klein, Antoine; Sesana, Alberto
2016-01-01
Up to hundreds of black hole binaries individually resolvable by eLISA will coalesce in the Advanced LIGO/Virgo band within ten years, allowing for multi-band gravitational wave observations. Binaries formed via dynamical interactions in dense star clusters are expected to have eccentricities $e_0\\sim 10^{-3}$-$10^{-1}$ at the frequencies $f_0=10^{-2}$ Hz where eLISA is most sensitive, while binaries formed in the field should have negligible eccentricity in both frequency bands. We estimate ...
Project DWARF - using eclipsing binaries for searching for exoplanets and brown dwarfs
Kudak, V.; Parimucha, Š.
2016-12-01
Project DWARF is a long-term observation campaign for about 60 selected eclipsing binaries aimed for detection of exoplanets or other objects (brown dwarfs) in low-mass detached binaries of different types (low-mass eclipsing binaries with M and K components, short-period binaries with sdB or sdO component, post-common-envelope systems containing a white dwarf). Existence of other bodies in systems are determined by analysing of O-C diagrams, constructed from observed minima times of binaries. Objects are selected with intention to determine minima with high precision. About 40 observatories are involved into the network at present time, mostly situated in Europe. The observations are made by small or middle class telescopes with apertures of 20-200 cm. In this contribution we give information about current status of the project, we present main goals and results of 4 years observations.
ENERGY DISSIPATION THROUGH QUASI-STATIC TIDES IN WHITE DWARF BINARIES
International Nuclear Information System (INIS)
Willems, B.; Deloye, C. J.; Kalogera, V.
2010-01-01
We present a formalism to study tidal interactions in white dwarf binaries in the limiting case of quasi-static tides, in which the tidal forcing frequencies are small, compared to the inverse of the white dwarf's dynamical timescale. The formalism is valid for arbitrary orbital eccentricities and therefore applicable to white dwarf binaries in the Galactic disk as well as globular clusters. In the quasi-static limit, the total perturbation of the gravitational potential shows a phase shift with respect to the position of the companion, the magnitude of which is determined primarily by the efficiency of energy dissipation through convective damping. We determine rates of secular evolution of the orbital elements and white dwarf rotational angular velocity for a 0.3 M sun helium white dwarf in binaries with orbital frequencies in the Laser Interferometer Space Antenna (LISA) gravitational wave frequency band and companion masses ranging from 0.3 M sun to 10 5 M sun . The resulting tidal evolution timescales for the orbital semimajor axis are longer than a Hubble time, so that convective damping of quasi-static tides need not be considered in the construction of gravitational wave templates of white dwarf binaries in the LISA band. Spin-up of the white dwarf, on the other hand, can occur on timescales of less than 10 Myr, provided that the white dwarf is initially rotating with a frequency much smaller than the orbital frequency. For semi-detached white dwarf binaries spin-up can occur on timescales of less than 1 Myr. Nevertheless, the timescales remain longer than the orbital inspiral timescales due to gravitational radiation, so that the degree of asynchronism in these binaries increases. As a consequence, tidal forcing eventually occurs at forcing frequencies beyond the quasi-static tide approximation. For the shortest period binaries, energy dissipation is therefore expected to take place through dynamic tides and resonantly excited g-modes.
Image Steganalysis with Binary Similarity Measures
Directory of Open Access Journals (Sweden)
Kharrazi Mehdi
2005-01-01
Full Text Available We present a novel technique for steganalysis of images that have been subjected to embedding by steganographic algorithms. The seventh and eighth bit planes in an image are used for the computation of several binary similarity measures. The basic idea is that the correlation between the bit planes as well as the binary texture characteristics within the bit planes will differ between a stego image and a cover image. These telltale marks are used to construct a classifier that can distinguish between stego and cover images. We also provide experimental results using some of the latest steganographic algorithms. The proposed scheme is found to have complementary performance vis-à-vis Farid's scheme in that they outperform each other in alternate embedding techniques.
On the dynamics of binary galaxies
International Nuclear Information System (INIS)
Verner, D.A.; Chernin, A.D.
1987-01-01
The dynamics of close noncontact binary galaxies is investigated. It is demonsrated that the tidal interaction is ineffective for circularization of galaxy orbits. Nonsphericity of galaxies develops a torque in a binary system. For a pair of elliptical galaxies this torque leads to swinging of the galaxies with respect to the orbital plane (which can be observed as a rotation about the minor axis) and to the excitation of internal degrees of freedom. Besides, this pendulum effect may be effective for elliptical galaxies in clusters due to the presence of the torque produced by a cluster as a whole. In the case of spiral galaxies the torque leads to the precession of their rotational axes. However this effect seems to be too weak to be observable
Cas A and the Crab were not stellar binaries at death
Kochanek, C. S.
2018-01-01
The majority of massive stars are in binaries, which implies that many core collapse supernovae should be binaries at the time of the explosion. Here we show that the three most recent, local (visual) SNe (the Crab, Cas A and SN 1987A) were not stellar binaries at death, with limits on the initial mass ratios of q = M2/M1 ≲ 0.1. No quantitative limits have previously been set for Cas A and the Crab, while for SN 1987A we merely updated existing limits in view of new estimates of the dust content. The lack of stellar companions to these three ccSNe implies a 90 per cent confidence upper limit on the q ≳ 0.1 binary fraction at death of fb runaway stars.
ON THE MASS RADIATED BY COALESCING BLACK HOLE BINARIES
International Nuclear Information System (INIS)
Barausse, E.; Morozova, V.; Rezzolla, L.
2012-01-01
We derive an analytic phenomenological expression that predicts the final mass of the black hole (BH) remnant resulting from the merger of a generic binary system of BHs on quasi-circular orbits. Besides recovering the correct test-particle limit for extreme mass-ratio binaries, our formula reproduces well the results of all the numerical-relativity simulations published so far, both when applied at separations of a few gravitational radii and when applied at separations of tens of thousands of gravitational radii. These validations make our formula a useful tool in a variety of contexts ranging from gravitational-wave (GW) physics to cosmology. As representative examples, we first illustrate how it can be used to decrease the phase error of the effective-one-body waveforms during the ringdown phase. Second, we show that, when combined with the recently computed self-force correction to the binding energy of nonspinning BH binaries, it provides an estimate of the energy emitted during the merger and ringdown. Finally, we use it to calculate the energy radiated in GWs by massive BH binaries as a function of redshift, using different models for the seeds of the BH population.
A binary origin for 'blue stragglers' in globular clusters.
Knigge, Christian; Leigh, Nathan; Sills, Alison
2009-01-15
Blue stragglers in globular clusters are abnormally massive stars that should have evolved off the stellar main sequence long ago. There are two known processes that can create these objects: direct stellar collisions and binary evolution. However, the relative importance of these processes has remained unclear. In particular, the total number of blue stragglers found in a given cluster does not seem to correlate with the predicted collision rate, providing indirect support for the binary-evolution model. Yet the radial distributions of blue stragglers in many clusters are bimodal, with a dominant central peak: this has been interpreted as an indication that collisions do dominate blue straggler production, at least in the high-density cluster cores. Here we report that there is a clear, but sublinear, correlation between the number of blue stragglers found in a cluster core and the total stellar mass contained within it. From this we conclude that most blue stragglers, even those found in cluster cores, come from binary systems. The parent binaries, however, may themselves have been affected by dynamical encounters. This may be the key to reconciling all of the seemingly conflicting results found to date.
Generation of two-dimensional binary mixtures in complex plasmas
Wieben, Frank; Block, Dietmar
2016-10-01
Complex plasmas are an excellent model system for strong coupling phenomena. Under certain conditions the dust particles immersed into the plasma form crystals which can be analyzed in terms of structure and dynamics. Previous experiments focussed mostly on monodisperse particle systems whereas dusty plasmas in nature and technology are polydisperse. Thus, a first and important step towards experiments in polydisperse systems are binary mixtures. Recent experiments on binary mixtures under microgravity conditions observed a phase separation of particle species with different radii even for small size disparities. This contradicts several numerical studies of 2D binary mixtures. Therefore, dedicated experiments are required to gain more insight into the physics of polydisperse systems. In this contribution first ground based experiments on two-dimensional binary mixtures are presented. Particular attention is paid to the requirements for the generation of such systems which involve the consideration of the temporal evolution of the particle properties. Furthermore, the structure of these two-component crystals is analyzed and compared to simulations. This work was supported by the Deutsche Forschungsgemeinschaft DFG in the framework of the SFB TR24 Greifswald Kiel, Project A3b.
Numerical relativity simulations of precessing binary neutron star mergers
Dietrich, Tim; Bernuzzi, Sebastiano; Brügmann, Bernd; Ujevic, Maximiliano; Tichy, Wolfgang
2018-03-01
We present the first set of numerical relativity simulations of binary neutron mergers that include spin precession effects and are evolved with multiple resolutions. Our simulations employ consistent initial data in general relativity with different spin configurations and dimensionless spin magnitudes ˜0.1 . They start at a gravitational-wave frequency of ˜392 Hz and cover more than 1 precession period and about 15 orbits up to merger. We discuss the spin precession dynamics by analyzing coordinate trajectories, quasilocal spin measurements, and energetics, by comparing spin aligned, antialigned, and irrotational configurations. Gravitational waveforms from different spin configuration are compared by calculating the mismatch between pairs of waveforms in the late inspiral. We find that precession effects are not distinguishable from nonprecessing configurations with aligned spins for approximately face-on binaries, while the latter are distinguishable from nonspinning configurations. Spin precession effects are instead clearly visible for approximately edge-on binaries. For the parameters considered here, precession does not significantly affect the characteristic postmerger gravitational-wave frequencies nor the mass ejection. Our results pave the way for the modeling of spin precession effects in the gravitational waveform from binary neutron star events.
Radioimmunotherapy [INIS-UY-GEO--700
International Nuclear Information System (INIS)
Cacchione, R.
2015-01-01
This presentation is about the radiotherapy, chemo-immunotherapy and radioimmunotherapy treatment. Its adequate response in Non-Hodgkin Lymphoma as well as the tolerance and reversibly hematologic toxicity
Min-Max decoding for non binary LDPC codes
Savin, Valentin
2008-01-01
Iterative decoding of non-binary LDPC codes is currently performed using either the Sum-Product or the Min-Sum algorithms or slightly different versions of them. In this paper, several low-complexity quasi-optimal iterative algorithms are proposed for decoding non-binary codes. The Min-Max algorithm is one of them and it has the benefit of two possible LLR domain implementations: a standard implementation, whose complexity scales as the square of the Galois field's cardinality and a reduced c...
Binary and Millisecond Pulsars at the New Millennium
Directory of Open Access Journals (Sweden)
Lorimer Duncan R.
2001-01-01
Full Text Available We review the properties and applications of binary and millisecond pulsars. Our knowledge of these exciting objects has greatly increased in recent years, mainly due to successful surveys which have brought the known pulsar population to over 1300. There are now 56 binary and millisecond pulsars in the Galactic disk and a further 47 in globular clusters. This review is concerned primarily with the results and spin-offs from these surveys which are of particular interest to the relativity community.
Be discs in coplanar circular binaries: Phase-locked variations of emission lines
Panoglou, Despina; Faes, Daniel M.; Carciofi, Alex C.; Okazaki, Atsuo T.; Baade, Dietrich; Rivinius, Thomas; Borges Fernandes, Marcelo
2018-01-01
In this paper, we present the first results of radiative transfer calculations on decretion discs of binary Be stars. A smoothed particle hydrodynamics code computes the structure of Be discs in coplanar circular binary systems for a range of orbital and disc parameters. The resulting disc configuration consists of two spiral arms, and this can be given as input into a Monte Carlo code, which calculates the radiative transfer along the line of sight for various observational coordinates. Making use of the property of steady disc structure in coplanar circular binaries, observables are computed as functions of the orbital phase. Some orbital-phase series of line profiles are given for selected parameter sets under various viewing angles, to allow comparison with observations. Flat-topped profiles with and without superimposed multiple structures are reproduced, showing, for example, that triple-peaked profiles do not have to be necessarily associated with warped discs and misaligned binaries. It is demonstrated that binary tidal effects give rise to phase-locked variability of the violet-to-red (V/R) ratio of hydrogen emission lines. The V/R ratio exhibits two maxima per cycle; in certain cases those maxima are equal, leading to a clear new V/R cycle every half orbital period. This study opens a way to identifying binaries and to constraining the parameters of binary systems that exhibit phase-locked variations induced by tidal interaction with a companion star.
Weight Distribution for Non-binary Cluster LDPC Code Ensemble
Nozaki, Takayuki; Maehara, Masaki; Kasai, Kenta; Sakaniwa, Kohichi
In this paper, we derive the average weight distributions for the irregular non-binary cluster low-density parity-check (LDPC) code ensembles. Moreover, we give the exponential growth rate of the average weight distribution in the limit of large code length. We show that there exist $(2,d_c)$-regular non-binary cluster LDPC code ensembles whose normalized typical minimum distances are strictly positive.
Gravitational waves from double white dwarfs and AM CVn binaries
International Nuclear Information System (INIS)
Nelemans, Gijs
2003-01-01
I give a brief overview of our model for the galactic population of compact binaries that is used to predict the low-frequency gravitational wave signal from the galaxy, and discuss recent observational developments that will enable us to test and improve this model. The SPY project will discover some 150 new close double white dwarfs and, recently, two ROSAT sources turned out to be new AM CVn candidates, one with an orbital period of only 5 min. I give an update on the expected binaries that will be resolved by LISA and discuss what we can learn about the galactic population of compact binaries once LISA gives her first results
Observational properties of models of semidetached close binaries. Pt. 2
International Nuclear Information System (INIS)
Giannone, P.; Giannuzzi, M.A.; Pucillo, M.
1975-01-01
Binaries of Cases A and B with intermediate and small masses have been studied. Synthetic light curves are shown to be affected mainly by the assumption concerning the shape of the components. The comparison between synthetic light curves and observed data can give further information on the reliability of the hypotheses assumed in the computations of binary star evolution. The calculated properties lead to useful indications about the evolutionary stages of observed binaries. The detection of systems evolving according to Case A appears to be favoured in comparison with that of systems of Case B. Systems with undersize subgiants result comparatively difficult to observe. (orig./BJ) [de
Short-Period Binary Stars: Observations, Analyses, and Results
Milone, Eugene F; Hobill, David W
2008-01-01
Short-period binaries run the gamut from widely separated stars to black-hole pairs; in between are systems that include neutron stars and white dwarfs, and partially evolved systems such as tidally distorted and over-contact systems. These objects represent stages of evolution of binary stars, and their degrees of separation provide critical clues to how their evolutionary paths differ from that of single stars. The widest and least distorted systems provide astronomers with the essential precise data needed to study all stars: mass and radius. The interactions of binary star components, on the other hand, provide a natural laboratory to observe how the matter in these stars behaves under different and often varying physical conditions. Thus, cataclysmic variables with and without overpoweringly strong magnetic fields, and stars with densities from that found in the Sun to the degenerate matter of white dwarfs and the ultra-compact states of neutron stars and black holes are all discussed. The extensive inde...
Thermodynamic properties of some gallium-based binary alloys
International Nuclear Information System (INIS)
Awe, O.E.; Odusote, Y.A.; Akinlade, O.; Hussain, L.A.
2008-01-01
We have studied the concentration dependence of the free energy of mixing, concentration-concentration fluctuations in the long-wavelength limit, the chemical short-range order parameter, the enthalpy and entropy of mixing of Ga-Zn, Ga-Mg and Al-Ga binary alloys at different temperatures using a quasi-chemical approximation for compound forming binary alloys and that for simple regular alloys. From the study of the thermodynamic quantities, we observed that thermodynamic properties of Ga-Zn and Al-Ga exhibit positive deviations from Raoultian behaviour, while Ga-Mg exhibits negative deviation. Hence, this study reveals that both Ga-Zn and Al-Ga are segregating systems, while chemical order exists in Ga-Mg alloy in the whole concentration range. Furthermore, our investigation indicate that Al-Ga binary alloy have a tendency to exhibit ideal mixture behaviour in the concentration range 0≤c Al ≤0.30 and 0.7≤c Al ≤1
Binary pattern analysis for 3D facial action unit detection
Sandbach, Georgia; Zafeiriou, Stefanos; Pantic, Maja
2012-01-01
In this paper we propose new binary pattern features for use in the problem of 3D facial action unit (AU) detection. Two representations of 3D facial geometries are employed, the depth map and the Azimuthal Projection Distance Image (APDI). To these the traditional Local Binary Pattern is applied,
The OB run-away stars from Sco-Cen and Orion reviewed
International Nuclear Information System (INIS)
Blaauw, A.
1989-01-01
The author studies the past paths of the run-away star Zeta Oph from the OB association Sco-Cen, and of the run-away stars AE Aur, Mu Col and 53 Ari from the OB association Ori OB1, in connection with the question of the origin of these high velocities. Should the binary-hypothesis be adhered to (supernova explosion of one of the components) or, perhaps, dynamical evolution in young, dense clusters offer a clue to this phenomenon? It is shown that the latter hypothesis is very unlikely to apply to Zeta Oph. For the run-away stars from Orion conclusive evidence may well be obtained in the course of the next decade, from improved accuracy of the proper motions
Can black-hole MACHO binaries be detected by the Brazilian spherical antenna?
International Nuclear Information System (INIS)
Araujo, J C N de; Miranda, O D; Castro, C S; Paleo, B W; Aguiar, O D
2004-01-01
Different studies show that dark matter of non-baryonic origin might exist. There is experimental evidence that at least one form of dark matter has been detected through microlensing effects. This form of dark matter is named MACHOs (massive astrophysical compact halo objects). The MACHO collaboration estimated that the masses of these objects are to be in the range 0.15-0.95M o-dot , where the most probable mass is of 0.5M o-dot . Some authors argue that MACHOs could be black holes, and that they could form binary systems, BHMACHO binaries. As is well known, binary systems are sources of gravitational waves. The Brazilian spherical antenna will operate in the frequency band of 3.0-3.4 kHz, sensitive to binaries of a pair of 0.5M o-dot black holes just before coalescing. In the present work we study the detectability of these putative BHMACHO binaries by the Brazilian spherical antenna Mario Schenberg
Evolution of a massive binary in a star field
International Nuclear Information System (INIS)
Baranov, A.S.
1984-01-01
The orbital evolution of a massive binary system interacting with a background field of single stars whose phase density is homogeneous in configuration space is considered. The velocity distribution is assumed isotropic up to some limiting value, and a typical field star is regarded as having a velocity much higher than the orbital speed of the pair components. An expression is derived for the transfer of energy from the binary to the field stars. The time evolution of the orbit parameters a, e is established, and the evolution rate is estimated for Kardashev's (1983) model galactic nucleus containing a central black-hole binary. On the above assumptions the components should become twice as close together within only a few tens of millennia, although the picture may change fundamentally if the nucleus is rotating. 13 references
Evidence of a stable binary CdCa quasicrystalline phase
DEFF Research Database (Denmark)
Jiang, Jianzhong; Jensen, C.H.; Rasmussen, A.R.
2001-01-01
Quasicrystals with a primitive icosahedral structure and a quasilattice constant of 5.1215 Angstrom have been synthesized in a binary Cd-Ca system. The thermal stability of the quasicrystal has been investigated by in situ high-temperature x-ray powder diffraction using synchrotron radiation. It ....... It is demonstrated that the binary CdCa quasicrystal is thermodynamic stable up to its melting temperature. The linear thermal expansion coefficient of the quasicrystal is 2.765x10(-5) K-1. (C) 2001 American Institute of Physics.......Quasicrystals with a primitive icosahedral structure and a quasilattice constant of 5.1215 Angstrom have been synthesized in a binary Cd-Ca system. The thermal stability of the quasicrystal has been investigated by in situ high-temperature x-ray powder diffraction using synchrotron radiation...
Study on the control mechanism of China aerospace enterprises' binary multinational operation
Institute of Scientific and Technical Information of China (English)
Wang Jian; Li Hanling; Wu Weiwei
2008-01-01
China's aerospace enterprises carry on the multinational operation and participate in the international competition and the international division of labor and cooperation positively.This article first analyzs China aerospace enterprises' binary multinational business control objective and constructes its model.Then the article analyzes the tangible and intangible control mechanism of China aerospace enterprises' binary multinational operation respectively.Finally,the article constructs the model of China aerospace enterprises' binary multinational operation mechanisms.
Emission-line diagnostics of nearby H II regions including interacting binary populations
Xiao, Lin; Stanway, Elizabeth R.; Eldridge, J. J.
2018-06-01
We present numerical models of the nebular emission from H II regions around young stellar populations over a range of compositions and ages. The synthetic stellar populations include both single stars and interacting binary stars. We compare these models to the observed emission lines of 254 H II regions of 13 nearby spiral galaxies and 21 dwarf galaxies drawn from archival data. The models are created using the combination of the BPASS (Binary Population and Spectral Synthesis) code with the photoionization code CLOUDY to study the differences caused by the inclusion of interacting binary stars in the stellar population. We obtain agreement with the observed emission line ratios from the nearby star-forming regions and discuss the effect of binary-star evolution pathways on the nebular ionization of H II regions. We find that at population ages above 10 Myr, single-star models rapidly decrease in flux and ionization strength, while binary-star models still produce strong flux and high [O III]/H β ratios. Our models can reproduce the metallicity of H II regions from spiral galaxies, but we find higher metallicities than previously estimated for the H II regions from dwarf galaxies. Comparing the equivalent width of H β emission between models and observations, we find that accounting for ionizing photon leakage can affect age estimates for H II regions. When it is included, the typical age derived for H II regions is 5 Myr from single-star models, and up to 10 Myr with binary-star models. This is due to the existence of binary-star evolution pathways, which produce more hot Wolf-Rayet and helium stars at older ages. For future reference, we calculate new BPASS binary maximal starburst lines as a function of metallicity, and for the total model population, and present these in Appendix A.
International Nuclear Information System (INIS)
Geller, Aaron M.; De Grijs, Richard; Li, Chengyuan; Hurley, Jarrod R.
2013-01-01
The massive (13,000-26,000 M ☉ ) and young (15-30 Myr) Large Magellanic Cloud star cluster NGC 1818 reveals an unexpected increasing binary frequency with radius for F-type stars (1.3-2.2 M ☉ ). This is in contrast to many older star clusters that show a decreasing binary frequency with radius. We study this phenomenon with sophisticated N-body modeling, exploring a range of initial conditions, from smooth virialized density distributions to highly substructured and collapsing configurations. We find that many of these models can reproduce the cluster's observed properties, although with a modest preference for substructured initial conditions. Our models produce the observed radial trend in binary frequency through disruption of soft binaries (with semi-major axes, a ≳ 3000 AU), on approximately a crossing time (∼5.4 Myr), preferentially in the cluster core. Mass segregation subsequently causes the binaries to sink toward the core. After roughly one initial half-mass relaxation time (t rh (0) ∼ 340 Myr) the radial binary frequency distribution becomes bimodal, the innermost binaries having already segregated toward the core, leaving a minimum in the radial binary frequency distribution that marches outward with time. After 4-6 t rh (0), the rising distribution in the halo disappears, leaving a radial distribution that rises only toward the core. Thus, both a radial binary frequency distribution that falls toward the core (as observed for NGC 1818) and one that rises toward the core (as for older star clusters) can arise naturally from the same evolutionary sequence owing to binary disruption and mass segregation in rich star clusters.
Binary pulsars as probes of a Galactic dark matter disk
Caputo, Andrea; Zavala, Jesús; Blas, Diego
2018-03-01
As a binary pulsar moves through a wind of dark matter particles, the resulting dynamical friction modifies the binary's orbit. We study this effect for the double disk dark matter (DDDM) scenario, where a fraction of the dark matter is dissipative and settles into a thin disk. For binaries within the dark disk, this effect is enhanced due to the higher dark matter density and lower velocity dispersion of the dark disk, and due to its co-rotation with the baryonic disk. We estimate the effect and compare it with observations for two different limits in the Knudsen number (Kn). First, in the case where DDDM is effectively collisionless within the characteristic scale of the binary (Kn ≫ 1) and ignoring the possible interaction between the pair of dark matter wakes. Second, in the fully collisional case (Kn ≪ 1), where a fluid description can be adopted and the interaction of the pair of wakes is taken into account. We find that the change in the orbital period is of the same order of magnitude in both limits. A comparison with observations reveals good prospects to probe currently allowed DDDM models with timing data from binary pulsars in the near future. We finally comment on the possibility of extending the analysis to the intermediate (rarefied gas) case with Kn ∼ 1.
"I would have preferred more options": accounting for non-binary youth in health research.
Frohard-Dourlent, Hélène; Dobson, Sarah; Clark, Beth A; Doull, Marion; Saewyc, Elizabeth M
2017-01-01
As a research team focused on vulnerable youth, we increasingly need to find ways to acknowledge non-binary genders in health research. Youth have become more vocal about expanding notions of gender beyond traditional categories of boy/man and girl/woman. Integrating non-binary identities into established research processes is a complex undertaking in a culture that often assumes gender is a binary variable. In this article, we present the challenges at every stage of the research process and questions we have asked ourselves to consider non-binary genders in our work. As researchers, how do we interrogate the assumptions that have made non-binary lives invisible? What challenges arise when attempting to transform research practices to incorporate non-binary genders? Why is it crucial that researchers consider these questions at each step of the research process? We draw on our own research experiences to highlight points of tensions and possibilities for change. Improving access to inclusive health-care for non-binary people, and non-binary youth in particular, is part of creating a more equitable healthcare system. We argue that increased and improved access to inclusive health-care can be supported by research that acknowledges and includes people of all genders. © 2016 John Wiley & Sons Ltd.
Flexible link functions in nonparametric binary regression with Gaussian process priors.
Li, Dan; Wang, Xia; Lin, Lizhen; Dey, Dipak K
2016-09-01
In many scientific fields, it is a common practice to collect a sequence of 0-1 binary responses from a subject across time, space, or a collection of covariates. Researchers are interested in finding out how the expected binary outcome is related to covariates, and aim at better prediction in the future 0-1 outcomes. Gaussian processes have been widely used to model nonlinear systems; in particular to model the latent structure in a binary regression model allowing nonlinear functional relationship between covariates and the expectation of binary outcomes. A critical issue in modeling binary response data is the appropriate choice of link functions. Commonly adopted link functions such as probit or logit links have fixed skewness and lack the flexibility to allow the data to determine the degree of the skewness. To address this limitation, we propose a flexible binary regression model which combines a generalized extreme value link function with a Gaussian process prior on the latent structure. Bayesian computation is employed in model estimation. Posterior consistency of the resulting posterior distribution is demonstrated. The flexibility and gains of the proposed model are illustrated through detailed simulation studies and two real data examples. Empirical results show that the proposed model outperforms a set of alternative models, which only have either a Gaussian process prior on the latent regression function or a Dirichlet prior on the link function. © 2015, The International Biometric Society.
Binary Black Hole Mergers in the First Advanced LIGO Observing Run
Abbott, B. P.; Abbott, R.; Abbott, T. D.; Abernathy, M. R.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, F.; Camp, J. B.;
2016-01-01
The first observational run of the Advanced LIGO detectors, from September 12, 2015 to January 19, 2016, saw the first detections of gravitational waves from binary black hole mergers. In this paper we present full results from a search for binary black hole merger signals with total masses up to 100M solar mass and detailed implications from our observations of these systems. Our search, based on general-relativistic models of gravitational wave signals from binary black hole systems, unambiguously identified two signals, GW150914 and GW151226, with a significance of greater than 5 alpha over the observing period. It also identified a third possible signal, LVT151012, with substantially lower significance, which has a 87 probability of being of astrophysical origin. We provide detailed estimates of the parameters of the observed systems. Both GW150914 and GW151226 provide an unprecedented opportunity to study the two-body motion of a compact-object binary in the large velocity, highly nonlinear regime. We do not observe any deviations from general relativity, and place improved empirical bounds on several high-order post-Newtonian coefficients. From our observations we infer stellar-mass binary black hole merger rates lying in the range 9-240 Gpc-3 yr-1. These observations are beginning to inform astrophysical predictions of binary black hole formation rates, and indicate that future observing runs of the Advanced detector network will yield many more gravitational wave detections.
Binary Black Hole Mergers in the First Advanced LIGO Observing Run
Directory of Open Access Journals (Sweden)
2016-10-01
Full Text Available The first observational run of the Advanced LIGO detectors, from September 12, 2015 to January 19, 2016, saw the first detections of gravitational waves from binary black hole mergers. In this paper, we present full results from a search for binary black hole merger signals with total masses up to 100M_{⊙} and detailed implications from our observations of these systems. Our search, based on general-relativistic models of gravitational-wave signals from binary black hole systems, unambiguously identified two signals, GW150914 and GW151226, with a significance of greater than 5σ over the observing period. It also identified a third possible signal, LVT151012, with substantially lower significance and with an 87% probability of being of astrophysical origin. We provide detailed estimates of the parameters of the observed systems. Both GW150914 and GW151226 provide an unprecedented opportunity to study the two-body motion of a compact-object binary in the large velocity, highly nonlinear regime. We do not observe any deviations from general relativity, and we place improved empirical bounds on several high-order post-Newtonian coefficients. From our observations, we infer stellar-mass binary black hole merger rates lying in the range 9–240 Gpc^{-3} yr^{-1}. These observations are beginning to inform astrophysical predictions of binary black hole formation rates and indicate that future observing runs of the Advanced detector network will yield many more gravitational-wave detections.
Circumstellar disks around binary stars in Taurus
Energy Technology Data Exchange (ETDEWEB)
Akeson, R. L. [NASA Exoplanet Science Institute, IPAC/Caltech, Pasadena, CA 91125 (United States); Jensen, E. L. N. [Swarthmore College, Department of Physics and Astronomy, Swarthmore, PA 19081 (United States)
2014-03-20
We have conducted a survey of 17 wide (>100 AU) young binary systems in Taurus with the Atacama Large Millimeter Array (ALMA) at two wavelengths. The observations were designed to measure the masses of circumstellar disks in these systems as an aid to understanding the role of multiplicity in star and planet formation. The ALMA observations had sufficient resolution to localize emission within the binary system. Disk emission was detected around all primaries and 10 secondaries, with disk masses as low as 10{sup –4} M {sub ☉}. We compare the properties of our sample to the population of known disks in Taurus and find that the disks from this binary sample match the scaling between stellar mass and millimeter flux of F{sub mm}∝M{sub ∗}{sup 1.5--2.0} to within the scatter found in previous studies. We also compare the properties of the primaries to those of the secondaries and find that the secondary/primary stellar and disk mass ratios are not correlated; in three systems, the circumsecondary disk is more massive than the circumprimary disk, counter to some theoretical predictions.
ORBITAL EVOLUTION OF COMPACT WHITE DWARF BINARIES
Energy Technology Data Exchange (ETDEWEB)
Kaplan, David L. [Physics Department, University of Wisconsin-Milwaukee, Milwaukee, WI 53211 (United States); Bildsten, Lars [Kavli Institute for Theoretical Physics and Department of Physics, Kohn Hall, University of California, Santa Barbara, CA 93106 (United States); Steinfadt, Justin D. R., E-mail: kaplan@uwm.edu, E-mail: bildsten@kitp.ucsb.edu, E-mail: jdrsteinfadt@gmail.com [Department of Physics, Broida Hall, University of California, Santa Barbara, CA 93106 (United States)
2012-10-10
The newfound prevalence of extremely low mass (ELM, M{sub He} < 0.2 M{sub Sun }) helium white dwarfs (WDs) in tight binaries with more massive WDs has raised our interest in understanding the nature of their mass transfer. Possessing small (M{sub env} {approx} 10{sup -3} M{sub Sun }) but thick hydrogen envelopes, these objects have larger radii than cold WDs and so initiate mass transfer of H-rich material at orbital periods of 6-10 minutes. Building on the original work of D'Antona et al., we confirm the 10{sup 6} yr period of continued inspiral with mass transfer of H-rich matter and highlight the fact that the inspiraling direct-impact double WD binary HM Cancri likely has an ELM WD donor. The ELM WDs have less of a radius expansion under mass loss, thus enabling a larger range of donor masses that can stably transfer matter and become a He mass transferring AM CVn binary. Even once in the long-lived AM CVn mass transferring stage, these He WDs have larger radii due to their higher entropy from the prolonged H-burning stage.
Lifescience Database Archive (English)
Full Text Available OS=Drosophila melanogast... 34 0.58 sp|P41326|VP30_MABVP Minor nucleoprotein VP30 OS=Lake Victoria... m... 33 0.99 sp|Q6UY65|VP30_MABVO Minor nucleoprotein VP30 OS=Lake Victoria m... 33 1.7 s... 32 3.8 sp|Q1PDC6|VP30_MABVR Minor nucleoprotein VP30 OS=Lake Victoria m... 31 4.... 3956 >sp|P41326|VP30_MABVP Minor nucleoprotein VP30 OS=Lake Victoria marburgvirus (strain Popp-67) GN=VP30 ... NHH R+ ++T Sbjct: 11 RNHQTASSIYHETQLPSKPHYTNHHPRARSMSST 44 >sp|Q6UY65|VP30_MABVO Minor nucleoprotein VP30 OS=Lake Victoria
Low-mass X-ray binaries from black hole retaining globular clusters
Giesler, Matthew; Clausen, Drew; Ott, Christian D.
2018-06-01
Recent studies suggest that globular clusters (GCs) may retain a substantial population of stellar-mass black holes (BHs), in contrast to the long-held belief of a few to zero BHs. We model the population of BH low-mass X-ray binaries (BH-LMXBs), an ideal observable proxy for elusive single BHs, produced from a representative group of Milky Way GCs with variable BH populations. We simulate the formation of BH binaries in GCs through exchange interactions between binary and single stars in the company of tens to hundreds of BHs. Additionally, we consider the impact of the BH population on the rate of compact binaries undergoing gravitational wave driven mergers. The characteristics of the BH-LMXB population and binary properties are sensitive to the GCs structural parameters as well as its unobservable BH population. We find that GCs retaining ˜1000 BHs produce a galactic population of ˜150 ejected BH-LMXBs, whereas GCs retaining only ˜20 BHs produce zero ejected BH-LMXBs. Moreover, we explore the possibility that some of the presently known BH-LMXBs might have originated in GCs and identify five candidate systems.
Low-mass X-ray binaries from black-hole retaining globular clusters
Giesler, Matthew; Clausen, Drew; Ott, Christian D.
2018-03-01
Recent studies suggest that globular clusters (GCs) may retain a substantial population of stellar-mass black holes (BHs), in contrast to the long-held belief of a few to zero BHs. We model the population of BH low-mass X-ray binaries (BH-LMXBs), an ideal observable proxy for elusive single BHs, produced from a representative group of Milky Way GCs with variable BH populations. We simulate the formation of BH-binaries in GCs through exchange interactions between binary and single stars in the company of tens to hundreds of BHs. Additionally, we consider the impact of the BH population on the rate of compact binaries undergoing gravitational wave driven mergers. The characteristics of the BH-LMXB population and binary properties are sensitive to the GCs structural parameters as well as its unobservable BH population. We find that GCs retaining ˜1000 BHs produce a galactic population of ˜150 ejected BH-LMXBs whereas GCs retaining only ˜20 BHs produce zero ejected BH-LMXBs. Moreover, we explore the possibility that some of the presently known BH-LMXBs might have originated in GCs and identify five candidate systems.
Thermodynamic equilibrium of hydroxyacetic acid in pure and binary solvent systems
International Nuclear Information System (INIS)
Huang, Qiaoyin; Xie, Chuang; Li, Yang; Su, Nannan; Lou, Yajing; Hu, Xiaoxue; Wang, Yongli; Bao, Ying; Hou, Baohong
2017-01-01
Highlights: • Solubility of hydroxyacetic acid in mono-solvents and binary solvent mixtures was measured. • Modified Apelblat, NRTL and Wilson model were used to correlate the solubility data in pure solvents. • CNIBS/R-K and Jouyban-Acree model were used to correlate the solubility in binary solvent mixtures. • The mixing properties were calculated based on the NRTL model. - Abstract: The solubility of hydroxyacetic acid in five pure organic solvents and two binary solvent mixtures were experimentally measured from 273.15 K to 313.15 K at atmospheric pressure (p = 0.1 MPa) by using a dynamic method. The order of solubility in pure organic solvents is ethanol > isopropanol > n-butanol > acetonitrile > ethyl acetate within the investigated temperature range, except for temperature lower than 278 K where the solubility of HA in ethyl acetate is slightly larger than that in acetonitrile. Furthermore, the solubility data in pure solvents were correlated with the modified Apelblat model, NRTL model, and Wilson model and that in the binary solvents mixtures were fitted to the CNIBS/R-K model and Jouyban-Acree model. Finally, the mixing thermodynamic properties of hydroxyacetic acid in pure and binary solvent systems were calculated and discussed.
International Nuclear Information System (INIS)
Li, Zhongmu; Mao, Caiyan; Chen, Li; Zhang, Qian; Li, Maocai
2013-01-01
Most galaxies possibly contain some binaries, and more than half of Galactic hot subdwarf stars, which are thought to be a possible origin of the UV-upturn of old stellar populations, are found in binaries. However, the effect of binary evolution has not been taken into account in most works on the spectral fitting of galaxies. This paper studies the role of binary evolution in the spectral fitting of early-type galaxies, via a stellar population synthesis model including both single and binary star populations. Spectra from ultraviolet to optical bands are fitted to determine a few galaxy parameters. The results show that the inclusion of binaries in stellar population models may lead to obvious change in the determination of some parameters of early-type galaxies and therefore it is potentially important for spectral studies. In particular, the ages of young components of composite stellar populations become much older when using binary star population models instead of single star population models. This implies that binary star population models will measure significantly different star formation histories for early-type galaxies compared to single star population models. In addition, stellar population models with binary interactions on average measure larger dust extinctions than single star population models. This suggests that when binary star population models are used, negative extinctions are possibly no longer necessary in the spectral fitting of galaxies (see previous works, e.g., Cid Fernandes et al. for comparison). Furthermore, it is shown that optical spectra have strong constraints on stellar age while UV spectra have strong constraints on binary fraction. Finally, our results suggest that binary star population models can provide new insight into the stellar properties of globular clusters
Effects of tidal distortion on binary-star velocity curves and ellipsoidal variation
International Nuclear Information System (INIS)
Wilson, R.E.; Sofia, S.
1976-01-01
Radial velocity curves for the more massive components of binaries with extreme mass ratios can show a large distortion due to tides, as first recognized by Sterne. Binaries in which the effect is large should be rare because nearly all such binaries would be in the rapid phase of mass transfer. However, the optical counterparts of some X-ray binaries may show the effect, which would then serve as a new means of extracting considerable information from the observations. The essential parts of the computational procedure are given. Light curves for ellipsoidal variables with extreme mass ratios were also computed, and were found to be less sinusoidal than those with normal mass ratios
Supercritical accretion in the evolution of neutron star binaries and its implications
Energy Technology Data Exchange (ETDEWEB)
Lee, Chang-Hwan, E-mail: clee@pusan.ac.kr; Cho, Hee-Suk
2014-08-15
Recently ∼2M{sub ⊙} neutron stars PSR J1614-2230 and PSR J0348+0432 have been observed in neutron star-white dwarf binaries. These observations ruled out many neutron star equations of states with which the maximum neutron star mass becomes less than 2M{sub ⊙}. On the other hand, all well-measured neutron star masses in double neutron star binaries are still less than 1.5M{sub ⊙}. In this article we suggest that 2M{sub ⊙} neutron stars in neutron star-white dwarf binaries are the result of the supercritical accretion onto the first-born neutron star during the evolution of the binary progenitors.
Physical Structure of Four Symbiotic Binaries
Kenyon, Scott J. (Principal Investigator)
1997-01-01
Disk accretion powers many astronomical objects, including pre-main sequence stars, interacting binary systems, and active galactic nuclei. Unfortunately, models developed to explain the behavior of disks and their surroundings - boundary layers, jets, and winds - lack much predictive power, because the physical mechanism driving disk evolution - the viscosity - is not understood. Observations of many types of accreting systems are needed to constrain the basic physics of disks and provide input for improved models. Symbiotic stars are an attractive laboratory for studying physical phenomena associated with disk accretion. These long period binaries (P(sub orb) approx. 2-3 yr) contain an evolved red giant star, a hot companion, and an ionized nebula. The secondary star usually is a white dwarf accreting material from the wind of its red giant companion. A good example of this type of symbiotic is BF Cygni: our analysis shows that disk accretion powers the nuclear burning shell of the hot white dwarf and also manages to eject material perpendicular to the orbital plane (Mikolajewska, Kenyon, and Mikolajewski 1989). The hot components in other symbiotic binaries appear powered by tidal overflow from a very evolved red giant companion. We recently completed a study of CI Cygni and demonstrated that the accreting secondary is a solar-type main sequence star, rather than a white dwarf (Kenyon et aL 1991). This project continued our study of symbiotic binary systems. Our general plan was to combine archival ultraviolet and optical spectrophotometry with high quality optical radial velocity observations to determine the variation of line and continuum sources as functions of orbital phase. We were very successful in generating orbital solutions and phasing UV+optical spectra for five systems: AG Dra, V443 Her, RW Hya, AG Peg, and AX Per. Summaries of our main results for these systems appear below. A second goal of our project was to consider general models for the
nth-Nearest neighbour distribution functions of a binary fluid mixture ...
Indian Academy of Sciences (India)
Administrator
for ob- taining the NND functions for single component flu- ids, to binary fluid mixtures. The MD simulation and computation details are presented in section 4. Results are elaborated in section 5 and conclusions are provided in section 6. 2. n-Particle distribution function. Considering a binary system of Nα and Nβ particles.
Inducing Risk Neutral Preferences with Binary Lotteries
DEFF Research Database (Denmark)
Harrison, Glenn W.; Martínez-Correa, Jimmy; Swarthout, J. Todd
2013-01-01
validity of any strategic equilibrium behavior, or even the customary independence axiom. We show that subjects sampled from our population are generally risk averse when lotteries are defined over monetary outcomes, and that the binary lottery procedure does indeed induce a statistically significant shift......We evaluate the binary lottery procedure for inducing risk neutral behavior. We strip the experimental implementation down to bare bones, taking care to avoid any potentially confounding assumptions about behavior having to be made. In particular, our evaluation does not rely on the assumed...... toward risk neutrality. This striking result generalizes to the case in which subjects make several lottery choices and one is selected for payment....
The binary progenitors of short and long GRBs and their gravitational-wave emission
Rueda, J. A.; Ruffini, R.; Rodriguez, J. F.; Muccino, M.; Aimuratov, Y.; Barres de Almeida, U.; Becerra, L.; Bianco, C. L.; Cherubini, C.; Filippi, S.; Kovacevic, M.; Moradi, R.; Pisani, G. B.; Wang, Y.
2018-01-01
We have sub-classified short and long-duration gamma-ray bursts (GRBs) into seven families according to the binary nature of their progenitors. Short GRBs are produced in mergers of neutron-star binaries (NS-NS) or neutron star-black hole binaries (NS-BH). Long GRBs are produced via the induced gravitational collapse (IGC) scenario occurring in a tight binary system composed of a carbon-oxygen core (COcore) and a NS companion. The COcore explodes as type Ic supernova (SN) leading to a hypercritical accretion process onto the NS: if the accretion is sufficiently high the NS reaches the critical mass and collapses forming a BH, otherwise a massive NS is formed. Therefore long GRBs can lead either to NS-BH or to NS-NS binaries depending on the entity of the accretion. We discuss for the above compact-object binaries: 1) the role of the NS structure and the nuclear equation of state; 2) the occurrence rates obtained from X and gamma-rays observations; 3) the predicted annual number of detections by the Advanced LIGO interferometer of their gravitational-wave emission.
On the dynamics of non-stationary binary stellar systems
International Nuclear Information System (INIS)
Bekov, A. A.; Bejsekov, A.N.; Aldibaeva, L.T.
2005-01-01
The motion of test body in the external gravitational field of the binary stellar system with slowly variable some physical parameters of radiating components is considered on the base of restricted non-stationary photo-gravitational three and two bodies problem. The family of polar and coplanar solutions are obtained. These solutions give the possibility of the dynamical and structure interpretation of the binary young evolving stars and galaxies. (author)
Memory Vulnerability Diagnosis for Binary Program
Directory of Open Access Journals (Sweden)
Tang Feng-Yi
2016-01-01
Full Text Available Vulnerability diagnosis is important for program security analysis. It is a further step to understand the vulnerability after it is detected, as well as a preparatory step for vulnerability repair or exploitation. This paper mainly analyses the inner theories of major memory vulnerabilities and the threats of them. And then suggests some methods to diagnose several types of memory vulnerabilities for the binary programs, which is a difficult task due to the lack of source code. The diagnosis methods target at buffer overflow, use after free (UAF and format string vulnerabilities. We carried out some tests on the Linux platform to validate the effectiveness of the diagnosis methods. It is proved that the methods can judge the type of the vulnerability given a binary program.
Optimally cloned binary coherent states
DEFF Research Database (Denmark)
Mueller, C. R.; Leuchs, G.; Marquardt, Ch
2017-01-01
their quantum-optimal clones. We analyze the Wigner function and the cumulants of the clones, and we conclude that optimal cloning of binary coherent states requires a nonlinearity above second order. We propose several practical and near-optimal cloning schemes and compare their cloning fidelity to the optimal...
The influence of massive black hole binaries on the morphology of merger remnants
Bortolas, E.; Gualandris, A.; Dotti, M.; Read, J. I.
2018-06-01
Massive black hole (MBH) binaries, formed as a result of galaxy mergers, are expected to harden by dynamical friction and three-body stellar scatterings, until emission of gravitational waves (GWs) leads to their final coalescence. According to recent simulations, MBH binaries can efficiently harden via stellar encounters only when the host geometry is triaxial, even if only modestly, as angular momentum diffusion allows an efficient repopulation of the binary loss cone. In this paper, we carry out a suite of N-body simulations of equal-mass galaxy collisions, varying the initial orbits and density profiles for the merging galaxies and running simulations both with and without central MBHs. We find that the presence of an MBH binary in the remnant makes the system nearly oblate, aligned with the galaxy merger plane, within a radius enclosing 100 MBH masses. We never find binary hosts to be prolate on any scale. The decaying MBHs slightly enhance the tangential anisotropy in the centre of the remnant due to angular momentum injection and the slingshot ejection of stars on nearly radial orbits. This latter effect results in about 1 per cent of the remnant stars being expelled from the galactic nucleus. Finally, we do not find any strong connection between the remnant morphology and the binary hardening rate, which depends only on the inner density slope of the remnant galaxy. Our results suggest that MBH binaries are able to coalesce within a few Gyr, even if the binary is found to partially erase the merger-induced triaxiality from the remnant.
Bonetti, Matteo; Perego, Albino; Capelo, Pedro R.; Dotti, Massimo; Miller, M. Coleman
2018-05-01
Surface abundance observations of halo stars hint at the occurrence of r-process nucleosynthesis at low metallicity ([Fe/H] scale of the inner compact object binaries. Our results are highly sensitive to the assumed initial distribution of the inner binary semi-major axes. Distributions with mostly wide compact object binaries are most affected by the third object, resulting in a strong increase (by more than a factor of 2) in the fraction of fast coalescences. If instead the distribution preferentially populates very close compact binaries, general relativistic precession prevents the third body from increasing the inner binary eccentricity to very high values. In this last case, the fraction of coalescing binaries is increased much less by tertiaries, but the fraction of binaries that would coalesce within 108 yr even without a third object is already high. Our results provide additional support to the compact-binary merger scenario for r-process nucleosynthesis.
Evolution of highly compact binary stellar systems in globular clusters
International Nuclear Information System (INIS)
Krolik, J.H.; Meiksin, A.; Joss, P.C.
1984-01-01
We have calculated the secular evolution of a highly compact binary stellar system, composed of a collapsed object and a low-mass secondary star, in the core of a globular cluster. The binary evolves under the combined influences of (i) gravitational radiation losses from the system, (ii) the evolution of the secondary star, (iii) the resultant gradual mass transfer, if any, from the secondary to the collapsed object, and (iv) occasional encounters with passing field stars. We calculate all these effects in detail, utilizing some simplifying approximations appropriate to low-mass secondaries. The times of encounters with field stars, and the initial parameter specifying those encounters, were chosen by use of a Monte Carlo technique; the subsequent gravitational interactions were calculated utilzing a three-body integrator, and the changes in the binary orbital parmeters were thereby determined. We carried out a total of 20 such evolutionary calculations for each of two cluster core densities (1 and 3 x 10 3 stars pc -3 ). Each calculation was continued until the binary was disrupted or until 2 x 10 10 yr had elapsed
On central ideals of finitely generated binary (-1,1)-algebras
International Nuclear Information System (INIS)
Pchelintsev, S V
2002-01-01
In 1975 the author proved that the centre of a free finitely generated (-1,1)-algebra contains a non-zero ideal of the whole algebra. Filippov proved that in a free alternative algebra of rank ≥4 there exists a trivial ideal contained in the associative centre. Il'tyakov established that the associative nucleus of a free alternative algebra of rank 3 coincides with the ideal of identities of the Cayley-Dickson algebra. In the present paper the above-mentioned theorem of the author is extended to free finitely generated binary (-1,1)-algebras. Theorem. The centre of a free finitely generated binary (-1,1)-algebra of rank ≥3 over a field of characteristic distinct from 2 and 3 contains a non-zero ideal of the whole algebra. As a by-product, we shall prove that the T-ideal generated by the function (z,x,(x,x,y)) in a free binary (-1,1)-algebra of finite rank is soluble. We deduce from this that the basis rank of the variety of binary (-1,1)-algebras is infinite
ENHANCED TIDAL DISRUPTION RATES FROM MASSIVE BLACK HOLE BINARIES
International Nuclear Information System (INIS)
Chen Xian; Liu, F. K.; Madau, Piero; Sesana, Alberto
2009-01-01
'Hard' massive black hole (MBH) binaries embedded in steep stellar cusps can shrink via three-body slingshot interactions. We show that this process will inevitably be accompanied by a burst of stellar tidal disruptions, at a rate that can be several orders of magnitude larger than that appropriate for a single MBH. Our numerical scattering experiments reveal that (1) a significant fraction of stars initially bound to the primary hole are scattered into its tidal disruption loss cone by gravitational interactions with the secondary hole, an enhancement effect that is more pronounced for very unequal mass binaries; (2) about 25% (40%) of all strongly interacting stars are tidally disrupted by an MBH binary of mass ratio q = 1/81 (q = 1/243) and eccentricity 0.1; and (3) two mechanisms dominate the fueling of the tidal disruption loss cone, a Kozai nonresonant interaction that causes the secular evolution of the stellar angular momentum in the field of the binary, and the effect of close encounters with the secondary hole that change the stellar orbital parameters in a chaotic way. For a hard MBH binary of 10 7 M sun and mass ratio 10 -2 , embedded in an isothermal stellar cusp of velocity dispersion σ * = 100 km s -1 , the tidal disruption rate can be as large as N-dot * ∼1 yr -1 . This is 4 orders of magnitude higher than estimated for a single MBH fed by two-body relaxation. When applied to the case of a putative intermediate-mass black hole inspiraling onto Sgr A*, our results predict tidal disruption rates N-dot * ∼0.05-0.1 yr -1 .
Observations and light curve solutions of four ultrashort-period binaries
Directory of Open Access Journals (Sweden)
Kjurkchieva D.
2016-01-01
Full Text Available The paper presents light curve solutions of our observations of four new ultrashort-period eclipsing binaries with MS components. Two of them have periods almost at the upper limit (0.22 days of the ultrashort-period binaries, while the periods of around 0.18 days of CSS J171508.5+350658 and CSS J214633.8+120016 are amongst the shortest known orbital periods. CSS J171410.0+ 445850, CSS J214633.8+120016 and CSS J224326.0+154532 are over contact binaries with fill out factors around 0.25 while CSS J171508.5+350658 is a semidetached system. The two targets with shortest periods consist of M dwarfs.
Single and simultaneous binary mergers in Wright-Fisher genealogies.
Melfi, Andrew; Viswanath, Divakar
2018-05-01
The Kingman coalescent is a commonly used model in genetics, which is often justified with reference to the Wright-Fisher (WF) model. Current proofs of convergence of WF and other models to the Kingman coalescent assume a constant sample size. However, sample sizes have become quite large in human genetics. Therefore, we develop a convergence theory that allows the sample size to increase with population size. If the haploid population size is N and the sample size is N 1∕3-ϵ , ϵ>0, we prove that Wright-Fisher genealogies involve at most a single binary merger in each generation with probability converging to 1 in the limit of large N. Single binary merger or no merger in each generation of the genealogy implies that the Kingman partition distribution is obtained exactly. If the sample size is N 1∕2-ϵ , Wright-Fisher genealogies may involve simultaneous binary mergers in a single generation but do not involve triple mergers in the large N limit. The asymptotic theory is verified using numerical calculations. Variable population sizes are handled algorithmically. It is found that even distant bottlenecks can increase the probability of triple mergers as well as simultaneous binary mergers in WF genealogies. Copyright © 2018 Elsevier Inc. All rights reserved.