The evolution of the disc variability along the hard state of the black hole transient GX 339-4

Science.gov (United States)

De Marco, B.; Ponti, G.; Muñoz-Darias, T.; Nandra, K.

2015-12-01

We report on the analysis of hard-state power spectral density function (PSD) of GX 339-4 down to the soft X-ray band, where the disc significantly contributes to the total emission. At any luminosity probed, the disc in the hard state is intrinsically more variable than in the soft state. However, the fast decrease of disc variability as a function of luminosity, combined with the increase of disc intensity, causes a net drop of fractional variability at high luminosities and low energies, which reminds the well-known behaviour of disc-dominated energy bands in the soft state. The peak frequency of the high-frequency Lorentzian (likely corresponding to the high-frequency break seen in active galactic nuclei, AGN) scales with luminosity, but we do not find evidence for a linear scaling. In addition, we observe that this characteristic frequency is energy dependent. We find that the normalization of the PSD at the peak of the high-frequency Lorentzian decreases with luminosity at all energies, though in the soft band this trend is steeper. Together with the frequency shift, this yields quasi-constant high-frequency (5-20 Hz) fractional rms at high energies, with less than 10 per cent scatter. This reinforces previous claims suggesting that the high-frequency PSD solely scales with black hole mass. On the other hand, this constancy breaks down in the soft band (where the scatter increases to ˜30 per cent). This is a consequence of the additional contribution from the disc component, and resembles the behaviour of optical variability in AGN.

No time for dead time: timing analysis of bright black hole binaries with NuSTAR

DEFF Research Database (Denmark)

Bachetti, Matteo; Harrison, Fiona A.; Cook, Rick

2015-01-01

Timing of high-count-rate sources with the NuSTAR Small Explorer Mission requires specialized analysis techniques. NuSTAR was primarily designed for spectroscopic observations of sources with relatively low count rates rather than for timing analysis of bright objects. The instrumental dead time ...... techniques. We apply this technique to NuSTAR observations of the black hole binaries GX 339-4, Cyg X-1, and GRS 1915+105....

Discovery of the near-infrared counterpart to the luminous neutron-star low-mass X-ray binary GX 3+1

Energy Technology Data Exchange (ETDEWEB)

Van den Berg, Maureen; Fridriksson, Joel K. [Anton Pannekoek Institute for Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Homan, Jeroen [Massachusetts Institute of Technology, Kavli Institute for Astrophysics and Space Research, 70 Vassar Street, Cambridge, MA 02139 (United States); Linares, Manuel, E-mail: M.C.vandenBerg@uva.nl [Instituto de Astrofísica de Canarias (IAC), Vía Láctea s/n, La Laguna, E-38205, S/C de Tenerife (Spain)

2014-10-01

Using the High Resolution Camera on board the Chandra X-ray Observatory, we have measured an accurate position for the bright persistent neutron star X-ray binary and atoll source GX 3+1. At a location that is consistent with this new position, we have discovered the near-infrared (NIR) counterpart to GX 3+1 in images taken with the PANIC and FourStar cameras on the Magellan Baade Telescope. The identification of this K{sub s} = 15.8 ± 0.1 mag star as the counterpart is based on the presence of a Br γ emission line in an NIR spectrum taken with the Folded-port InfraRed Echelette spectrograph on the Baade Telescope. The absolute magnitude derived from the best available distance estimate to GX 3+1 indicates that the mass donor in the system is not a late-type giant. We find that the NIR light in GX 3+1 is likely dominated by the contribution from a heated outer accretion disk. This is similar to what has been found for the NIR flux from the brighter class of Z sources, but unlike the behavior of atolls fainter (L{sub X} ≈ 10{sup 36}-10{sup 37} erg s{sup –1}) than GX 3+1, where optically thin synchrotron emission from a jet probably dominates the NIR flux.

The Evolution of the Phase Lags Associated with the Type-C Quasi-periodic Oscillation in GX 339–4 during the 2006/2007 Outburst

Energy Technology Data Exchange (ETDEWEB)

Zhang, Liang; Chen, Li [Department of Astronomy, Beijing Normal University, Beijing 100875 (China); Wang, Yanan; Méndez, Mariano [Kapteyn Astronomical Institute, University of Groningen, P.O. Box 800, NL-9700 AV Groningen (Netherlands); Qu, Jinlu [Key Laboratory for Particle Astrophysics, Institute of High Energy Physics, CAS, Beijing 100049 (China); Altamirano, Diego [Department of Physics and Astronomy, University of Southampton, Southampton, Hampshire SO17 1BJ (United Kingdom); Belloni, Tomaso, E-mail: 201431160006@mail.bnu.edu.cn [INAF-Osservatorio Astronomico di Brera, via E. Bianchi 46, I-23807 Merate (Italy)

2017-08-20

We present the evolution of the phase lags associated with the type-C QPO in GX 339–4 during the rising phase of the 2006/2007 outburst. We find that the phase lags at the QPO frequency are always positive (hard) and show very different behavior between QPOs with frequencies below and above ∼1.7 Hz: when the QPO frequency is below ∼1.7 Hz, the phase lags increase both with QPO frequency and energy, while when the QPO frequency is above ∼1.7 Hz, the phase lags remain more or less constant. When the QPO frequency is higher than ∼1.7 Hz, a broad feature is always present in the lag–energy spectra at around 6.5 keV, suggesting that the reflection component may have a significant contribution to the phase lags. Below ∼1.7 Hz, the QPO rms first decreases with energy and then turns to almost flat, while above ∼1.7 Hz, the QPO rms increases with energy. During the transition from the low-hard state to the hard-intermediate state, the second harmonic and subharmonic of this QPO appear in the power density spectra. The second-harmonic and subharmonic phase lags show very similar evolutions for their centroid frequencies. However, the energy dependence of the second-harmonic and subharmonic phase lags are quite different. Our results suggest that, at different phases of the outburst, different mechanisms may be responsible for the phase lags of the QPO. We briefly discuss the possible scenarios for producing the lags.

Many faces of compact objects: distance, optical extinction and multi-wavelength behaviour

International Nuclear Information System (INIS)

Corbel, Stephane

1999-01-01

This thesis is devoted to a multi-wavelength study of accretion-ejection phenomena around compact stars (black holes and neutron stars). The first part of this manuscript describes problems related to the determination of the distance and the optical extinction to compact objects - fundamental parameters for the evaluation of the energy budget of these systems. To this end, the structure and the dynamics of the Galaxy are studied by observations of the atomic and molecular gas along the line of sight to compact stars. This method leads to the first evaluation of the distance to two Soft Gamma Repeaters: SGR 1806-20 and SGR 1627-41. We then draw some conclusions on the nature of these sources of recurrent gamma-ray bursts. The above method is then applied to two X-ray binaries: Cir X-1 and GX 339-4. In the second part of this thesis, we present a multi-wavelength study of the Galactic black hole candidate GX 339-4. We first discuss the characteristics of the radio emission from GX 339-4. In 1998, GX 339-4 underwent a transition to a soft-high X-ray state and observations in three wavelength regimes (radio, soft and hard X-rays) revealed new patterns of behaviour. This allowed us to constrain the region of origin of the radio emission (a compact jet) in GX 339-4 and allowed a better understanding of the physical coupling between accretion and ejection in GX 339-4. An analogy with the black hole candidate Cyg X-1 is then presented. Finally, these results are discussed in the context of micro-quasars and active galactic nuclei in order to gain a deeper insight into the accretion-ejection coupling around compact objects. (author) [fr

TRACING THE REVERBERATION LAG IN THE HARD STATE OF BLACK HOLE X-RAY BINARIES

International Nuclear Information System (INIS)

De Marco, B.; Ponti, G.; Nandra, K.; Muñoz-Darias, T.

2015-01-01

We report results obtained from a systematic analysis of X-ray lags in a sample of black hole X-ray binaries, with the aim of assessing the presence of reverberation lags and studying their evolution during outburst. We used XMM-Newton and simultaneous Rossi X-ray Timing Explorer (RXTE) observations to obtain broadband energy coverage of both the disk and the hard X-ray Comptonization components. In most cases the detection of reverberation lags is hampered by low levels of variability-power signal-to-noise ratio (typically when the source is in a soft state) and/or short exposure times. The most detailed study was possible for GX 339-4 in the hard state, which allowed us to characterize the evolution of X-ray lags as a function of luminosity in a single source. Over all the sampled frequencies (∼0.05–9 Hz), we observe the hard lags intrinsic to the power-law component, already well known from previous RXTE studies. The XMM-Newton soft X-ray response allows us to detail the disk variability. At low frequencies (long timescales) the disk component always leads the power-law component. On the other hand, a soft reverberation lag (ascribable to thermal reprocessing) is always detected at high frequencies (short timescales). The intrinsic amplitude of the reverberation lag decreases as the source luminosity and the disk fraction increase. This suggests that the distance between the X-ray source and the region of the optically thick disk where reprocessing occurs gradually decreases as GX 339-4 rises in luminosity through the hard state, possibly as a consequence of reduced disk truncation

Resolving the hard X-ray emission of GX 5-1 with INTEGRAL

DEFF Research Database (Denmark)

Paizis, A.; Ebisawa, K.; Tikkanen, T.

2005-01-01

We present the study of one year of INTEGRAL data on the neutron star low mass X-ray binary GX 5-1. Thanks to the excellent angular resolution and sensitivity of INTEGRAL, we are able to obtain a high quality spectrum of GX 5-1 from similar to 5keV to similar to 100 keV, for the first time without...... contamination from the nearby black hole candidate GRS 1758-258 above 20 keV. During our observations, GX 5-1 was mostly found in the horizontal and normal branch of its hardness intensity diagram. A clear hard X-ray emission is observed above similar to 30 keV which exceeds the exponential cut-off spectrum...... expected from lower energies. This spectral flattening may have the same origin of the hard components observed in other Z sources as it shares the property of being characteristic to the horizontal branch. The hard excess is explained by introducing Compton up-scattering of soft photons from the neutron...

SPITZER OBSERVATIONS OF GX17+2: CONFIRMATION OF A PERIODIC SYNCHROTRON SOURCE

International Nuclear Information System (INIS)

Harrison, Thomas E.; McNamara, Bernard J.; Bornak, Jillian; Gelino, Dawn M.; Wachter, Stefanie; Rupen, Michael P.; Gelino, Christopher R.

2011-01-01

GX17+2 is a low-mass X-ray binary (LMXB) that is also a member of a small family of LMXBs known as 'Z-sources' that are believed to have persistent X-ray luminosities that are very close to the Eddington limit. GX17+2 is highly variable at both radio and X-ray frequencies, a feature common to Z-sources. What sets GX17+2 apart is its dramatic variability in the near-infrared, where it changes by ΔK ∼ 3 mag. Previous investigations have shown that these brightenings are periodic, recurring every 3.01 days. Given its high extinction (A V ≥ 9 mag), it has not been possible to ascertain the nature of these events with ground-based observations. We report mid-infrared Spitzer observations of GX17+2 which indicate a synchrotron spectrum for the infrared brightenings. In addition, GX17+2 is highly variable in the mid-infrared during these events. The combination of the large-scale outbursts, the presence of a synchrotron spectrum, and the dramatic variability in the mid-infrared suggest that the infrared brightening events are due to the periodic transit of a synchrotron jet across our line of sight. An analysis of both new, and archival, infrared observations has led us to revise the period for these events to 3.0367 days. We also present new Rossi X-Ray Timing Explorer (RXTE) data for GX17+2 obtained during two predicted infrared brightening events. Analysis of these new data, and data from the RXTE archive, indicates that there is no correlation between the X-ray behavior of this source and the observed infrared brightenings. We examine various scenarios that might produce periodic jet emission.

A connection between the X-ray spectral branches and the radio brightness in GX17+2

International Nuclear Information System (INIS)

Penninx, Wim; Lewin, W.H.G.; Paradijs, J. van; Klis, M. van der

1988-01-01

GX17 + 2(4U 1813 - 14) is a bright X-ray binary in which matter is accreting on to a neutron star from a nearby companion. X-ray bursts are sometimes observed, as well as quasiperiodic oscillations in the X-ray flux. The frequencies of the quasiperiodic oscillations depend on the spectral state of the source, which manifests itself as three distinct spectral 'branches' in an X-ray colour-colour diagram. GX17 + 2 is also a variable radio source; there is no believable optical counterpart. We report here on simultaneous X-ray and radio observations which showed a connection between the spectral branches and the radio brightness. The 6-cm and 20-cm flux density increased by factors of 30±5 and 40± 10, respectively, as the X-ray state changed from the so-called 'flaring branch' to the 'horizontal branch'. (author)

Spectrophotometry of the unusual optical candidate for 3U 1728-24 (=GX 2 + 5 = GX 1 + 4)

International Nuclear Information System (INIS)

Davidsen, A.; Malina, R.; Bowyer, S.

1976-01-01

The spectrum of the object suggested as a possible optical counterpart of GX 2 + 5 (Glass and Feast 1973) was investigated, using the image tube scanner attached to the 3-m telescope of Lick Observatory. An improved x-ray error box obtained with Copernicus (Mason 1974) strongly supports this proposed identification. It is found that the candidate displays all the characteristics of the symbiotic stars and the related recurrent novae. The spectrum reveals the presence of an M star together with a blue component and a large number of emission lines displaying a wide range of ionization. Among the emission lines identified or suspected are: H I, He I, O I, [O I], [O II], [O III], Na I, Fe II, [Fe VII], [Fe X], [A X], and [A XI]. There is evidence of variability of both the continuum and the line intensities. This object provides strong support for the often proposed association of some x-ray sources with nova-like systems. It is suggested that in GX 2 + 5 accretion on a compact companion of an M giant produces x-rays and ultraviolet radiation which ionizes a circumstellar nebula, perhaps ejected in a previous nova-like outburst

Physiological responses of astronaut candidates to simulated +Gx orbital emergency re-entry.

Science.gov (United States)

Wu, Bin; Xue, Yueying; Wu, Ping; Gu, Zhiming; Wang, Yue; Jing, Xiaolu

2012-08-01

We investigated astronaut candidates' physiological and pathological responses to +Gx exposure during simulated emergency return from a running orbit to advance astronaut +Gx tolerance training and medical support in manned spaceflight. There were 13 male astronaut candidates who were exposed to a simulated high +Gx acceleration profile in a spacecraft during an emergency return lasting for 230 s. The peak value was 8.5 G. Subjective feelings and symptoms, cardiovascular and respiratory responses, and changes in urine component before, during, and after +Gx exposure were investigated. Under high +Gx exposure, 15.4% of subjects exhibited arrhythmia. Heart rate (HR) increased significantly and four different types of HR response curves were distinguished. The ratio of QT to RR interval on the electrocardiograms was significantly increased. Arterial oxygen saturation (SaO2) declined with increasing G value and then returned gradually. SaO2 reached a minimum (87.7%) at 3 G during the decline phase of the +Gx curve. Respiratory rate increased significantly with increasing G value, while the amplitude and area of the respiratory waves were significantly reduced. The overshoot appeared immediately after +Gx exposure. A few subjects suffered from slight injuries, including positive urine protein (1/13), positive urinary occult blood (1/13), and a large area of petechiae on the back (1/13). Astronaut candidates have relatively good tolerance to the +Gx profile during a simulation of spacecraft emergent ballistic re-entry. However, a few subjects exhibited adverse physiological responses and slight reversible pathological injuries.

A curious case of the accretion-powered X-ray pulsar GX 1+4

Science.gov (United States)

Jaisawal, Gaurava K.; Naik, Sachindra; Gupta, Shivangi; Chenevez, Jérôme; Epili, Prahlad

2018-04-01

We present detailed spectral and timing studies using a NuSTAR observation of GX 1+4 in October 2015 during an intermediate intensity state. The measured spin period of 176.778 s is found to be one of the highest values since its discovery. In contrast to a broad sinusoidal-like pulse profile, a peculiar sharp peak is observed in profiles below ˜25 keV. The profiles at higher energies are found to be significantly phase-shifted compared to the soft X-ray profiles. Broadband energy spectra of GX 1+4, obtained from NuSTAR and Swift observations, are described with various continuum models. Among these, a two component model consisting of a bremsstrahlung and a blackbody component is found to best-fit the phase-averaged and phase-resolved spectra. Physical models are also used to investigate the emission mechanism in the pulsar, which allows us to estimate the magnetic field strength to be in ˜(5-10)× 1012 G range. Phase-resolved spectroscopy of NuSTAR observation shows a strong blackbody emission component in a narrow pulse phase range. This component is interpreted as the origin of the peculiar peak in the pulse profiles below ≤25 keV. The size of emitting region is calculated to be ˜400 m. The bremsstrahlung component is found to dominate in hard X-rays and explains the nature of simple profiles at high energies.

Overview of GX launch services by GALEX

Science.gov (United States)

Sato, Koji; Kondou, Yoshirou

2006-07-01

Galaxy Express Corporation (GALEX) is a launch service company in Japan to develop a medium size rocket, GX rocket and to provide commercial launch services for medium/small low Earth orbit (LEO) and Sun synchronous orbit (SSO) payloads with a future potential for small geo-stationary transfer orbit (GTO). It is GALEX's view that small/medium LEO/SSO payloads compose of medium scaled but stable launch market due to the nature of the missions. GX rocket is a two-stage rocket of well flight proven liquid oxygen (LOX)/kerosene booster and LOX/liquid natural gas (LNG) upper stage. This LOX/LNG propulsion under development by Japan's Aerospace Exploration Agency (JAXA), is robust with comparable performance as other propulsions and have future potential for wider application such as exploration programs. GX rocket is being developed through a joint work between the industries and GX rocket is applying a business oriented approach in order to realize competitive launch services for which well flight proven hardware and necessary new technology are to be introduced as much as possible. It is GALEX's goal to offer “Easy Access to Space”, a highly reliable and user-friendly launch services with a competitive price. GX commercial launch will start in Japanese fiscal year (JFY) 2007 2008.

Tracing the Jet Contribution to the Mid-IR over the 2005 Outburst of GRO J1655-40 via Broadband Spectral Modeling

Science.gov (United States)

Migliari, S.; Tomsick, J. A.; Markoff, S.; Kalemci, E.; Bailyn, C. D.; Buxton, M.; Corbel, S; Fender, R. P.; Kaaret, P.

2007-01-01

We present new results from a multi-wavelength (radio/infrared/optical/X-ray) study of the black hole Xray binary GRO 51655-40 during its 2005 outburst. We detected, for the first time, mid-infrared emission at 24 micron from the compact jet of a black hole X-ray binary during its hard state, when the source shows emission from a radio compact jet, as well as a strong non-thermal hard X-ray component. These detections strongly constrain the optically thick part of the synchrotron spectrum of the compact jet, which is consistent with it being flat over 4 orders of magnitude in frequency. Moreover, using this unprecedented coverage, and especially thanks to the new Spitzer observations, we can test broadband disk and jet models during the hard state. Two of the hard-state broadband spectra are reasonably well fitted using a jet model with parameters that overall are similar to those previously found for Cyg X-1 and GX 339-4. Differences are also present; most notably, the jet power in GRO J1655-40 appears to be a factor of at least approximately 3-5 higher (depending on the distance) than those of Cyg X-1 and GX-339-4 at comparable disk luminosities. Furthermore, a few discrepancies between the model and the data, previously not found for the other two black hole systems for which there was no mid-IR/IR and optical coverage, are evident, and will help to constrain and refine theoretical models.

Validation of the 172 group ENDFB7GX library

International Nuclear Information System (INIS)

Khan, Suhail Ahmad; Raj, Devesh; Karthikeyan, R.; Jagannathan, V.

2007-01-01

Full text: Five 172 group libraries, viz., IAEAGX, ENDFB6GX, JENDL3GX, JEFF31GX, and LWRPSGX were obtained as a part of the IAEA WIMS Library Update Project (WLUP). The first four libraries have data available for 173 nuclides up to 244 Cm. The LWRPSGX library based on JEFF3.1 point dataset is an extended library up to 252 Cf. Data for 12 more actinides and the related burnup chain were added. The five libraries were validated against known experiments in an earlier work. In general the LWRPSGX was found to be giving better results. Recently another version of 172 group library 'ENDFB7GX' has been released. In the present work we provide the results of validation of the ENDFB7GX library against the same set of experimental data and a comparison with results of other libraries. The experimental configuration data include a variety of uniform lattices with enriched UO 2 , U- metal, mixed oxide (UO 2 -PuO 2 ) fuels with H 2 O and D 2 O moderators for a wide range of enrichment, fuel diameter and ratio of moderator to fuel volume (V m /V f ). The calculations have been done using the code LATTEST which solves the single pin lattice cell problem by 1-D multi-group transport theory after cylindricalising the square or hexagonal cell boundary. The LATTEST code is an improved version of the MURLI code and is capable of providing a ready testing of any new cross section library against a set of experimental benchmark lattices collected from various sources. The calculated k eff values and certain spectral indices, where available, have been compared for all the libraries for more than hundred critical lattices. There is a general under prediction of k eff values by all libraries. The maximum under prediction is for ENDFB6GX library and the least is for JENDL3GX library. The ENDFB7GX library, in general, is found to over predict in comparison to the k eff values obtained using LWRPSGX library. While scrutinizing the basic nuclear data it was noted that the slowing down cross

12 CFR 339.8 - Determination fees.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Determination fees. 339.8 Section 339.8 Banks... IN AREAS HAVING SPECIAL FLOOD HAZARDS § 339.8 Determination fees. (a) General. Notwithstanding any... hazard area. A determination fee may also include, but is not limited to, a fee for life-of-loan...

Relativistic jets from accreting black holes

International Nuclear Information System (INIS)

Coriat, Mickael

2010-01-01

Matter ejection processes, more commonly called jets, are among the most ubiquitous phenomena of the universe at ail scales of size and energy and are inseparable from accretion process. This intimate link, still poorly understood, is the main focus of this thesis. Through multi-wavelength observations of X-ray binary Systems hosting a black hole, I will try to bring new constraints on the physics of relativistic jets and the accretion - ejection coupling. We strive first to compare the simultaneous infrared, optical and X-ray emissions of the binary GX 339-4 over a period of five years. We study the nature of the central accretion flow, one of the least understood emission components of X-ray binaries, both in its geometry and in term of the physical processes that take place. This component is fundamental since it is could be the jets launching area or be highly connected to it. Then we focus on the infrared emission of the jets to investigate the physical conditions close to the jets base. We finally study the influence of irradiation of the outer accretion disc by the central X-ray source. Then, we present the results of a long-term radio and X-ray study of the micro-quasar H1743- 322. This System belongs to a population of accreting black holes that display, for a given X-ray luminosity, a radio emission fainter than expected. We make several assumptions about the physical origin of this phenomenon and show in particular that these sources could have a radiatively efficient central accretion flow. We finally explore the phases of return to the hard state of GX 339-4. We follow the re-emergence of the compact jets emission and try to bring new constraints on the physics of jet formation. (author) [fr

Repetitive patterns in rapid optical variations in the nearby black-hole binary V404 Cygni.

Science.gov (United States)

Kimura, Mariko; Isogai, Keisuke; Kato, Taichi; Ueda, Yoshihiro; Nakahira, Satoshi; Shidatsu, Megumi; Enoto, Teruaki; Hori, Takafumi; Nogami, Daisaku; Littlefield, Colin; Ishioka, Ryoko; Chen, Ying-Tung; King, Sun-Kun; Wen, Chih-Yi; Wang, Shiang-Yu; Lehner, Matthew J; Schwamb, Megan E; Wang, Jen-Hung; Zhang, Zhi-Wei; Alcock, Charles; Axelrod, Tim; Bianco, Federica B; Byun, Yong-Ik; Chen, Wen-Ping; Cook, Kem H; Kim, Dae-Won; Lee, Typhoon; Marshall, Stuart L; Pavlenko, Elena P; Antonyuk, Oksana I; Antonyuk, Kirill A; Pit, Nikolai V; Sosnovskij, Aleksei A; Babina, Julia V; Baklanov, Aleksei V; Pozanenko, Alexei S; Mazaeva, Elena D; Schmalz, Sergei E; Reva, Inna V; Belan, Sergei P; Inasaridze, Raguli Ya; Tungalag, Namkhai; Volnova, Alina A; Molotov, Igor E; de Miguel, Enrique; Kasai, Kiyoshi; Stein, William L; Dubovsky, Pavol A; Kiyota, Seiichiro; Miller, Ian; Richmond, Michael; Goff, William; Andreev, Maksim V; Takahashi, Hiromitsu; Kojiguchi, Naoto; Sugiura, Yuki; Takeda, Nao; Yamada, Eiji; Matsumoto, Katsura; James, Nick; Pickard, Roger D; Tordai, Tamás; Maeda, Yutaka; Ruiz, Javier; Miyashita, Atsushi; Cook, Lewis M; Imada, Akira; Uemura, Makoto

2016-01-07

How black holes accrete surrounding matter is a fundamental yet unsolved question in astrophysics. It is generally believed that matter is absorbed into black holes via accretion disks, the state of which depends primarily on the mass-accretion rate. When this rate approaches the critical rate (the Eddington limit), thermal instability is supposed to occur in the inner disk, causing repetitive patterns of large-amplitude X-ray variability (oscillations) on timescales of minutes to hours. In fact, such oscillations have been observed only in sources with a high mass-accretion rate, such as GRS 1915+105 (refs 2, 3). These large-amplitude, relatively slow timescale, phenomena are thought to have physical origins distinct from those of X-ray or optical variations with small amplitudes and fast timescales (less than about 10 seconds) often observed in other black-hole binaries-for example, XTE J1118+480 (ref. 4) and GX 339-4 (ref. 5). Here we report an extensive multi-colour optical photometric data set of V404 Cygni, an X-ray transient source containing a black hole of nine solar masses (and a companion star) at a distance of 2.4 kiloparsecs (ref. 8). Our data show that optical oscillations on timescales of 100 seconds to 2.5 hours can occur at mass-accretion rates more than ten times lower than previously thought. This suggests that the accretion rate is not the critical parameter for inducing inner-disk instabilities. Instead, we propose that a long orbital period is a key condition for these large-amplitude oscillations, because the outer part of the large disk in binaries with long orbital periods will have surface densities too low to maintain sustained mass accretion to the inner part of the disk. The lack of sustained accretion--not the actual rate--would then be the critical factor causing large-amplitude oscillations in long-period systems.

Thermal behaviour of pure and binary Fe(NO3)3.9H2O and (NH4)6Mo7O24.4H2O systems

International Nuclear Information System (INIS)

Shaheen, W.M.

2007-01-01

Thermal behaviour of pure ferric nitrate, ammonium molybdate and their mixtures in different ratios were investigated by means of thermal analysis (TG, DTG and DTA) techniques. Relative thermal analysis (RTA) graphical treatment of derivatographic curves of the components in the pure and binary system has been carried out as well. A series of Fe 2 O 3 -MoO 3 systems were prepared from pure and binary salts by heating at 350, 550, 750 and 1000 deg. C. The X-ray diffraction (XRD) analysis was used to characterize the phases produced from thermal treatment of investigated solids. The results revealed that pure ferric nitrate decomposed to Fe 2 O 3 at 250, while pure ammonium molybdate decomposed into MoO 3 and 340 deg. C and then melted at 790 deg. C. For the binary components, crystalline ferric or molybdenum oxides were detected beside ferric molybdate Fe 2 (MoO 4 ) 3 phase starting from 350 deg. C. Fe 2 (MoO 4 ) 3 phase was formed as a result of solid-solid interactions between the produced oxides. The thermal stability of the formed compound was significantly affected by the composition of the mixture and treatment temperature. The presence of two-component solids in the binary systems affected the thermal decomposition of their individual salt and affected their physical and chemical behaviour. The catalytic activity of the obtained pure and mixed oxides was measured using the decomposition of hydrogen peroxide reaction as a model reaction at 20-50 deg. C. It was found that the mixed oxide solids had catalytic activity higher than single oxides thermally treated at 350 and 550 deg. C. This is attributed to the increase in the concentration of active sites via creation of new ion pairs in case of binary systems. The rise in calcination temperature up to 750 and 1000 deg. C brought about drastic decrease in the activity of all solids because of changing catalyst composition and/or sintering process. The activation energies of H 2 O 2 decomposition were determined

The variable cyclotron line of GX 301-2

Energy Technology Data Exchange (ETDEWEB)

Kreykenbohm, I.; Wilms, J.; Coburn, W.; Kuster, M.; Rothschild, R.E.; Heindl, W.A.; Kretschmar, P.; Staubert, R

2004-06-01

We present a 200 ksec observation of the High Mass X-ray Binary GX 301-2 taken in 2000 November with the Rossi X-ray Timing Explorer during the pre-periastron flare and the actual periastron passage of the neutron star. To model the spectrum we use a power law with the Fermi Dirac cutoff and a cyclotron line at higher energies plus either a reflection component or a heavily absorbed partial covering component. Although completely different, both models describe the data equally well. Phase resolved spectra show that the energy and the depth of the cyclotron resonant scattering feature vary strongly with pulse phase: It is deepest in the fall of the main pulse, the rise of the secondary pulse, and the pulse minimum in-between with {tau}{sub C}{approx}0.3. In the other phase bins the line is much less deep with {tau}{sub C}{approx}0.1. The energy of the line correlates strongly with its depth and varies by 25 % from 30.1 keV in the fall of the secondary pulse to 37.9 keV in the fall of the main pulse.

Black-hole Binaries: Life Begins at 40 keV

Science.gov (United States)

Belloni, Tomaso M.; Motta, Sara

2009-05-01

In the study of black-hole transients, an important problem that still needs to be answered is how the high-energy part of the spectrum evolves from the low-hard to the high-soft state, given that they have very different properties. Recent results obtained with RXTE and INTEGRAL have given inconsistent results. With RXTE, we have found that the high-energy cutoff in GX 339-4 during the transition first decreases (during the low-hard state), then increases again across the Hard-Intermediate state, to become unmeasurable in the soft states (possibly because of statistical limitations). We show Simbol-X will be able to determine the spectral shape with superb accuracy. As the high-energy part of the spectrum is relatively less known than the one below 20 keV, Simbol-X will provide important results that will help out understanding of the extreme physical conditions in the vicinity of a stellar-mass black hole.

Two-phase X-ray burst from GX 3+1 observed by INTEGRAL

DEFF Research Database (Denmark)

Chenevez, Jérôme; Falanga, M.F.; Brandt, Søren

2006-01-01

INTEGRAL detected on August 31, 2004, an unusual thermonuclear X-ray burst from the low-mass X-ray binary GX 3 3+1. Its duration was 30 min, which is between the normal burst durations for this source (less than or similar to 10 s) and the superburst observed in 1998 ( several hours). We see...... emission up to 30 keV energy during the first few seconds of the burst where the bolometric peak luminosity approaches the Eddington limit. This peculiar burst is characterized by two distinct phases: an initial short spike of similar to 6 s consistent with being similar to a normal type I X-ray burst...... in the present case); and 3) limited carbon burning at an unusually shallow depth triggered by unstable helium ignition. Though none of these provide a satisfactory description of this uncommon event, the former one seems the most probable....

12 CFR 339.10 - Notice of servicer's identity.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Notice of servicer's identity. 339.10 Section... POLICY LOANS IN AREAS HAVING SPECIAL FLOOD HAZARDS § 339.10 Notice of servicer's identity. (a) Notice... Director of FEMA (or the Director of FEMA's designee) in writing of the identity of the servicer of the...

7 CFR 58.339 - Containers.

Science.gov (United States)

2010-01-01

... 7 Agriculture 3 2010-01-01 2010-01-01 false Containers. 58.339 Section 58.339 Agriculture... Procedures § 58.339 Containers. (a) Containers used for the packaging of butter and related products shall be commercially acceptable containers or packaging material that will satisfactorily protect the quality of the...

40 CFR 81.339 - Pennsylvania.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Pennsylvania. 81.339 Section 81.339... AREAS FOR AIR QUALITY PLANNING PURPOSES Section 107 Attainment Status Designations § 81.339 Pennsylvania. Pennsylvania—TSP Designated area Does not meet primary standards Does not meet secondary standards Cannot be...

INTEGRAL observation of renewed activity from 4U 1608-522

DEFF Research Database (Denmark)

Ishibashi, W.; Ferrigno, C.; Sánchez-Fernández, C.

2010-01-01

On 3 March 2010 SuperAGILE detected an X-ray burst from the LMXB 4U 1608-522 (Atel #2461). Confirmation of the renewed activity of this transient source was reported by MAXI/GSC (Atel #2462). 4U1608-522 was in the IBIS/ISGRI and JEMX field of view during several observations between 2010-Feb-23 06......, the source was not detected by IBIS/ISGRI. We derive an upper limit (5-sigma) on the X-ray flux of 5-10 mCrab in the 20-40 keV band. INTEGRAL is currently observing the field of GX 339-4 (March 4th-6th) and will continue monitoring of the inner Galactic Disk until the end of March. 4U 1608...

Testing GxG interactions between coinfecting microbial parasite genotypes within hosts

Directory of Open Access Journals (Sweden)

Rebecca D Schulte

2014-05-01

Full Text Available Host-parasite interactions represent one of the strongest selection pressures in nature. They are often governed by genotype-specific (GxG interactions resulting in host genotypes that differ in resistance and parasite genotypes that differ in virulence depending on the antagonist’s genotype. Another type of GxG interactions, which is often neglected but which certainly influences host-parasite interactions, are those between coinfecting parasite genotypes. Mechanistically, within-host parasite interactions may range from competition for limited host resources to cooperation for more efficient host exploitation. The exact type of interaction, i.e. whether competitive or cooperative, is known to affect life-history traits such as virulence. However, the latter has been shown for chosen genotype combinations only, not considering whether the specific genotype combination per se may influence the interaction (i.e. GxG interactions. Here, we want to test for the presence of GxG interactions between coinfections of the bacterium Bacillus thuringiensis infecting the nematode Caenorhabditis elegans by combining two non-pathogenic and five pathogenic strains in all possible ways. Furthermore, we evaluate whether the type of interaction, reflected by the direction of virulence change of multiple compared to single infections, is genotype-specific. Generally, we found no indication for GxG interactions between non-pathogenic and pathogenic bacterial strains, indicating that virulence of pathogenic strains is equally affected by both non-pathogenic strains. Specific genotype combinations, however, differ in the strength of virulence change, indicating that the interaction type between coinfecting parasite strains and thus the virulence mechanism is specific for different genotype combinations. Such interactions are expected to influence host-parasite interactions and to have strong implications for coevolution.

Truncation of the Inner Accretion Disk Around a Black Hole at Low Luminosity

Science.gov (United States)

Tomsick, John A.; Yamoka, Kazutaka; Corbel, Stephane; Kaaret, Philip; Kalemci, Emrah; Migliari, Simone

2011-01-01

Most black hole binaries show large changes in X-ray luminosity caused primarily by variations in mass accretion rate. An important question for understanding black hole accretion and jet production is whether the inner edge of the accretion disk recedes at low accretion rate. Measurements of the location of the inner edge (R(sub in)) can be made using iron emission lines that arise due to fluorescence of iron in the disk, and these indicate that R(sub in) is very close to the black hole at high and moderate luminosities (greater than or equal to 1% of the Eddington luminosity, L(sub Edd). Here, we report on X-ray observations of the black hole GX 339-4 in the hard state by Suzaku and the Rossi X-ray Timing Explorer that extend iron line studies to 0.14% L(sub Edd) and show that R(sub in) increases by a factor of greater than 27 over the value found when GX 339-4 was bright. The exact value of R(sub in) depends on the inclination of the inner disk (i), and we derive 90% confidence limits of R(sub in) greater than 35 R(sub g) at i = 0 degrees and R(sub in) greater than 175 R(sub g) at i = 30 degrees. This provides direct evidence that the inner portion of the disk is not present at low luminosity, allowing for the possibility that the inner disk is replaced by advection- or magnetically dominated accretion flows.

Template-assisted hydrothermally synthesized iron-titanium binary oxides and their application as catalysts for ethyl acetate oxidation

Czech Academy of Sciences Publication Activity Database

Tsoncheva, T.; Ivanova, R.; Dimitrov, M.; Paneva, D.; Kovacheva, D.; Henych, Jiří; Vomáčka, Petr; Kormunda, M.; Velinov, N.; Mitov, I.; Štengl, Václav

2016-01-01

Roč. 528, NOV (2016), s. 24-35 ISSN 0926-860X R&D Projects: GA MŠk(CZ) LM2015073 Institutional support: RVO:61388980 Keywords : Effect of Fe/Ti ratio and temperature of hydrothermal treatment * Hydrothermal synthesis * Iron-titanium binary oxides Subject RIV: CA - Inorganic Chemistry Impact factor: 4.339, year: 2016

100y DASCH Search for historical outbursts of Black Hole Low Mass X-ray Binaries

Science.gov (United States)

Grindlay, Jonathan E.; Miller, George; Gomez, Sebastian

2018-01-01

Black Hole Low mass X-ray binaries (BH-LMXBs) are all transients, although several (e.g. GRS1915+109 and GX339-4) are quasi-persistent. All of the now 22 dynamically confirmed BH-LMXBs were discovered by their luminous outbursts, reaching Lx ~10^37 ergs/s, with outburst durations of typically ~1-3 months. These systems then (with few exceptions) return to a deep quiescent state, with Lx reduced by factors ~10^5-6 and hard X-ray spectra. The X-ray outbursts are accompanied by optical outbursts (if not absorbed by Galactic extinction) with ~6-9 magnitude increases and similar lightcurve shapes and durations as the X-ray (discovery) outburst. Prior to this work, only 3 BH-LMXBs have had historical (before the X-ray discovery) outbursts found in the archival data: A0620-00, the first BH-LMXB to be so identified, V404 Cyg (discoverd as "Nova Cyg" in 1938 and regarded as a classical nova), and V4641-Sgr which was given its variable star name when first noted in 1975. We report on the historical outbursts now discovered from the DASCH (Digital Access to a Sky Century @ Harvard) data from scanning and digitizing the now ~210,000 glass plates in the northern Galactic Hemisphere. This was one of the primary motivations for the DASCH project: to use the detection (or lack threof) of historic outbursts to measure or constrain the Duty Cycle of the accreting black holes in these systems. This, in turn, allows the total population of BH-LMXBs to be estimated and compared with that for the very similar systems containing neutron stars as the accretor (NS-LMXBs). Whereas the ratio of BHs/NSs from stellar evolution and IMFs is expected to be <<1, the DASCH results on half the sky point to an excess of BH-LMXBs. This must constrain the formation process for these systems, of importance for understanding both BH formation and compact binary evolution.

47 CFR 1.339 - Witness fees.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 1 2010-10-01 2010-10-01 false Witness fees. 1.339 Section 1.339....339 Witness fees. Witnesses who are subpenaed and respond thereto are entitled to the same fees, including mileage, as are paid for like service in the courts of the United States. Fees shall be paid by...

Effect of acute exposure to hypergravity (GX vs. GZ) on dynamic cerebral autoregulation

Science.gov (United States)

Serrador, J. M.; Wood, S. J.; Picot, P. A.; Stein, F.; Kassam, M. S.; Bondar, R. L.; Rupert, A. H.; Schlegel, T. T.

2001-01-01

We examined the effects of 30 min of exposure to either +3GX (front-to-back) or +GZ (head-to-foot) centrifugation on cerebrovascular responses to 80 degrees head-up tilt (HUT) in 14 healthy individuals. Both before and after +3 GX or +3 GZ centrifugation, eye-level blood pressure (BP(eye)), end tidal PCO2 (PET(CO2)), mean cerebral flow velocity (CFV) in the middle cerebral artery (transcranial Doppler ultrasound), cerebral vascular resistance (CVR), and dynamic cerebral autoregulatory gain (GAIN) were measured with subjects in the supine position and during subsequent 80 degrees HUT for 30 min. Mean BP(eye) decreased with HUT in both the GX (n = 7) and GZ (n = 7) groups (P centrifugation only in the GZ group (P centrifugation. CFV decreased during HUT more significantly after centrifugation than before centrifugation in both groups (P centrifugation compared with before centrifugation, GAIN increased in both groups (P centrifugation resulted in a leftward shift of the cerebral autoregulation curve. We speculate that this leftward shift may have been due to vestibular activation (especially during +GX) or potentially to an adaptation to reduced cerebral perfusion pressure during +GZ.

X-ray bursts from GX 17+2: a new approach

International Nuclear Information System (INIS)

Sztajno, M.; Langmeier, A.; Truemper, J.; Pietsch, W.; Paradijs, J. van; Lewin, W.H.G.; Massachusetts Inst. of Tech., Cambridge

1986-01-01

The detection of two X-ray bursts from GX 17+2 is reported; a short one (lasting about 10s), and a long one (which lasted about 5 min). These bursts reached a maximum intensity of only about 40 per cent above the persistent flux level. Like previous long bursts observed from GX 17+2 the long burst showed little softening during its decay, and it is difficult at first glance to classify it as either a type 1 or a type 2 burst. Following the recent results of two of the authors a time-dependent spectral analysis of these bursts has been made. (author)

A method to associate all possible combinations of genetic and environmental factors using GxE landscape plot.

Science.gov (United States)

Nagaie, Satoshi; Ogishima, Soichi; Nakaya, Jun; Tanaka, Hiroshi

2015-01-01

Genome-wide association studies (GWAS) and linkage analysis has identified many single nucleotide polymorphisms (SNPs) related to disease. There are many unknown SNPs whose minor allele frequencies (MAFs) as low as 0.005 having intermediate effects with odds ratio between 1.5~3.0. Low frequency variants having intermediate effects on disease pathogenesis are believed to have complex interactions with environmental factors called gene-environment interactions (GxE). Hence, we describe a model using 3D Manhattan plot called GxE landscape plot to visualize the association of p-values for gene-environment interactions (GxE). We used the Gene-Environment iNteraction Simulator 2 (GENS2) program to simulate interactions between two genetic loci and one environmental factor in this exercise. The dataset used for training contains disease status, gender, 20 environmental exposures and 100 genotypes for 170 subjects, and p-values were calculated by Cochran-Mantel-Haenszel chi-squared test on known data. Subsequently, we created a 3D GxE landscape plot of negative logarithm of the association of p-values for all the possible combinations of genetic and environmental factors with their hierarchical clustering. Thus, the GxE landscape plot is a valuable model to predict association of p-values for GxE and similarity among genotypes and environments in the context of disease pathogenesis. GxE - Gene-environment interactions, GWAS - Genome-wide association study, MAFs - Minor allele frequencies, SNPs - Single nucleotide polymorphisms, EWAS - Environment-wide association study, FDR - False discovery rate, JPT+CHB - HapMap population of Japanese in Tokyo, Japan - Han Chinese in Beijing.

Dicty_cDB: SSI339 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSI339 (Link to dictyBase) - - - Contig-U04467-1 SSI339Z (Link... to Original site) - - SSI339Z 563 - - - - Show SSI339 Library SS (Link to library) Clone ID SSI339 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04467-1 Original site URL http://dict...1998. 1.22 Translated Amino Acid sequence ---FTCSNNQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICT...NQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICTTSSGYSCETNQTNGVLKCISPDNSISCIGNQFY

7 CFR 1205.339 - Books and records.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and records. 1205.339 Section 1205.339... Cotton Research and Promotion Order Reports, Books, and Records § 1205.339 Books and records. Each... and make available for inspection by the Secretary such books and records as are necessary to carry...

5 CFR 339.303 - Examination procedures.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Examination procedures. 339.303 Section... QUALIFICATION DETERMINATIONS Medical Examinations § 339.303 Examination procedures. (a) When an agency orders or offers a medical examination under this subpart, it must inform the applicant or employee in writing of...

Changes of structure and properties of cast steels GX10NiCrNb32-20 and GX10NiCrNb3-25 after long-term tempering at 600-1000 C

International Nuclear Information System (INIS)

Gommans, R.; Schrijen, H.; Sundermann, J.; Steinkusch, W.; Hering, W.

2001-01-01

Low-alloy cast steels of type GX 10NiCrNb 32.20 are commonly used for the outlet section of reformer and cracker tubes for the temperature range of 600-1000 C. There was a lack of data on the ductility of the 25%Cr alloyed cast steel GX10NiCrNb 35.25 at room temperature after tempering, which was investigated in a joint project of Pose-Marre and DSM. Mechanical tests were carried out at room temperature and at elevated temperatures. Apart from light microscopy, also SEM/EDX, SAM and TEM analyses were carried out. The 25% alloy has lower ductility than the 20% alloy, owing primarily to the more pronounced development of M 6 C carbide from primary NbC carbide, which takes up Ni and Si during tempering. The microstructure and composition of the M 6 C carbide wre not fully clarified. Information is presented on the potential application of low-carbon materials of the type GX10NiCrNb35.25 [de

Analytical verification and quality assessment of the Tosoh HLC-723GX HbA1c analyzer

Directory of Open Access Journals (Sweden)

Marko Ris

2017-04-01

Full Text Available Objectives: Ion-exchange high-performance liquid chromatography (IE-HPLC has long been used as a reproducible and versatile analytical tool for HbA1c measurement.In this study, we performed analytical verification and quality assessment of the recently introduced small IE-HPLC Tosoh HLC-723GX HbA1c analyzer, and a comparison of results to immunoassay (IA and capillary electrophoresis (CE. Design and methods: The total imprecision of Tosoh HLC-723GX was verified according to CLSI EP15-A2 protocol using commercial control materials (C-QC and pooled human whole blood samples (HWB. The Sigma metric was used for the evaluation of quality targets. HbA1c results were compared to automated CE (MiniCap Flex Piercing, Sebia, France and IA (Tina-quant HbA1c Gen 2, Cobas Integra 400+, Roche Diagnostics, USA procedures. Results: The total imprecision of Tosoh HLC-723GX-HbA1c for IFCC(mmol/mol and NGSP(% units was: 1.91/1.25% (HbA1c=31 mmol/mol/5.0% and 0.51/0.63% (HbA1c=84 mmol/mol/9.8% for C-QC, and 0.39/0.2% (HbA1c=47 mmol/mol/6.5% and 0.77/0.46% (HbA1c=94 mmol/mol/10.8% in HWB samples, respectively. Bland-Altman analysis did not reveal any deviation of the results between Tosoh HLC-723GX and CE: mean difference 0.0% (95%CI: −0.02927 to 0.02653%, while the mean HbA1c difference against IA was −0.07% (95%CI: −0.1039 to −0.02765. At the selected HbA1c clinical decision level (48 mmol/mol/6,5%, six sigma analysis gave σ value of 3.91, within a desirable classification of performance. Conclusion: The analytical performance of the Tosoh HLC-723GX complies with the rigorous quality criteria for clinical use of HbA1c, with the results comparable to the CE procedure. Tosoh HLC-723GX provides a plausible analytical choice for reliable HbA1c measurement in low-volume laboratories. Keywords: HbA1c, Quality targets, Six sigma, Tosoh HLC-723GX analyzer

COMMON PATTERNS IN THE EVOLUTION BETWEEN THE LUMINOUS NEUTRON STAR LOW-MASS X-RAY BINARY SUBCLASSES

International Nuclear Information System (INIS)

Fridriksson, Joel K.; Homan, Jeroen; Remillard, Ronald A.

2015-01-01

The X-ray transient XTE J1701–462 was the first source observed to evolve through all known subclasses of low-magnetic-field neutron star low-mass X-ray binaries (NS-LMXBs), as a result of large changes in its mass accretion rate. To investigate to what extent similar evolution is seen in other NS-LMXBs we have performed a detailed study of the color–color and hardness–intensity diagrams (CDs and HIDs) of Cyg X-2, Cir X-1, and GX 13+1—three luminous X-ray binaries, containing weakly magnetized neutron stars, known to exhibit strong secular changes in their CD/HID tracks. Using the full set of Rossi X-ray Timing Explorer Proportional Counter Array data collected for the sources over the 16 year duration of the mission, we show that Cyg X-2 and Cir X-1 display CD/HID evolution with close similarities to XTE J1701–462. Although GX 13+1 shows behavior that is in some ways unique, it also exhibits similarities to XTE J1701–462, and we conclude that its overall CD/HID properties strongly indicate that it should be classified as a Z source, rather than as an atoll source. We conjecture that the secular evolution of Cyg X-2, Cir X-1, and GX 13+1—illustrated by sequences of CD/HID tracks we construct—arises from changes in the mass accretion rate. Our results strengthen previous suggestions that within single sources Cyg-like Z source behavior takes place at higher luminosities and mass accretion rates than Sco-like Z behavior, and lend support to the notion that the mass accretion rate is the primary physical parameter distinguishing the various NS-LMXB subclasses

COMMON PATTERNS IN THE EVOLUTION BETWEEN THE LUMINOUS NEUTRON STAR LOW-MASS X-RAY BINARY SUBCLASSES

Energy Technology Data Exchange (ETDEWEB)

Fridriksson, Joel K. [Anton Pannekoek Institute for Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Homan, Jeroen; Remillard, Ronald A., E-mail: J.K.Fridriksson@uva.nl [Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139 (United States)

2015-08-10

The X-ray transient XTE J1701–462 was the first source observed to evolve through all known subclasses of low-magnetic-field neutron star low-mass X-ray binaries (NS-LMXBs), as a result of large changes in its mass accretion rate. To investigate to what extent similar evolution is seen in other NS-LMXBs we have performed a detailed study of the color–color and hardness–intensity diagrams (CDs and HIDs) of Cyg X-2, Cir X-1, and GX 13+1—three luminous X-ray binaries, containing weakly magnetized neutron stars, known to exhibit strong secular changes in their CD/HID tracks. Using the full set of Rossi X-ray Timing Explorer Proportional Counter Array data collected for the sources over the 16 year duration of the mission, we show that Cyg X-2 and Cir X-1 display CD/HID evolution with close similarities to XTE J1701–462. Although GX 13+1 shows behavior that is in some ways unique, it also exhibits similarities to XTE J1701–462, and we conclude that its overall CD/HID properties strongly indicate that it should be classified as a Z source, rather than as an atoll source. We conjecture that the secular evolution of Cyg X-2, Cir X-1, and GX 13+1—illustrated by sequences of CD/HID tracks we construct—arises from changes in the mass accretion rate. Our results strengthen previous suggestions that within single sources Cyg-like Z source behavior takes place at higher luminosities and mass accretion rates than Sco-like Z behavior, and lend support to the notion that the mass accretion rate is the primary physical parameter distinguishing the various NS-LMXB subclasses.

9 CFR 3.39 - Care in transit.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Care in transit. 3.39 Section 3.39 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment, and Transportation of Guinea...

Rossi X-Ray Timing Explorer Observations of the First Transient Z Source XTE J1701-462: Shedding New Light on Mass Accretion in Luminous Neutron Star X-Ray Binaries

Science.gov (United States)

Homan, Jeroen; van der Klis, Michiel; Wijnands, Rudy; Belloni, Tomaso; Fender, Rob; Klein-Wolt, Marc; Casella, Piergiorgio; Méndez, Mariano; Gallo, Elena; Lewin, Walter H. G.; Gehrels, Neil

2007-02-01

We report on the first 10 weeks of RXTE observations of the X-ray transient XTE J1701-462 and conclude that it had all the characteristics of the neutron star Z sources, i.e., the brightest persistent neutron star low-mass X-ray binaries. These include the typical Z-shaped tracks traced out in X-ray color diagrams and the variability components detected in the power spectra, such as kHz QPOs and normal and horizontal branch oscillations. XTE J1701-462 is the first transient Z source and provides unique insights into mass accretion rate (m˙) and luminosity dependencies in neutron star X-ray binaries. As its overall luminosity decreased, we observed a switch between two types of Z source behavior, with the branches of the Z track changing their shape and/or orientation. We interpret this as an extreme case of the more moderate long-term changes seen in the persistent Z sources and suggest that they result from changes in m˙. We also suggest that the Cyg-like Z sources (Cyg X-2, GX 5-1, and GX 340+0) are substantially more luminous (>50%) than the Sco-like Z sources (Sco X-1, GX 17+2, and GX 349+2). Adopting a possible explanation for the behavior of kHz QPOs, which involves a prompt as well as a filtered response to changes in m˙, we further propose that changes in m˙ can explain both movement along the Z track and changes in the shape of the Z track. We discuss some consequences of this and consider the possibility that the branches of the Z will smoothly evolve into the branches observed in X-ray color diagrams of the less luminous atoll sources, although not in a way that was previously suggested.

Temperature-dependent thermal and thermoelectric properties of n -type and p -type S c1 -xM gxN

Science.gov (United States)

Saha, Bivas; Perez-Taborda, Jaime Andres; Bahk, Je-Hyeong; Koh, Yee Rui; Shakouri, Ali; Martin-Gonzalez, Marisol; Sands, Timothy D.

2018-02-01

Scandium Nitride (ScN) is an emerging rocksalt semiconductor with octahedral coordination and an indirect bandgap. ScN has attracted significant attention in recent years for its potential thermoelectric applications, as a component material in epitaxial metal/semiconductor superlattices, and as a substrate for defect-free GaN growth. Sputter-deposited ScN thin films are highly degenerate n -type semiconductors and exhibit a large thermoelectric power factor of ˜3.5 ×10-3W /m -K2 at 600-800 K. Since practical thermoelectric devices require both n- and p-type materials with high thermoelectric figures-of-merit, development and demonstration of highly efficient p-type ScN is extremely important. Recently, the authors have demonstrated p-type S c1 -xM gxN thin film alloys with low M gxNy mole-fractions within the ScN matrix. In this article, we demonstrate temperature dependent thermal and thermoelectric transport properties, including large thermoelectric power factors in both n- and p-type S c1 -xM gxN thin film alloys at high temperatures (up to 850 K). Employing a combination of temperature-dependent Seebeck coefficient, electrical conductivity, and thermal conductivity measurements, as well as detailed Boltzmann transport-based modeling analyses of the transport properties, we demonstrate that p-type S c1 -xM gxN thin film alloys exhibit a maximum thermoelectric power factor of ˜0.8 ×10-3W /m -K2 at 850 K. The thermoelectric properties are tunable by adjusting the M gxNy mole-fraction inside the ScN matrix, thereby shifting the Fermi energy in the alloy films from inside the conduction band in case of undoped n -type ScN to inside the valence band in highly hole-doped p -type S c1 -xM gxN thin film alloys. The thermal conductivities of both the n- and p-type films were found to be undesirably large for thermoelectric applications. Thus, future work should address strategies to reduce the thermal conductivity of S c1 -xM gxN thin-film alloys, without affecting

Light Curve Stability and Period Behavior of the Contact Binary TZ ...

Indian Academy of Sciences (India)

J. Astrophys. Astr. (2013) 34, 329–339 c Indian Academy of Sciences. Light Curve Stability and Period Behavior of the Contact. Binary TZ Boo. M. M. Elkhateeb1,2 & M. I. Nouh1,2,∗. 1National Research Institute of Astronomy and Geophysics, 11421 Helwan, Cairo, Egypt. 2Physics Department, College of Science, Northern ...

GxGrare: gene-gene interaction analysis method for rare variants from high-throughput sequencing data.

Science.gov (United States)

Kwon, Minseok; Leem, Sangseob; Yoon, Joon; Park, Taesung

2018-03-19

With the rapid advancement of array-based genotyping techniques, genome-wide association studies (GWAS) have successfully identified common genetic variants associated with common complex diseases. However, it has been shown that only a small proportion of the genetic etiology of complex diseases could be explained by the genetic factors identified from GWAS. This missing heritability could possibly be explained by gene-gene interaction (epistasis) and rare variants. There has been an exponential growth of gene-gene interaction analysis for common variants in terms of methodological developments and practical applications. Also, the recent advancement of high-throughput sequencing technologies makes it possible to conduct rare variant analysis. However, little progress has been made in gene-gene interaction analysis for rare variants. Here, we propose GxGrare which is a new gene-gene interaction method for the rare variants in the framework of the multifactor dimensionality reduction (MDR) analysis. The proposed method consists of three steps; 1) collapsing the rare variants, 2) MDR analysis for the collapsed rare variants, and 3) detect top candidate interaction pairs. GxGrare can be used for the detection of not only gene-gene interactions, but also interactions within a single gene. The proposed method is illustrated with 1080 whole exome sequencing data of the Korean population in order to identify causal gene-gene interaction for rare variants for type 2 diabetes. The proposed GxGrare performs well for gene-gene interaction detection with collapsing of rare variants. GxGrare is available at http://bibs.snu.ac.kr/software/gxgrare which contains simulation data and documentation. Supported operating systems include Linux and OS X.

5 CFR 339.302 - Authority to offer examinations.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Authority to offer examinations. 339.302... QUALIFICATION DETERMINATIONS Medical Examinations § 339.302 Authority to offer examinations. An agency may, at its option, offer a medical examination (including a psychiatric evaluation) in any situation where...

49 CFR 350.339 - What are tolerance guidelines?

Science.gov (United States)

2010-10-01

... 49 Transportation 5 2010-10-01 2010-10-01 false What are tolerance guidelines? 350.339 Section 350... MOTOR CARRIER SAFETY ASSISTANCE PROGRAM Funding § 350.339 What are tolerance guidelines? Tolerance guidelines set forth the limited deviations from the FMCSRs allowed in your State's laws and regulations...

Gene-by-social-environment interaction (GxSE) between ADCYAP1R1 genotype and neighborhood crime predicts major depression symptoms in trauma-exposed women.

Science.gov (United States)

Lowe, Sarah R; Pothen, John; Quinn, James W; Rundle, Andrew; Bradley, Bekh; Galea, Sandro; Ressler, Kerry J; Koenen, Karestan C

2015-11-15

Few studies have explored interactions between genes and social environmental exposures (GxSEs) for trauma-related psychopathology, including symptoms of posttraumatic stress (PTS) and major depression (MD). The extant literature suggests the possibility of a GxSE between the rs2267735 variant of the ADCYAP1R1 gene and neighborhood crime. The current study aimed to explore this possibility among a predominantly African American sample of trauma-exposed women. Female participants (N=1361) were recruited from a public hospital, and completed measures of PTS and MD symptoms and provided DNA samples. Participants' home addresses were mapped onto 300 neighborhoods (2010 census tracts), and data on crime within neighborhoods was collected. Multilevel models detected a significant GxSE between rs2267735 and neighborhood crime for MD symptoms (p=.01). Having two copies of the risk (C) allele was associated with higher MD symptoms for participants living in high-crime neighborhoods. At least six limitations are noteworthy: (1) low statistical power; (2) use of self-report symptom inventories; (3) lack of information on symptom onset; (4) homogeneous sample from a single metropolitan area; (5) non-specific index of crime; and (6) use of census tracts to define neighborhoods. The results provide further evidence of GxSEs for psychiatric outcomes among trauma-exposed populations. Further investigations of genetic factors for trauma-related psychopathology should include careful assessments of the social environment. Copyright © 2015 Elsevier B.V. All rights reserved.

Solid-Liquid Equilibria for the Binary Mixtures 1,4-Xylene + Ethylbenzene and 1,4-Xylene + Toluene

DEFF Research Database (Denmark)

Huyghe, Raphaël; Rasmussen, Peter; Thomsen, Kaj

2004-01-01

Solid-liquid equilibrium (SLE) data for the binary mixtures 1,4-xylene + ethylbenzene, and 1,4-xylene + toluene have been measured using differential scanning calorimetry (DSC) in the temperature range from 133.15 K to 293.15 K.......Solid-liquid equilibrium (SLE) data for the binary mixtures 1,4-xylene + ethylbenzene, and 1,4-xylene + toluene have been measured using differential scanning calorimetry (DSC) in the temperature range from 133.15 K to 293.15 K....

Spectral State Evolution of 4U 1820-30: the Stability of the Spectral Index of Comptonization Tail

Science.gov (United States)

Titarchuk, Lev G.; Seifina, Elena; Frontera, Filippo

2013-01-01

We analyze the X-ray spectra and their timing properties of the compact Xray binary 4U 1820-30. We establish spectral transitions in this source seen with BeppoSAX and the Rossi X-ray Timing Explorer (RXTE). During the RXTE observations (1996 - 2009), the source were approximately approximately 75% of its time in the soft state making the lower banana and upper banana transitions combined with long-term low-high state transitions. We reveal that all of the X-ray spectra of 4U 1820-30 are fit by a composition of a thermal (blackbody) component, a Comptonization component (COMPTB) and a Gaussian-line component. Thus using this spectral analysis we find that the photon power-law index Gamma of the Comptonization component is almost unchangeable (Gamma approximately 2) while the electron temperature kTe changes from 2.9 to 21 keV during these spectral events. We also establish that for these spectral events the normalization of COMPTB component (which is proportional to mass accretion rate ?M) increases by factor 8 when kTe decreases from 21 keV to 2.9 keV. Before this index stability effect was also found analyzing X-ray data for Z-source GX 340+0 and for atolls, 4U 1728-34, GX 3+1. Thus, we can suggest that this spectral stability property is a spectral signature of an accreting neutron star source. On the other hand in a black hole binary G monotonically increases with ?Mand ultimately its value saturates at large ?M.

A note on subtrees rooted along the primary path of a binary tree

Science.gov (United States)

Troutman, B.M.; Karlinger, M.R.

1993-01-01

Let Fn denote the set of rooted binary plane trees with n external nodes, for given T???Fn let ui(T) be the altitude i node along the primary path of T, and let ??i(T) denote the number of external nodes in the induced subtree rooted at ui(T). We set ??i(T) = 0 if i is greater than the length of the primary path of T. We prove limn?????? ???i???x/n En{??i}/???iG(x), where En denotes the average over trees T???Fn and where the distribution function G is determined by its moments, for which we present an explicit expression. ?? 1993.

Period variation studies of six contact binaries in M4

Science.gov (United States)

Rukmini, Jagirdar; Shanti Priya, Devarapalli

2018-04-01

We present the first period study of six contact binaries in the closest globular cluster M4 the data collected from June 1995‑June 2009 and Oct 2012‑Sept 2013. New times of minima are determined for all the six variables and eclipse timing (O-C) diagrams along with the quadratic fit are presented. For all the variables, the study of (O-C) variations reveals changes in the periods. In addition, the fundamental parameters for four of the contact binaries obtained using the Wilson-Devinney code (v2003) are presented. Planned observations of these binaries using the 3.6-m Devasthal Optical Telescope (DOT) and the 4-m International Liquid Mirror Telescope (ILMT) operated by the Aryabhatta Research Institute of Observational Sciences (ARIES; Nainital) can throw light on their evolutionary status from long term period variation studies.

48 CFR 339.7102 - Applicability.

Science.gov (United States)

2010-10-01

... CONTRACTING ACQUISITION OF INFORMATION TECHNOLOGY Information Security Management 339.7102 Applicability. Contracting Officers are responsible for ensuring that all information technology acquisitions comply with the Federal Information Security Management Act (FISMA), the HHS-OCIO Information Systems Security and Privacy...

48 CFR 339.7101 - Policy.

Science.gov (United States)

2010-10-01

... CONTRACTING ACQUISITION OF INFORMATION TECHNOLOGY Information Security Management 339.7101 Policy. HHS is responsible for implementing an information security program to ensure that its information systems and... information contained in those systems. Each system's level of security shall protect the integrity...

Monte Carlo simulations of the detailed iron absorption line profiles from thermal winds in X-ray binaries

Science.gov (United States)

Tomaru, Ryota; Done, Chris; Odaka, Hirokazu; Watanabe, Shin; Takahashi, Tadayuki

2018-05-01

Blueshifted absorption lines from highly ionized iron are seen in some high inclination X-ray binary systems, indicating the presence of an equatorial disc wind. This launch mechanism is under debate, but thermal driving should be ubiquitous. X-ray irradiation from the central source heats disc surface, forming a wind from the outer disc where the local escape velocity is lower than the sound speed. The mass-loss rate from each part of the disc is determined by the luminosity and spectral shape of the central source. We use these together with an assumed density and velocity structure of the wind to predict the column density and ionization state, then combine this with a Monte Carlo radiation transfer to predict the detailed shape of the absorption (and emission) line profiles. We test this on the persistent wind seen in the bright neutron star binary GX 13+1, with luminosity L/LEdd ˜ 0.5. We approximately include the effect of radiation pressure because of high luminosity, and compute line features. We compare these to the highest resolution data, the Chandra third-order grating spectra, which we show here for the first time. This is the first physical model for the wind in this system, and it succeeds in reproducing many of the features seen in the data, showing that the wind in GX13+1 is most likely a thermal-radiation driven wind. This approach, combined with better streamline structures derived from full radiation hydrodynamic simulations, will allow future calorimeter data to explore the detail wind structure.

Isometries and binary images of linear block codes over ℤ4 + uℤ4 and ℤ8 + uℤ8

Science.gov (United States)

Sison, Virgilio; Remillion, Monica

2017-10-01

Let {{{F}}}2 be the binary field and ℤ2 r the residue class ring of integers modulo 2 r , where r is a positive integer. For the finite 16-element commutative local Frobenius non-chain ring ℤ4 + uℤ4, where u is nilpotent of index 2, two weight functions are considered, namely the Lee weight and the homogeneous weight. With the appropriate application of these weights, isometric maps from ℤ4 + uℤ4 to the binary spaces {{{F}}}24 and {{{F}}}28, respectively, are established via the composition of other weight-based isometries. The classical Hamming weight is used on the binary space. The resulting isometries are then applied to linear block codes over ℤ4+ uℤ4 whose images are binary codes of predicted length, which may or may not be linear. Certain lower and upper bounds on the minimum distances of the binary images are also derived in terms of the parameters of the ℤ4 + uℤ4 codes. Several new codes and their images are constructed as illustrative examples. An analogous procedure is performed successfully on the ring ℤ8 + uℤ8, where u 2 = 0, which is a commutative local Frobenius non-chain ring of order 64. It turns out that the method is possible in general for the class of rings ℤ2 r + uℤ2 r , where u 2 = 0, for any positive integer r, using the generalized Gray map from ℤ2 r to {{{F}}}2{2r-1}.

Genotype by sex and genotype by age interactions with sedentary behavior: the Portuguese Healthy Family Study.

Directory of Open Access Journals (Sweden)

Daniel M V Santos

Full Text Available Sedentary behavior (SB expression and its underlying causal factors have been progressively studied, as it is a major determinant of decreased health quality. In the present study we applied Genotype x Age (GxAge and Genotype x Sex (GxSex interaction methods to determine if the phenotypic expression of different SB traits is influenced by an interaction between genetic architecture and both age and sex. A total of 1345 subjects, comprising 249 fathers, 327 mothers, 334 sons and 325 daughters, from 339 families of The Portuguese Healthy Family Study were included in the analysis. SB traits were assessed by means of a 3-d physical activity recall, the Baecke and IPAQ questionnaires. GxAge and GxSex interactions were analyzed using SOLAR 4.0 software. Sedentary behaviour heritability estimates were not always statistically significant (p>0.05 and ranged from 3% to 27%. The GxSex and GxAge interaction models were significantly better than the single polygenic models for TV (min/day, EEsed (kcal/day, personal computer (PC usage and physical activty (PA tertiles. The GxAge model is also significantly better than the polygenic model for Sed (min/day. For EEsed, PA tertiles, PC and Sed, the GxAge interaction was significant because the genetic correlation between SB environments was significantly different from 1. Further, PC and Sed variance heterogeneity among distinct ages were observed. The GxSex interaction was significant for EEsed due to genetic variance heterogeneity between genders and for PC due to a genetic correlation less than 1 across both sexes. Our results suggest that SB expression may be influenced by the interactions between genotype with both sex and age. Further, different sedentary behaviors seem to have distinct genetic architectures and are differentially affected by age and sex.

GX1-conjugated poly(lactic acid nanoparticles encapsulating Endostar for improved in vivo anticolorectal cancer treatment

Directory of Open Access Journals (Sweden)

Du Y

2015-05-01

Full Text Available Yang Du,1,* Qian Zhang,1,* Lijia Jing,2 Xiaolong Liang,2 Chongwei Chi,1 Yaqian Li,1 Xin Yang,1 Zhifei Dai,2 Jie Tian1 1Key Laboratory of Molecular Imaging, The State Key Laboratory of Management and Control for Complex Systems, Institute of Automation, Chinese Academy of Sciences, Beijing, People’s Republic of China; 2Department of Biomedical Engineering, College of Engineering, Peking University, Beijing People’s Republic of China *These authors contributed equally to this work Abstract: Tumor angiogenesis plays a key role in tumor growth and metastasis; thus, targeting tumor-associated angiogenesis is an important goal in cancer therapy. However, the efficient delivery of drugs to tumors remains a key issue in antiangiogenesis therapy. GX1, a peptide identified by phage-display technology, is a novel tumor vasculature endothelium-specific ligand and possesses great potential as a targeted vector and antiangiogenic agent in the diagnosis and treatment of human cancers. Endostar, a novel recombinant human endostatin, has been shown to inhibit tumor angiogenesis. In this study, we developed a theranostic agent composed of GX1-conjugated poly(lactic acid nanoparticles encapsulating Endostar (GPENs and labeled with the near-infrared dye IRDye 800CW to improve colorectal tumor targeting and treatment efficacy in vivo. The in vivo fluorescence molecular imaging data showed that GPENs (IRDye 800CW more specifically targeted tumors than free IRDye 800CW in colorectal tumor-bearing mice. Moreover, the antitumor efficacy was evaluated by bioluminescence imaging and immunohistology, revealing that GPENs possessed improved antitumor efficacy on subcutaneous colorectal xenografts compared to other treatment groups. Thus, our study showed that GPENs, a novel GX1 peptide guided form of nanoscale Endostar, can be used as a theranostic agent to facilitate more efficient targeted therapy and enable real-time monitoring of therapeutic efficacy in vivo

The True Ultracool Binary Fraction Using Spectral Binaries

Science.gov (United States)

Bardalez Gagliuffi, Daniella; Burgasser, Adam J.; Schmidt, Sarah J.; Gagné, Jonathan; Faherty, Jacqueline K.; Cruz, Kelle; Gelino, Chris

2018-01-01

Brown dwarfs bridge the gap between stars and giant planets. While the essential mechanisms governing their formation are not well constrained, binary statistics are a direct outcome of the formation process, and thus provide a means to test formation theories. Observational constraints on the brown dwarf binary fraction place it at 10 ‑ 20%, dominated by imaging studies (85% of systems) with the most common separation at 4 AU. This coincides with the resolution limit of state-of-the-art imaging techniques, suggesting that the binary fraction is underestimated. We have developed a separation-independent method to identify and characterize tightly-separated (dwarfs as spectral binaries by identifying traces of methane in the spectra of late-M and early-L dwarfs. Imaging follow-up of 17 spectral binaries yielded 3 (18%) resolved systems, corroborating the observed binary fraction, but 5 (29%) known binaries were missed, reinforcing the hypothesis that the short-separation systems are undercounted. In order to find the true binary fraction of brown dwarfs, we have compiled a volume-limited, spectroscopic sample of M7-L5 dwarfs and searched for T dwarf companions. In the 25 pc volume, 4 candidates were found, three of which are already confirmed, leading to a spectral binary fraction of 0.95 ± 0.50%, albeit for a specific combination of spectral types. To extract the true binary fraction and determine the biases of the spectral binary method, we have produced a binary population simulation based on different assumptions of the mass function, age distribution, evolutionary models and mass ratio distribution. Applying the correction fraction resulting from this method to the observed spectral binary fraction yields a true binary fraction of 27 ± 4%, which is roughly within 1σ of the binary fraction obtained from high resolution imaging studies, radial velocity and astrometric monitoring. This method can be extended to identify giant planet companions to young brown

Binary Star Fractions from the LAMOST DR4

Science.gov (United States)

Tian, Zhi-Jia; Liu, Xiao-Wei; Yuan, Hai-Bo; Chen, Bing-Qiu; Xiang, Mao-Sheng; Huang, Yang; Wang, Chun; Zhang, Hua-Wei; Guo, Jin-Cheng; Ren, Juan-Juan; Huo, Zhi-Ying; Yang, Yong; Zhang, Meng; Bi, Shao-Lan; Yang, Wu-Ming; Liu, Kang; Zhang, Xian-Fei; Li, Tan-Da; Wu, Ya-Qian; Zhang, Jing-Hua

2018-05-01

Stellar systems composed of single, double, triple or higher-order systems are rightfully regarded as the fundamental building blocks of the Milky Way. Binary stars play an important role in formation and evolution of the Galaxy. Through comparing the radial velocity variations from multi-epoch observations, we analyze the binary fraction of dwarf stars observed with LAMOST. Effects of different model assumptions, such as orbital period distributions on the estimate of binary fractions, are investigated. The results based on log-normal distribution of orbital periods reproduce the previous complete analyses better than the power-law distribution. We find that the binary fraction increases with T eff and decreases with [Fe/H]. We first investigate the relation between α-elements and binary fraction in such a large sample as provided by LAMOST. The old stars with high [α/Fe] dominate with a higher binary fraction than young stars with low [α/Fe]. At the same mass, earlier forming stars possess a higher binary fraction than newly forming ones, which may be related with evolution of the Galaxy.

Evolution of tidal capture X-ray binaries - 4U 2127+12 (M15) to 4U 1820-30 (NGC 6624)

International Nuclear Information System (INIS)

Bailyn, C.D.; Grindlay, J.E.

1987-01-01

A new evolutionary scenario for X-ray binaries in globular clusters, which begins with a tidal capture of a main-sequence star by a neutron star and ends with a white dwarf-neutron star system, is presented. For tidal captures of main-sequence stars into orbits too wide to begin mass transfer immediately, the subsequent evolution of the secondary can lead to a common envelope binary similar to what the 9 hr X-ray binary 4U 2127+12 in M15 is suspected to be. If the common envelope is thick enough, it may cause the neutron star and the white dwarf core of the secondary to spiral in, producing a detached white dwarf-neutron star system. Subsequently, gravitational radiation losses may evolve this into the configuration seen in the 11 minute X-ray binary 4U 1820-30 in NGC 6624. This model appears more likely on statistical grounds than formation by collision of a neutron star and a red giant. In some circumstances, the latter process may result in unstable mass transfer, which would result in coalescence rather than a binary system like 4U 1820-30. 34 references

Genotype by Environment Interactions in Cognitive Ability: A Survey of 14 Studies from 4 Countries covering 4 Age Groups

Science.gov (United States)

Molenaar, Dylan; van der Sluis, Sophie; Boomsma, Dorret I.; Haworth, Claire M. A.; Hewitt, John K.; Martin, Nicholas G.; Plomin, Robert; Wright, Margie J.; Dolan, Conor V.

2014-01-01

A large part of the variation in cognitive ability is known to be due to genetic factors. Researchers have tried to identify modifiers that influence the heritability of cognitive ability, indicating a genotype by environment interaction (GxE). To date, such modifiers include measured variables like income and socioeconomic status. The present paper focuses on GxE in cognitive ability where the environmental variable is an unmeasured environmental factor that is uncorrelated in family members. We examined this type of GxE in the GHCA-database (Haworth et al., 2009), which comprises data of 14 different cognition studies from 4 different countries including participants of different ages. Results indicate that for younger participants (4–13 years), the strength of E decreases across the additive genetic factor A, but that this effect reverts for older participants (17–34 years). However, a clear and general conclusion about the presence of a genuine GxE is hampered by differences between the individual studies with respect to environmental and genetic influences on cognitive ability. PMID:23397253

Observing Compact Stars with AstroSat

Indian Academy of Sciences (India)

25

... of the Crab pulsar and an X-ray binary system GX 301-2 are presented to illustrate some of the capabilities of the mission. ...... vided online at the web portal of the AstroSat Science. Support Cell1. ... Library, Springer, 440, 61. [4] Bhalerao,V.

Optical spectroscopy of the Be/X-ray binary V850 Centauri/GX 304-1 during faint X-ray periodical activity

Science.gov (United States)

Malacaria, C.; Kollatschny, W.; Whelan, E.; Santangelo, A.; Klochkov, D.; McBride, V.; Ducci, L.

2017-07-01

Context. Be/X-ray binaries (BeXRBs) are the most populous class of high-mass X-ray binaries. Their X-ray duty cycle is tightly related to the optical companion wind activity, which in turn can be studied through dedicated optical spectroscopic observations. Aims: We study optical spectral features of the Be circumstellar disk to test their long-term variability and their relation with the X-ray activity. Special attention has been given to the Hα emission line, one of the best tracers of the disk conditions. Methods: We obtained optical broadband medium resolution spectra from a dedicated campaign with the Anglo-Australian Telescope and the Southern African Large Telescope in 2014-2015. Data span over one entire binary orbit, and cover both X-ray quiescent and moderately active periods. We used Balmer emission lines to follow the evolution of the circumstellar disk. Results: We observe prominent spectral features, like double-peaked Hα and Hβ emission lines. The HαV/R ratio significantly changes over a timescale of about one year. Our observations are consistent with a system observed at a large inclination angle (I ≳ 60°). The derived circumstellar disk size shows that the disk evolves from a configuration that prevents accretion onto the neutron star, to one that allows only moderate accretion. This is in agreement with the contemporary observed X-ray activity. Our results are interpreted within the context of inefficient tidal truncation of the circumstellar disk, as expected for this source's binary configuration. We derived the Hβ-emitting region size, which is equal to about half of the corresponding Hα-emitting disk, and constrain the luminosity class of V850 Cen as III-V, consistent with the previously proposed class.

INTERFERENCE AS AN ORIGIN OF THE PEAKED NOISE IN ACCRETING X-RAY BINARIES

Energy Technology Data Exchange (ETDEWEB)

Veledina, Alexandra, E-mail: alexandra.veledina@gmail.com [Nordita, KTH Royal Institute of Technology and Stockholm University, Roslagstullsbacken 23, SE-10691 Stockholm (Sweden)

2016-12-01

We propose a physical model for the peaked noise in the X-ray power density spectra of accreting X-ray binaries. We interpret its appearance as an interference of two Comptonization continua: one coming from the upscattering of seed photons from the cold thin disk and the other fed by the synchrotron emission of the hot flow. Variations of both X-ray components are caused by fluctuations in mass accretion rate, but there is a delay between them corresponding to the propagation timescale from the disk Comptonization radius to the region of synchrotron Comptonization. If the disk and synchrotron Comptonization are correlated, the humps in the power spectra are harmonically related and the dips between them appear at frequencies related as odd numbers 1:3:5. If they are anti-correlated, the humps are related as 1:3:5, but the dips are harmonically related. Similar structures are expected to be observed in accreting neutron star binaries and supermassive black holes. The delay can be easily recovered from the frequency of peaked noise and further used to constrain the combination of the viscosity parameter and disk height-to-radius ratio α ( H / R ){sup 2} of the accretion flow. We model multi-peak power spectra of black hole X-ray binaries GX 339–4 and XTE J1748–288 to constrain these parameters.

31 CFR 339.1 - Definitions of words and terms as used in this circular.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Definitions of words and terms as used in this circular. 339.1 Section 339.1 Money and Finance: Treasury Regulations Relating to Money... OFFERING OF UNITED STATES SAVINGS BONDS, SERIES H § 339.1 Definitions of words and terms as used in this...

INTEGRAL hard X-ray detection of HMXB GX 304-1 and H1417-624

DEFF Research Database (Denmark)

Manousakis, A.; Beckmann, V.; Bianchin, V.

2008-01-01

We report on the first detection of the Be star HMXBs GX 304-1 and H1417-624 above 20 keV with the IBIS/ISGRI X-ray imager on board INTEGRAL. From 2008-06-24 to 2008-07-09, INTEGRAL performed monitoring observations of the Galactic plane around l=305 degrees for a total exposure time of 352 ksec....

The 4U 0115+63: Another energetic gamma ray binary pulsar

Science.gov (United States)

Chadwick, P. M.; Dipper, N. A.; Dowthwaite, J. C.; Kirkman, I. W.; Mccomb, T. J. L.; Orford, K. J.; Turver, K. E.

1985-01-01

Following the discovery of Her X-1 as a source of pulsed 1000 Gev X-rays, a search for emission from an X-ray binary containing a pulsar with similar values of period, period derivative and luminosity was successful. The sporadic X-ray binary 4U 0115-63 has been observed, with probability 2.5 x 10 to the minus 6 power ergs/s to emit 1000 GeV gamma-rays with a time averaged energy flux of 6 to 10 to the 35th power.

PROPERTIES OF THE 24 DAY MODULATION IN GX 13+1 FROM NEAR-INFRARED AND X-RAY OBSERVATIONS

International Nuclear Information System (INIS)

Corbet, Robin H. D.; Pearlman, Aaron B.; Buxton, Michelle; Levine, Alan M.

2010-01-01

A 24 day period for the low-mass X-ray binary (LMXB) GX 13+1 was previously proposed on the basis of seven years of RXTE All-Sky Monitor (ASM) observations and it was suggested that this was the orbital period of the system. This would make it one of the longest known orbital periods for a Galactic LMXB powered by Roche lobe overflow. We present here the results of (1) K-band photometry obtained with the SMARTS Consortium CTIO 1.3 m telescope on 68 nights over a 10 month interval; (2) continued monitoring with the RXTE ASM, analyzed using a semi-weighted power spectrum instead of the data filtering technique previously used; and (3) Swift Burst Alert Telescope (BAT) hard X-ray observations. Modulation near 24 days is seen in both the K band and additional statistically independent ASM X-ray observations. However, the modulation in the ASM is not strictly periodic. The periodicity is also not detected in the Swift BAT observations, but modulation at the same relative level as seen with the ASM cannot be ruled out. If the 24 day period is the orbital period of system, this implies that the X-ray modulation is caused by structure that is not fixed in location. A possible mechanism for the X-ray modulation is the dipping behavior recently reported from XMM-Newton observations.

THE HOST GALAXY OF THE SUPER-LUMINOUS SN 2010gx AND LIMITS ON EXPLOSIVE 56Ni PRODUCTION

International Nuclear Information System (INIS)

Chen, Ting-Wan; Smartt, Stephen J.; Kotak, Rubina; McCrum, Matt; Fraser, Morgan; Bresolin, Fabio; Kudritzki, Rolf-Peter; Pastorello, Andrea; Valenti, Stefano

2013-01-01

Super-luminous supernovae have a tendency to occur in faint host galaxies which are likely to have low mass and low metallicity. While these extremely luminous explosions have been observed from z = 0.1 to 1.55, the closest explosions allow more detailed investigations of their host galaxies. We present a detailed analysis of the host galaxy of SN 2010gx (z = 0.23), one of the best studied super-luminous type Ic supernovae. The host is a dwarf galaxy (M g = –17.42 ± 0.17) with a high specific star formation rate. It has a remarkably low metallicity of 12 + log (O/H) = 7.5 ± 0.1 dex as determined from the detection of the [O III] λ4363 line. This is the first reliable metallicity determination of a super-luminous stripped-envelope supernova host. We collected deep multi-epoch imaging with Gemini + GMOS between 240 and 560 days after explosion to search for any sign of radioactive 56 Ni, which might provide further insights on the explosion mechanism and the progenitor's nature. We reach griz magnitudes of m AB ∼ 26, but do not detect SN 2010gx at these epochs. The limit implies that any 56 Ni production was similar to or below that of SN 1998bw (a luminous type Ic SN that produced around 0.4 M ☉ of 56 Ni). The low volumetric rates of these supernovae (∼10 –4 of the core-collapse population) could be qualitatively matched if the explosion mechanism requires a combination of low-metallicity (below 0.2 Z ☉ ), high progenitor mass (>60 M ☉ ) and high rotation rate (fastest 10% of rotators).

Phenotype abnormality: 339 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 339 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u844i increased number of inflore...scence in organ named whole plant ... whole plant ... present in greater numbers in organism ... inflorescence ...

Formation, evolution and environment of high-mass X-ray binaries

International Nuclear Information System (INIS)

Coleiro, Alexis

2013-01-01

between the HMXB spatial distribution and the star forming regions distribution exists, making the HMXB a good tracer of star formation. This study also allow us to constrain the evolution of thirteen binary systems, precisely their age and migration distance due to the supernova explosion. The third part reports the results of a near-infrared observing campaign dedicated to the identification of new HMXB in the INTEGRAL data. We present the infrared observation constraints and the observational strategy used during these observations carried out at La Silla Observatory. Then, we show the results that led to the spectral identification of thirteen HMXB. We complete these results by characterizing the close environment of three of them. We also update the HMXB population statistics and we explain how these new discoveries challenge population synthesis models. Finally, we suggest some clues that may bring back together observations and models. Understanding the structure of the HMXB environment is crucial since it can reflect the evolution of the binary system and the influence of the compact object. We show in the fourth part how the Herschel satellite has opened a new window on the HMXB study, allowing, for the first time, the study of an HMXB in far-infrared. We focus on GX 301-2, a massive X-ray binary composed of a neutron star orbiting an hyper-giant star. We show that the matter surrounding the binary system is disk-shaped and we compare these results with those obtained for other HMXB. This enables to begin studying their evolution through the analysis of their close environment. In another hand, we show that GX 301-2 is likely interacting with the interstellar medium and we suggest new constraints on the system evolution, brought by these novel observations, coupled with archival data, from the optical to the radio domain. Finally, we close this manuscript by giving a conclusion and bringing short and long term perspectives. (author) [fr

On the kinematics of visual binary and multiple stars of the FK4 cataloque

International Nuclear Information System (INIS)

Starikova, G.A.

1981-01-01

Kinematic features of single, binary and multiple stars are considered. To compare kinematics of such stars with the kinematics of single stars the data on positions and proper motions of those stars which are given in the basic catalogue FK4. Single as well as visual binary and multiple stars united because of their limited content in FK4 have been subdivided by spectra and classes of luminosity into groups with account for known kinematic peculiarities of various spectral groups. Kinematic features for the studied spectral groups are given. By the stars of the FK4 catalogue for various spectral classes the difference of kinematic features of single, visual binary and multiple stars is obtained. However the values of these differences need to be specified due to small number of stars included in five of six groups considered

miR-339-5p inhibits alcohol-induced brain inflammation through regulating NF-κB pathway

International Nuclear Information System (INIS)

Zhang, Yu; Wei, Guangkuan; Di, Zhiyong; Zhao, Qingjie

2014-01-01

Graphical abstract: - Highlights: • Alcohol upregulates miR-339-5p expression. • miR-339-5p inhibits the NF-kB pathway. • miR-339-5p interacts with and blocks activity of IKK-beat and IKK-epsilon. • miR-339-5p modulates IL-1β, IL-6 and TNF-α. - Abstract: Alcohol-induced neuroinflammation is mediated by the innate immunesystem. Pro-inflammatory responses to alcohol are modulated by miRNAs. The miRNA miR-339-5p has previously been found to be upregulated in alcohol-induced neuroinflammation. However, little has been elucidated on the regulatory functions of this miRNA in alcohol-induced neuroinflammation. We investigated the function of miR-339-5p in alcohol exposed brain tissue and isolated microglial cells using ex vivo and in vitro techniques. Our results show that alcohol induces transcription of miR 339-5p, IL-6, IL-1β and TNF-α in mouse brain tissue and isolated microglial cells by activating NF-κB. Alcohol activation of NF-κB allows for nuclear translocation of the NF-κB subunit p65 and expression of pro-inflammatory mediators. miR-339-5p inhibited expression of these pro-inflammatory factors through the NF-κB pathway by abolishing IKK-β and IKK-ε activity

miR-339-5p inhibits alcohol-induced brain inflammation through regulating NF-κB pathway

Energy Technology Data Exchange (ETDEWEB)

Zhang, Yu [Department of Neurology, The First Affiliated School of Harbin Medical University, Harbin 150001 (China); Wei, Guangkuan [Department of Neurology, Heilongjiang Provincial Hospital, Harbin 150036 (China); Di, Zhiyong [Department of Laboratory, Heilongjiang Provincial Hospital, Harbin 150036 (China); Zhao, Qingjie, E-mail: zhaoqingjie2013@163.com [Department of Neurology, The First Affiliated School of Harbin Medical University, Harbin 150001 (China)

2014-09-26

Graphical abstract: - Highlights: • Alcohol upregulates miR-339-5p expression. • miR-339-5p inhibits the NF-kB pathway. • miR-339-5p interacts with and blocks activity of IKK-beat and IKK-epsilon. • miR-339-5p modulates IL-1β, IL-6 and TNF-α. - Abstract: Alcohol-induced neuroinflammation is mediated by the innate immunesystem. Pro-inflammatory responses to alcohol are modulated by miRNAs. The miRNA miR-339-5p has previously been found to be upregulated in alcohol-induced neuroinflammation. However, little has been elucidated on the regulatory functions of this miRNA in alcohol-induced neuroinflammation. We investigated the function of miR-339-5p in alcohol exposed brain tissue and isolated microglial cells using ex vivo and in vitro techniques. Our results show that alcohol induces transcription of miR 339-5p, IL-6, IL-1β and TNF-α in mouse brain tissue and isolated microglial cells by activating NF-κB. Alcohol activation of NF-κB allows for nuclear translocation of the NF-κB subunit p65 and expression of pro-inflammatory mediators. miR-339-5p inhibited expression of these pro-inflammatory factors through the NF-κB pathway by abolishing IKK-β and IKK-ε activity.

Bounds on the degree of APN polynomials: the case of x −1 + g(x)

DEFF Research Database (Denmark)

Leander, Gregor; Rodier, François

2011-01-01

In this paper we consider APN functions $${f:\\mathcal{F}_{2^m}\\to \\mathcal{F}_{2^m}}$$ of the form f(x) = x −1 + g(x) where g is any non $${\\mathcal{F}_{2}}$$-affine polynomial. We prove a lower bound on the degree of the polynomial g. This bound in particular implies that such a function f is AP...

X1908+075: An X-Ray Binary with a 4.4 Day Period

Science.gov (United States)

Wen, Linqing; Remillard, Ronald A.; Bradt, Hale V.

2000-04-01

X1908+075 is an optically unidentified and highly absorbed X-ray source that appeared in early surveys such as Uhuru, OSO 7, Ariel 5, HEAO-1, and the EXOSAT Galactic Plane Survey. These surveys measured a source intensity in the range 2-12 mcrab at 2-10 keV, and the position was localized to ~0.5d. We use the Rossi X-Ray Timing Explorer (RXTE) All-Sky Monitor (ASM) to confirm our expectation that a particular Einstein/IPC detection (1E 1908.4+0730) provides the correct position for X1908+075. The analysis of the coded mask shadows from the ASM for the position of 1E 1908.4+0730 yields a persistent intensity ~8 mcrab (1.5-12 keV) over a 3 yr interval beginning in 1996 February. Furthermore, we detect a period of 4.400+/-0.001 days with a false-alarm probability less than 10-7. The folded light curve is roughly sinusoidal, with an amplitude that is 26% of the mean flux. The X-ray period may be attributed to the scattering and absorption of X-rays through a stellar wind combined with the orbital motion in a binary system. We suggest that X1908+075 is an X-ray binary with a high-mass companion star.

The MAVERIC Survey: A Red Straggler Binary with an Invisible Companion in the Galactic Globular Cluster M10

Science.gov (United States)

Shishkovsky, Laura; Strader, Jay; Chomiuk, Laura; Bahramian, Arash; Tremou, Evangelia; Li, Kwan-Lok; Salinas, Ricardo; Tudor, Vlad; Miller-Jones, James C. A.; Maccarone, Thomas J.; Heinke, Craig O.; Sivakoff, Gregory R.

2018-03-01

We present the discovery and characterization of a radio-bright binary in the Galactic globular cluster M10. First identified in deep radio continuum data from the Karl G. Jansky Very Large Array, M10-VLA1 has a flux density of 27 ± 4 μJy at 7.4 GHz and a flat-to-inverted radio spectrum. Chandra imaging shows an X-ray source with L X ≈ 1031 erg s‑1 matching the location of the radio source. This places M10-VLA1 within the scatter of the radio-X-ray luminosity correlation for quiescent stellar-mass black holes, and a black hole X-ray binary is a viable explanation for this system. The radio and X-ray properties of the source disfavor, but do not rule out, identification as an accreting neutron star or white dwarf system. Optical imaging from the Hubble Space Telescope and spectroscopy from the SOAR telescope show that the system has an orbital period of 3.339 days and an unusual “red straggler” component: an evolved star found redward of the M10 red giant branch. These data also show UV/optical variability and double-peaked Hα emission characteristic of an accretion disk. However, SOAR spectroscopic monitoring reveals that the velocity semi-amplitude of the red straggler is low. We conclude that M10-VLA1 is most likely either a quiescent black hole X-ray binary with a rather face-on (i orientation or an unusual flaring RS Canum Venaticorum variable-type active binary, and discuss future observations that could distinguish between these possibilities.

Preferential solvation of fluorenone and 4-hydroxyfluorenone in binary solvent mixtures

International Nuclear Information System (INIS)

Jozefowicz, Marek; Heldt, Janina R.

2003-01-01

Preferential solvation of fluorenone and 4-hydroxyfluorenone in binary solvent mixtures has been studied using steady-state spectroscopic measurements. This study concerns the solvent-induced shift of the absorption and fluorescence spectra of both molecules in two solvent mixtures, i.e., cyclohexane-tetrahydrofuran and cyclohexane-ethanol. The first system contains polar solute molecules, fluorenone and 4-hydroxyfluorenone, in a mixture of polar aprotic (tetrahydrofuran) and non-polar (cyclohexane) solvents. In the second solvents mixture, hydrogen bonding with solute molecules (ethanol) may occur. The results of spectroscopic measurements are analysed using theoretical models of Bakshiev, Mazurenko and Suppan which describe preferential solvation phenomena. In the case of cyclohexane-tetrahydrofuran mixtures, the deviation from linearity in the absorption and fluorescence solvatochromic shifts vs. the solution polarity is due to non-specific dipolar solvent-solute interactions. For cyclohexane-ethanol binary mixtures, both non-specific and specific (hydrogen bond and proton-relay tautomerization) interactions contribute to the observed solvatochromism

A Novel Design of 4-Class BCI Using Two Binary Classifiers and Parallel Mental Tasks

Directory of Open Access Journals (Sweden)

Tao Geng

2008-01-01

Full Text Available A novel 4-class single-trial brain computer interface (BCI based on two (rather than four or more binary linear discriminant analysis (LDA classifiers is proposed, which is called a “parallel BCI.” Unlike other BCIs where mental tasks are executed and classified in a serial way one after another, the parallel BCI uses properly designed parallel mental tasks that are executed on both sides of the subject body simultaneously, which is the main novelty of the BCI paradigm used in our experiments. Each of the two binary classifiers only classifies the mental tasks executed on one side of the subject body, and the results of the two binary classifiers are combined to give the result of the 4-class BCI. Data was recorded in experiments with both real movement and motor imagery in 3 able-bodied subjects. Artifacts were not detected or removed. Offline analysis has shown that, in some subjects, the parallel BCI can generate a higher accuracy than a conventional 4-class BCI, although both of them have used the same feature selection and classification algorithms.

BINARY QUASARS AT HIGH REDSHIFT. I. 24 NEW QUASAR PAIRS AT z ∼ 3-4

International Nuclear Information System (INIS)

Hennawi, Joseph F.; Myers, Adam D.; Shen, Yue; Strauss, Michael A.; Djorgovski, S. G.; Glikman, Eilat; Mahabal, Ashish; Fan Xiaohui; Martin, Crystal L.; Richards, Gordon T.; Schneider, Donald P.; Shankar, Francesco

2010-01-01

The clustering of quasars on small scales yields fundamental constraints on models of quasar evolution and the buildup of supermassive black holes. This paper describes the first systematic survey to discover high-redshift binary quasars. Using color-selection and photometric redshift techniques, we searched 8142 deg 2 of Sloan Digital Sky Survey imaging data for binary quasar candidates, and confirmed them with follow-up spectroscopy. Our sample of 27 high-redshift binaries (24 of them new discoveries) at redshifts 2.9 perpendicular perpendicular 3.5. The completeness and efficiency of our well-defined selection algorithm are quantified using simulated photometry and we find that our sample is ∼50% complete. Our companion paper uses this knowledge to make the first measurement of the small-scale clustering (R -1 Mpc comoving) of high-redshift quasars. High-redshift binaries constitute exponentially rare coincidences of two extreme (M ∼> 10 9 M sun ) supermassive black holes. At z ∼ 4, there is about one close binary per 10 Gpc 3 , thus these could be the highest sigma peaks, the analogs of superclusters, in the early universe.

Equilibrium points and associated periodic orbits in the gravity of binary asteroid systems: (66391) 1999 KW4 as an example

Science.gov (United States)

Shi, Yu; Wang, Yue; Xu, Shijie

2018-04-01

The motion of a massless particle in the gravity of a binary asteroid system, referred as the restricted full three-body problem (RF3BP), is fundamental, not only for the evolution of the binary system, but also for the design of relevant space missions. In this paper, equilibrium points and associated periodic orbit families in the gravity of a binary system are investigated, with the binary (66391) 1999 KW4 as an example. The polyhedron shape model is used to describe irregular shapes and corresponding gravity fields of the primary and secondary of (66391) 1999 KW4, which is more accurate than the ellipsoid shape model in previous studies and provides a high-fidelity representation of the gravitational environment. Both of the synchronous and non-synchronous states of the binary system are considered. For the synchronous binary system, the equilibrium points and their stability are determined, and periodic orbit families emanating from each equilibrium point are generated by using the shooting (multiple shooting) method and the homotopy method, where the homotopy function connects the circular restricted three-body problem and RF3BP. In the non-synchronous binary system, trajectories of equivalent equilibrium points are calculated, and the associated periodic orbits are obtained by using the homotopy method, where the homotopy function connects the synchronous and non-synchronous systems. Although only the binary (66391) 1999 KW4 is considered, our methods will also be well applicable to other binary systems with polyhedron shape data. Our results on equilibrium points and associated periodic orbits provide general insights into the dynamical environment and orbital behaviors in proximity of small binary asteroids and enable the trajectory design and mission operations in future binary system explorations.

ANTI-CORRELATED TIME LAGS IN THE Z SOURCE GX 5-1: POSSIBLE EVIDENCE FOR A TRUNCATED ACCRETION DISK

Energy Technology Data Exchange (ETDEWEB)

Sriram, K.; Choi, C. S. [Korea Astronomy and Space Science Institute, Daejeon 305-348 (Korea, Republic of); Rao, A. R., E-mail: astrosriram@yahoo.co.in [Tata Institute of Fundamental Research, Mumbai 400005 (India)

2012-06-01

We investigate the nature of the inner accretion disk in the neutron star source GX 5-1 by making a detailed study of time lags between X-rays of different energies. Using the cross-correlation analysis, we found anti-correlated hard and soft time lags of the order of a few tens to a few hundred seconds and the corresponding intensity states were mostly the horizontal branch (HB) and upper normal branch. The model independent and dependent spectral analysis showed that during these time lags the structure of the accretion disk significantly varied. Both eastern and western approaches were used to unfold the X-ray continuum and systematic changes were observed in soft and hard spectral components. These changes along with a systematic shift in the frequency of quasi-periodic oscillations (QPOs) made it substantially evident that the geometry of the accretion disk is truncated. Simultaneous energy spectral and power density spectral study shows that the production of the horizontal branch oscillations (HBOs) is closely related to the Comptonizing region rather than the disk component in the accretion disk. We found that as the HBO frequency decreases from the hard apex to upper HB, the disk temperature increases along with an increase in the coronal temperature, which is in sharp contrast with the changes found in black hole binaries where the decrease in the QPO frequency is accompanied by a decrease in the disk temperature and a simultaneous increase in the coronal temperature. We discuss the results in the context of re-condensation of coronal material in the inner region of the disk.

Spectral and Timing Nature of the Symbiotic X-Ray Binary 4U 1954+319: The Slowest Rotating Neutron Star in AN X-Ray Binary System

Science.gov (United States)

Enoto, Teruaki; Sasano, Makoto; Yamada, Shin'Ya; Tamagawa, Toru; Makishima, Kazuo; Pottschmidt, Katja; Marcu, Diana; Corbet, Robin H. D.; Fuerst, Felix; Wilms, Jorn

2014-01-01

The symbiotic X-ray binary (SyXB) 4U 1954+319 is a rare system hosting a peculiar neutron star (NS) and an M-type optical companion. Its approx. 5.4 hr NS spin period is the longest among all known accretion-powered pulsars and exhibited large (is approx. 7%) fluctuations over 8 yr. A spin trend transition was detected with Swift/BAT around an X-ray brightening in 2012. The source was in quiescent and bright states before and after this outburst based on 60 ks Suzaku observations in 2011 and 2012. The observed continuum is well described by a Comptonized model with the addition of a narrow 6.4 keV Fe-K alpha line during the outburst. Spectral similarities to slowly rotating pulsars in high-mass X-ray binaries, its high pulsed fraction (approx. 60%-80%), and the location in the Corbet diagram favor high B-field (approx. greater than 10(exp12) G) over a weak field as in low-mass X-ray binaries. The observed low X-ray luminosity (10(exp33)-10(exp35) erg s(exp-1)), probable wide orbit, and a slow stellar wind of this SyXB make quasi-spherical accretion in the subsonic settling regime a plausible model. Assuming a approx. 10(exp13) G NS, this scheme can explain the approx. 5.4 hr equilibrium rotation without employing the magnetar-like field (approx. 10(exp16) G) required in the disk accretion case. The timescales of multiple irregular flares (approx. 50 s) can also be attributed to the free-fall time from the Alfv´en shell for a approx. 10(exp13) G field. A physical interpretation of SyXBs beyond the canonical binary classifications is discussed.

Solving a binary puzzle

NARCIS (Netherlands)

Utomo, P.H.; Makarim, R.H.

2017-01-01

A Binary puzzle is a Sudoku-like puzzle with values in each cell taken from the set {0,1} {0,1}. Let n≥4 be an even integer, a solved binary puzzle is an n×n binary array that satisfies the following conditions: (1) no three consecutive ones and no three consecutive zeros in each row and each

Separation of toluene from n-heptane by liquid–liquid extraction using binary mixtures of [bpy][BF4] and [4bmpy][Tf2N] ionic liquids as solvent

International Nuclear Information System (INIS)

García, Silvia; Larriba, Marcos; García, Julián; Torrecilla, José S.; Rodríguez, Francisco

2012-01-01

Highlights: ► Binary mixtures of ionic liquids as extraction solvents of aromatics. ► [4bmpy][Tf 2 N] shows higher capacity but lower selectivity than sulfolane. ► [bpy][BF 4 ] shows lower capacity but higher selectivity than sulfolane. ► Mixed {[4bmpy][Tf 2 N] + [bpy][BF 4 ]} improves both extractive properties. - Abstract: The use of binary mixture of ionic liquids N-butylpyridinium tetrafluoroborate ([bpy][BF 4 ]), and 1-butyl-4-methylpyridinium bis(trifluoromethylsulfonyl)imide ([4bmpy][Tf 2 N]) in the liquid–liquid extraction of toluene from n-heptane has been investigated at 313.2 K and atmospheric pressure. The experimental capacity of extraction and selectivity for this binary mixture has proved to be intermediate to those corresponding to the pure ionic liquids, and they can be predicted using a logarithmic–linear model of solubility. Furthermore, the results showed that the use of binary mixture of {[bpy][BF 4 ] + [4bmpy][Tf 2 N]} at a mole solvent composition around 0.7 for [bpy][BF 4 ] improves both the capacity of extraction of toluene and the selectivity with respect to those of sulfolane, the organic solvent taken as a benchmark. Thus, this mixed ionic liquid could be likely to be used in the extraction of aromatic from aliphatic in replacement to sulfolane.

Characteristics of centrifugally cast GX25CrNiSi18-9 steel

Directory of Open Access Journals (Sweden)

R. Zapała

2011-07-01

Full Text Available The paper presents the results of microstructural examinations of the industrial heat-resistant centrifugally cast GX25CrNiSi18-9 steel characterised by increased content of Cu. The study included changes in the microstructure of base cast steel respective of the steel held at a temperature of 900 and 950°C for 48 hours. Based on the results obtained, an increase in microhardness of the examined cast steel matrix with increasing temperature was stated, which was probably caused by fine precipitates enriched in Cr, Mo, and C forming inside the matrix grains.The layer of scale formed on the tested cast steel oxidised in the atmosphere of air at 900 and 950°C was characterised by an increased tendency to degradation with increasing temperature of the conducted tests.

BINARY CENTRAL STARS OF PLANETARY NEBULAE DISCOVERED THROUGH PHOTOMETRIC VARIABILITY. IV. THE CENTRAL STARS OF HaTr 4 AND Hf 2-2

Energy Technology Data Exchange (ETDEWEB)

Hillwig, Todd C.; Schaub, S. C. [Department of Physics and Astronomy, Valparaiso University, Valparaiso, IN 46383 (United States); Bond, Howard E. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Frew, David J. [Department of Physics, The University of Hong Kong, Pokfulam Road (Hong Kong); Bodman, Eva H. L., E-mail: todd.hillwig@valpo.edu [Southeastern Association for Research in Astronomy (SARA) (United States)

2016-08-01

We explore the photometrically variable central stars of the planetary nebulae HaTr 4 and Hf 2-2. Both have been classified as close binary star systems previously based on their light curves alone. Here, we present additional arguments and data confirming the identification of both as close binaries with an irradiated cool companion to the hot central star. We include updated light curves, orbital periods, and preliminary binary modeling for both systems. We also identify for the first time the central star of HaTr 4 as an eclipsing binary. Neither system has been well studied in the past, but we utilize the small amount of existing data to limit possible binary parameters, including system inclination. These parameters are then compared to nebular parameters to further our knowledge of the relationship between binary central stars of planetary nebulae and nebular shaping and ejection.

Several tetratricopeptide repeat (TPR) motifs of FANCG are required for assembly of the BRCA2/D1-D2-G-X3 complex, FANCD2 monoubiquitylation and phleomycin resistance

International Nuclear Information System (INIS)

Wilson, James B.; Blom, Eric; Cunningham, Ryan; Xiao, Yuxuan; Kupfer, Gary M.; Jones, Nigel J.

2010-01-01

The Fanconi anaemia (FA) FANCG protein is an integral component of the FA nuclear core complex that is required for monoubiquitylation of FANCD2. FANCG is also part of another protein complex termed D1-D2-G-X3 that contains FANCD2 and the homologous recombination repair proteins BRCA2 (FANCD1) and XRCC3. Formation of the D1-D2-G-X3 complex is mediated by serine-7 phosphorylation of FANCG and occurs independently of the FA core complex and FANCD2 monoubiquitylation. FANCG contains seven tetratricopeptide repeat (TPR) motifs that mediate protein-protein interactions and here we show that mutation of several of the TPR motifs at a conserved consensus residue ablates the in vivo binding activity of FANCG. Expression of mutated TPR1, TPR2, TPR5 and TPR6 in Chinese hamster fancg mutant NM3 fails to functionally complement its hypersensitivities to mitomycin C (MMC) and phleomycin and fails to restore FANCD2 monoubiquitylation. Using co-immunoprecipitation analysis, we demonstrate that these TPR-mutated FANCG proteins fail to interact with BRCA2, XRCC3, FANCA or FANCF. The interactions of other proteins in the D1-D2-G-X3 complex are also absent, including the interaction of BRCA2 with both the monoubiquitylated (FANCD2-L) and non-ubiquitylated (FANCD2-S) isoforms of FANCD2. Interestingly, a mutation of TPR7 (R563E), that complements the MMC and phleomycin hypersensitivity of human FA-G EUFA316 cells, fails to complement NM3, despite the mutated FANCG protein co-precipitating with FANCA, BRCA2 and XRCC3. Whilst interaction of TPR7-mutated FANCG with FANCF does appear to be reduced in NM3, FANCD2 is monoubiquitylated suggesting that sub-optimal interactions of FANCG in the core complex and the D1-D2-G-X3 complex are responsible for the observed MMC- and phleomycin-hypersensitivity, rather than a defect in FANCD2 monoubiquitylation. Our data demonstrate that FANCG functions as a mediator of protein-protein interactions and is vital for the assembly of multi-protein complexes

Several tetratricopeptide repeat (TPR) motifs of FANCG are required for assembly of the BRCA2/D1-D2-G-X3 complex, FANCD2 monoubiquitylation and phleomycin resistance

Energy Technology Data Exchange (ETDEWEB)

Wilson, James B. [Molecular Oncology and Stem Cell Research Group, School of Biological Sciences, University of Liverpool, Biosciences Building, Crown Street, Liverpool L69 7ZB (United Kingdom); Blom, Eric [Department of Clinical Genetics and Human Genetics, VU University Medical Center, Van der Boechorststraat 7, NL-1081 BT Amsterdam (Netherlands); Cunningham, Ryan; Xiao, Yuxuan [Molecular Oncology and Stem Cell Research Group, School of Biological Sciences, University of Liverpool, Biosciences Building, Crown Street, Liverpool L69 7ZB (United Kingdom); Kupfer, Gary M. [Departments of Pediatrics and Pathology, Yale University School of Medicine, Section of Hematology/Oncology, 333 Cedar Street, New Haven, CT 0652 (United States); Jones, Nigel J., E-mail: njjones@liv.ac.uk [Molecular Oncology and Stem Cell Research Group, School of Biological Sciences, University of Liverpool, Biosciences Building, Crown Street, Liverpool L69 7ZB (United Kingdom)

2010-07-07

The Fanconi anaemia (FA) FANCG protein is an integral component of the FA nuclear core complex that is required for monoubiquitylation of FANCD2. FANCG is also part of another protein complex termed D1-D2-G-X3 that contains FANCD2 and the homologous recombination repair proteins BRCA2 (FANCD1) and XRCC3. Formation of the D1-D2-G-X3 complex is mediated by serine-7 phosphorylation of FANCG and occurs independently of the FA core complex and FANCD2 monoubiquitylation. FANCG contains seven tetratricopeptide repeat (TPR) motifs that mediate protein-protein interactions and here we show that mutation of several of the TPR motifs at a conserved consensus residue ablates the in vivo binding activity of FANCG. Expression of mutated TPR1, TPR2, TPR5 and TPR6 in Chinese hamster fancg mutant NM3 fails to functionally complement its hypersensitivities to mitomycin C (MMC) and phleomycin and fails to restore FANCD2 monoubiquitylation. Using co-immunoprecipitation analysis, we demonstrate that these TPR-mutated FANCG proteins fail to interact with BRCA2, XRCC3, FANCA or FANCF. The interactions of other proteins in the D1-D2-G-X3 complex are also absent, including the interaction of BRCA2 with both the monoubiquitylated (FANCD2-L) and non-ubiquitylated (FANCD2-S) isoforms of FANCD2. Interestingly, a mutation of TPR7 (R563E), that complements the MMC and phleomycin hypersensitivity of human FA-G EUFA316 cells, fails to complement NM3, despite the mutated FANCG protein co-precipitating with FANCA, BRCA2 and XRCC3. Whilst interaction of TPR7-mutated FANCG with FANCF does appear to be reduced in NM3, FANCD2 is monoubiquitylated suggesting that sub-optimal interactions of FANCG in the core complex and the D1-D2-G-X3 complex are responsible for the observed MMC- and phleomycin-hypersensitivity, rather than a defect in FANCD2 monoubiquitylation. Our data demonstrate that FANCG functions as a mediator of protein-protein interactions and is vital for the assembly of multi-protein complexes

Is there a highly magnetized neutron star in GX 301-2?

Science.gov (United States)

Doroshenko, V.; Santangelo, A.; Suleimanov, V.; Kreykenbohm, I.; Staubert, R.; Ferrigno, C.; Klochkov, D.

2010-06-01

We present the results of an in-depth study of the long-period X-ray pulsar GX 301-2. Using archival data of INTEGRAL, RXTE ASM, and CGRO BATSE, we study the spectral and timing properties of the source. Comparison of our timing results with previously published work reveals a secular decay of the orbital period at a rate of ≃ - 3.25 × 10-5 d yr-1, which is an order of magnitude faster than for other known systems. We argue that this is probably result either of the apsidal motion or of gravitational coupling of the matter lost by the optical companion with the neutron star, although current observations do not allow us to distinguish between those possibilities. We also propose a model to explain the observed long pulse period. We find that a very strong magnetic field B ~ 1014 G can explain the observed pulse period in the framework of existing models for torques affecting the neutron star. We show that the apparent contradiction with the magnetic field strength BCRSF ~ 4 × 1012 G derived from the observed cyclotron line position may be resolved if the line formation region resides in a tall accretion column of height ~2.5-3 RNS. The color temperature measured from the spectrum suggests that such a column may indeed be present, and our estimates show that its height is sufficient to explain the observed cyclotron line position.

BROADBAND SPECTROSCOPY USING TWO SUZAKU OBSERVATIONS OF THE HMXB GX 301-2

Energy Technology Data Exchange (ETDEWEB)

Suchy, Slawomir; Markowitz, Alex; Rothschild, Richard E. [Center for Astrophysics and Space Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093-0424 (United States); Fuerst, Felix; Kreykenbohm, Ingo; Wilms, Joern [Dr. Karl Remeis Sternwarte and Erlangen Center for Astroparticle Physics, Sternwartstr. 7, 96049 Bamberg (Germany); Pottschmidt, Katja [Center for Space Science and Technology, University of Maryland Baltimore County, 1000 Hilltop Circle, Baltimore, MD 21250 (United States); Caballero, Isabel, E-mail: ssuchy@ucsd.edu [CEA Saclay, DSM/IRFU/SAp-UMR AIM (7158), CNRS/CEA, University Paris 7, Diderot, Gif sur Yvette (France)

2012-02-01

We present the analysis of two Suzaku observations of GX 301-2 at two orbital phases after the periastron passage. Variations in the column density of the line-of-sight absorber are observed, consistent with accretion from a clumpy wind. In addition to a cyclotron resonance scattering feature (CRSF), multiple fluorescence emission lines were detected in both observations. The variations in the pulse profiles and the CRSF throughout the pulse phase have a signature of a magnetic dipole field. Using a simple dipole model we calculated the expected magnetic field values for different pulse phases and were able to extract a set of geometrical angles, loosely constraining the dipole geometry in the neutron star. From the variation of the CRSF width and energy, we found a geometrical solution for the dipole, making the inclination consistent with previously published values.

Predicting the 4th caustic crossing in Gaia16aye binary microlensing event

Science.gov (United States)

Mroz, P.; Wyrzykowski, L.; Rybicki, K.; Altavilla, G.; Bakis, V.; Bendjoya, P.; Birenbaum, G.; Blagorodnova, N.; Blanco-Cuaresma, S.; Bonanos, A.; Bozza, V.; Britavskiy, N.; Burgaz, U.; Butterley, T.; Capuozzo, P.; Carrasco, J. M.; Chruslinska, M.; Damljanovic, G.; Dennefeld, M.; Dhillon, V. S.; Dominik, M.; Esenoglu, H.; Fossey, S.; Gomboc, A.; Hallokoun, N.; Hamanowicz, A.; Hardy, L. K.; Hudec, R.; Khamitov, I.; Klencki, J.; Kolaczkowski, Z.; Kolb, U.; Leonini, S.; Leto, G.; Lewis, F.; Liakos, A.; Littlefair, S. P.; Maoz, D.; Maund, J. R.; Mikolajczyk, P.; Palaversa, L.; Pawlak, M.; Penny, M.; Piascik, A.; Reig, P.; Rhodes, L.; Russell, D.; Sanchez, R. Z.; Shappee, B.; Shvartzvald, Y.; Sitek, M.; Sniegowska, M.; Sokolovsky, K.; Steele, I.; Street, R.; Tomasella, L.; Trascinelli, L.; Wiersema, K.; Wilson, R. W.; Zharkov, I.; Zola, S.; Zubareva, A.

2016-11-01

Gaia16aye, nicknamed Ayers Rock (19:40:01.13 +30:07:53.4, J2000) is a spectacular binary microlensing event in the Northern Galactic Plane. The event has been observed by Gaia, ASAS-SN survey and a network of follow-up telescopes, coordinated by the Time Domain WP of the EC's OPTICON grant.

Formation and evolution of compact binaries

NARCIS (Netherlands)

Sluijs, Marcel Vincent van der

2006-01-01

In this thesis we investigate the formation and evolution of compact binaries. Chapters 2 through 4 deal with the formation of luminous, ultra-compact X-ray binaries in globular clusters. We show that the proposed scenario of magnetic capture produces too few ultra-compact X-ray binaries to explain

MiR-339-5p inhibits breast cancer cell migration and invasion in vitro and may be a potential biomarker for breast cancer prognosis

International Nuclear Information System (INIS)

Wu, Zheng-sheng; Xu, Xiao-chun; Wu, Qiang; Wang, Chao-qun; Wang, Xiao-nan; Wang, Yan; Zhao, Jing-jing; Mao, Shan-shan; Zhang, Gui-hong; Zhang, Nong

2010-01-01

MicroRNAs (miRNAs) play an important role in the regulation of cell growth, differentiation, apoptosis, and carcinogenesis. Detection of their expression may lead to identifying novel markers for breast cancer. We profiled miRNA expression in three breast cancer cell lines (MCF-7, MDA-MB-231, and MDA-MB-468) and then focused on one miRNA, miR-339-5p, for its role in regulation of tumor cell growth, migration, and invasion and target gene expression. We then analyzed miR-339-5p expression in benign and cancerous breast tissue specimens. A number of miRNAs were differentially expressed in these cancer cell lines. Real-time PCR indicated that miR-339-5p expression was downregulated in the aggressive cell lines MDA-MB-468 and MDA-MB-231 and in breast cancer tissues compared with benign tissues. Transfection of miR-339-5p oligonucleotides reduced cancer cell growth only slightly but significantly decreased tumor cell migration and invasion capacity compared with controls. Real-time PCR analysis showed that BCL-6, a potential target gene of miR-339-5p, was downregulated in MDA-MB-231 cells by miR-339-5p transfection. Furthermore, the reduced miR-339-5p expression was associated with an increase in metastasis to lymph nodes and with high clinical stages. Kaplan-Meier analyses found that the patients with miR-339-5p expression had better overall and relapse-free survivals compared with those without miR-339-5p expression. Cox proportional hazards analyses showed that miR-339-5p expression was an independent prognostic factor for breast cancer patients. MiR-339-5p may play an important role in breast cancer progression, suggesting that miR-339-5p should be further evaluated as a biomarker for predicting the survival of breast cancer patients

4-bit digital to analog converter using R-2R ladder and binary weighted resistors

Science.gov (United States)

Diosanto, J.; Batac, M. L.; Pereda, K. J.; Caldo, R.

2017-06-01

The use of a 4-bit digital-to-analog converter using two methods; Binary Weighted Resistors and R-2R Ladder is designed and presented in this paper. The main components that were used in constructing both circuits were different resistor values, operational amplifier (LM741) and single pole double throw switches. Both circuits were designed using MULTISIM software to be able to test the circuit for its ideal application and FRITZING software for the layout designing and fabrication to the printed circuit board. The implementation of both systems in an actual circuit benefits in determining and comparing the advantages and disadvantages of each. It was realized that the binary weighted circuit is more efficient DAC, having lower percentage error of 0.267% compared to R-2R ladder circuit which has a minimum of percentage error of 4.16%.

Photoelectric UBVRI sequences in the Magellanic Cloud clusters Lindsay 1, NGC 339, NGC 361, and NGC 1466

International Nuclear Information System (INIS)

Alcaino, G.; Alvarado, F.; Wenderoth, E.; Liller, W.

1990-01-01

UBVRI sequences in three Small Magellanic Cloud (SMC) clusters Lindsay 1, NGC 339, NGC 361, and in NGC 1466, which lies between the two Magellanic Clouds, are presented. These sequences are appropriate for charge-coupled device (CCD) coverage. Only BV standards have been published in NGC 339 and UBV in NGC 1466; no sequences exist for the two other clusters. 15 refs

A curious case of the accretion-powered X-ray pulsar GX 1+4

DEFF Research Database (Denmark)

Jaisawal, Gaurava K.; Naik, Sachindra; Gupta, Shivangi

2018-01-01

We present detailed spectral and timing studies using a NuSTAR observation of GX 1+4 in 2015 October during an intermediate-intensity state. The measured spin period of 176.778 s is found to be one of the highest values since its discovery. In contrast to a broad sinusoidal-like pulse profile......, a peculiar sharp peak is observed in profiles below ∼25 keV. The profiles at higher energies are found to be significantly phase shifted compared to the soft X-ray profiles. Broad-band energy spectra of GX 1+4, obtained from NuSTAR and Swift observations, are described with various continuum models. Among...

Correlated Radial Velocity and X-Ray Variations in HD 154791/4U 1700+24

Science.gov (United States)

Galloway, Duncan K.; Sokoloski, J. L.; Kenyon, Scott J.

2002-12-01

We present evidence for approximately 400 day variations in the radial velocity of HD 154791 (V934 Her), the suggested optical counterpart of 4U 1700+24. The variations are correlated with the previously reported ~400 day variations in the X-ray flux of 4U 1700+24, which supports the association of these two objects, as well as the identification of this system as the second known X-ray binary in which a neutron star accretes from the wind of a red giant. The HD 154791 radial velocity variations can be fitted with an eccentric orbit with period 404+/-3 days, amplitude K=0.75+/-0.12kms-1, and eccentricity e=0.26+/-0.15. There are also indications of variations on longer timescales >~2000 days. We have reexamined all available All-Sky Monitor (ASM) data following an unusually large X-ray outburst in 1997-1998 and confirm that the 1 day averaged 2-10 keV X-ray flux from 4U 1700+24 is modulated with a period of 400+/-20 days. The mean profile of the persistent X-ray variations was approximately sinusoidal, with an amplitude of 0.108+/-0.012 ASM counts s-1 (corresponding to 31% rms). The epoch of X-ray maximum was approximately 40 days after the time of periastron, according to the eccentric orbital fit. If the 400 day oscillations from HD 154791/4U 1700+24 are due to orbital motion, then the system parameters are probably close to those of the only other neutron star symbiotic-like binary, GX 1+4. We discuss the similarities and differences between these two systems.

Optical studies of massive X-ray binaries

International Nuclear Information System (INIS)

Zuiderwijk, E.J.

1979-01-01

Photometric and spectroscopic studies of several optical counterparts of massive X-ray binaries are presented. Subjects of study were the binary systems:HD77581/4U0900-40 (Vela X-1), HD153919/4U1700-37, Wray 977/4U1223-62 and Sk160/4U0115-74 (=SMC X-1). (Auth.)

(Vapour + liquid) equilibria for binary and ternary mixtures of 2-propanol, tetrahydropyran, and 2,2,4-trimethylpentane at P = 101.3 kPa

International Nuclear Information System (INIS)

Lin, Dun-Yi; Tu, Chein-Hsiun

2012-01-01

Highlights: ► We report the VLE data at P = 101.3 kPa involving a cyclic ether. ► The activity coefficients of mixtures were obtained from modified Raoult’s law. ► The VLE data were correlated by four liquid activity coefficient models. ► The ternary VLE data were predicted from binary parameters of the four models. - Abstract: (Vapour + liquid) equilibrium (VLE) at P = 101.3 kPa have been determined for a ternary system (2-propanol + tetrahydropyran + 2,2,4-trimethylpentane) and its constituent binary systems (2-propanol + tetrahydropyran, 2-propanol + 2,2,4-trimethylpentane), and (tetrahydropyran + 2,2,4-trimethylpentane). Analysis of VLE data reveals that two binary systems (2-propanol + tetrahydropyran) and (2-propanol + 2,2,4-trimethylpentane) have a minimum boiling azeotrope. No azeotrope was found for the ternary system. The activity coefficients of liquid mixtures were obtained from the modified Raoult’s law and were used to calculate the reduced excess molar Gibbs free energy (g E /RT). Thermodynamic consistency tests were performed for all VLE data using the Van Ness direct test for the binary systems and the test of McDermott–Ellis as modified by Wisniak and Tamir for the ternary system. The VLE data of the binary mixtures were correlated using the three-suffix Margules, Wilson, NRTL, and UNIQUAC activity-coefficient models. The models with their best-fitted interaction parameters of the binary systems were used to predict the ternary (vapour + liquid) equilibrium.

Serial binary interval ratios improve rhythm reproduction

Directory of Open Access Journals (Sweden)

Xiang eWu

2013-08-01

Full Text Available Musical rhythm perception is a natural human ability that involves complex cognitive processes. Rhythm refers to the organization of events in time, and musical rhythms have an underlying hierarchical metrical structure. The metrical structure induces the feeling of a beat and the extent to which a rhythm induces the feeling of a beat is referred to as its metrical strength. Binary ratios are the most frequent interval ratio in musical rhythms. Rhythms with hierarchical binary ratios are better discriminated and reproduced than rhythms with hierarchical non-binary ratios. However, it remains unclear whether a superiority of serial binary over non-binary ratios in rhythm perception and reproduction exists. In addition, how different types of serial ratios influence the metrical strength of rhythms remains to be elucidated. The present study investigated serial binary vs. non-binary ratios in a reproduction task. Rhythms formed with exclusively binary (1:2:4:8, non-binary integer (1:3:5:6, and non-integer (1:2.3:5.3:6.4 ratios were examined within a constant meter. The results showed that the 1:2:4:8 rhythm type was more accurately reproduced than the 1:3:5:6 and 1:2.3:5.3:6.4 rhythm types, and the 1:2.3:5.3:6.4 rhythm type was more accurately reproduced than the 1:3:5:6 rhythm type. Further analyses showed that reproduction performance was better predicted by the distribution pattern of event occurrences within an inter-beat interval, than by the coincidence of events with beats, or the magnitude and complexity of interval ratios. Whereas rhythm theories and empirical data emphasize the role of the coincidence of events with beats in determining metrical strength and predicting rhythm performance, the present results suggest that rhythm processing may be better understood when the distribution pattern of event occurrences is taken into account. These results provide new insights into the mechanisms underlining musical rhythm perception.

Serial binary interval ratios improve rhythm reproduction.

Science.gov (United States)

Wu, Xiang; Westanmo, Anders; Zhou, Liang; Pan, Junhao

2013-01-01

Musical rhythm perception is a natural human ability that involves complex cognitive processes. Rhythm refers to the organization of events in time, and musical rhythms have an underlying hierarchical metrical structure. The metrical structure induces the feeling of a beat and the extent to which a rhythm induces the feeling of a beat is referred to as its metrical strength. Binary ratios are the most frequent interval ratio in musical rhythms. Rhythms with hierarchical binary ratios are better discriminated and reproduced than rhythms with hierarchical non-binary ratios. However, it remains unclear whether a superiority of serial binary over non-binary ratios in rhythm perception and reproduction exists. In addition, how different types of serial ratios influence the metrical strength of rhythms remains to be elucidated. The present study investigated serial binary vs. non-binary ratios in a reproduction task. Rhythms formed with exclusively binary (1:2:4:8), non-binary integer (1:3:5:6), and non-integer (1:2.3:5.3:6.4) ratios were examined within a constant meter. The results showed that the 1:2:4:8 rhythm type was more accurately reproduced than the 1:3:5:6 and 1:2.3:5.3:6.4 rhythm types, and the 1:2.3:5.3:6.4 rhythm type was more accurately reproduced than the 1:3:5:6 rhythm type. Further analyses showed that reproduction performance was better predicted by the distribution pattern of event occurrences within an inter-beat interval, than by the coincidence of events with beats, or the magnitude and complexity of interval ratios. Whereas rhythm theories and empirical data emphasize the role of the coincidence of events with beats in determining metrical strength and predicting rhythm performance, the present results suggest that rhythm processing may be better understood when the distribution pattern of event occurrences is taken into account. These results provide new insights into the mechanisms underlining musical rhythm perception.

BROADBAND SPECTROSCOPY USING TWO SUZAKU OBSERVATIONS OF THE HMXB GX 301–2

International Nuclear Information System (INIS)

Suchy, Slawomir; Markowitz, Alex; Rothschild, Richard E.; Fürst, Felix; Kreykenbohm, Ingo; Wilms, Jörn; Pottschmidt, Katja; Caballero, Isabel

2012-01-01

We present the analysis of two Suzaku observations of GX 301–2 at two orbital phases after the periastron passage. Variations in the column density of the line-of-sight absorber are observed, consistent with accretion from a clumpy wind. In addition to a cyclotron resonance scattering feature (CRSF), multiple fluorescence emission lines were detected in both observations. The variations in the pulse profiles and the CRSF throughout the pulse phase have a signature of a magnetic dipole field. Using a simple dipole model we calculated the expected magnetic field values for different pulse phases and were able to extract a set of geometrical angles, loosely constraining the dipole geometry in the neutron star. From the variation of the CRSF width and energy, we found a geometrical solution for the dipole, making the inclination consistent with previously published values.

Search for a neutral particle of mass 33.9 MeV in pion decay

Energy Technology Data Exchange (ETDEWEB)

Daum, M [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

1996-11-01

We have measured the muon momentum distribution in charged pion decay in flight in order to search for a small branching fraction {eta} of pion decays {pi}{sup +}{yields}{mu}{sup +} 1 X, in which a heavy neutral particle X with a mass of 33.9 MeV would be emitted. Such a particle was postulated by the KARMEN collaboration as a possible explanation for an anomaly in their time-of-flight spectrum. In a first experiment we found an upper limit of {eta}{<=}2.6.10{sup -8} at a confidence level of 95%. (author) 4 figs., 9 refs.

Constraining the inclination of the Low-Mass X-ray Binary Cen X-4

Science.gov (United States)

Hammerstein, Erica K.; Cackett, Edward M.; Reynolds, Mark T.; Miller, Jon M.

2018-05-01

We present the results of ellipsoidal light curve modeling of the low mass X-ray binary Cen X-4 in order to constrain the inclination of the system and mass of the neutron star. Near-IR photometric monitoring was performed in May 2008 over a period of three nights at Magellan using PANIC. We obtain J, H and K lightcurves of Cen X-4 using differential photometry. An ellipsoidal modeling code was used to fit the phase folded light curves. The lightcurve fit which makes the least assumptions about the properties of the binary system yields an inclination of 34.9^{+4.9}_{-3.6} degrees (1σ), which is consistent with previous determinations of the system's inclination but with improved statistical uncertainties. When combined with the mass function and mass ratio, this inclination yields a neutron star mass of 1.51^{+0.40}_{-0.55} M⊙. This model allows accretion disk parameters to be free in the fitting process. Fits that do not allow for an accretion disk component in the near-IR flux gives a systematically lower inclination between approximately 33 and 34 degrees, leading to a higher mass neutron star between approximately 1.7 M⊙ and 1.8 M⊙. We discuss the implications of other assumptions made during the modeling process as well as numerous free parameters and their effects on the resulting inclination.

Densities and viscosities of binary and ternary mixtures of cyclohexanone, 1,4-dioxane and isooctane from T = (288.15 to 313.15) K

International Nuclear Information System (INIS)

Rafiee, Hamid Reza; Ranjbar, Shahram; Poursalman, Fariborz

2012-01-01

Graphical abstract: For binary and ternary mixtures of the following liquids the densities and viscosities have been determined at several temperatures and over the entire range of composition. Also the Δη and excess molar volumes for binary mixtures determined and have been fitted to the Redlich–Kister equation. The interaction parameters, G 12 in the Grunberg–Nissan equation have been found to be negative for all binary mixtures which indicates decreasing the interaction between unlike molecules. Highlights: ► Experimental data for viscosity and density of binary and ternary mixtures reported. ► The considered solvents are Cyclohexanone, 1,4-Dioxane and Isooctane. ► Temperature ranges from 288.15 to 313.15 K and entire range of composition is considered. ► G 12 , in Grunberg–Nissan equation was negative in all binary mixtures at all temperatures. ► V E and Δη for binary mixtures have been fitted to Redlich–Kister equation. - Abstract: Densities and viscosities of binary and ternary mixtures of cyclohexanone, 1,4-dioxane and isooctane have been measured at temperatures from 288.15 K to 313.15 K and over the entire composition range, under atmospheric pressure. From these binary data, the excess molar volumes have been determined and then fitted to Redlich–Kister equation to determine the appropriate coefficients. This work also provides a test of the Grunberg and Nissan equation for correlation the dynamic viscosities of binary mixtures with mole fractions. The interaction parameters for this equation, G 12 were negative for all binary mixtures at different temperatures over entire range of composition which attributed to decreasing the strength of interaction between unlike molecules in mixture.

Interacting binaries

International Nuclear Information System (INIS)

Eggleton, P.P.; Pringle, J.E.

1985-01-01

This volume contains 15 review articles in the field of binary stars. The subjects reviewed span considerably, from the shortest period of interacting binaries to the longest, symbiotic stars. Also included are articles on Algols, X-ray binaries and Wolf-Rayet stars (single and binary). Contents: Preface. List of Participants. Activity of Contact Binary Systems. Wolf-Rayet Stars and Binarity. Symbiotic Stars. Massive X-ray Binaries. Stars that go Hump in the Night: The SU UMa Stars. Interacting Binaries - Summing Up

Relativistic Binaries in Globular Clusters

Directory of Open Access Journals (Sweden)

Matthew J. Benacquista

2013-03-01

Full Text Available Galactic globular clusters are old, dense star systems typically containing 10^4 – 10^6 stars. As an old population of stars, globular clusters contain many collapsed and degenerate objects. As a dense population of stars, globular clusters are the scene of many interesting close dynamical interactions between stars. These dynamical interactions can alter the evolution of individual stars and can produce tight binary systems containing one or two compact objects. In this review, we discuss theoretical models of globular cluster evolution and binary evolution, techniques for simulating this evolution that leads to relativistic binaries, and current and possible future observational evidence for this population. Our discussion of globular cluster evolution will focus on the processes that boost the production of tight binary systems and the subsequent interaction of these binaries that can alter the properties of both bodies and can lead to exotic objects. Direct N-body integrations and Fokker–Planck simulations of the evolution of globular clusters that incorporate tidal interactions and lead to predictions of relativistic binary populations are also discussed. We discuss the current observational evidence for cataclysmic variables, millisecond pulsars, and low-mass X-ray binaries as well as possible future detection of relativistic binaries with gravitational radiation.

Coevolution of Binaries and Circumbinary Gaseous Disks

Science.gov (United States)

Fleming, David; Quinn, Thomas R.

2018-04-01

The recent discoveries of circumbinary planets by Kepler raise questions for contemporary planet formation models. Understanding how these planets form requires characterizing their formation environment, the circumbinary protoplanetary disk, and how the disk and binary interact. The central binary excites resonances in the surrounding protoplanetary disk that drive evolution in both the binary orbital elements and in the disk. To probe how these interactions impact both binary eccentricity and disk structure evolution, we ran N-body smooth particle hydrodynamics (SPH) simulations of gaseous protoplanetary disks surrounding binaries based on Kepler 38 for 10^4 binary orbital periods for several initial binary eccentricities. We find that nearly circular binaries weakly couple to the disk via a parametric instability and excite disk eccentricity growth. Eccentric binaries strongly couple to the disk causing eccentricity growth for both the disk and binary. Disks around sufficiently eccentric binaries strongly couple to the disk and develop an m = 1 spiral wave launched from the 1:3 eccentric outer Lindblad resonance (EOLR). This wave corresponds to an alignment of gas particle longitude of periastrons. We find that in all simulations, the binary semi-major axis decays due to dissipation from the viscous disk.

Hydrology and modeling of flow conditions at Bridge 339 and Mile 38-43, Copper River Highway, Alaska

Science.gov (United States)

Brabets, Timothy P.

2012-01-01

The Copper River basin, the sixth largest watershed in Alaska, drains an area of 24,200 square miles in south-central Alaska. This large, glacier-fed river flows across a wide alluvial fan before it enters the Gulf of Alaska. The Copper River Highway, which traverses the alluvial fan, has been affected by channel planform reconfiguration. Currently (2012), two areas of the Copper River Highway are at risk: at Mile 38-43, the road grade is too low and the highway could be flooded by high flows of the Copper River, and at Mile 36, the main channel of the Copper River has migrated directly toward Bridge 339. Because Bridge 339 was not designed and built to convey the main flow of the Copper River, as much as 50 feet of scour occurred at the piers in 2011. The piers can no longer absorb the lateral or vertical loads, resulting in closure of the bridge and the Copper River Highway. The U.S. Geological Survey Flow and Sediment Transport with Morphologic Evolution of Channels (FaSTMECH) model was used to simulate the flow of the Copper River and produce simulations of depth, water-surface elevation, and velocity. At the Mile 38-43 area, FaSTMECH was used to analyze the effects of raising the road grade 5 feet, and at Mile 36, FaSTMECH was used to analyze the effects of constructing a channel to divert flow away from Bridge 339. Results from FaSTMECH indicate that if raising the road grade 5 feet in the Mile 38-43 area, a flood with an annual exceedance probability of 2 percent (400,000 cubic feet per second) would not overtop the highway. In the Bridge 339 area, results from FaSTMECH indicate that a design channel could divert flows as much as 100,000 cubic feet per second away from Bridge 339.

Spectrophotometric Determination of the CuSO4 Soret Coefficient of a CuSO4-H2O Binary Solutions System

Directory of Open Access Journals (Sweden)

Ijang Rohman

2010-06-01

Full Text Available A spectrophotometric technique for the determination of the CuSO4 soret coefficient of a CuSO4-water binary solutions system is described. A short column of solutions is placed between horizontal metal plates that are held at different temperatures. The subsequent changes in composition due to thermal diffusion are followed by monitoring changes of transmittance near the end of the solutions column. In water, CuSO4 diffuses to the warm compartment of column. The soret coefficient of CuSO4 0.0254 molal in water agrees with the appropriate theory, i.e. 17.60x10-3 °C-1 on the average.

Learning to assign binary weights to binary descriptor

Science.gov (United States)

Huang, Zhoudi; Wei, Zhenzhong; Zhang, Guangjun

2016-10-01

Constructing robust binary local feature descriptors are receiving increasing interest due to their binary nature, which can enable fast processing while requiring significantly less memory than their floating-point competitors. To bridge the performance gap between the binary and floating-point descriptors without increasing the computational cost of computing and matching, optimal binary weights are learning to assign to binary descriptor for considering each bit might contribute differently to the distinctiveness and robustness. Technically, a large-scale regularized optimization method is applied to learn float weights for each bit of the binary descriptor. Furthermore, binary approximation for the float weights is performed by utilizing an efficient alternatively greedy strategy, which can significantly improve the discriminative power while preserve fast matching advantage. Extensive experimental results on two challenging datasets (Brown dataset and Oxford dataset) demonstrate the effectiveness and efficiency of the proposed method.

Binary Format for Scene (BIFS): combining MPEG-4 media to build rich multimedia services

Science.gov (United States)

Signes, Julien

1998-12-01

In this paper, we analyze the design concepts and some technical details behind the MPEG-4 standard, particularly the scene description layer, commonly known as the Binary Format for Scene (BIFS). We show how MPEG-4 may ease multimedia proliferation by offering a unique, optimized multimedia platform. Lastly, we analyze the potential of the technology for creating rich multimedia applications on various networks and platforms. An e-commerce application example is detailed, highlighting the benefits of the technology. Compression results show how rich applications may be built even on very low bit rate connections.

On the Nature of the Compact Object in SS 433. Observational Evidence of X-Ray Photon Index Saturation

Science.gov (United States)

Seifina, Elena; Titarchuk, Lev

2010-01-01

We present an analysis of the X-ray spectral properties observed from black hole , candidate (BHC) binary SS 433. We have analyzed Rossi X-ray Time Explorer (RXTE) data from this source, coordinated with Green Bank Interferometer/RATAN-600. We show that SS 433 undergoes a X-ray spectral transition from the low hard state (LHS) to the intermediate state (IS). We show that the X-ray broad-band energy spectra during all spectral states are well fit by a sum of so called "Bulk Motion Comptonization (BMC) component" and by two (broad and narrow) Gaussians for the continuum and line emissions respectively. In addition to these spectral model components we also find a strong feature that we identify as a" blackbody-like (BB)" component which color temperature is in the range of 4-5 keV in 24 IS spectra during the radio outburst decay in SS 433. Our observational results on the "high temperature BB" bump leads us to suggest the presence of gravitationally redshifted annihilation line emission in this source. In fact this spectral feature has been recently reproduced in Monte Carlo simulations by Laurent and Titarchuk. We have also established the photon index saturation at about 2.3 in index vs mass accretion correlation. This index-mass accretion correlation allows us to evaluate the low limit of black hole (BH) mass of compact object in SS 433, M(sub bh) approximately > 2 solar masses, using the scaling method using BHC GX 339-4 as a reference source. Our estimate of the BH mass in SS 433 is consistent with recent BH mass measurement using the radial-velocity measurements of the binary system by Hillwig & Gies who find that M(sub x)( = (4.3 +/- 0.8) solar masses. This is the smallest BH mass found up to now among all BH sources. Moreover, the index saturation effect versus mass accretion rate revealed in SS 433, like in a number of other BH candidates, is the strong observational evidence for the presence of a BH in SS 433.

Spontaneous compactification of a (4+d)-dimensional Kaluza-Klein theory into M4xG/H for arbitrary G and H

International Nuclear Information System (INIS)

Randjbar-Daemi, S.; Percacci, R.

1982-05-01

Einstein-Yang-Mills theory in 4+d dimensions admits a solution of the form M 4 xG/H, where M 4 is Einstein and G/H is symmetric, if the gauge group is H (or larger). The gauge fields of this solution are topologically nontrivial. The symmetry group is G 4 xGxH, G 4 being the isometry group of M 4 ; M 4 could be Minkowski or anti-de-Sitter space. (author)

The disc-jet coupling in the neutron star X-ray binary 4U 1728-34

NARCIS (Netherlands)

Tudose, Valeriu; Tzioumis, Anastasios; Belloni, Tomaso; Altamirano, Diego; Linares, Manuel; Mendez, Mariano; Hiemstra, Beike

2010-01-01

The present radio proposal is part of a multi-wavelength campaign focused on the study of the accretion/ejection process in the neutron star X-ray binary system 4U 1728-34. Our intention is to study the behaviour of the inner part of the accretion disc as inferred from the X-ray observations of the

Binary Linear-Time Erasure Decoding for Non-Binary LDPC codes

OpenAIRE

Savin, Valentin

2009-01-01

In this paper, we first introduce the extended binary representation of non-binary codes, which corresponds to a covering graph of the bipartite graph associated with the non-binary code. Then we show that non-binary codewords correspond to binary codewords of the extended representation that further satisfy some simplex-constraint: that is, bits lying over the same symbol-node of the non-binary graph must form a codeword of a simplex code. Applied to the binary erasure channel, this descript...

Binary effectivity rules

DEFF Research Database (Denmark)

Keiding, Hans; Peleg, Bezalel

2006-01-01

is binary if it is rationalized by an acyclic binary relation. The foregoing result motivates our definition of a binary effectivity rule as the effectivity rule of some binary SCR. A binary SCR is regular if it satisfies unanimity, monotonicity, and independence of infeasible alternatives. A binary...

Application of the multi-dimensional surface water modeling system at Bridge 339, Copper River Highway, Alaska

Science.gov (United States)

Brabets, Timothy P.; Conaway, Jeffrey S.

2009-01-01

The Copper River Basin, the sixth largest watershed in Alaska, drains an area of 24,200 square miles. This large, glacier-fed river flows across a wide alluvial fan before it enters the Gulf of Alaska. Bridges along the Copper River Highway, which traverses the alluvial fan, have been impacted by channel migration. Due to a major channel change in 2001, Bridge 339 at Mile 36 of the highway has undergone excessive scour, resulting in damage to its abutments and approaches. During the snow- and ice-melt runoff season, which typically extends from mid-May to September, the design discharge for the bridge often is exceeded. The approach channel shifts continuously, and during our study it has shifted back and forth from the left bank to a course along the right bank nearly parallel to the road.Maintenance at Bridge 339 has been costly and will continue to be so if no action is taken. Possible solutions to the scour and erosion problem include (1) constructing a guide bank to redirect flow, (2) dredging approximately 1,000 feet of channel above the bridge to align flow perpendicular to the bridge, and (3) extending the bridge. The USGS Multi-Dimensional Surface Water Modeling System (MD_SWMS) was used to assess these possible solutions. The major limitation of modeling these scenarios was the inability to predict ongoing channel migration. We used a hybrid dataset of surveyed and synthetic bathymetry in the approach channel, which provided the best approximation of this dynamic system. Under existing conditions and at the highest measured discharge and stage of 32,500 ft3/s and 51.08 ft, respectively, the velocities and shear stresses simulated by MD_SWMS indicate scour and erosion will continue. Construction of a 250-foot-long guide bank would not improve conditions because it is not long enough. Dredging a channel upstream of Bridge 339 would help align the flow perpendicular to Bridge 339, but because of the mobility of the channel bed, the dredged channel would

A Deep ROSAT HRI Observation of NGC 1313

Science.gov (United States)

Schlegel, Eric M.; Petre, Robert; Colbert, E. J. M.; Miller, Scott

2000-11-01

We describe a series of observations of NGC 1313 using the ROSAT HRI with a combined exposure time of 183.5 ks. The observations span an interval between 1992 and 1998; the purpose of observations since 1994 was to monitor the X-ray flux of SN 1978K, one of several luminous sources in the galaxy. No diffuse emission is detected in the galaxy to a level of ~1-2×1037 ergs s-1 arcmin-2. A total of eight sources are detected in the summed image within the D25 diameter of the galaxy. The luminosities of five of the eight range from ~6×1037 to ~6×1038 ergs s-1 these sources are most likely accreting X-ray binaries, similar to sources observed in M31 and M33. The remaining three sources all emit above 1039 ergs s-1. We present light curves of the five brightest sources. Variability is detected at the 99.9% level in four of these. We identify one of the sources as an NGC 1313 counterpart of a Galactic X-ray source. The light curve, though crudely sampled, most closely resembles that of a Galactic black hole candidate such as GX 339-4 but with considerably higher peak X-ray luminosity. An additional seven sources lie outside the D25 diameter and are either foreground stars or background active galactic nuclei.

Catalogue of high-mass X-ray binaries in the Galaxy (4th edition)

NARCIS (Netherlands)

Liu, Q.Z.; van Paradijs, J.; van den Heuvel, E.P.J.

2006-01-01

We present a new edition of the catalogue of high-mass X-ray binaries in the Galaxy. The catalogue contains source name(s), coordinates, finding chart, X-ray luminosity, system parameters, and stellar parameters of the components and other characteristic properties of 114 high-mass X-ray binaries,

Diffusion coefficients in 4-component mixture expressed explicitly in terms of binary diffusion coefficients and mole fractions

International Nuclear Information System (INIS)

Furuta, Hiroshi; Yamamoto, Ichiro

1996-01-01

Diffusion coefficients in 4-component mixture D ij (4) were expressed explicitly in terms of binary diffusion coefficients and mole fractions by solving a ratio of determinants defined by Hirschfelder et al. The explicit expressions of D ij (4) were divided into two terms, a term due to the i-j pairs of attention and a term common to all the pairs out of the 4 components. The two terms of D ij (4) had extended structures similar to corresponding those of D ij (3) respectively. (author)

Thermodynamic study of binary mixture of x1[C6mim][BF4] + x21-propanol: Measurements and molecular modeling

International Nuclear Information System (INIS)

Kermanpour, F.; Sharifi, T.

2012-01-01

Highlights: ► Densities and viscosities for binary mixture of {x 1 [C 6 mim][BF 4 ] + x 2 1-propanol} were measured at different temperatures. ► The excess molar functions were calculated from the obtained experimental data. ► These data were correlated with the Redlich–Kister equation and PFP model to obtain the coefficients and standard deviations. - Abstract: Densities, ρ, and viscosities, η, of pure 1-hexyl-3-methylimidazoliumtetrafluoro borate ([C 6 mim][BF 4 ]) and 1-propanol, and their binary mixture {x 1 [C 6 mim][BF 4 ] + x 2 1-propanol} were measured at atmospheric pressure and in the temperature range of 293.15–333.15 K. The excess molar volumes, V m E , thermal expansion coefficients, α, and their excess values, α E , isothermal coefficient of excess molar enthalpy, (∂H m E /∂p) T,x and excess viscosities, η E , were calculated from the experimental values of densities and viscosities. The excess molar volumes of the binary mixture are negative over the entire mole fraction range and increase with increasing temperature. Excess viscosities are negative over the entire mole fraction range of the mixture and decrease with increasing temperature. The obtained excess molar volumes and excess viscosities were correlated with the Redlich–Kister equation. The experimental results have also been used to examine the applicability of Prigogine–Flory–Patterson (PFP) theory in predicting the excess molar volume of the binary mixture. It is indicated that agreement between excess molar volumes calculated via PFP theory and the experimental results is good in all temperatures.

Optical Spectroscopy of the Classical Novae V339 Del (2013) and V5668 Sgr (2015 No. 2)

Science.gov (United States)

Wagner, R. Mark; Woodward, Charles E.; Starrfield, Sumner; Ilyin, Ilya; Strassmeier, Klaus G.; Page, Kim; Osborne, Julian P.; Beardmore, Andrew P.

2016-01-01

We report the results of optical spectroscopy of the gamma-ray classical novae V339 Del (2013) and V5668 Sgr (PNV J18365700-2855420/Nova Sgr 2015 No. 2) supplemented by UV and X-ray observations obtained with Swift. Our spectra were obtained with the Steward Observatory Bok 2.3 m telescope (+B&C), the MDM 2.4 m Hiltner telescope (+OSMOS), the 6.5 m MMT (+BlueChannel), and the 2 x 8.4 m Large Binocular Telescope (+MODS1 and PEPSI) between 2013 August and 2015 September. The PEPSI spectra cover all or part of the 384-907 nm spectral region at a resolution of up to 270,000 (1 km/s). This is the highest resolution available on any 8-10 m class telescope. V339 Del was discovered on 2015 August 14.58 by Itagaki at V about 6.8. This nova reached a peak magnitude of about 4.3 making it one of the brightest novae of this century. Because of its exceptional brightness it has been observed at a variety of wavelengths and by a host of observatories both on the ground and in space. V5668 Sgr was discovered on 2015 March 15.634 by Seach at a magnitude of 6.0. It subsequently reached a maximum brightness of about 4.0 in late March. High resolution PEPSI spectra obtained in early April show dramatic variations in the multi-component P Cygni-type line profiles. V5668 Sgr was observed to form dust in June thereafter fading to about 13th magnitude. Our recent observations show that it has now evolved into the nebular phase. SS acknowledges partial support from NSF and NASA grants to ASU. CEW acknowledges support from NASA.

Low Mass X-ray Binary 4U1705-44 Exiting an Extended High X-ray State

Science.gov (United States)

Phillipson, Rebecca; Boyd, Patricia T.; Smale, Alan P.

2017-09-01

The neutron-star low-mass X-ray binary 4U1705-44, which exhibited high amplitude long-term X-ray variability on the order of hundreds of days during the 16-year continuous monitoring by the RXTE ASM (1995-2012), entered an anomalously long high state in July 2012 as observed by MAXI (2009-present).

Discovery of an Accreting Millisecond Pulsar in the Eclipsing Binary System SWIFT J1749.4-2807

NARCIS (Netherlands)

Altamirano, D.; Cavecchi, Y.; Patruno, A.; Watts, A.; Linares, M.; Degenaar, N.; Kalamkar, M.; van der Klis, M.; Rea, N.; Casella, P.; Padilla, M. Armas; Kaur, R.; Yang, Y. J.; Soleri, P.; Wijnands, R.

2011-01-01

We report on the discovery and the timing analysis of the first eclipsing accretion-powered millisecond X-ray pulsar (AMXP): SWIFT J1749.4-2807. The neutron star rotates at a frequency of similar to 517.9 Hz and is in a binary system with an orbital period of 8.8 hr and a projected semimajor axis of

Massive binaries in the vicinity of Sgr A*

Energy Technology Data Exchange (ETDEWEB)

Pfuhl, O.; Gillessen, S.; Genzel, R.; Eisenhauer, F.; Fritz, T. K.; Ott, T. [Max-Planck-Institut für Extraterrestrische Physik, D-85748 Garching (Germany); Alexander, T. [Faculty of Physics, Weizmann Institute of Science, P.O. Box 26, Rehovot 76100 (Israel); Martins, F., E-mail: pfuhl@mpe.mpg.de [LUPM, Université Montpelier 2, CNRS, Place Eugéne Bataillon, F-34095, Montpellier (France)

2014-02-20

A long-term spectroscopic and photometric survey of the most luminous and massive stars in the vicinity of the supermassive black hole Sgr A* revealed two new binaries: a long-period Ofpe/WN9 binary, IRS 16NE, with a modest eccentricity of 0.3 and a period of 224 days, and an eclipsing Wolf-Rayet binary with a period of 2.3 days. Together with the already identified binary IRS 16SW, there are now three confirmed OB/WR binaries in the inner 0.2 pc of the Galactic center. Using radial velocity change upper limits, we were able to constrain the spectroscopic binary fraction in the Galactic center to F{sub SB}=0.30{sub −0.21}{sup +0.34} at a confidence level of 95%, a massive binary fraction close to that observed in dense clusters. The fraction of eclipsing binaries with photometric amplitudes Δm > 0.4 is F{sub EB}{sup GC}=3%±2%, which is consistent with local OB star clusters (F {sub EB} = 1%). Overall, the Galactic center binary fraction seems to be similar to the binary fraction in comparable young clusters.

Effect of operational factors on bioregeneration of binary phenol and 4-chlorophenol-loaded granular activated carbon using PVA-immobilized biomass cryogels.

Science.gov (United States)

Leong, Kwok-Yii; Adnan, Rohana; Lim, Poh-Eng; Ng, Si-Ling; Seng, Chye-Eng

2017-09-01

The effects of dry biomass density in cryogel beads, shaking speed and initial concentration ratio of phenol to 4-chlorophenol (4-CP) on the bioregeneration efficiencies of binary phenol and 4-CP-loaded granular activated carbon (GAC) for phenol and 4-CP, respectively, were investigated under the simultaneous adsorption and biodegradation approach. The results revealed higher bioregeneration efficiencies of binary-loaded GAC for phenol and 4-CP at higher dry biomass density but moderate shaking speed. The optimum dry biomass density in cryogel beads and shaking speed for use in bioregeneration were found to be 0.01 g/mL and 250 rpm, respectively. With respect to the initial phenol to 4-CP concentration ratio, the bioregeneration efficiencies were lower under increasing phenol and 4-CP initial concentrations, respectively, with the effect being more conspicuous under increasing 4-CP concentration. Higher bioregeneration efficiencies were achieved with the use of immobilized rather than suspended biomasses.

THE CLOSE BINARY FRACTION OF DWARF M STARS

International Nuclear Information System (INIS)

Clark, Benjamin M.; Blake, Cullen H.; Knapp, Gillian R.

2012-01-01

We describe a search for close spectroscopic dwarf M star binaries using data from the Sloan Digital Sky Survey to address the question of the rate of occurrence of multiplicity in M dwarfs. We use a template-fitting technique to measure radial velocities from 145,888 individual spectra obtained for a magnitude-limited sample of 39,543 M dwarfs. Typically, the three or four spectra observed for each star are separated in time by less than four hours, but for ∼17% of the stars, the individual observations span more than two days. In these cases we are sensitive to large-amplitude radial velocity variations on timescales comparable to the separation between the observations. We use a control sample of objects having observations taken within a four-hour period to make an empirical estimate of the underlying radial velocity error distribution and simulate our detection efficiency for a wide range of binary star systems. We find the frequency of binaries among the dwarf M stars with a < 0.4 AU to be 3%-4%. Comparison with other samples of binary stars demonstrates that the close binary fraction, like the total binary fraction, is an increasing function of primary mass.

THE CLOSE BINARY FRACTION OF DWARF M STARS

Energy Technology Data Exchange (ETDEWEB)

Clark, Benjamin M. [Penn Manor High School, 100 East Cottage Avenue, Millersville, PA 17551 (United States); Blake, Cullen H.; Knapp, Gillian R. [Princeton University, Department of Astrophysical Sciences, Peyton Hall, Ivy Lane, Princeton, NJ 08544 (United States)

2012-01-10

We describe a search for close spectroscopic dwarf M star binaries using data from the Sloan Digital Sky Survey to address the question of the rate of occurrence of multiplicity in M dwarfs. We use a template-fitting technique to measure radial velocities from 145,888 individual spectra obtained for a magnitude-limited sample of 39,543 M dwarfs. Typically, the three or four spectra observed for each star are separated in time by less than four hours, but for {approx}17% of the stars, the individual observations span more than two days. In these cases we are sensitive to large-amplitude radial velocity variations on timescales comparable to the separation between the observations. We use a control sample of objects having observations taken within a four-hour period to make an empirical estimate of the underlying radial velocity error distribution and simulate our detection efficiency for a wide range of binary star systems. We find the frequency of binaries among the dwarf M stars with a < 0.4 AU to be 3%-4%. Comparison with other samples of binary stars demonstrates that the close binary fraction, like the total binary fraction, is an increasing function of primary mass.

The white dwarf binary pathways survey - II. Radial velocities of 1453 FGK stars with white dwarf companions from LAMOST DR 4

Science.gov (United States)

Rebassa-Mansergas, A.; Ren, J. J.; Irawati, P.; García-Berro, E.; Parsons, S. G.; Schreiber, M. R.; Gänsicke, B. T.; Rodríguez-Gil, P.; Liu, X.; Manser, C.; Nevado, S. P.; Jiménez-Ibarra, F.; Costero, R.; Echevarría, J.; Michel, R.; Zorotovic, M.; Hollands, M.; Han, Z.; Luo, A.; Villaver, E.; Kong, X.

2017-12-01

We present the second paper of a series of publications aiming at obtaining a better understanding regarding the nature of type Ia supernovae (SN Ia) progenitors by studying a large sample of detached F, G and K main-sequence stars in close orbits with white dwarf companions (i.e. WD+FGK binaries). We employ the Large Sky Area Multi-Object Fibre Spectroscopic Telescope (LAMOST) data release 4 spectroscopic data base together with Galaxy Evolution Explorer (GALEX) ultraviolet fluxes to identify 1549 WD+FGK binary candidates (1057 of which are new), thus doubling the number of known sources. We measure the radial velocities of 1453 of these binaries from the available LAMOST spectra and/or from spectra obtained by us at a wide variety of different telescopes around the globe. The analysis of the radial velocity data allows us to identify 24 systems displaying more than 3σ radial velocity variation that we classify as close binaries. We also discuss the fraction of close binaries among WD+FGK systems, which we find to be ∼10 per cent, and demonstrate that high-resolution spectroscopy is required to efficiently identify double-degenerate SN Ia progenitor candidates.

The binary white dwarf LHS 3236

Energy Technology Data Exchange (ETDEWEB)

Harris, Hugh C.; Dahn, Conard C.; Canzian, Blaise; Guetter, Harry H.; Levine, Stephen E.; Luginbuhl, Christian B.; Monet, Alice K. B.; Stone, Ronald C.; Subasavage, John P.; Tilleman, Trudy; Walker, Richard L. [US Naval Observatory, 10391 West Naval Observatory Road, Flagstaff, AZ 86001-8521 (United States); Dupuy, Trent J.; Liu, Michael C. [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Hartkopf, William I. [US Naval Observatory, 3450 Massachusetts Avenue, N.W., Washington, DC 20392-5420 (United States); Ireland, Michael J. [Department of Physics and Astronomy, Macquarie University, New South Wales, NSW 2109 (Australia); Leggett, S. K., E-mail: hch@nofs.navy.mil [Gemini Observatory, 670 N. Aohoku Place, Hilo, HI 96720 (United States)

2013-12-10

The white dwarf LHS 3236 (WD1639+153) is shown to be a double-degenerate binary, with each component having a high mass. Astrometry at the U.S. Naval Observatory gives a parallax and distance of 30.86 ± 0.25 pc and a tangential velocity of 98 km s{sup –1}, and reveals binary orbital motion. The orbital parameters are determined from astrometry of the photocenter over more than three orbits of the 4.0 yr period. High-resolution imaging at the Keck Observatory resolves the pair with a separation of 31 and 124 mas at two epochs. Optical and near-IR photometry give a set of possible binary components. Consistency of all data indicates that the binary is a pair of DA stars with temperatures near 8000 and 7400 K and with masses of 0.93 and 0.91 M {sub ☉}; also possible is a DA primary and a helium DC secondary with temperatures near 8800 and 6000 K and with masses of 0.98 and 0.69 M {sub ☉}. In either case, the cooling ages of the stars are ∼3 Gyr and the total ages are <4 Gyr. The combined mass of the binary (1.66-1.84 M {sub ☉}) is well above the Chandrasekhar limit; however, the timescale for coalescence is long.

Structure and properties of Mn4Cl9: An antiferromagnetic binary hyperhalogen

Science.gov (United States)

Li, Yawei; Zhang, Shunhong; Wang, Qian; Jena, Puru

2013-02-01

Calculations based on density functional theory show that the structure of Mn4Cl9 anion is that of a Mn atom at the core surrounded by three MnCl3 moieties. Since Mn is predominantly divalent and MnCl3 is known to be a superhalogen with a vertical detachment energy (VDE) of 5.27 eV, Mn4Cl9 can be viewed as a hyperhalogen with the formula unit Mn(MnCl3)3. Indeed, the calculated VDE of Mn4Cl9 anion, namely 6.76 eV, is larger than that of MnCl3 anion. More importantly, unlike previously discovered hyperhalogens, Mn4Cl9 is the first such hyperhalogen species composed of only two constituent atoms. We further show that Mn4Cl9 can be used as a ligand to design molecules with even higher VDEs. For example, Li[Mn(MnCl3)3]2 anion has a VDE of 7.26 eV. These negatively charged clusters are antiferromagnetic with most of the magnetic moments localized at the Mn sites. Our studies show new pathways for creating binary hyperhalogens.

Wind accretion in the massive X-ray binary 4U 2206+54: abnormally slow wind and a moderately eccentric orbit

Science.gov (United States)

Ribó, M.; Negueruela, I.; Blay, P.; Torrejón, J. M.; Reig, P.

2006-04-01

Massive X-ray binaries are usually classified by the properties of the donor star in classical, supergiant and Be X-ray binaries, the main difference being the mass transfer mechanism between the two components. The massive X-ray binary 4U 2206+54 does not fit in any of these groups, and deserves a detailed study to understand how the transfer of matter and the accretion on to the compact object take place. To this end we study an IUE spectrum of the donor and obtain a wind terminal velocity (v_∞) of ~350 km s-1, which is abnormally slow for its spectral type. We also analyse here more than 9 years of available RXTE/ASM data. We study the long-term X-ray variability of the source and find it to be similar to that observed in the wind-fed supergiant system Vela X-1, reinforcing the idea that 4U 2206+54 is also a wind-fed system. We find a quasi-period decreasing from ~270 to ~130 d, noticed in previous works but never studied in detail. We discuss possible scenarios for its origin and conclude that long-term quasi-periodic variations in the mass-loss rate of the primary are probably driving such variability in the measured X-ray flux. We obtain an improved orbital period of P_orb=9.5591±0.0007 d with maximum X-ray flux at MJD 51856.6±0.1. Our study of the orbital X-ray variability in the context of wind accretion suggests a moderate eccentricity around 0.15 for this binary system. Moreover, the low value of v_∞ solves the long-standing problem of the relatively high X-ray luminosity for the unevolved nature of the donor, BD +53°2790, which is probably an O9.5 V star. We note that changes in v_∞ and/or the mass-loss rate of the primary alone cannot explain the different patterns displayed by the orbital X-ray variability. We finally emphasize that 4U 2206+54, together with LS 5039, could be part of a new population of wind-fed HMXBs with main sequence donors, the natural progenitors of supergiant X-ray binaries.

UPLC TOF MS for sensitive quantification of naturally occurring pyrrolizidine alkaloids in Petasites hybridus extract (Ze 339).

Science.gov (United States)

Schenk, Alexander; Siewert, Beate; Toff, Stephan; Drewe, Jürgen

2015-08-01

Due to increasing regulatory awareness of their hepatotoxic, genotoxic and possibly carcinogenic potential, pyrrolizidine alkaloid (PA) content has to be thoroughly monitored in herbal medicinal preparations. Recently, new very low PA regulatory threshold concentrations have been requested by the authorities. Therefore, a highly sensitive and reproducible UPLC TOF MS method for the quantification of the PAs senkirkine, senecionine, seneciphylline, senecionine-N-oxide and seneciphylline-N-oxide in a CO2-extract of Petasites hybridus leaves (Ze 339) has been developed. The limit of quantification (LOQ) was 2ppb for all PAs. Recovery at the LOQ was between 88.9 and 141.9%, the repeatability precision between 3.5 and 13.6%. Linearity of the five PAs showed correlation coefficients between 0.9995 and 0.9998 and coefficients of variation between 7.44 and 8.56%. A working range between 2 ppb and 200 ppb could be fixed. In the tested batches of the P. hybridus extract Ze 339, the absence of PAs could be demonstrated. In conclusion, this assay allows to determine trace PA concentrations in P. hybridus extract Ze 339, making it suitable for analytical PA monitoring in accordance with regulatory requirements. Copyright © 2015 The Authors. Published by Elsevier B.V. All rights reserved.

［BMim］［HSO4］-H2SO4二组分物系密度的测定及相关热力学性质的研究%Density and thermodynamic properties of binary[BMim][HSO4]-H2SO4 system

Institute of Scientific and Technical Information of China (English)

张帅; 张涛; 唐盛伟

2016-01-01

在常压和283.15～313.15 K的温度范围内，测定了离子液体1-丁基-3-甲基咪唑硫酸氢盐（[BMim][HSO4]）与H2SO4二组分物系在全浓度范围内的密度，由密度数据计算了不同温度和浓度下混合物的超额摩尔体积（VE）和各组分的偏摩尔体积，基于半经验Zhang方程和NMSRK状态方程建立了二组分物系密度的预测模型。实验结果表明，两种模型的计算值与实验值具有较高的符合度，其平均绝对误差均不超过0.30%；在全浓度范围内二组分物系的VE均为正值，当xH2SO4=0.60时，物系的VE达到最大，最大值为2.46280 cm3/mol（313.15 K）；二组分物系中[BMim][HSO4]的偏摩尔体积随xH2SO4的增大而增大， H2SO4的偏摩尔体积随xH2SO4的增大而减小。%Under the conditions of ambient pressure and 283.15-313.15 K,the density of binary [BMim][HSO4]-H2SO4 systems with the molar fraction of H2SO4 of 0-1 was measured. Based on the obtained density data,the excess molar volume of the systems and the partial molar volumes of the two components at different temperature were calculated. The models for predicting the density of the binary systems were established by means of the semi-empirical Zhang model and NMSRK equation of state separately. It was showed that,the two models predict the density of the binary systems well with an average deviation of less than 0.30%. The excess molar volumes of all the measured binary systems were greater than zero and the maximum value of 2.462 80 cm3/mol was obtained under the conditions of molar fracton of H2SO4 0.60 and 313.15 K. In the binary systems,with increasing the molar fraction of H2SO4, the partial molar volume of[BMim][HSO4] increased while the partial molar volume of H2SO4 decreased.

The Frequency of Binary Stars in the Globular Cluster M71

Science.gov (United States)

Barden, S. C.; Armandroff, T. E.; Pryor, C. P.

1994-12-01

The frequency of binary stars is a fundamental property of a stellar population. A comparison of the frequency of binaries in globular clusters with those in the field halo and disk populations tests the similarity of star formation in those environments. Binary stars in globular clusters also act as an energy source which ``heats" the cluster through super-elastic encounters with other stars and binaries. Such encounters can not only profoundly affect the dynamical evolution of the cluster, they can disrupt the widely separated binaries and catalyze the formation of exotic objects such as blue stragglers, x-ray binaries, and milli-second pulsars. We have used the KPNO 4-m and the multi-fiber instruments Nessie and Hydra to measure radial velocities at 4 epochs over two years for a sample of 126 stars in the globular cluster M71. Velocity errors are under 1 km s(-1) for the brighter stars and under 2 km s(-1) for the majority of our data set. These velocities will be valuable for studying the kinematics of M71, but here we focus on searching for binaries. The faintest stars are at V=17, or just above the main sequence turnoff. Our sample is thus deeper than any published globular cluster binary search utilizing spectroscopic techniques. By observing smaller stars, we double the number of decades of binary periods sampled compared to previous studies and come within a factor of 4 of the shortest possible periods for turnoff stars. This wider period window has produced the largest known sample of binaries in a globular cluster. Four stars show velocity ranges larger than 20 km s(-1) , nine have ranges larger than 10 km s(-1) , and others are clearly variable. We will compare the radial distribution of these stars to that predicted by theory and derive the main-sequence binary fraction.

Ebulliometric determination and prediction of (vapor + liquid) equilibria for binary and ternary mixtures containing alcohols (C1-C4) and dimethyl carbonate

International Nuclear Information System (INIS)

Matsuda, Hiroyuki; Fukano, Makoto; Kikkawa, Shinichiro; Constantinescu, Dana; Kurihara, Kiyofumi; Tochigi, Katsumi; Ochi, Kenji; Gmehling, Juergen

2012-01-01

Highlights: → The VLE behavior of systems containing dimethyl carbonate (DMC) was investigated. → VLE data for ternary and binary mixtures containing alcohol and DMC were measured. → Several activity coefficient models were used for data reduction or prediction. → Valley line, i.e., distillation boundary, was observed for the ternary mixture. → Residue curves were calculated to investigate composition profile for distillation. - Abstract: (Vapor + liquid) equilibrium (VLE) data for a ternary mixture, namely {methanol + propan-1-ol + dimethyl carbonate (DMC)}, and four binary mixtures, namely an {alcohol (C 3 or C 4 ) + DMC}, containing the binary constituent mixtures of the ternary mixture, were measured at p = (40.00 to 93.32) kPa using a modified Swietoslawski-type ebulliometer. The experimental data for the binary systems were correlated using the Wilson model. The Wilson model was also applied to the ternary system to predict the VLE behavior using parameters from the binary mixtures. The modified UNIFAC (Dortmund) model was also tested for the predictions of the VLE behavior of the binary and ternary mixtures. In addition, the experimental VLE data for the ternary and constituent binary mixtures were correlated using the extended Redlich-Kister (ERK) model, which can completely represent the azeotropic points. For the ternary system, a comparison of the experimental and the predicted or correlated boiling points obtained using the Wilson and ERK models showed that the ERK model is more accurate. The valley line, i.e., the curve which divides the patterns of vapor-liquid tie lines, was found in the (methanol + propan-1-ol + DMC) system. This valley line could be represented by the ERK model. Finally, the composition profile for simple distillation of this ternary mixture was obtained by analysis of the residue curves from the estimated Wilson parameters of the constituent binary mixtures.

Probabilistic seismic history matching using binary images

Science.gov (United States)

Davolio, Alessandra; Schiozer, Denis Jose

2018-02-01

Currently, the goal of history-matching procedures is not only to provide a model matching any observed data but also to generate multiple matched models to properly handle uncertainties. One such approach is a probabilistic history-matching methodology based on the discrete Latin Hypercube sampling algorithm, proposed in previous works, which was particularly efficient for matching well data (production rates and pressure). 4D seismic (4DS) data have been increasingly included into history-matching procedures. A key issue in seismic history matching (SHM) is to transfer data into a common domain: impedance, amplitude or pressure, and saturation. In any case, seismic inversions and/or modeling are required, which can be time consuming. An alternative to avoid these procedures is using binary images in SHM as they allow the shape, rather than the physical values, of observed anomalies to be matched. This work presents the incorporation of binary images in SHM within the aforementioned probabilistic history matching. The application was performed with real data from a segment of the Norne benchmark case that presents strong 4D anomalies, including softening signals due to pressure build up. The binary images are used to match the pressurized zones observed in time-lapse data. Three history matchings were conducted using: only well data, well and 4DS data, and only 4DS. The methodology is very flexible and successfully utilized the addition of binary images for seismic objective functions. Results proved the good convergence of the method in few iterations for all three cases. The matched models of the first two cases provided the best results, with similar well matching quality. The second case provided models presenting pore pressure changes according to the expected dynamic behavior (pressurized zones) observed on 4DS data. The use of binary images in SHM is relatively new with few examples in the literature. This work enriches this discussion by presenting a new

Rotation Determinations for 50 Virginia, 58 Concordia 307 Nike, and 339 Dorothea

Science.gov (United States)

Pilcher, Frederick

2016-10-01

Synodic rotation periods and amplitudes are found for 50 Virginia 14.320 ± 0.001 hours, amplitude 0.10 ± 0.01 magnitudes; 58 Concordia 9.895 ± 0.001 hours, 0.10 ± 0.01 magnitudes; 307 Nike 11.857 ± 0.001 hours, 0.20 ± 0.02 magnitudes; 339 Dorothea 5.9684 ± 0.0001 hours, 0.09 ± 0.01 magnitudes. Both 50 Virginia and 58 Concordia have irregular lightcurves.

Pulsars in binary systems: probing binary stellar evolution and general relativity.

Science.gov (United States)

Stairs, Ingrid H

2004-04-23

Radio pulsars in binary orbits often have short millisecond spin periods as a result of mass transfer from their companion stars. They therefore act as very precise, stable, moving clocks that allow us to investigate a large set of otherwise inaccessible astrophysical problems. The orbital parameters derived from high-precision binary pulsar timing provide constraints on binary evolution, characteristics of the binary pulsar population, and the masses of neutron stars with different mass-transfer histories. These binary systems also test gravitational theories, setting strong limits on deviations from general relativity. Surveys for new pulsars yield new binary systems that increase our understanding of all these fields and may open up whole new areas of physics, as most spectacularly evidenced by the recent discovery of an extremely relativistic double-pulsar system.

A study of non-binary discontinuity wavelet

International Nuclear Information System (INIS)

Lin Hai; Liu Lianshou

2006-01-01

This paper gives a study of non-binary discontinuity wavelet, put forward the theory and method of constituting basic wavelet functions, and has constituted concretely a wavelet function using λ=3.4 as an example. It also conducts a theoretical inference on the decomposition algorithm and reconstruction algorithm of non-binary wavelet, and gives a concrete study of the change of matrix in connection with λ=3.4. In the end, it shows the future of application of the result to the study of high energy collision. (authors)

Pleistocene calcareous nannofossil biochronology at IODP Site U1385 (Expedition 339)

Science.gov (United States)

Balestra, B.; Flores, J.-A.; Hodell, D. A.; Hernández-Molina, F. J.; Stow, D. A. V.

2015-12-01

During Integrated Ocean Drilling Program (IODP) Expedition 339, Site U1385 (37°34‧N, 10°7‧W, 2578 m below sea level) was drilled in the lower slope of the Portuguese margin, to provide a marine reference section of Pleistocene millennial-scale climate variability. Five holes were cored using the Advanced Piston Corer (APC) to a depth of ~ 151 m below sea floor (mbsf) recovering a continuous stratigraphic record covering the past 1.4 Ma. Here we present results of the succession of standard and unconventional calcareous nannofossil biostratigraphic events. The quantitative study of calcareous nannofossils showed well-preserved and abundant assemblages throughout the core. Most conventional Pleistocene events were recognized and the timing of bioevents were calibrated using correlation to the new oxygen isotope stratigraphy record developed for the Site U1385. The analyses provide further data on the stratigraphic distribution of selected species and genera, such as the large Emiliania huxleyi (> 4 μm), Gephyrocapsa caribbeanica, Helicosphaera inversa, Gephyrocapsa omega and Reticulofenestra asanoi (> 6 μm) and other circular-subcircular small reticulofenestrids, resulting in new insights into the environmental control of their stratigraphic patterns. Finally, the comparison between nannofossil datums and oxygen isotope stratigraphy on the same samples has resulted in an accurate revision of timing of the events, providing valuable biochronologic information.

Trojan Binaries

Science.gov (United States)

Noll, K. S.

2017-12-01

The Jupiter Trojans, in the context of giant planet migration models, can be thought of as an extension of the small body populations found beyond Neptune in the Kuiper Belt. Binaries are a distinctive feature of small body populations in the Kuiper Belt with an especially high fraction apparent among the brightest Cold Classicals. The binary fraction, relative sizes, and separations in the dynamically excited populations (Scattered, Resonant) reflects processes that may have eroded a more abundant initial population. This trend continues in the Centaurs and Trojans where few binaries have been found. We review new evidence including a third resolved Trojan binary and lightcurve studies to understand how the Trojans are related to the small body populations that originated in the outer protoplanetary disk.

EVIDENCE FOR SIMULTANEOUS JETS AND DISK WINDS IN LUMINOUS LOW-MASS X-RAY BINARIES

Energy Technology Data Exchange (ETDEWEB)

Homan, Jeroen; Neilsen, Joseph; Allen, Jessamyn L.; Chakrabarty, Deepto; Remillard, Ronald A.; Schulz, Norbert [MIT Kavli Institute for Astrophysics and Space Research, 77 Massachusetts Avenue 37-582D, Cambridge, MA 02139 (United States); Fender, Rob [Astrophysics, Department of Physics, University of Oxford, Keble Road, Oxford OX1 3RH (United Kingdom); Fridriksson, Joel K., E-mail: jeroen@space.mit.edu [Anton Pannekoek Institute, University of Amsterdam, Postbus 94249, 1090 GE Amsterdam (Netherlands)

2016-10-10

Recent work on jets and disk winds in low-mass X-ray binaries (LMXBs) suggests that they are to a large extent mutually exclusive, with jets observed in spectrally hard states and disk winds observed in spectrally soft states. In this paper we use existing literature on jets and disk winds in the luminous neutron star (NS) LMXB GX 13+1, in combination with archival Rossi X-ray Timing Explorer data, to show that this source is likely able to produce jets and disk winds simultaneously. We find that jets and disk winds occur in the same location on the source’s track in its X-ray color–color diagram. A further study of literature on other luminous LMXBs reveals that this behavior is more common, with indications for simultaneous jets and disk winds in the black hole LMXBs V404 Cyg and GRS 1915+105 and the NS LMXBs Sco X-1 and Cir X-1. For the three sources for which we have the necessary spectral information, we find that simultaneous jets/winds all occur in their spectrally hardest states. Our findings indicate that in LMXBs with luminosities above a few tens of percent of the Eddington luminosity, jets and disk winds are not mutually exclusive, and the presence of disk winds does not necessarily result in jet suppression.

ICAROG: a computer code that converts a WIMSD/4 format library of BCD code to binary and vice versa

International Nuclear Information System (INIS)

Caldeira, A.D.

1991-09-01

A program called ICAROG, developed for the CYBER 170/750 system, that converts from BCD to binary code and vice versa a nuclear data library in WIMSD/4 program format is presented. ICAROG has also the capability of separating from the library isotopes specified by the user. (author)

Young and Waltzing Binary Stars

Science.gov (United States)

2001-10-01

ADONIS Observes Low-mass Eclipsing System in Orion Summary A series of very detailed images of a binary system of two young stars have been combined into a movie . In merely 3 days, the stars swing around each other. As seen from the earth, they pass in front of each other twice during a full revolution, producing eclipses during which their combined brightness diminishes . A careful analysis of the orbital motions has now made it possible to deduce the masses of the two dancing stars . Both turn out to be about as heavy as our Sun. But while the Sun is about 4500 million years old, these two stars are still in their infancy. They are located some 1500 light-years away in the Orion star-forming region and they probably formed just 10 million years ago . This is the first time such an accurate determination of the stellar masses could be achieved for a young binary system of low-mass stars . The new result provides an important piece of information for our current understanding of how young stars evolve. The observations were obtained by a team of astronomers from Italy and ESO [1] using the ADaptive Optics Near Infrared System (ADONIS) on the 3.6-m telescope at the ESO La Silla Observatory. PR Photo 29a/01 : The RXJ 0529.4+0041 system before primary eclipse PR Photo 29b/01 : The RXJ 0529.4+0041 system at mid-primary eclipse PR Photo 29c/01 : The RXJ 0529.4+0041 system after primary eclipse PR Photo 29d/01 : The RXJ 0529.4+0041 system before secondary eclipse PR Photo 29e/01 : The RXJ 0529.4+0041 system at mid-secondary eclipse PR Photo 29f/01 : The RXJ 0529.4+0041 system after secondary eclipse PR Video Clip 06/01 : Video of the RXJ 0529.4+0041 system Binary stars and stellar masses Since some time, astronomers have noted that most stars seem to form in binary or multiple systems. This is quite fortunate, as the study of binary stars is the only way in which it is possible to measure directly one of the most fundamental quantities of a star, its mass. The mass of a

Formation and Evolution of X-ray Binaries

Science.gov (United States)

Shao, Y.

2017-07-01

-donor mass plane increases with the increasing neutron star mass. This may help to explain why some millisecond pulsars with orbital periods longer than ˜ 60 d seem to have less massive white dwarfs than expected. Alternatively, some of these wide binary pulsars may be formed through mass transfer driven by planet/brown dwarf-involved common envelope evolution; (2) Some of the pulsars in compact binaries might have evolved from intermediate-mass X-ray binaries with an anomalous magnetic braking; (3) The equilibrium spin periods of neutron stars in low-mass X-ray binaries are in general shorter than the observed spin periods of binary pulsars by more than one order of magnitude, suggesting that either the simple equilibrium spin model does not apply, or there are other mechanisms/processes spinning down the neutron stars. In Chapter 4, angular momentum loss mechanisms in the cataclysmic variables below the period gap are presented. By considering several kinds of consequential angular momentum loss mechanisms, we find that neither isotropic wind from the white dwarf nor outflow from the L1 point can explain the extra angular momentum loss rate, while an ouflow from the L2 point or a circumbinary disk can effectively extract the angular momentum provided that ˜ 15%-45% of the transferred mass is lost from the binary. A more promising mechanism is a circumbinary disk exerting a gravitational torque on the binary. In this case the mass loss fraction can be as low as ≲ 10-3. In Chapter 5 we present a study on the population of ultraluminous X-ray sources with an accreting neutron star. Most ULXs are believed to be X-ray binary systems, but previous observational and theoretical studies tend to prefer a black hole rather than a neutron star accretor. The recent discovery of 1.37 s pulsations from the ULX M82 X-2 has established its nature as a magnetized neutron star. In this chapter we model the formation history of neutron star ULXs in an M82- or Milky Way-like galaxy, by

Dynamical evolution of a fictitious population of binary Neptune Trojans

Science.gov (United States)

Brunini, Adrián

2018-03-01

We present numerical simulations of the evolution of a synthetic population of Binary Neptune Trojans, under the influence of the solar perturbations and tidal friction (the so-called Kozai cycles and tidal friction evolution). Our model includes the dynamical influence of the four giant planets on the heliocentric orbit of the binary centre of mass. In this paper, we explore the evolution of initially tight binaries around the Neptune L4 Lagrange point. We found that the variation of the heliocentric orbital elements due to the libration around the Lagrange point introduces significant changes in the orbital evolution of the binaries. Collisional processes would not play a significant role in the dynamical evolution of Neptune Trojans. After 4.5 × 109 yr of evolution, ˜50 per cent of the synthetic systems end up separated as single objects, most of them with slow diurnal rotation rate. The final orbital distribution of the surviving binary systems is statistically similar to the one found for Kuiper Belt Binaries when collisional evolution is not included in the model. Systems composed by a primary and a small satellite are more fragile than the ones composed by components of similar sizes.

Improvement of Binary Analysis Components in Automated Malware Analysis Framework

Science.gov (United States)

2017-02-21

AFRL-AFOSR-JP-TR-2017-0018 Improvement of Binary Analysis Components in Automated Malware Analysis Framework Keiji Takeda KEIO UNIVERSITY Final...TYPE Final 3. DATES COVERED (From - To) 26 May 2015 to 25 Nov 2016 4. TITLE AND SUBTITLE Improvement of Binary Analysis Components in Automated Malware ...analyze malicious software ( malware ) with minimum human interaction. The system autonomously analyze malware samples by analyzing malware binary program

Testing the Binary Black Hole Nature of a Compact Binary Coalescence.

Science.gov (United States)

Krishnendu, N V; Arun, K G; Mishra, Chandra Kant

2017-09-01

We propose a novel method to test the binary black hole nature of compact binaries detectable by gravitational wave (GW) interferometers and, hence, constrain the parameter space of other exotic compact objects. The spirit of the test lies in the "no-hair" conjecture for black holes where all properties of a Kerr black hole are characterized by its mass and spin. The method relies on observationally measuring the quadrupole moments of the compact binary constituents induced due to their spins. If the compact object is a Kerr black hole (BH), its quadrupole moment is expressible solely in terms of its mass and spin. Otherwise, the quadrupole moment can depend on additional parameters (such as the equation of state of the object). The higher order spin effects in phase and amplitude of a gravitational waveform, which explicitly contains the spin-induced quadrupole moments of compact objects, hence, uniquely encode the nature of the compact binary. Thus, we argue that an independent measurement of the spin-induced quadrupole moment of the compact binaries from GW observations can provide a unique way to distinguish binary BH systems from binaries consisting of exotic compact objects.

Decay properties of {sup 256-339}Ds superheavy nuclei

Energy Technology Data Exchange (ETDEWEB)

Santhosh, K.P.; Nithya, C. [Kannur University, School of Pure and Applied Physics, Payyanur, Kerala (India)

2017-09-15

The decay properties of 84 isotopes of darmstadtium superheavy nuclei (Z = 110) have been studied using various theoretical models. The proton emission half-lives, the alpha decay half-lives, the spontaneous fission half-lives and the cluster decay half-lives of all the isotopes are evaluated. The one-proton emission half-lives and the alpha decay half-lives are predicted using the Coulomb and proximity potential model for deformed nuclei (CPPMDN). The calculated alpha half-lives are compared with the available experimental results as well as with the predictions of other theoretical models. The predicted half-lives matches well with the experimental results. The one-proton half-lives are also compared with the predictions using other formalisms. The shell-effect-dependent formula of Santhosh et al. has been employed for calculating the spontaneous fission half-lives. A theoretical comparison of spontaneous fission half-lives with four different formalisms is performed. By comparing the one-proton emission half-lives, the alpha decay half-lives and the spontaneous fission half-lives decay modes are predicted for all the isotopes of Ds. It is seen that the isotopes within the range 256 ≤ A ≤ 263 and 279 ≤ A ≤ 339 decay through spontaneous fission and the isotopes 264 ≤ A ≤ 278 exhibit alpha decay. Cluster decay half-lives are calculated using different models including the Coulomb and proximity potential (CPPM), for determining the magicities in the superheavy region. The effect of magicity at N = 184 and N = 202 were confirmed from the plot of log{sub 10}T{sub 1/2} versus neutron number of the daughter nuclei for the emission of different clusters. We hope that the systematic and detailed study of all the possible decay modes of {sup 256-339}Ds using various theoretical models will be helpful in the experimental identification of the isotopes of the element in the future. (orig.)

Binary Masking & Speech Intelligibility

DEFF Research Database (Denmark)

Boldt, Jesper

The purpose of this thesis is to examine how binary masking can be used to increase intelligibility in situations where hearing impaired listeners have difficulties understanding what is being said. The major part of the experiments carried out in this thesis can be categorized as either experime......The purpose of this thesis is to examine how binary masking can be used to increase intelligibility in situations where hearing impaired listeners have difficulties understanding what is being said. The major part of the experiments carried out in this thesis can be categorized as either...... experiments under ideal conditions or as experiments under more realistic conditions useful for real-life applications such as hearing aids. In the experiments under ideal conditions, the previously defined ideal binary mask is evaluated using hearing impaired listeners, and a novel binary mask -- the target...... binary mask -- is introduced. The target binary mask shows the same substantial increase in intelligibility as the ideal binary mask and is proposed as a new reference for binary masking. In the category of real-life applications, two new methods are proposed: a method for estimation of the ideal binary...

Study of complexation process between 4'-nitrobenzo-15-crown-5 and yttrium(III) cation in binary mixed non-aqueous solvents using conductometric method

Science.gov (United States)

Habibi, N.; Rounaghi, G. H.; Mohajeri, M.

2012-12-01

The complexation reaction of macrocyclic ligand (4'-nitrobenzo-15C5) with Y3+ cation was studied in acetonitrile-methanol (AN-MeOH), acetonitrile-ethanol (AN-EtOH), acetonitrile-dimethylformamide (AN-DMF) and ethylacetate-methanol (EtOAc-MeOH) binary mixtures at different temperatures using conductometry method. The conductivity data show that in all solvent systems, the stoichiometry of the complex formed between 4'-nitrobenzo-15C5 and Y3+ cation is 1: 1 (ML). The stability order of (4'-nitrobenzo-15C5). Y3+ complex in pure non-aqueous solvents at 25°C was found to be: EtOAc > EtOH > AN ≈ DMF > MeOH, and in the case of most compositions of the binary mixed solvents at 25°C it was: AN≈MeOH ≈ AN-EtOH > AN-DMF > EtOAc-MeOH. But the results indicate that the sequence of the stability of the complex in the binary mixed solutions changes with temperature. A non-linear behavior was observed for changes of log K f of (4'-nitrobenzo-15C5 · Y3+) complex versus the composition of the binary mixed solvents, which was explained in terms of solvent-solvent interactions and also the hetero-selective solvation of the species involved in the complexation reaction. The values of thermodynamic parameters (Δ H {c/ℴ} and Δ S {c/ℴ}) for formation of the complex were obtained from temperature dependent of the stability constant using the van't Hoff plots. The results represent that in most cases, the complex is both enthalpy and entropy stabilized and the values and also the sign of thermodynamic parameters are influenced by the nature and composition of the mixed solvents.

Interacting binary stars

CERN Document Server

Sahade, Jorge; Ter Haar, D

1978-01-01

Interacting Binary Stars deals with the development, ideas, and problems in the study of interacting binary stars. The book consolidates the information that is scattered over many publications and papers and gives an account of important discoveries with relevant historical background. Chapters are devoted to the presentation and discussion of the different facets of the field, such as historical account of the development in the field of study of binary stars; the Roche equipotential surfaces; methods and techniques in space astronomy; and enumeration of binary star systems that are studied

Qualitative and quantitative radiation protection analysis of mucosa of ICR strained mice using selected herbal extracts such as GC-2112 from garlic (Allium sativum) and GX-2137 from ginseng (Panax sp.)

International Nuclear Information System (INIS)

Bunagan, J.B.

2005-01-01

Full text: Earlier reports showed that ginseng has significant radioprotective and stimulatory effect on the recovery of the lymphocytes and leukocytes. Using graded absorbed doses of radiation (1.5, 5, 20, 50 Gy) applied in ICR strain male white mice which was injected with GX-2137 from ginseng (Panax sp.) and GC-2112 from garlic (Allium sativum) was tested to prove some radioprotective efficiency. The herbal extracts were injected intraperitoneally and the experimental mice were sacrificed 2 and 48 hrs post-irradiation. Factors such as analyzing kinetics of critical tissue parameters (length of villi, the number of crypt and villi cells and cell density) and determining the Relative Protection Efficiencies (RPE) using quantitative histopathological techniques were used to quantify the radiation protection assay in the duodenum of ICR strain mice. Results showed that GC-2112 and GX-2137 protected the villi structures. After 2 hrs. post irradiation, tissue degeneration was evident. RPE values of significant radioprotection of the crypts is demonstrated at absorbed dose. It was found that some villi cells are even viable at non-physiologic dose of 50 Gy. (author)

Dynamical Configuration of Binary Near-Earth Asteroid (66391) 1999 KW4

Czech Academy of Sciences Publication Activity Database

Scheeres, D.J.; Fahnestock, E.G.; Ostro, S. J.; Margot, J. L.; Benner, L. A. M.; Broschart, S.B.; Bellerose, J.; Giorgini, J. D.; Nolan, M. C.; Magri, C.; Pravec, Petr; Scheirich, Peter; Rose, R.; Jurgens, R. F.; De Jong, E. M.; Suzuki, S.

2006-01-01

Roč. 314, č. 5803 (2006), s. 1280-1283 ISSN 0036-8075 R&D Projects: GA ČR GA205/05/0604 Institutional research plan: CEZ:AV0Z10030501 Keywords : binary asteroid * dynamics Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 30.028, year: 2006

Evolutionary models of early-type contact binary SV Centauri

Energy Technology Data Exchange (ETDEWEB)

Nakamura, Y; Saio, H [Tohoku Univ., Sendai (Japan). Faculty of Science; Sugimoto, Daiichiro

1978-12-01

Models of the early-type contact binary system SV Centauri are computed with a binary-star evolution program. The effects of mass exchange, i.e., the effects of mass acceptance as well as mass loss, are properly included. With the initial masses of the component stars as 12.4 and 8.0 M sub(solar mass), the following observed configurations are well reproduced; the component stars are definitely in contact and the rate of mass exchange is 4 x 10/sup -4/ M sub(solar mass)yr/sup -1/. The more massive component is less luminous and has a lower effective temperature. Such features are also reproduced quantitatively. Agreement of the computed models with observation indicates that the binary system SV Cen is actually in the phase of rapid mass exchange preceding the mass-ratio reversal.

Gaia Assorted Mass Binaries Long Excluded from SLoWPoKES (GAMBLES): Identifying Ultra-wide Binary Pairs with Components of Diverse Mass

Energy Technology Data Exchange (ETDEWEB)

Oelkers, Ryan J.; Stassun, Keivan G.; Dhital, Saurav, E-mail: ryan.j.oelkers@vanderbilt.edu [Vanderbilt University, Department of Physics and Astronomy, Nashville, TN 37235 (United States)

2017-06-01

The formation and evolution of binary star systems are some of the remaining key questions in modern astronomy. Wide binary pairs (separations >10{sup 3} au) are particularly intriguing because their low binding energies make it difficult for the stars to stay gravitationally bound over extended timescales, and thus to probe the dynamics of binary formation and dissolution. Our previous SLoWPoKES catalogs, I and II, provided the largest and most complete sample of wide-binary pairs of low masses. Here we present an extension of these catalogs to a broad range of stellar masses: the Gaia Assorted Mass Binaries Long Excluded from SloWPoKES (GAMBLES), comprising 8660 statistically significant wide pairs that we make available in a living online database. Within this catalog we identify a subset of 543 long-lived (dissipation timescale >1.5 Gyr) candidate binary pairs, of assorted mass, with typical separations between 10{sup 3} and 10{sup 5.5} au (0.002–1.5 pc), using the published distances and proper motions from the Tycho -Gaia Astrometric Solution and Sloan Digital Sky Survey photometry. Each pair has at most a false positive probability of 0.05; the total expectation is 2.44 false binaries in our sample. Among these, we find 22 systems with 3 components, 1 system with 4 components, and 15 pairs consisting of at least 1 possible red giant. We find the largest long-lived binary separation to be nearly 3.2 pc; even so, >76% of GAMBLES long-lived binaries have large binding energies and dissipation lifetimes longer than 1.5 Gyr. Finally, we find that the distribution of binary separations is clearly bimodal, corroborating the findings from SloWPoKES and suggesting multiple pathways for the formation and dissipation of the widest binaries in the Galaxy.

Gaia Assorted Mass Binaries Long Excluded from SLoWPoKES (GAMBLES): Identifying Ultra-wide Binary Pairs with Components of Diverse Mass

International Nuclear Information System (INIS)

Oelkers, Ryan J.; Stassun, Keivan G.; Dhital, Saurav

2017-01-01

The formation and evolution of binary star systems are some of the remaining key questions in modern astronomy. Wide binary pairs (separations >10 3 au) are particularly intriguing because their low binding energies make it difficult for the stars to stay gravitationally bound over extended timescales, and thus to probe the dynamics of binary formation and dissolution. Our previous SLoWPoKES catalogs, I and II, provided the largest and most complete sample of wide-binary pairs of low masses. Here we present an extension of these catalogs to a broad range of stellar masses: the Gaia Assorted Mass Binaries Long Excluded from SloWPoKES (GAMBLES), comprising 8660 statistically significant wide pairs that we make available in a living online database. Within this catalog we identify a subset of 543 long-lived (dissipation timescale >1.5 Gyr) candidate binary pairs, of assorted mass, with typical separations between 10 3 and 10 5.5 au (0.002–1.5 pc), using the published distances and proper motions from the Tycho -Gaia Astrometric Solution and Sloan Digital Sky Survey photometry. Each pair has at most a false positive probability of 0.05; the total expectation is 2.44 false binaries in our sample. Among these, we find 22 systems with 3 components, 1 system with 4 components, and 15 pairs consisting of at least 1 possible red giant. We find the largest long-lived binary separation to be nearly 3.2 pc; even so, >76% of GAMBLES long-lived binaries have large binding energies and dissipation lifetimes longer than 1.5 Gyr. Finally, we find that the distribution of binary separations is clearly bimodal, corroborating the findings from SloWPoKES and suggesting multiple pathways for the formation and dissipation of the widest binaries in the Galaxy.

NuSTAR Observations of Fermi-detected Novae, V339 Delphini and V5668 Sagitarii

Science.gov (United States)

Mukai, K.; Nelson, T.; Sokoloski, J.; Chomiuk, L.; Finzell, T.; Linford, J.; Weston, J.; Rupen, M.; Mioduszewski, A.

2017-10-01

Ten Galactic novae have been detected as transient GeV gamma-ray sources with Fermi/LAT to date, presumably due to shock acceleration that produces relativistic particles. This unexpected discovery highlights the complexity of the mass ejection process in novae. It has also added a new class of objects in which particle acceleration can be studied. We can in principle study the same shock in X-rays through their thermal emission and the lower energy extension of the non-thermal emission. Here we present our NuSTAR observations of two Fermi-detected novae, V339 Del and V5668 Sgr, that were carried out while they were being detected with the LAT. We did not detect thermal or non-thermal emissions from these novae. Our results place a tight limit on the properties of the putative shocks in V339 Del and V5668 Sgr. We also compare our results with previous reports of possible detection of non-thermal hard X-rays from novae, and discuss the implications in the context of our current understanding of the complicated process of mass ejection in novae.

Full Ionisation In Binary-Binary Encounters With Small Positive Energies

Science.gov (United States)

Sweatman, W. L.

2006-08-01

Interactions between binary stars and single stars and binary stars and other binary stars play a key role in the dynamics of a dense stellar system. Energy can be transferred between the internal dynamics of a binary and the larger scale dynamics of the interacting objects. Binaries can be destroyed and created by the interaction. In a binary-binary encounter, full ionisation occurs when both of the binary stars are destroyed in the interaction to create four single stars. This is only possible when the total energy of the system is positive. For very small energies the probability of this occurring is very low and it tends towards zero as the total energy tends towards zero. Here the case is considered for which all the stars have equal masses. An asymptotic power law is predicted relating the probability of full ionisation with the total energy when this latter quantity is small. The exponent, which is approximately 2.31, is compared with the results from numerical scattering experiments. The theoretical approach taken is similar to one used previously in the three-body problem. It makes use of the fact that the most dramatic changes in scale and energies of a few-body system occur when its components pass near to a central configuration. The position, and number, of these configurations is not known for the general four-body problem, however, with equal masses there are known to be exactly five different cases. Separate consideration and comparison of the properties of orbits close to each of these five central configurations enables the prediction of the form of the cross-section for full ionisation for the case of small positive total energy. This is the relation between total energy and the probability of total ionisation described above.

NO TIME FOR DEAD TIME: TIMING ANALYSIS OF BRIGHT BLACK HOLE BINARIES WITH NuSTAR

Energy Technology Data Exchange (ETDEWEB)

Bachetti, Matteo; Barret, Didier [Université de Toulouse, UPS-OMP, IRAP, Toulouse F-31400 (France); Harrison, Fiona A.; Cook, Rick; Grefenstette, Brian W.; Fürst, Felix [Cahill Center for Astronomy and Astrophysics, Caltech, Pasadena, CA 91125 (United States); Tomsick, John; Boggs, Steven E.; Craig, William W. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Schmid, Christian [Dr. Karl-Remeis-Sternwarte and ECAP, Sternwartstrasse 7, D-96049 Bamberg (Germany); Christensen, Finn E. [DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Fabian, Andrew C.; Kara, Erin [Institute of Astronomy, University of Cambridge, Madingley Road, Cambridge CB3 0HA (United Kingdom); Gandhi, Poshak [Department of Physics, Durham University, South Road DH1 3LE (United Kingdom); Hailey, Charles J. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Maccarone, Thomas J. [Department of Physics, Texas Tech University, Lubbock, TX 79409 (United States); Miller, Jon M. [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48109-1042 (United States); Pottschmidt, Katja [CRESST, UMBC, and NASA GSFC, Code 661, Greenbelt, MD 20771 (United States); Stern, Daniel [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Uttley, Phil, E-mail: matteo.bachetti@irap.omp.eu [Anton Pannekoek Institute, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); and others

2015-02-20

Timing of high-count-rate sources with the NuSTAR Small Explorer Mission requires specialized analysis techniques. NuSTAR was primarily designed for spectroscopic observations of sources with relatively low count rates rather than for timing analysis of bright objects. The instrumental dead time per event is relatively long (∼2.5 msec) and varies event-to-event by a few percent. The most obvious effect is a distortion of the white noise level in the power density spectrum (PDS) that cannot be easily modeled with standard techniques due to the variable nature of the dead time. In this paper, we show that it is possible to exploit the presence of two completely independent focal planes and use the cospectrum, the real part of the cross PDS, to obtain a good proxy of the white-noise-subtracted PDS. Thereafter, one can use a Monte Carlo approach to estimate the remaining effects of dead time, namely, a frequency-dependent modulation of the variance and a frequency-independent drop of the sensitivity to variability. In this way, most of the standard timing analysis can be performed, albeit with a sacrifice in signal-to-noise ratio relative to what would be achieved using more standard techniques. We apply this technique to NuSTAR observations of the black hole binaries GX 339–4, Cyg X-1, and GRS 1915+105.

CALCULATING THE HABITABLE ZONE OF BINARY STAR SYSTEMS. I. S-TYPE BINARIES

Energy Technology Data Exchange (ETDEWEB)

Kaltenegger, Lisa [MPIA, Koenigstuhl 17, D-69117 Heidelberg (Germany); Haghighipour, Nader, E-mail: kaltenegger@mpia.de [Institute for Astronomy and NASA Astrobiology Institute, University of Hawaii-Manoa, Honolulu, HI 96822 (United States)

2013-11-10

We have developed a comprehensive methodology for calculating the boundaries of the habitable zone (HZ) of planet-hosting S-type binary star systems. Our approach is general and takes into account the contribution of both stars to the location and extent of the binary HZ with different stellar spectral types. We have studied how the binary eccentricity and stellar energy distribution affect the extent of the HZ. Results indicate that in binaries where the combination of mass-ratio and orbital eccentricity allows planet formation around a star of the system to proceed successfully, the effect of a less luminous secondary on the location of the primary's HZ is generally negligible. However, when the secondary is more luminous, it can influence the extent of the HZ. We present the details of the derivations of our methodology and discuss its application to the binary HZ around the primary and secondary main-sequence stars of an FF, MM, and FM binary, as well as two known planet-hosting binaries α Cen AB and HD 196886.

CALCULATING THE HABITABLE ZONE OF BINARY STAR SYSTEMS. I. S-TYPE BINARIES

International Nuclear Information System (INIS)

Kaltenegger, Lisa; Haghighipour, Nader

2013-01-01

We have developed a comprehensive methodology for calculating the boundaries of the habitable zone (HZ) of planet-hosting S-type binary star systems. Our approach is general and takes into account the contribution of both stars to the location and extent of the binary HZ with different stellar spectral types. We have studied how the binary eccentricity and stellar energy distribution affect the extent of the HZ. Results indicate that in binaries where the combination of mass-ratio and orbital eccentricity allows planet formation around a star of the system to proceed successfully, the effect of a less luminous secondary on the location of the primary's HZ is generally negligible. However, when the secondary is more luminous, it can influence the extent of the HZ. We present the details of the derivations of our methodology and discuss its application to the binary HZ around the primary and secondary main-sequence stars of an FF, MM, and FM binary, as well as two known planet-hosting binaries α Cen AB and HD 196886

Radar Imaging of Binary Near-Earth Asteroid (66391) 1999 KW4

Czech Academy of Sciences Publication Activity Database

Ostro, S. J.; Margot, J. L.; Benner, L. A. M.; Giorgini, J. D.; Scheeres, D.J.; Fahnestock, E.G.; Broschart, S.B.; Bellerose, J.; Nolan, M. C.; Magri, C.; Pravec, Petr; Scheirich, Peter; Rose, R.; Jurgens, R. F.; De Jong, E. M.; Suzuki, S.

2006-01-01

Roč. 314, č. 5803 (2006), s. 1276-1280 ISSN 0036-8075 R&D Projects: GA ČR GA205/05/0604 Institutional research plan: CEZ:AV0Z10030501 Keywords : binary asteroid * radar imaging Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 30.028, year: 2006

Phase equilibrium properties of binary aqueous solutions containing ethanediamine, 1,2-diaminopropane, 1,3-diaminopropane, or 1,4-diaminobutane at several temperatures

Energy Technology Data Exchange (ETDEWEB)

Ahmed, Nouria Chiali-Baba [LATA2M, Laboratoire de Thermodynamique Appliquee et Modelisation Moleculaire, University AbouBekr Belkaid of Tlemcen, P.O. Box 119, Tlemcen 13000 (Algeria); Negadi, Latifa, E-mail: l_negadi@mail.univ-tlemcen.d [LATA2M, Laboratoire de Thermodynamique Appliquee et Modelisation Moleculaire, University AbouBekr Belkaid of Tlemcen, P.O. Box 119, Tlemcen 13000 (Algeria); Mokbel, Ilham; Jose, Jacques [LSA, Laboratoire des Sciences Analytiques, CNRS-UMR 5180, Universite Claude Bernard - Lyon I. 43, Bd du 11 Novembre 1918, Villeurbanne Cedex 69622 (France)

2011-05-15

Research highlights: Vapour pressures of ethanediamine (EDA), 1,2-diaminopropane, 1,3-diaminopropane (1,3-DAP), or 1,4-diaminobutane (1,4-DAB) aqueous solutions are reported between (293 and 363) K. The two first mixtures show negative azeotropic behaviour. The aqueous solutions of EDA, 1,2-DAP, or 1,3-DAP exhibit negative G{sup E} whereas the one containing 1,4-DAB shows either negative G{sup E} or sinusoidal shape for G{sup E}. - Abstract: The vapour pressures of {l_brace}ethanediamine (EDA) + water{r_brace}, {l_brace}1,2-diaminopropane (1,2-DAP) + water{r_brace}, {l_brace}1,3-diaminopropane (1,3-DAP) + water{r_brace} or {l_brace}1,4-diaminobutane (1,4-DAB) + water{r_brace} binary mixtures, and of pure EDA, 1,2-DAP, 1,3-DAP, 1,4-DAB, and water components were measured by means of two static devices at temperatures between (293 and 363) K. The data were correlated with the Antoine equation. From these data, the excess Gibbs function (G{sup E}) was calculated for several constant temperatures and fitted to a fourth-order Redlich-Kister equation using the Barker's method. The {l_brace}ethanediamine (EDA) + water{r_brace}, and {l_brace}1,2-diaminopropane (1,2-DAP) + water{r_brace} binary systems show negative azeotropic behaviour. The aqueous solutions of EDA, 1,2-DAP, or 1,3-DAP exhibit negative deviations in G{sup E} for all investigated temperatures over the whole composition range whereas the (1,4-DAB + water) binary mixture shows negative G{sup E} for temperatures (293.15 < T/K < 353.15) and a sinusoidal shape for G{sup E} at T = 363.15 K.

Ebulliometric determination and prediction of (vapor + liquid) equilibria for binary and ternary mixtures containing alcohols (C{sub 1}-C{sub 4}) and dimethyl carbonate

Energy Technology Data Exchange (ETDEWEB)

Matsuda, Hiroyuki, E-mail: matsuda@chem.cst.nihon-u.ac.jp [Department of Materials and Applied Chemistry, Nihon University, 1-8 Kanda Surugadai, Chiyoda-ku, Tokyo 101-8308 (Japan); Fukano, Makoto; Kikkawa, Shinichiro [Department of Materials and Applied Chemistry, Nihon University, 1-8 Kanda Surugadai, Chiyoda-ku, Tokyo 101-8308 (Japan); Constantinescu, Dana [Carl von Ossietzky Universitaet Oldenburg, Technische Chemie, D-26111 Oldenburg (Germany); Kurihara, Kiyofumi; Tochigi, Katsumi; Ochi, Kenji [Department of Materials and Applied Chemistry, Nihon University, 1-8 Kanda Surugadai, Chiyoda-ku, Tokyo 101-8308 (Japan); Gmehling, Juergen [Carl von Ossietzky Universitaet Oldenburg, Technische Chemie, D-26111 Oldenburg (Germany)

2012-01-15

Highlights: > The VLE behavior of systems containing dimethyl carbonate (DMC) was investigated. > VLE data for ternary and binary mixtures containing alcohol and DMC were measured. > Several activity coefficient models were used for data reduction or prediction. > Valley line, i.e., distillation boundary, was observed for the ternary mixture. > Residue curves were calculated to investigate composition profile for distillation. - Abstract: (Vapor + liquid) equilibrium (VLE) data for a ternary mixture, namely {l_brace}methanol + propan-1-ol + dimethyl carbonate (DMC){r_brace}, and four binary mixtures, namely an {l_brace}alcohol (C{sub 3} or C{sub 4}) + DMC{r_brace}, containing the binary constituent mixtures of the ternary mixture, were measured at p = (40.00 to 93.32) kPa using a modified Swietoslawski-type ebulliometer. The experimental data for the binary systems were correlated using the Wilson model. The Wilson model was also applied to the ternary system to predict the VLE behavior using parameters from the binary mixtures. The modified UNIFAC (Dortmund) model was also tested for the predictions of the VLE behavior of the binary and ternary mixtures. In addition, the experimental VLE data for the ternary and constituent binary mixtures were correlated using the extended Redlich-Kister (ERK) model, which can completely represent the azeotropic points. For the ternary system, a comparison of the experimental and the predicted or correlated boiling points obtained using the Wilson and ERK models showed that the ERK model is more accurate. The valley line, i.e., the curve which divides the patterns of vapor-liquid tie lines, was found in the (methanol + propan-1-ol + DMC) system. This valley line could be represented by the ERK model. Finally, the composition profile for simple distillation of this ternary mixture was obtained by analysis of the residue curves from the estimated Wilson parameters of the constituent binary mixtures.

Maintaining Arc Consistency in Non-Binary Dynamic CSPs using Simple Tabular Reduction

DEFF Research Database (Denmark)

Queva, Matthieu Stéphane Benoit; Probst, Christian W.; Ricci, Laurent

2010-01-01

CSPs use filtering techniques such as arc consistency, which also have been adapted to handle DCSPs with binary constraints. However, there exists only one algorithm targeting non-binary DCSPs (DnGAC4). In this paper we present a new algorithm DnSTR for maintaining arc consistency in DCSPs with non-binary...

Interacting binaries

CERN Document Server

Shore, S N; van den Heuvel, EPJ

1994-01-01

This volume contains lecture notes presented at the 22nd Advanced Course of the Swiss Society for Astrophysics and Astronomy. The contributors deal with symbiotic stars, cataclysmic variables, massive binaries and X-ray binaries, in an attempt to provide a better understanding of stellar evolution.

Final binary star results from the ESO VLT Lunar occultations program

Energy Technology Data Exchange (ETDEWEB)

Richichi, A. [National Astronomical Research Institute of Thailand, 191 Siriphanich Bldg., Huay Kaew Road, Suthep, Muang, Chiang Mai 50200 (Thailand); Fors, O. [Departament Astronomia i Meteorologia and Institut de Ciències del Cosmos (ICC), Universitat de Barcelona (UB/IEEC), Martí i Franqués 1, E-08028 Barcelona (Spain); Cusano, F. [INAF-Osservatorio Astronomico di Bologna, Via Ranzani 1, I-40127 Bologna (Italy); Ivanov, V. D., E-mail: andrea4work@gmail.com [European Southern Observatory, Ave. Alonso de Cordova 3107, Casilla 19001, Santiago 19 (Chile)

2014-03-01

We report on 13 subarcsecond binaries, detected by means of lunar occultations in the near-infrared at the ESO Very Large Telescope (VLT). They are all first-time detections except for the visual binary HD 158122, which we resolved for the first time in the near-infrared. The primaries have magnitudes in the range K = 4.5-10.0, and companions in the range K = 6.8-11.1. The magnitude differences have a median value of 2.4, with the largest being 4.6. The projected separations are in the range of 4-168 mas, with a median of 13 mas. We discuss and compare our results with the available literature. With this paper, we conclude the mining for binary star detections in the 1226 occultations recorded at the VLT with the ISAAC instrument. We expect that the majority of these binaries may be unresolvable by adaptive optics on current telescopes, and they might be challenging for long-baseline interferometry. However, they constitute an interesting sample for future larger telescopes and for astrometric missions such as GAIA.

Eclipsing binaries in open clusters

DEFF Research Database (Denmark)

Southworth, John; Clausen, J.V.

2006-01-01

Stars: fundamental parameters - Stars : binaries : eclipsing - Stars: Binaries: spectroscopic - Open clusters and ass. : general Udgivelsesdato: 5 August......Stars: fundamental parameters - Stars : binaries : eclipsing - Stars: Binaries: spectroscopic - Open clusters and ass. : general Udgivelsesdato: 5 August...

Asymmetric supernova explosions and the origin of binary pulsars

International Nuclear Information System (INIS)

Sutantyo, W.

1978-01-01

The author investigates the effect of asymmetric supernova explosions on the orbital parameters of binary systems with a compact component. Such explosions are related to the origin of binary pulsars. The degree of asymmetry of the explosion is represented by the kick velocity gained by the exploding star due to the asymmetric mass ejection. The required kick velocity to produce the observed parameters of the binary pulsar PSR 1913 + 16 should be larger than approximately 80 km s -1 if the mass of the exploding star is larger than approximately 4 solar masses. The mean survival probability of the binary system ( ) is examined for various degrees of asymmetry in the explosion. The rare occurrence of a binary pulsar does not neccessarily imply that such a probability is low since not all pulsars have originated in a binary system. Assuming the birth rate of pulsars by Taylor and Manchester (1977), it is derived that would be as high as 0.25. Such values of can be obtained if the mass of the exploding stars is, in general, not large (< approximately 10 solar masses). (Auth.)

CALCULATING THE HABITABLE ZONE OF BINARY STAR SYSTEMS. II. P-TYPE BINARIES

International Nuclear Information System (INIS)

Haghighipour, Nader; Kaltenegger, Lisa

2013-01-01

We have developed a comprehensive methodology for calculating the circumbinary habitable zone (HZ) in planet-hosting P-type binary star systems. We present a general formalism for determining the contribution of each star of the binary to the total flux received at the top of the atmosphere of an Earth-like planet and use the Sun's HZ to calculate the inner and outer boundaries of the HZ around a binary star system. We apply our calculations to the Kepler's currently known circumbinary planetary systems and show the combined stellar flux that determines the boundaries of their HZs. We also show that the HZ in P-type systems is dynamic and, depending on the luminosity of the binary stars, their spectral types, and the binary eccentricity, its boundaries vary as the stars of the binary undergo their orbital motion. We present the details of our calculations and discuss the implications of the results

CALCULATING THE HABITABLE ZONE OF BINARY STAR SYSTEMS. II. P-TYPE BINARIES

Energy Technology Data Exchange (ETDEWEB)

Haghighipour, Nader [Institute for Astronomy and NASA Astrobiology Institute, University of Hawaii-Manoa, Honolulu, HI 96822 (United States); Kaltenegger, Lisa [MPIA, Koenigstuhl 17, Heidelberg, D-69117 (Germany)

2013-11-10

We have developed a comprehensive methodology for calculating the circumbinary habitable zone (HZ) in planet-hosting P-type binary star systems. We present a general formalism for determining the contribution of each star of the binary to the total flux received at the top of the atmosphere of an Earth-like planet and use the Sun's HZ to calculate the inner and outer boundaries of the HZ around a binary star system. We apply our calculations to the Kepler's currently known circumbinary planetary systems and show the combined stellar flux that determines the boundaries of their HZs. We also show that the HZ in P-type systems is dynamic and, depending on the luminosity of the binary stars, their spectral types, and the binary eccentricity, its boundaries vary as the stars of the binary undergo their orbital motion. We present the details of our calculations and discuss the implications of the results.

Gene selection using hybrid binary black hole algorithm and modified binary particle swarm optimization.

Science.gov (United States)

Pashaei, Elnaz; Pashaei, Elham; Aydin, Nizamettin

2018-04-14

In cancer classification, gene selection is an important data preprocessing technique, but it is a difficult task due to the large search space. Accordingly, the objective of this study is to develop a hybrid meta-heuristic Binary Black Hole Algorithm (BBHA) and Binary Particle Swarm Optimization (BPSO) (4-2) model that emphasizes gene selection. In this model, the BBHA is embedded in the BPSO (4-2) algorithm to make the BPSO (4-2) more effective and to facilitate the exploration and exploitation of the BPSO (4-2) algorithm to further improve the performance. This model has been associated with Random Forest Recursive Feature Elimination (RF-RFE) pre-filtering technique. The classifiers which are evaluated in the proposed framework are Sparse Partial Least Squares Discriminant Analysis (SPLSDA); k-nearest neighbor and Naive Bayes. The performance of the proposed method was evaluated on two benchmark and three clinical microarrays. The experimental results and statistical analysis confirm the better performance of the BPSO (4-2)-BBHA compared with the BBHA, the BPSO (4-2) and several state-of-the-art methods in terms of avoiding local minima, convergence rate, accuracy and number of selected genes. The results also show that the BPSO (4-2)-BBHA model can successfully identify known biologically and statistically significant genes from the clinical datasets. Copyright © 2018 Elsevier Inc. All rights reserved.

Close binary stars

International Nuclear Information System (INIS)

Larsson-Leander, G.

1979-01-01

Studies of close binary stars are being persued more vigorously than ever, with about 3000 research papers and notes pertaining to the field being published during the triennium 1976-1978. Many major advances and spectacular discoveries were made, mostly due to increased observational efficiency and precision, especially in the X-ray, radio, and ultraviolet domains. Progress reports are presented in the following areas: observational techniques, methods of analyzing light curves, observational data, physical data, structure and models of close binaries, statistical investigations, and origin and evolution of close binaries. Reports from the Coordinates Programs Committee, the Committee for Extra-Terrestrial Observations and the Working Group on RS CVn binaries are included. (Auth./C.F.)

Binary CuO/Co3O4 nanofibers for ultrafast and amplified electrochemical sensing of fructose

International Nuclear Information System (INIS)

Wang Yang; Wang Wen; Song Wenbo

2011-01-01

Highlights: → Binary CuO/Co 3 O 4 nanofiber as active electrode material. → Dramatically enhanced catalytic activity and direct fructose detection. → Significantly lowered overpotential, ultrafast (1 s) and sensitive (18.988 μA mM -1 ) response. - Abstract: Cobalt oxide-doped copper oxide composite nanofibers (CCNFs) were successfully achieved via electrospinning followed by thermal treatment processes and then exploited as active electrode material for direct enzyme-free fructose detection. The morphology and the structure of as-prepared samples were investigated by X-ray diffraction spectrum (XRD) and scanning electron microscopy (SEM). The electrocatalytic activity of CCNFs films towards fructose oxidation and sensing performances were evaluated by conventional electrochemical techniques. Cyclic voltammetry (CV) and chronoamperometry (I-t) revealed the distinctly enhanced sensing properties towards fructose compared to pure copper oxide nanofibers (CNFs), i.e., showing significantly lowered overpotential of 0.30 V, ultrafast (1 s) and ultrasensitive (18.988 μA mM -1 ) current response in a wide linear range of 1.0 x 10 -5 M to 6.0 x 10 -3 M with satisfied reproducibility and stability, which could be ascribed to the synergic catalytic effect of the binary CuO/Co 3 O 4 composite nanofibers and the highly porous three-dimensional network films structure of the CCNFs. In addition, a good selectivity for fructose detection was achieved. Results in this work demonstrated that CCNFs is one of the promising catalytic electrode materials for enzymeless fructose sensor fabrication.

Massive Black Hole Binary Evolution

Directory of Open Access Journals (Sweden)

Merritt David

2005-11-01

Full Text Available Coalescence of binary supermassive black holes (SBHs would constitute the strongest sources of gravitational waves to be observed by LISA. While the formation of binary SBHs during galaxy mergers is almost inevitable, coalescence requires that the separation between binary components first drop by a few orders of magnitude, due presumably to interaction of the binary with stars and gas in a galactic nucleus. This article reviews the observational evidence for binary SBHs and discusses how they would evolve. No completely convincing case of a bound, binary SBH has yet been found, although a handful of systems (e.g. interacting galaxies; remnants of galaxy mergers are now believed to contain two SBHs at projected separations of <~ 1kpc. N-body studies of binary evolution in gas-free galaxies have reached large enough particle numbers to reproduce the slow, “diffusive” refilling of the binary’s loss cone that is believed to characterize binary evolution in real galactic nuclei. While some of the results of these simulations - e.g. the binary hardening rate and eccentricity evolution - are strongly N-dependent, others - e.g. the “damage” inflicted by the binary on the nucleus - are not. Luminous early-type galaxies often exhibit depleted cores with masses of ~ 1-2 times the mass of their nuclear SBHs, consistent with the predictions of the binary model. Studies of the interaction of massive binaries with gas are still in their infancy, although much progress is expected in the near future. Binary coalescence has a large influence on the spins of SBHs, even for mass ratios as extreme as 10:1, and evidence of spin-flips may have been observed.

STRUCTURE AND EVOLUTION OF CIRCUMBINARY DISKS AROUND SUPERMASSIVE BLACK HOLE BINARIES

International Nuclear Information System (INIS)

Rafikov, Roman R.

2013-01-01

We explore properties of circumbinary disks around supermassive black hole (SMBH) binaries in centers of galaxies by reformulating standard viscous disk evolution in terms of the viscous angular momentum flux F J . If the binary stops gas inflow and opens a cavity in the disk, then the inner disk evolves toward a constant-F J (rather than a constant M-dot ) state. We compute disk properties in different physical regimes relevant for SMBH binaries, focusing on the gas-assisted evolution of systems starting at separations 10 –4 – 10 –2 pc, and find the following. (1) Mass pileup at the inner disk edge caused by the tidal barrier accelerates binary inspiral. (2) Binaries can be forced to merge even by a disk with a mass below that of the secondary. (3) Torque on the binary is set non-locally, at radii far larger than the binary semi-major axis; its magnitude does not reflect disk properties in the vicinity of the binary. (4) Binary inspiral exhibits hysteresis—it depends on the past evolution of the disk. (5) The Eddington limit can be important for circumbinary disks even if they accrete at sub-Eddington rates, but only at late stages of the inspiral. (6) Gas overflow across the orbit of the secondary can be important for low secondary mass, high- M-dot systems, but mainly during the inspiral phase dominated by the gravitational wave emission. (7) Circumbinary disks emit more power and have harder spectra than constant M-dot disks; their spectra are very sensitive to the amount of overflow across the secondary orbit

Hexadecyltrimethylammonium bromide (CTA-Br) and 1-butyl-3-methylimidazolium tetrafluoroborate (bmim-BF4) in aqueous solution: An ephemeral binary system.

Science.gov (United States)

Comelles, Francesc; Ribosa, Isabel; Gonzalez, Juan José; Garcia, M Teresa

2017-03-15

Mixtures of the cationic surfactant hexadecyltrimethylammonium bromide (CTA-Br) and the ionic liquid 1-butyl-3-methylimidazolium tetrafluoroborate (bmim-BF 4 ) in aqueous solutions are expected to behave as typical binary cationic surfactant system taking into account the surface activity displayed by the ionic liquid, instead of considering the IL as a water cosolvent. Surface tension and conductivity measurements have been conducted as a function of the total concentration of the mixtures at different surfactant mole fraction (α CTA-Br ) to investigate the surface active properties. Turbidity immediately appearing when the compounds are mixed in water suggests the spontaneous formation of the low soluble compound hexadecyltrimethylammonium tetrafluoroborate (CTA-BF 4 ), together with the salt formed by the respective counterions bmim + and Br - in solution. For α CTA-Br ≠0.5, furthermore of the mentioned compounds, the spare bmim-BF 4 (for α CTA-Br Br (for α CTA-Br >0.5), are also present in the aqueous solution. Systems containing excess of bmim-BF 4 show a low critical aggregate concentration (cac), but an unexpected high surface tension at cac (γ cac ≈53-56mN/m), as pure CTA-BF 4 . For systems containing excess of CTA-Br, cac increases but γ cac decreases up to 36mN/m. Mixtures of pure CTA-BF 4 and bmim-BF 4 or CTA-Br behave as typical binary surfactant systems. Copyright © 2016 Elsevier Inc. All rights reserved.

Accreting Binary Populations in the Earlier Universe

Science.gov (United States)

Hornschemeier, Ann

2010-01-01

It is now understood that X-ray binaries dominate the hard X-ray emission from normal star-forming galaxies. Thanks to the deepest (2-4 Ms) Chandra surveys, such galaxies are now being studied in X-rays out to z approximates 4. Interesting X-ray stacking results (based on 30+ galaxies per redshift bin) suggest that the mean rest-frame 2-10 keV luminosity from z=3-4 Lyman break galaxies (LBGs), is comparable to the most powerful starburst galaxies in the local Universe. This result possibly indicates a similar production mechanism for accreting binaries over large cosmological timescales. To understand and constrain better the production of X-ray binaries in high-redshift LBGs, we have utilized XMM-Newton observations of a small sample of z approximates 0.1 GALEX-selected Ultraviolet-Luminous Galaxies (UVLGs); local analogs to high-redshift LBGs. Our observations enable us to study the X-ray emission from LBG-like galaxies on an individual basis, thus allowing us to constrain object-to-object variances in this population. We supplement these results with X-ray stacking constraints using the new 3.2 Ms Chandra Deep Field-South (completed spring 2010) and LBG candidates selected from HST, Swift UVOT, and ground-based data. These measurements provide new X-ray constraints that sample well the entire z=0-4 baseline

KIC 7177553: A QUADRUPLE SYSTEM OF TWO CLOSE BINARIES

Energy Technology Data Exchange (ETDEWEB)

Lehmann, H. [Thüringer Landessternwarte Tautenburg, Sternwarte 5, D-07778 Tautenburg (Germany); Borkovits, T. [Baja Astronomical Observatory of Szeged University, H-6500 Baja, Szegedi út, Kt. 766 (Hungary); Rappaport, S. A. [Massachusetts Institute of Technology, Department of Physics, 77 Massachusetts Avenue, Cambridge, MA 02139-4307 (United States); Ngo, H. [California Institute of Technology, Division of Geological and Planetary Sciences, 1200 E. California Boulevard, MC 150-21, Pasadena, CA 91125 (United States); Mawet, D. [California Institute of Technology, Astronomy Dept. MC 249-17, 1200 E. California Boulevard, Pasadena, CA 91125 (United States); Csizmadia, Sz. [German Aerospace Center (DLR), Institut für Planeten-forschung, Rutherfordstraße 2, D-12489 Berlin (Germany); Forgács-Dajka, E., E-mail: lehm@tls-tautenburg.de, E-mail: borko@electra.bajaobs.hu, E-mail: sar@mit.edu, E-mail: hngo@caltech.edu, E-mail: dmawet@astro.caltech.edu, E-mail: szilard.csizmadia@dlr.de, E-mail: e.forgacs-dajka@astro.elte.hu [Astronomical Department, Eötvös University, H-1118 Budapest, Pázmány Péter stny. 1/A (Hungary)

2016-03-01

KIC 7177553 was observed by the Kepler satellite to be an eclipsing eccentric binary star system with an 18-day orbital period. Recently, an eclipse timing study of the Kepler binaries has revealed eclipse timing variations (ETVs) in this object with an amplitude of ∼100 s and an outer period of 529 days. The implied mass of the third body is that of a super-Jupiter, but below the mass of a brown dwarf. We therefore embarked on a radial velocity (RV) study of this binary to determine its system configuration and to check the hypothesis that it hosts a giant planet. From the RV measurements, it became immediately obvious that the same Kepler target contains another eccentric binary, this one with a 16.5-day orbital period. Direct imaging using adaptive optics reveals that the two binaries are separated by 0.″4 (∼167 AU) and have nearly the same magnitude (to within 2%). The close angular proximity of the two binaries and very similar γ velocities strongly suggest that KIC 7177553 is one of the rare SB4 systems consisting of two eccentric binaries where at least one system is eclipsing. Both systems consist of slowly rotating, nonevolved, solar-like stars of comparable masses. From the orbital separation and the small difference in γ velocity, we infer that the period of the outer orbit most likely lies in the range of 1000–3000 yr. New images taken over the next few years, as well as the high-precision astrometry of the Gaia satellite mission, will allow us to set much narrower constraints on the system geometry. Finally, we note that the observed ETVs in the Kepler data cannot be produced by the second binary. Further spectroscopic observations on a longer timescale will be required to prove the existence of the massive planet.

Context based Coding of Binary Shapes by Object Boundary Straightness Analysis

DEFF Research Database (Denmark)

Aghito, Shankar Manuel; Forchhammer, Søren

2004-01-01

A new lossless compression scheme for bilevel images targeted at binary shapes of image and video objects is presented. The scheme is based on a local analysis of the digital straightness of the causal part of the object boundary, which is used in the context definition for arithmetic encoding....... Tested on individual images of binary shapes and binary layers of digital maps the algorithm outperforms PWC, JBIG and MPEG-4 CAE. On the binary shapes the code lengths are reduced by 21%, 25%, and 42%, respectively. On the maps the reductions are 34%, 32%, and 59%, respectively. The algorithm is also...

Orbits for 18 Visual Binaries and Two Double-line Spectroscopic Binaries Observed with HRCAM on the CTIO SOAR 4 m Telescope, Using a New Bayesian Orbit Code Based on Markov Chain Monte Carlo

Science.gov (United States)

Mendez, Rene A.; Claveria, Ruben M.; Orchard, Marcos E.; Silva, Jorge F.

2017-11-01

We present orbital elements and mass sums for 18 visual binary stars of spectral types B to K (five of which are new orbits) with periods ranging from 20 to more than 500 yr. For two double-line spectroscopic binaries with no previous orbits, the individual component masses, using combined astrometric and radial velocity data, have a formal uncertainty of ˜ 0.1 {M}⊙ . Adopting published photometry and trigonometric parallaxes, plus our own measurements, we place these objects on an H-R diagram and discuss their evolutionary status. These objects are part of a survey to characterize the binary population of stars in the Southern Hemisphere using the SOAR 4 m telescope+HRCAM at CTIO. Orbital elements are computed using a newly developed Markov chain Monte Carlo (MCMC) algorithm that delivers maximum-likelihood estimates of the parameters, as well as posterior probability density functions that allow us to evaluate the uncertainty of our derived parameters in a robust way. For spectroscopic binaries, using our approach, it is possible to derive a self-consistent parallax for the system from the combined astrometric and radial velocity data (“orbital parallax”), which compares well with the trigonometric parallaxes. We also present a mathematical formalism that allows a dimensionality reduction of the feature space from seven to three search parameters (or from 10 to seven dimensions—including parallax—in the case of spectroscopic binaries with astrometric data), which makes it possible to explore a smaller number of parameters in each case, improving the computational efficiency of our MCMC code. Based on observations obtained at the Southern Astrophysical Research (SOAR) telescope, which is a joint project of the Ministério da Ciência, Tecnologia, e Inovação (MCTI) da República Federativa do Brasil, the U.S. National Optical Astronomy Observatory (NOAO), the University of North Carolina at Chapel Hill (UNC), and Michigan State University (MSU).

Short binary convolutional codes with maximal free distance for rates 2/3 and 3/4

DEFF Research Database (Denmark)

Paaske, Erik

1974-01-01

. Farther, the search among the remaining codes is started in a subset in which we expect the possibility of finding codes with large values ofd_{free}to be good. A number of short, optimum (in the sense of maximizingd_{free}), rate-2/3 and 3/4 codes found by the search procedure are listed.......A search procedure is developed to find good short binary(N,N - 1)convolutional codes. It uses simple rules to discard from the complete ensemble of codes a large fraction whose free distanced_{free}either cannot achieve the maximum value or is equal tod_{free}of some code in the remaining set...

Thermodynamic models for determination of 3-chloro-N-phenylphthalimide solubility in binary solvent mixtures of (acetone, ethyl acetate or 1,4-dioxane + methanol)

International Nuclear Information System (INIS)

Xie, Yong; Shi, Hongwei; Du, Cunbin; Cong, Yang; Wang, Jian; Zhao, Hongkun

2016-01-01

Highlights: • Solubility of 3-chloro-N-phenylphthalimide in binary mixed solvents were determined. • Solubility data were correlated and calculated by five models. • The standard molar enthalpy for the dissolution processes were calculated. - Abstract: The solubility of 3-chloro-N-phenylphthalimide in binary mixed solvents of (acetone + methanol, ethyl acetate + methanol and 1,4-dioxane + methanol) were determined experimentally by using the isothermal dissolution equilibrium method within the temperature range from (288.15 to 323.15) K under atmosphere pressure. For the binary systems of (acetone + methanol) and (1,4-dioxane + methanol), the solubility of 3-chloro-N-phenylphthalimide increased with increasing temperature and mass fraction of acetone or 1,4-dioxane; and for the (ethyl acetate + methanol) system, at a given composition of ethyl acetate, the solubility of 3-chloro-N-phenylphthalimide increased with an increase in temperature; nevertheless at the same temperature, they increased at first and then decreased with increasing mass fraction of 1,4-dioxane. At the same temperature and mass fraction of acetone, ethyl acetate or 1,4-dioxane, the solubility of 3-chloro-N-phenylphthalimide was greater in (1,4-dioxane + methanol) than in the other two mixed solvents. The solubility values were correlated by employing the Jouyban–Acree model, van’t Hoff–Jouyban–Acree model, Apelblat–Jouyban–Acree model, Ma model, and Sun model. On the whole, the Ma model and Sun model were proven to provide good representation of the experimental solubility results. Furthermore, the dissolution enthalpies of the dissolution process were calculated. The dissolution process of 3-chloro-N-phenylphthalimide in these mixed solvents is endothermic. The experimental solubility and the models in this study could be helpful in purifying 3-chloro-N-phenylphthalimide.

nth-Nearest neighbour distribution functions of a binary fluid mixture ...

Indian Academy of Sciences (India)

Administrator

for ob- taining the NND functions for single component flu- ids, to binary fluid mixtures. The MD simulation and computation details are presented in section 4. Results are elaborated in section 5 and conclusions are provided in section 6. 2. n-Particle distribution function. Considering a binary system of Nα and Nβ particles.

The fate of close encounters between binary stars and binary supermassive black holes

Science.gov (United States)

Wang, Yi-Han; Leigh, Nathan; Yuan, Ye-Fei; Perna, Rosalba

2018-04-01

The evolution of main-sequence binaries that reside in the Galactic Centre can be heavily influenced by the central supermassive black hole (SMBH). Due to these perturbative effects, the stellar binaries in dense environments are likely to experience mergers, collisions, or ejections through secular and/or non-secular interactions. More direct interactions with the central SMBH are thought to produce hypervelocity stars (HVSs) and tidal disruption events (TDEs). In this paper, we use N-body simulations to study the dynamics of stellar binaries orbiting a central SMBH primary with an outer SMBH secondary orbiting this inner triple. The effects of the secondary SMBH on the event rates of HVSs, TDEs, and stellar mergers are investigated, as a function of the SMBH-SMBH binary mass ratio. Our numerical experiments reveal that, relative to the isolated SMBH case, the TDE and HVS rates are enhanced for, respectively, the smallest and largest mass ratio SMBH-SMBH binaries. This suggests that the observed event rates of TDEs and HVSs have the potential to serve as a diagnostic of the mass ratio of a central SMBH-SMBH binary. The presence of a secondary SMBH also allows for the creation of hypervelocity binaries. Observations of these systems could thus constrain the presence of a secondary SMBH in the Galactic Centre.

Optical eclipses and precessional effects in the X-ray binary system HD 77581=4U 0900-40

International Nuclear Information System (INIS)

Khruzina, T.S.; Cherepashchuk, A.M.

1982-01-01

The longperiod (P=93.3sup(d)) variability of the amplitude and shape of the optical light curves of the X-ray binary HD 77581 has been discovered from the analysis of all published photometric data. The 93.3-day period is presumably the period of the forced precession of the rotational axis of the optical star. It is shown that the system HD 77581 appears to be an eclipsing binary in the optical range with the amplitude of the ellipsoidal variability approximately 0sup(m).04 and the depth of the eclipse reaching approximately 0sup(m).04. The eclipses are caused by the gaseous streams and the accreting structure, the orientation of which in the binary system is varying with the precession period of the optical star. The estimates of the parameters of the system are obtained. It is shown that the parameter of the Roche Lobe filling for the optical star is μ < 1. The mass of the neutron star is Msub(x)=(1.6+-0.3) Msub(Sun), where Msub(Sun) is the solar mass. The forced precession of the optical star is connected with the non-perpendicularity of its rotational axis to the orbit plane of the binary system. This non-perpendicularity may be a result of supernova explosion in a close binary system

Fatigue Resistance of GX12CrMoVNbN9-1 Cast Steel after Ageing Process

Directory of Open Access Journals (Sweden)

Stanisław MROZIŃSKI

2014-12-01

Full Text Available In the present paper, low cycle fatigue behaviour of GX12CrMoVNbN9-1 (GP91 cast steel is presented. Fatigue tests were performed under isothermal conditions at room temperature and at 550 and 600oC, on five levels of total strain amplitude value ɛac = 0.25÷0.60%. The cast steel subject to investigation was in the as-received condition (after heat treatment and after 8000 hours of ageing at the temperature of 600oC. Performed research has shown an insignificant influence of the ageing process on mechanical properties of GP91 cast steel, determined with the static test of tension. Analysis of the performed tests has proved that GP91 cast steel in the as-received condition and after ageing process was characterized by strong cyclic softening without a clear period of stabilization of the hysteresis loop parameters. The fatigue lifetime curves at each temperature were obtained based on Basquin and Coffin – Manson equations. The process of ageing of GP91 cast steel contributed to a decrease in its fatigue life Nf from a few to a few dozen percent, and the level of fatigue life was dependent on the value of strain amplitude ɛac. It has also been stated that the fatigue life Nf of GP91 cast steel is determined by its plastic properties, and the degree of changes in fatigue life Nf was dependent not only on the temperature of testing, but also on the value of strain amplitude ɛac. DOI: http://dx.doi.org/10.5755/j01.ms.20.4.6077

Properties of the Binary Black Hole Merger GW150914

Science.gov (United States)

Abbott, B. P.; Abbott, R.; Abbott, T. D.; Abernathy, M. R.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Camp, J. B.

2016-01-01

On September 14, 2015, the Laser Interferometer Gravitational-Wave Observatory (LIGO) detected a gravitational-wave transient (GW150914); we characterize the properties of the source and its parameters. The data around the time of the event were analyzed coherently across the LIGO network using a suite of accurate waveform models that describe gravitational waves from a compact binary system in general relativity. GW150914 was produced by a nearly equal mass binary black hole of masses 36(+5/-4) solar mass and 29(+4/-4) solar mass; for each parameter we report the median value and the range of the 90% credible interval. The dimensionless spin magnitude of the more massive black hole is bound to be less than 0.7 (at 90% probability). The luminosity distance to the source is 410(+160/-180) Mpc, corresponding to a redshift 0.09(+0.03/-0.04) assuming standard cosmology. The source location is constrained to an annulus section of 610 sq deg, primarily in the southern hemisphere. The binary merges into a black hole of mass 62(+4/-4) solar mass and spin 0.67(+0.05/-0.07). This black hole is significantly more massive than any other inferred from electromagnetic observations in the stellar-mass regime.

Properties of the Binary Black Hole Merger GW150914

Science.gov (United States)

Abbott, B. P.; Abbott, R.; Abbott, T. D.; Abernathy, M. R.; Acernese, F.; Ackley, K.; Adams, C.; Adams, T.; Addesso, P.; Adhikari, R. X.; Adya, V. B.; Affeldt, C.; Agathos, M.; Agatsuma, K.; Aggarwal, N.; Aguiar, O. D.; Aiello, L.; Ain, A.; Ajith, P.; Allen, B.; Allocca, A.; Altin, P. A.; Anderson, S. B.; Anderson, W. G.; Arai, K.; Araya, M. C.; Arceneaux, C. C.; Areeda, J. S.; Arnaud, N.; Arun, K. G.; Ascenzi, S.; Ashton, G.; Ast, M.; Aston, S. M.; Astone, P.; Aufmuth, P.; Aulbert, C.; Babak, S.; Bacon, P.; Bader, M. K. M.; Baker, P. T.; Baldaccini, F.; Ballardin, G.; Ballmer, S. W.; Barayoga, J. C.; Barclay, S. E.; Barish, B. C.; Barker, D.; Barone, F.; Barr, B.; Barsotti, L.; Barsuglia, M.; Barta, D.; Bartlett, J.; Bartos, I.; Bassiri, R.; Basti, A.; Batch, J. C.; Baune, C.; Bavigadda, V.; Bazzan, M.; Behnke, B.; Bejger, M.; Bell, A. S.; Bell, C. J.; Berger, B. K.; Bergman, J.; Bergmann, G.; Berry, C. P. L.; Bersanetti, D.; Bertolini, A.; Betzwieser, J.; Bhagwat, S.; Bhandare, R.; Bilenko, I. A.; Billingsley, G.; Birch, J.; Birney, R.; Birnholtz, O.; Biscans, S.; Bisht, A.; Bitossi, M.; Biwer, C.; Bizouard, M. A.; Blackburn, J. K.; Blair, C. D.; Blair, D. G.; Blair, R. M.; Bloemen, S.; Bock, O.; Bodiya, T. P.; Boer, M.; Bogaert, G.; Bogan, C.; Bohe, A.; Bojtos, P.; Bond, C.; Bondu, F.; Bonnand, R.; Boom, B. A.; Bork, R.; Boschi, V.; Bose, S.; Bouffanais, Y.; Bozzi, A.; Bradaschia, C.; Brady, P. R.; Braginsky, V. B.; Branchesi, M.; Brau, J. E.; Briant, T.; Brillet, A.; Brinkmann, M.; Brisson, V.; Brockill, P.; Brooks, A. F.; Brown, D. A.; Brown, D. D.; Brown, N. M.; Buchanan, C. C.; Buikema, A.; Bulik, T.; Bulten, H. J.; Buonanno, A.; Buskulic, D.; Buy, C.; Byer, R. L.; Cadonati, L.; Cagnoli, G.; Cahillane, C.; Calderón Bustillo, J.; Callister, T.; Calloni, E.; Camp, J. B.; Cannon, K. C.; Cao, J.; Capano, C. D.; Capocasa, E.; Carbognani, F.; Caride, S.; Casanueva Diaz, J.; Casentini, C.; Caudill, S.; Cavaglià, M.; Cavalier, F.; Cavalieri, R.; Cella, G.; Cepeda, C. B.; Carbon Baiardi, L.; Cerretani, G.; Cesarini, E.; Chakraborty, R.; Chalermsongsak, T.; Chamberlin, S. J.; Chan, M.; Chao, S.; Charlton, P.; Chassande-Mottin, E.; Chen, H. Y.; Chen, Y.; Cheng, C.; Chincarini, A.; Chiummo, A.; Cho, H. S.; Cho, M.; Chow, J. H.; Christensen, N.; Chu, Q.; Chua, S.; Chung, S.; Ciani, G.; Clara, F.; Clark, J. A.; Cleva, F.; Coccia, E.; Cohadon, P.-F.; Colla, A.; Collette, C. G.; Cominsky, L.; Constancio, M.; Conte, A.; Conti, L.; Cook, D.; Corbitt, T. R.; Cornish, N.; Corsi, A.; Cortese, S.; Costa, C. A.; Coughlin, M. W.; Coughlin, S. B.; Coulon, J.-P.; Countryman, S. T.; Couvares, P.; Cowan, E. E.; Coward, D. M.; Cowart, M. J.; Coyne, D. C.; Coyne, R.; Craig, K.; Creighton, J. D. E.; Cripe, J.; Crowder, S. G.; Cumming, A.; Cunningham, L.; Cuoco, E.; Dal Canton, T.; Danilishin, S. L.; D'Antonio, S.; Danzmann, K.; Darman, N. S.; Dattilo, V.; Dave, I.; Daveloza, H. P.; Davier, M.; Davies, G. S.; Daw, E. J.; Day, R.; DeBra, D.; Debreczeni, G.; Degallaix, J.; De Laurentis, M.; Deléglise, S.; Del Pozzo, W.; Denker, T.; Dent, T.; Dereli, H.; Dergachev, V.; De Rosa, R.; DeRosa, R. T.; DeSalvo, R.; Devine, C.; Dhurandhar, S.; Díaz, M. C.; Di Fiore, L.; Di Giovanni, M.; Di Lieto, A.; Di Pace, S.; Di Palma, I.; Di Virgilio, A.; Dojcinoski, G.; Dolique, V.; Donovan, F.; Dooley, K. L.; Doravari, S.; Douglas, R.; Downes, T. P.; Drago, M.; Drever, R. W. P.; Driggers, J. C.; Du, Z.; Ducrot, M.; Dwyer, S. E.; Edo, T. B.; Edwards, M. C.; Effler, A.; Eggenstein, H.-B.; Ehrens, P.; Eichholz, J.; Eikenberry, S. S.; Engels, W.; Essick, R. C.; Etienne, Z.; Etzel, T.; Evans, M.; Evans, T. M.; Everett, R.; Factourovich, M.; Fafone, V.; Fair, H.; Fairhurst, S.; Fan, X.; Fang, Q.; Farinon, S.; Farr, B.; Farr, W. M.; Fauchon-Jones, E.; Favata, M.; Fays, M.; Fehrmann, H.; Fejer, M. M.; Ferrante, I.; Ferreira, E. C.; Ferrini, F.; Fidecaro, F.; Fiori, I.; Fiorucci, D.; Fisher, R. P.; Flaminio, R.; Fletcher, M.; Fournier, J.-D.; Franco, S.; Frasca, S.; Frasconi, F.; Frei, Z.; Freise, A.; Frey, R.; Frey, V.; Fricke, T. T.; Fritschel, P.; Frolov, V. V.; Fulda, P.; Fyffe, M.; Gabbard, H. A. G.; Gaebel, S. M.; Gair, J. R.; Gammaitoni, L.; Gaonkar, S. G.; Garufi, F.; Gatto, A.; Gaur, G.; Gehrels, N.; Gemme, G.; Gendre, B.; Genin, E.; Gennai, A.; George, J.; Gergely, L.; Germain, V.; Ghosh, Archisman; Ghosh, S.; Giaime, J. A.; Giardina, K. D.; Giazotto, A.; Gill, K.; Glaefke, A.; Goetz, E.; Goetz, R.; Gondan, L.; González, G.; Gonzalez Castro, J. M.; Gopakumar, A.; Gordon, N. A.; Gorodetsky, M. L.; Gossan, S. E.; Gosselin, M.; Gouaty, R.; Graef, C.; Graff, P. B.; Granata, M.; Grant, A.; Gras, S.; Gray, C.; Greco, G.; Green, A. C.; Groot, P.; Grote, H.; Grunewald, S.; Guidi, G. M.; Guo, X.; Gupta, A.; Gupta, M. K.; Gushwa, K. E.; Gustafson, E. K.; Gustafson, R.; Hacker, J. J.; Hall, B. R.; Hall, E. D.; Hammond, G.; Haney, M.; Hanke, M. M.; Hanks, J.; Hanna, C.; Hannam, M. D.; Hanson, J.; Hardwick, T.; Harms, J.; Harry, G. M.; Harry, I. W.; Hart, M. J.; Hartman, M. T.; Haster, C.-J.; Haughian, K.; Healy, J.; Heidmann, A.; Heintze, M. C.; Heitmann, H.; Hello, P.; Hemming, G.; Hendry, M.; Heng, I. S.; Hennig, J.; Heptonstall, A. W.; Heurs, M.; Hild, S.; Hoak, D.; Hodge, K. A.; Hofman, D.; Hollitt, S. E.; Holt, K.; Holz, D. E.; Hopkins, P.; Hosken, D. J.; Hough, J.; Houston, E. A.; Howell, E. J.; Hu, Y. M.; Huang, S.; Huerta, E. A.; Huet, D.; Hughey, B.; Husa, S.; Huttner, S. H.; Huynh-Dinh, T.; Idrisy, A.; Indik, N.; Ingram, D. R.; Inta, R.; Isa, H. N.; Isac, J.-M.; Isi, M.; Islas, G.; Isogai, T.; Iyer, B. R.; Izumi, K.; Jacqmin, T.; Jang, H.; Jani, K.; Jaranowski, P.; Jawahar, S.; Jiménez-Forteza, F.; Johnson, W. W.; Johnson-McDaniel, N. K.; Jones, D. I.; Jones, R.; Jonker, R. J. G.; Ju, L.; K, Haris; Kalaghatgi, C. V.; Kalogera, V.; Kandhasamy, S.; Kang, G.; Kanner, J. B.; Karki, S.; Kasprzack, M.; Katsavounidis, E.; Katzman, W.; Kaufer, S.; Kaur, T.; Kawabe, K.; Kawazoe, F.; Kéfélian, F.; Kehl, M. S.; Keitel, D.; Kelley, D. B.; Kells, W.; Kennedy, R.; Key, J. S.; Khalaidovski, A.; Khalili, F. Y.; Khan, I.; Khan, S.; Khan, Z.; Khazanov, E. A.; Kijbunchoo, N.; Kim, C.; Kim, J.; Kim, K.; Kim, Nam-Gyu; Kim, Namjun; Kim, Y.-M.; King, E. J.; King, P. J.; Kinzel, D. L.; Kissel, J. S.; Kleybolte, L.; Klimenko, S.; Koehlenbeck, S. M.; Kokeyama, K.; Koley, S.; Kondrashov, V.; Kontos, A.; Korobko, M.; Korth, W. Z.; Kowalska, I.; Kozak, D. B.; Kringel, V.; Krishnan, B.; Królak, A.; Krueger, C.; Kuehn, G.; Kumar, P.; Kuo, L.; Kutynia, A.; Lackey, B. D.; Landry, M.; Lange, J.; Lantz, B.; Lasky, P. D.; Lazzarini, A.; Lazzaro, C.; Leaci, P.; Leavey, S.; Lebigot, E. O.; Lee, C. H.; Lee, H. K.; Lee, H. M.; Lee, K.; Lenon, A.; Leonardi, M.; Leong, J. R.; Leroy, N.; Letendre, N.; Levin, Y.; Levine, B. M.; Li, T. G. F.; Libson, A.; Littenberg, T. B.; Lockerbie, N. A.; Logue, J.; Lombardi, A. L.; London, L. T.; Lord, J. E.; Lorenzini, M.; Loriette, V.; Lormand, M.; Losurdo, G.; Lough, J. D.; Lousto, C. O.; Lovelace, G.; Lück, H.; Lundgren, A. P.; Luo, J.; Lynch, R.; Ma, Y.; MacDonald, T.; Machenschalk, B.; MacInnis, M.; Macleod, D. M.; Magaña-Sandoval, F.; Magee, R. M.; Mageswaran, M.; Majorana, E.; Maksimovic, I.; Malvezzi, V.; Man, N.; Mandel, I.; Mandic, V.; Mangano, V.; Mansell, G. L.; Manske, M.; Mantovani, M.; Marchesoni, F.; Marion, F.; Márka, S.; Márka, Z.; Markosyan, A. S.; Maros, E.; Martelli, F.; Martellini, L.; Martin, I. W.; Martin, R. M.; Martynov, D. V.; Marx, J. N.; Mason, K.; Masserot, A.; Massinger, T. J.; Masso-Reid, M.; Matichard, F.; Matone, L.; Mavalvala, N.; Mazumder, N.; Mazzolo, G.; McCarthy, R.; McClelland, D. E.; McCormick, S.; McGuire, S. C.; McIntyre, G.; McIver, J.; McManus, D. J.; McWilliams, S. T.; Meacher, D.; Meadors, G. D.; Meidam, J.; Melatos, A.; Mendell, G.; Mendoza-Gandara, D.; Mercer, R. A.; Merilh, E.; Merzougui, M.; Meshkov, S.; Messenger, C.; Messick, C.; Meyers, P. M.; Mezzani, F.; Miao, H.; Michel, C.; Middleton, H.; Mikhailov, E. E.; Milano, L.; Miller, J.; Millhouse, M.; Minenkov, Y.; Ming, J.; Mirshekari, S.; Mishra, C.; Mitra, S.; Mitrofanov, V. P.; Mitselmakher, G.; Mittleman, R.; Moggi, A.; Mohan, M.; Mohapatra, S. R. P.; Montani, M.; Moore, B. C.; Moore, C. J.; Moraru, D.; Moreno, G.; Morriss, S. R.; Mossavi, K.; Mours, B.; Mow-Lowry, C. M.; Mueller, C. L.; Mueller, G.; Muir, A. W.; Mukherjee, Arunava; Mukherjee, D.; Mukherjee, S.; Mukund, N.; Mullavey, A.; Munch, J.; Murphy, D. J.; Murray, P. G.; Mytidis, A.; Nardecchia, I.; Naticchioni, L.; Nayak, R. K.; Necula, V.; Nedkova, K.; Nelemans, G.; Neri, M.; Neunzert, A.; Newton, G.; Nguyen, T. T.; Nielsen, A. B.; Nissanke, S.; Nitz, A.; Nocera, F.; Nolting, D.; Normandin, M. E.; Nuttall, L. K.; Oberling, J.; Ochsner, E.; O'Dell, J.; Oelker, E.; Ogin, G. H.; Oh, J. J.; Oh, S. H.; Ohme, F.; Oliver, M.; Oppermann, P.; Oram, Richard J.; O'Reilly, B.; O'Shaughnessy, R.; Ottaway, D. J.; Ottens, R. S.; Overmier, H.; Owen, B. J.; Pai, A.; Pai, S. A.; Palamos, J. R.; Palashov, O.; Palomba, C.; Pal-Singh, A.; Pan, H.; Pan, Y.; Pankow, C.; Pannarale, F.; Pant, B. C.; Paoletti, F.; Paoli, A.; Papa, M. A.; Paris, H. R.; Parker, W.; Pascucci, D.; Pasqualetti, A.; Passaquieti, R.; Passuello, D.; Patricelli, B.; Patrick, Z.; Pearlstone, B. L.; Pedraza, M.; Pedurand, R.; Pekowsky, L.; Pele, A.; Penn, S.; Perreca, A.; Pfeiffer, H. P.; Phelps, M.; Piccinni, O.; Pichot, M.; Piergiovanni, F.; Pierro, V.; Pillant, G.; Pinard, L.; Pinto, I. M.; Pitkin, M.; Poggiani, R.; Popolizio, P.; Post, A.; Powell, J.; Prasad, J.; Predoi, V.; Premachandra, S. S.; Prestegard, T.; Price, L. R.; Prijatelj, M.; Principe, M.; Privitera, S.; Prodi, G. A.; Prokhorov, L.; Puncken, O.; Punturo, M.; Puppo, P.; Pürrer, M.; Qi, H.; Qin, J.; Quetschke, V.; Quintero, E. A.; Quitzow-James, R.; Raab, F. J.; Rabeling, D. S.; Radkins, H.; Raffai, P.; Raja, S.; Rakhmanov, M.; Rapagnani, P.; Raymond, V.; Razzano, M.; Re, V.; Read, J.; Reed, C. M.; Regimbau, T.; Rei, L.; Reid, S.; Reitze, D. H.; Rew, H.; Reyes, S. D.; Ricci, F.; Riles, K.; Robertson, N. A.; Robie, R.; Robinet, F.; Rocchi, A.; Rolland, L.; Rollins, J. G.; Roma, V. J.; Romano, R.; Romanov, G.; Romie, J. H.; Rosińska, D.; Röver, C.; Rowan, S.; Rüdiger, A.; Ruggi, P.; Ryan, K.; Sachdev, S.; Sadecki, T.; Sadeghian, L.; Salconi, L.; Saleem, M.; Salemi, F.; Samajdar, A.; Sammut, L.; Sanchez, E. J.; Sandberg, V.; Sandeen, B.; Sanders, J. R.; Sassolas, B.; Sathyaprakash, B. S.; Saulson, P. R.; Sauter, O.; Savage, R. L.; Sawadsky, A.; Schale, P.; Schilling, R.; Schmidt, J.; Schmidt, P.; Schnabel, R.; Schofield, R. M. S.; Schönbeck, A.; Schreiber, E.; Schuette, D.; Schutz, B. F.; Scott, J.; Scott, S. M.; Sellers, D.; Sengupta, A. S.; Sentenac, D.; Sequino, V.; Sergeev, A.; Serna, G.; Setyawati, Y.; Sevigny, A.; Shaddock, D. A.; Shah, S.; Shahriar, M. S.; Shaltev, M.; Shao, Z.; Shapiro, B.; Shawhan, P.; Sheperd, A.; Shoemaker, D. H.; Shoemaker, D. M.; Siellez, K.; Siemens, X.; Sigg, D.; Silva, A. D.; Simakov, D.; Singer, A.; Singer, L. P.; Singh, A.; Singh, R.; Singhal, A.; Sintes, A. M.; Slagmolen, B. J. J.; Smith, J. R.; Smith, N. D.; Smith, R. J. E.; Son, E. J.; Sorazu, B.; Sorrentino, F.; Souradeep, T.; Srivastava, A. K.; Staley, A.; Steinke, M.; Steinlechner, J.; Steinlechner, S.; Steinmeyer, D.; Stephens, B. C.; Stevenson, S. P.; Stone, R.; Strain, K. A.; Straniero, N.; Stratta, G.; Strauss, N. A.; Strigin, S.; Sturani, R.; Stuver, A. L.; Summerscales, T. Z.; Sun, L.; Sutton, P. J.; Swinkels, B. L.; Szczepańczyk, M. J.; Tacca, M.; Talukder, D.; Tanner, D. B.; Tápai, M.; Tarabrin, S. P.; Taracchini, A.; Taylor, R.; Theeg, T.; Thirugnanasambandam, M. P.; Thomas, E. G.; Thomas, M.; Thomas, P.; Thorne, K. A.; Thorne, K. S.; Thrane, E.; Tiwari, S.; Tiwari, V.; Tokmakov, K. V.; Tomlinson, C.; Tonelli, M.; Torres, C. V.; Torrie, C. I.; Töyrä, D.; Travasso, F.; Traylor, G.; Trifirò, D.; Tringali, M. C.; Trozzo, L.; Tse, M.; Turconi, M.; Tuyenbayev, D.; Ugolini, D.; Unnikrishnan, C. S.; Urban, A. L.; Usman, S. A.; Vahlbruch, H.; Vajente, G.; Valdes, G.; van Bakel, N.; van Beuzekom, M.; van den Brand, J. F. J.; Van Den Broeck, C.; Vander-Hyde, D. C.; van der Schaaf, L.; van der Sluys, M. V.; van Heijningen, J. V.; Vañó-Viñuales, A.; van Veggel, A. A.; Vardaro, M.; Vass, S.; Vasúth, M.; Vaulin, R.; Vecchio, A.; Vedovato, G.; Veitch, J.; Veitch, P. J.; Venkateswara, K.; Verkindt, D.; Vetrano, F.; Viceré, A.; Vinciguerra, S.; Vine, D. J.; Vinet, J.-Y.; Vitale, S.; Vo, T.; Vocca, H.; Vorvick, C.; Voss, D.; Vousden, W. D.; Vyatchanin, S. P.; Wade, A. R.; Wade, L. E.; Wade, M.; Walker, M.; Wallace, L.; Walsh, S.; Wang, G.; Wang, H.; Wang, M.; Wang, X.; Wang, Y.; Ward, R. L.; Warner, J.; Was, M.; Weaver, B.; Wei, L.-W.; Weinert, M.; Weinstein, A. J.; Weiss, R.; Welborn, T.; Wen, L.; Weßels, P.; Westphal, T.; Wette, K.; Whelan, J. T.; White, D. J.; Whiting, B. F.; Williams, R. D.; Williamson, A. R.; Willis, J. L.; Willke, B.; Wimmer, M. H.; Winkler, W.; Wipf, C. C.; Wittel, H.; Woan, G.; Worden, J.; Wright, J. L.; Wu, G.; Yablon, J.; Yam, W.; Yamamoto, H.; Yancey, C. C.; Yap, M. J.; Yu, H.; Yvert, M.; ZadroŻny, A.; Zangrando, L.; Zanolin, M.; Zendri, J.-P.; Zevin, M.; Zhang, F.; Zhang, L.; Zhang, M.; Zhang, Y.; Zhao, C.; Zhou, M.; Zhou, Z.; Zhu, X. J.; Zucker, M. E.; Zuraw, S. E.; Zweizig, J.; Boyle, M.; Brügamin, B.; Campanelli, M.; Clark, M.; Hamberger, D.; Kidder, L. E.; Kinsey, M.; Laguna, P.; Ossokine, S.; Scheel, M. A.; Szilagyi, B.; Teukolsky, S.; Zlochower, Y.; LIGO Scientific Collaboration; Virgo Collaboration

2016-06-01

On September 14, 2015, the Laser Interferometer Gravitational-Wave Observatory (LIGO) detected a gravitational-wave transient (GW150914); we characterize the properties of the source and its parameters. The data around the time of the event were analyzed coherently across the LIGO network using a suite of accurate waveform models that describe gravitational waves from a compact binary system in general relativity. GW150914 was produced by a nearly equal mass binary black hole of masses 3 6-4+5M⊙ and 2 9-4+4M⊙ ; for each parameter we report the median value and the range of the 90% credible interval. The dimensionless spin magnitude of the more massive black hole is bound to be <0.7 (at 90% probability). The luminosity distance to the source is 41 0-180+160 Mpc , corresponding to a redshift 0.0 9-0.04+0.03 assuming standard cosmology. The source location is constrained to an annulus section of 610 deg2 , primarily in the southern hemisphere. The binary merges into a black hole of mass 6 2-4+4M⊙ and spin 0.6 7-0.07+0.05. This black hole is significantly more massive than any other inferred from electromagnetic observations in the stellar-mass regime.

Near-Infrared Polarimetry of the GG Tauri A Binary System

Science.gov (United States)

Itoh, Yoichi; Oasa, Yumiko; Kudo, Tomoyuki; Kusakabe, Nobuhiko; Hashimoto, Jun; Abe, Lyu; Brandner, Wolfgang; Brandt, Timothy D.; Carson, Joseph C.; Egner, Sebastian;

Presence of mixed modes in red giants in binary systems

Directory of Open Access Journals (Sweden)

Themeßl Nathalie

2017-01-01

Full Text Available The frequencies of oscillation modes in stars contain valueable information about the stellar properties. In red giants the frequency spectrum also contains mixed modes, with both pressure (p and gravity (g as restoring force, which are key to understanding the physical conditions in the stellar core. We observe a high fraction of red giants in binary systems, for which g-dominated mixed modes are not pronounced. This trend leads us to investigate whether this is specific for binary systems or a more general feature. We do so by comparing the fraction of stars with only p-dominated mixed modes in binaries and in a larger set of stars from the APOKASC sample. We find only p-dominated mixed modes in about 50% of red giants in detached eclipsing binaries compared to about 4% in the large sample. This could indicate that this phenomenon is tightly related to binarity and that the binary fraction in the APOKASC sample is about 8%.

BINARY CANDIDATES IN THE JOVIAN TROJAN AND HILDA POPULATIONS FROM NEOWISE LIGHT CURVES

Energy Technology Data Exchange (ETDEWEB)

Sonnett, S.; Mainzer, A.; Masiero, J.; Bauer, J. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Grav, T., E-mail: Sarah.Sonnett@jpl.nasa.gov [Planetary Science Institute, Tucson, AZ (United States)

2015-02-01

Determining the binary fraction for a population of asteroids, particularly as a function of separation between the two components, helps describe the dynamical environment at the time the binaries formed, which in turn offers constraints on the dynamical evolution of the solar system. We searched the NEOWISE archival data set for close and contact binary Trojans and Hildas via their diagnostically large light curve amplitudes. We present 48 out of 554 Hilda and 34 out of 953 Trojan binary candidates in need of follow-up to confirm their large light curve amplitudes and subsequently constrain the binary orbit and component sizes. From these candidates, we calculate a preliminary estimate of the binary fraction without confirmation or debiasing of 14%-23% for Trojans larger than ∼12 km and 30%-51% for Hildas larger than ∼4 km. Once the binary candidates have been confirmed, it should be possible to infer the underlying, debiased binary fraction through estimation of survey biases.

A NuSTAR observation of the reflection spectrum of the low-mass X-ray binary 4U 1728-34

DEFF Research Database (Denmark)

Sleator, Clio C.; Tomsick, John A.; King, Ashley L.

2016-01-01

We report on a simultaneous NuSTAR and Swift observation of the neutron star low-mass X-ray binary 4U 1728-34. We identified and removed four Type I X-ray bursts during the observation in order to study the persistent emission. The continuum spectrum is hard and described well by a blackbody with...

Formation of the wide asynchronous binary asteroid population

International Nuclear Information System (INIS)

Jacobson, Seth A.; Scheeres, Daniel J.; McMahon, Jay

2014-01-01

We propose and analyze a new mechanism for the formation of the wide asynchronous binary population. These binary asteroids have wide semimajor axes relative to most near-Earth and main belt asteroid systems. Confirmed members have rapidly rotating primaries and satellites that are not tidally locked. Previously suggested formation mechanisms from impact ejecta, from planetary flybys, and directly from rotational fission events cannot satisfy all of the observations. The newly hypothesized mechanism works as follows: (1) these systems are formed from rotational fission, (2) their satellites are tidally locked, (3) their orbits are expanded by the binary Yarkovsky-O'Keefe-Radzievskii-Paddack (BYORP) effect, (4) their satellites desynchronize as a result of the adiabatic invariance between the libration of the secondary and the mutual orbit, and (5) the secondary avoids resynchronization because of the YORP effect. This seemingly complex chain of events is a natural pathway for binaries with satellites that have particular shapes, which define the BYORP effect torque that acts on the system. After detailing the theory, we analyze each of the wide asynchronous binary members and candidates to assess their most likely formation mechanism. Finally, we suggest possible future observations to check and constrain our hypothesis.

First Higher-Multipole Model of Gravitational Waves from Spinning and Coalescing Black-Hole Binaries.

Science.gov (United States)

London, Lionel; Khan, Sebastian; Fauchon-Jones, Edward; García, Cecilio; Hannam, Mark; Husa, Sascha; Jiménez-Forteza, Xisco; Kalaghatgi, Chinmay; Ohme, Frank; Pannarale, Francesco

2018-04-20

Gravitational-wave observations of binary black holes currently rely on theoretical models that predict the dominant multipoles (ℓ=2,|m|=2) of the radiation during inspiral, merger, and ringdown. We introduce a simple method to include the subdominant multipoles to binary black hole gravitational waveforms, given a frequency-domain model for the dominant multipoles. The amplitude and phase of the original model are appropriately stretched and rescaled using post-Newtonian results (for the inspiral), perturbation theory (for the ringdown), and a smooth transition between the two. No additional tuning to numerical-relativity simulations is required. We apply a variant of this method to the nonprecessing PhenomD model. The result, PhenomHM, constitutes the first higher-multipole model of spinning and coalescing black-hole binaries, and currently includes the (ℓ,|m|)=(2,2),(3,3),(4,4),(2,1),(3,2),(4,3) radiative moments. Comparisons with numerical-relativity waveforms demonstrate that PhenomHM is more accurate than dominant-multipole-only models for all binary configurations, and typically improves the measurement of binary properties.

First Higher-Multipole Model of Gravitational Waves from Spinning and Coalescing Black-Hole Binaries

Science.gov (United States)

London, Lionel; Khan, Sebastian; Fauchon-Jones, Edward; García, Cecilio; Hannam, Mark; Husa, Sascha; Jiménez-Forteza, Xisco; Kalaghatgi, Chinmay; Ohme, Frank; Pannarale, Francesco

2018-04-01

Gravitational-wave observations of binary black holes currently rely on theoretical models that predict the dominant multipoles (ℓ=2 ,|m |=2 ) of the radiation during inspiral, merger, and ringdown. We introduce a simple method to include the subdominant multipoles to binary black hole gravitational waveforms, given a frequency-domain model for the dominant multipoles. The amplitude and phase of the original model are appropriately stretched and rescaled using post-Newtonian results (for the inspiral), perturbation theory (for the ringdown), and a smooth transition between the two. No additional tuning to numerical-relativity simulations is required. We apply a variant of this method to the nonprecessing PhenomD model. The result, PhenomHM, constitutes the first higher-multipole model of spinning and coalescing black-hole binaries, and currently includes the (ℓ,|m |)=(2 ,2 ),(3 ,3 ),(4 ,4 ),(2 ,1 ),(3 ,2 ),(4 ,3 ) radiative moments. Comparisons with numerical-relativity waveforms demonstrate that PhenomHM is more accurate than dominant-multipole-only models for all binary configurations, and typically improves the measurement of binary properties.

A thermodynamic study of complexation process between N, N'-dipyridoxylidene(1,4-butanediamine) and Cd2+ in some binary mixed solvents using conductometry

Science.gov (United States)

Ebrahimpoor, Sonia; Khoshnood, Razieh Sanavi; Beyramabadi, S. Ali

2016-12-01

Complexation of the Cd2+ ion with N, N'-dipyridoxylidene(1,4-butanediamine) Schiff base was studied in pure solvents including acetonitrile (AN), ethanol (EtOH), methanol (MeOH), tetrahydrofuran (THF), dimethylformamide (DMF), water (H2O), and various binary solvent mixtures of acetonitrile-ethanol (AN-EtOH), acetonitrile-methanol (AN-MeOH), acetonitrile-tetrahydrofuran (AN-THF), acetonitrile-dimethylformamide (AN-DMF), and acetonitrile-water (AN-H2O) systems at different temperatures using the conductometric method. The conductance data show that the stoichiometry of complex is 1: 1 [ML] in all solvent systems. A non-linear behavior was observed for changes of log K f of [Cd( N, N'-dipyridoxylidene(1,4-butanediamine)] complex versus the composition of the binary mixed solvents, which was explained in terms of solvent-solvent interactions. The results show that the thermodynamics of complexation reaction is affected by the nature and composition of the mixed solvents.

Superlattice configurations in linear chain hydrocarbon binary mixtures

Indian Academy of Sciences (India)

Unknown

Long-chain alkanes; binary mixtures; superlattices; discrete orientational changes. 1. Introduction ... tem and a model of superlattice configuration was proposed4, in terms of .... C18 system,4 the angle with value = 3⋅3° was seen to play an ...

Skewed Binary Search Trees

DEFF Research Database (Denmark)

Brodal, Gerth Stølting; Moruz, Gabriel

2006-01-01

It is well-known that to minimize the number of comparisons a binary search tree should be perfectly balanced. Previous work has shown that a dominating factor over the running time for a search is the number of cache faults performed, and that an appropriate memory layout of a binary search tree...... can reduce the number of cache faults by several hundred percent. Motivated by the fact that during a search branching to the left or right at a node does not necessarily have the same cost, e.g. because of branch prediction schemes, we in this paper study the class of skewed binary search trees....... For all nodes in a skewed binary search tree the ratio between the size of the left subtree and the size of the tree is a fixed constant (a ratio of 1/2 gives perfect balanced trees). In this paper we present an experimental study of various memory layouts of static skewed binary search trees, where each...

Binary and ternary vapor–liquid equilibrium data of the system ethylbenzene + styrene + 3-methyl-N-butylpyridinium tetracyanoborate at vacuum conditions and liquid–liquid equilibrium data of their binary systems

NARCIS (Netherlands)

Jongmans, M.T.G.; Hermens, E.; Schuur, B.; Haan, de A.B.

2012-01-01

In this study, binary LLE data at 313.2, 333.2, and 353.2 K, binary VLE data in the pressure range of 3–30 kPa and ternary VLE data at 5, 10, and 15 kPa have been determined for the system ethylbenzene + styrene + [3-mebupy][B(CN)4]. The IL [3-mebupy][B(CN)4] can increase the relative volatility of

Binary and ternary vapor-liquid equilibrium data of the system ethylbenzene+styrene+3-methyl-N-butylpyridinium tetracyanoborate at vacuum conditions and liquid-liquid equilibrium data of their binary systems

NARCIS (Netherlands)

Jongmans, Mark; Hermens, E.; Schuur, Boelo; de Haan, A.B.

2012-01-01

In this study, binary LLE data at 313.2, 333.2, and 353.2 K, binary VLE data in the pressure range of 3–30 kPa and ternary VLE data at 5, 10, and 15 kPa have been determined for the system ethylbenzene + styrene + [3-mebupy][B(CN)4]. The IL [3-mebupy][B(CN)4] can increase the relative volatility of

BROWN DWARF BINARIES FROM DISINTEGRATING TRIPLE SYSTEMS

Energy Technology Data Exchange (ETDEWEB)

Reipurth, Bo [Institute for Astronomy and NASA Astrobiology Institute University of Hawaii, 640 N. Aohoku Place, Hilo, HI 96720 (United States); Mikkola, Seppo, E-mail: reipurth@ifa.hawaii.edu, E-mail: Seppo.Mikkola@utu.fi [Tuorla Observatory, University of Turku, Väisäläntie 20, Piikkiö (Finland)

2015-04-15

Binaries in which both components are brown dwarfs (BDs) are being discovered at an increasing rate, and their properties may hold clues to their origin. We have carried out 200,000 N-body simulations of three identical stellar embryos with masses drawn from a Chabrier IMF and embedded in a molecular core. The bodies are initially non-hierarchical and undergo chaotic motions within the cloud core, while accreting using Bondi–Hoyle accretion. The coupling of dynamics and accretion often leads to one or two dominant bodies controlling the center of the cloud core, while banishing the other(s) to the lower-density outskirts, leading to stunted growth. Eventually each system transforms either to a bound hierarchical configuration or breaks apart into separate single and binary components. The orbital motion is followed for 100 Myr. In order to illustrate 200,000 end-states of such dynamical evolution with accretion, we introduce the “triple diagnostic diagram,” which plots two dimensionless numbers against each other, representing the binary mass ratio and the mass ratio of the third body to the total system mass. Numerous freefloating BD binaries are formed in these simulations, and statistical properties are derived. The separation distribution function is in good correspondence with observations, showing a steep rise at close separations, peaking around 13 AU and declining more gently, reaching zero at separations greater than 200 AU. Unresolved BD triple systems may appear as wider BD binaries. Mass ratios are strongly peaked toward unity, as observed, but this is partially due to the initial assumptions. Eccentricities gradually increase toward higher values, due to the lack of viscous interactions in the simulations, which would both shrink the orbits and decrease their eccentricities. Most newborn triple systems are unstable and while there are 9209 ejected BD binaries at 1 Myr, corresponding to about 4% of the 200,000 simulations, this number has grown to

BROWN DWARF BINARIES FROM DISINTEGRATING TRIPLE SYSTEMS

International Nuclear Information System (INIS)

Reipurth, Bo; Mikkola, Seppo

2015-01-01

Binaries in which both components are brown dwarfs (BDs) are being discovered at an increasing rate, and their properties may hold clues to their origin. We have carried out 200,000 N-body simulations of three identical stellar embryos with masses drawn from a Chabrier IMF and embedded in a molecular core. The bodies are initially non-hierarchical and undergo chaotic motions within the cloud core, while accreting using Bondi–Hoyle accretion. The coupling of dynamics and accretion often leads to one or two dominant bodies controlling the center of the cloud core, while banishing the other(s) to the lower-density outskirts, leading to stunted growth. Eventually each system transforms either to a bound hierarchical configuration or breaks apart into separate single and binary components. The orbital motion is followed for 100 Myr. In order to illustrate 200,000 end-states of such dynamical evolution with accretion, we introduce the “triple diagnostic diagram,” which plots two dimensionless numbers against each other, representing the binary mass ratio and the mass ratio of the third body to the total system mass. Numerous freefloating BD binaries are formed in these simulations, and statistical properties are derived. The separation distribution function is in good correspondence with observations, showing a steep rise at close separations, peaking around 13 AU and declining more gently, reaching zero at separations greater than 200 AU. Unresolved BD triple systems may appear as wider BD binaries. Mass ratios are strongly peaked toward unity, as observed, but this is partially due to the initial assumptions. Eccentricities gradually increase toward higher values, due to the lack of viscous interactions in the simulations, which would both shrink the orbits and decrease their eccentricities. Most newborn triple systems are unstable and while there are 9209 ejected BD binaries at 1 Myr, corresponding to about 4% of the 200,000 simulations, this number has grown to

Evolution and merging of binaries with compact objects

International Nuclear Information System (INIS)

Bethe, Hans A.; Brown, Gerald E.; Lee, Chang-Hwan

2007-01-01

In the light of recent observations in which short γ-ray bursts are interpreted as arising from black-hole(BH), neutron-star(NS) or NS-NS mergings we would like to review our research on the evolution of compact binaries, especially those containing NS's. These were carried out with predictions for LIGO in mind, but are directly applicable to short γ-ray bursts in the interpretation above. Most important in our review is that we show that the standard scenario for evolving NS-NS binaries always ends up with a low-mass BH (LMBH), NS binary. Bethe and Brown [1998, Astrophys. J. 506, 780] showed that this fate could be avoided if the two giants in the progenitor binary burned He at the same time, and that in this way the binary could avoid the common envelope evolution of the NS with red giant companion which sends the first born NS into a BH in the standard scenario. The burning of He at the same time requires, for the more massive giants such as the progenitors of the Hulse-Taylor binary NS that the two giants be within 4% of each other in zero age main sequence (ZAMS) mass. Applying this criterion to all binaries results in a factor ∼5 of LMBH-NS binaries as compared with NS-NS binaries. Although this factor is substantially less than the originally claimed factor of 20 which Bethe and Brown (1998) estimated, largely because a careful evolution has been carried through here, our factor 5 is augmented by a factor of ∼8 arising from the higher rate of star formation in the earlier Galaxy from which the BH-NS binaries came from. Furthermore, here we calculate the mergers for short-hard gamma-ray bursts, whereas Bethe and Brown's factor 20 included a factor of 2 for the higher chirp masses in a BH-NS binary as compared with NS-NS one. In short, we end up with an estimate of factor ∼40 over that calculated with NS-NS binary mergers in our Galaxy alone. Our total rate is estimated to be about one merging of compact objects per year. Our scenario of NS-NS binaries

Binary optics: Trends and limitations

Science.gov (United States)

Farn, Michael W.; Veldkamp, Wilfrid B.

1993-01-01

We describe the current state of binary optics, addressing both the technology and the industry (i.e., marketplace). With respect to the technology, the two dominant aspects are optical design methods and fabrication capabilities, with the optical design problem being limited by human innovation in the search for new applications and the fabrication issue being limited by the availability of resources required to improve fabrication capabilities. With respect to the industry, the current marketplace does not favor binary optics as a separate product line and so we expect that companies whose primary purpose is the production of binary optics will not represent the bulk of binary optics production. Rather, binary optics' more natural role is as an enabling technology - a technology which will directly result in a competitive advantage in a company's other business areas - and so we expect that the majority of binary optics will be produced for internal use.

Conductance Studies on Complex Formation between c-Methylcalix[4]resorcinarene and Titanium (III in Acetonitrile-H2O Binary Solutions

Directory of Open Access Journals (Sweden)

Naghmeh Saadati

2013-09-01

Full Text Available Calixresorcinarenes have proved to be unique molecules for molecular recognition via hydrogen bonding, hydrophobic and ionic interactions with suitable substrates such as cations. The study of the interactions involved in the complexation of different cations with calixresorcinarenes in solvent mixtures is important for a better understanding of the mechanism of biological transport, molecular recognition, and other analytical applications. This article summarizes different aspects of the complexes of the Ti3+ metal cation with c-methylcalix[4]resorcinarene (CMCR as studied by conductometry in acetonitrile (AN–water (H2O binary mixtures at different temperatures. Conductance data show that the metal cation/ligand (ML stoichiometry of the complexes in solution is 1:1 in all cases. Non-linear behaviour was observed for the variation of logKf of the complexes vs. the composition of the binary solvent mixtures. Selectivity of CMCR for the Ti3+ cation is sensitive to solvent composition; in some cases and at certain compositions of the mixed solvent systems, the selectivity order is changed. Values of thermodynamic parameters (, for formation of the CMCR–Ti3+ complexes in AN–H2O binary systems were obtained from the temperature dependence of stability constants, and the results show that the thermodynamics of complexation reactions are affected by the nature and composition of the mixed solvents.

Black holes in binary stars

NARCIS (Netherlands)

Wijers, R.A.M.J.

1996-01-01

Introduction Distinguishing neutron stars and black holes Optical companions and dynamical masses X-ray signatures of the nature of a compact object Structure and evolution of black-hole binaries High-mass black-hole binaries Low-mass black-hole binaries Low-mass black holes Formation of black holes

BINARY CEPHEIDS: SEPARATIONS AND MASS RATIOS IN 5 M ☉ BINARIES

International Nuclear Information System (INIS)

Evans, Nancy Remage; Karovska, Margarita; Tingle, Evan; Bond, Howard E.; Schaefer, Gail H.; Mason, Brian D.

2013-01-01

Deriving the distribution of binary parameters for a particular class of stars over the full range of orbital separations usually requires the combination of results from many different observing techniques (radial velocities, interferometry, astrometry, photometry, direct imaging), each with selection biases. However, Cepheids—cool, evolved stars of ∼5 M ☉ —are a special case because ultraviolet (UV) spectra will immediately reveal any companion star hotter than early type A, regardless of the orbital separation. We have used International Ultraviolet Explorer UV spectra of a complete sample of all 76 Cepheids brighter than V = 8 to create a list of all 18 Cepheids with companions more massive than 2.0 M ☉ . Orbital periods of many of these binaries are available from radial-velocity studies, or can be estimated for longer-period systems from detected velocity variability. In an imaging survey with the Hubble Space Telescope Wide Field Camera 3, we resolved three of the companions (those of η Aql, S Nor, and V659 Cen), allowing us to make estimates of the periods out to the long-period end of the distribution. Combining these separations with orbital data in the literature, we derive an unbiased distribution of binary separations, orbital periods, and mass ratios. The distribution of orbital periods shows that the 5 M ☉ binaries have systematically shorter periods than do 1 M ☉ stars. Our data also suggest that the distribution of mass ratios depends on both binary separation and system multiplicity. The distribution of mass ratios as a function of orbital separation, however, does not depend on whether a system is a binary or a triple

Probing the Mysteries of the X-Ray Binary 4U 1210-64 with ASM, MAXI and Suzaku

Science.gov (United States)

Coley, Joel B.; Corbet, R.; Mukai, K.; Pottschmidt, K.

2013-01-01

Optical and X-ray observations of 4U 1210-64 (1ES 1210-646) suggest that the source is a High Mass X-ray Binary (HMXB) probably powered by the Be mechanism. Data acquired by the RXTE All Sky Monitor (ASM), the ISS Monitor of All-sky X-ray Image (MAXI) and Suzaku provide a detailed temporal and spectral description of this poorly understood source. Long-term data produced by ASM and MAXI indicate that the source shows two distinct high and low states. A 6.7-day orbital period of the system was found in folded light curves produced by both ASM and MAXI. A two day Suzaku observation in Dec. 2010 took place during a transition from the minimum to the maximum of the folded light curve. The two day Suzaku observation reveals large variations in flux indicative of strong orbit to orbit variability. Flares in the Suzaku light curve can reach nearly 1.4 times the mean count rate. From a spectral analysis of the Suzaku data, emission lines in the Fe K alpha region were detected at 6.4 keV, 6.7 keV and 6.97 keV interpreted as FeI, FeXXV and FeXXVI. In addition, emission lines were observed at approximately 1.0 and 2.6 keV, corresponding to NeX and SXVI respectively. Thermal bremsstrahlung or power law models both modified by interstellar and partially covering absorption provide a good fit to the continuum data. This source is intriguing for these reasons: i) No pulse period was observed; ii) 6.7 day orbital period is much less than typical orbital periods seen in Be/X-ray Binaries; iii) The optical companion is a B5V--an unusual spectral class for an HMXB; iv) There are extended high and low X-ray states.

Spectral properties of binary asteroids

Science.gov (United States)

Pajuelo, Myriam; Birlan, Mirel; Carry, Benoît; DeMeo, Francesca E.; Binzel, Richard P.; Berthier, Jérôme

2018-04-01

We present the first attempt to characterize the distribution of taxonomic class among the population of binary asteroids (15% of all small asteroids). For that, an analysis of 0.8-2.5{μ m} near-infrared spectra obtained with the SpeX instrument on the NASA/IRTF is presented. Taxonomic class and meteorite analog is determined for each target, increasing the sample of binary asteroids with known taxonomy by 21%. Most binary systems are bound in the S-, X-, and C- classes, followed by Q and V-types. The rate of binary systems in each taxonomic class agrees within uncertainty with the background population of small near-Earth objects and inner main belt asteroids, but for the C-types which are under-represented among binaries.

The disc-jet coupling in the neutron star X-ray binary 4U 1728-34

Science.gov (United States)

Tudose, Valeriu; Tzioumis, Anastasios; Belloni, Tomaso; Altamirano, Diego; Linares, Manuel; Mendez, Mariano; Hiemstra, Beike

2010-10-01

The present radio proposal is part of a multi-wavelength campaign focused on the study of the accretion/ejection process in the neutron star X-ray binary system 4U 1728-34. Our intention is to study the behaviour of the inner part of the accretion disc as inferred from the X-ray observations of the Fe emission line and the kHz quasi-periodic oscillations, and to link it to the properties of the radio jet. To achieve this goal we request 5 × 11h of observing time with ATCA, scheduled at regular intervals in the period 2010 August 27- October 13, the visibility window of the granted X-ray observations with RXTE (PI: Mendez) and Suzaku (PI: Linares).

Consequences of dynamical disruption and mass segregation for the binary frequencies of star clusters

International Nuclear Information System (INIS)

Geller, Aaron M.; De Grijs, Richard; Li, Chengyuan; Hurley, Jarrod R.

2013-01-01

The massive (13,000-26,000 M ☉ ) and young (15-30 Myr) Large Magellanic Cloud star cluster NGC 1818 reveals an unexpected increasing binary frequency with radius for F-type stars (1.3-2.2 M ☉ ). This is in contrast to many older star clusters that show a decreasing binary frequency with radius. We study this phenomenon with sophisticated N-body modeling, exploring a range of initial conditions, from smooth virialized density distributions to highly substructured and collapsing configurations. We find that many of these models can reproduce the cluster's observed properties, although with a modest preference for substructured initial conditions. Our models produce the observed radial trend in binary frequency through disruption of soft binaries (with semi-major axes, a ≳ 3000 AU), on approximately a crossing time (∼5.4 Myr), preferentially in the cluster core. Mass segregation subsequently causes the binaries to sink toward the core. After roughly one initial half-mass relaxation time (t rh (0) ∼ 340 Myr) the radial binary frequency distribution becomes bimodal, the innermost binaries having already segregated toward the core, leaving a minimum in the radial binary frequency distribution that marches outward with time. After 4-6 t rh (0), the rising distribution in the halo disappears, leaving a radial distribution that rises only toward the core. Thus, both a radial binary frequency distribution that falls toward the core (as observed for NGC 1818) and one that rises toward the core (as for older star clusters) can arise naturally from the same evolutionary sequence owing to binary disruption and mass segregation in rich star clusters.

Formation and Evolution of Binary Asteroids

Science.gov (United States)

Walsh, K. J.; Jacobson, S. A.

Satellites of asteroids have been discovered in nearly every known small-body population, and a remarkable aspect of the known satellites is the diversity of their properties. They tell a story of vast differences in formation and evolution mechanisms that act as a function of size, distance from the Sun, and the properties of their nebular environment at the beginning of solar system history and their dynamical environment over the next 4.5 G.y. The mere existence of these systems provides a laboratory to study numerous types of physical processes acting on asteroids, and their dynamics provide a valuable probe of their physical properties otherwise possible only with spacecraft. Advances in understanding the formation and evolution of binary systems have been assisted by (1) the growing catalog of known systems, increasing from 33 to ~250 between the Merline et al. (2002) chapter in Asteroids III and now; (2) the detailed study and long-term monitoring of individual systems such as 1999 KW4 and 1996 FG3, (3) the discovery of new binary system morphologies and triple systems, (4) and the discovery of unbound systems that appear to be end-states of binary dynamical evolutionary paths. Specifically for small bodies (diameter smaller than 10 km), these observations and discoveries have motivated theoretical work finding that thermal forces can efficiently drive the rotational disruption of small asteroids. Long-term monitoring has allowed studies to constrain the system's dynamical evolution by the combination of tides, thermal forces, and rigid-body physics. The outliers and split pairs have pushed the theoretical work to explore a wide range of evolutionary end-states.

NEAR-INFRARED SPECTROSCOPY OF LOW-MASS X-RAY BINARIES: ACCRETION DISK CONTAMINATION AND COMPACT OBJECT MASS DETERMINATION IN V404 Cyg AND Cen X-4

International Nuclear Information System (INIS)

Khargharia, Juthika; Froning, Cynthia S.; Robinson, Edward L.

2010-01-01

We present near-infrared (NIR) broadband (0.80-2.42 μm) spectroscopy of two low-mass X-ray binaries: V404 Cyg and Cen X-4. One important parameter required in the determination of the mass of the compact objects in these systems is the binary inclination. We can determine the inclination by modeling the ellipsoidal modulations of the Roche-lobe filling donor star, but the contamination of the donor star light from other components of the binary, particularly the accretion disk, must be taken into account. To this end, we determined the donor star contribution to the infrared flux by comparing the spectra of V404 Cyg and Cen X-4 to those of various field K-stars of known spectral type. For V404 Cyg, we determined that the donor star has a spectral type of K3 III. We determined the fractional donor contribution to the NIR flux in the H and K bands as 0.98 ± 0.05 and 0.97 ± 0.09, respectively. We remodeled the H-band light curve from Sanwal et al. after correcting for the donor star contribution to obtain a new value for the binary inclination. From this, we determined the mass of the black hole in V404 Cyg to be M BH = 9.0 +0.2 -0.6 M sun . We performed the same spectral analysis for Cen X-4 and found the spectral type of the donor star to be in the range K5-M1 V. The donor star contribution in Cen X-4 is 0.94 ± 0.14 in the H band while in the K band, the accretion disk can contribute up to 10% of the infrared flux. We remodeled the H-band light curve from Shahbaz et al., again correcting for the fractional contribution of the donor star to obtain the inclination. From this, we determined the mass of the neutron star as M NS = 1.5 +0.1 -0.4 M sun . However, the masses obtained for both systems should be viewed with some caution since contemporaneous light curve and spectral data are required to obtain definitive masses.

Influence of heat treatment on microstructure and properties of GX12CrMoVNbN9-1 cast steel

Directory of Open Access Journals (Sweden)

G. Golański

2010-07-01

Full Text Available The paper presents results of research on the influence of multistage heat treatment on microstructure and properties of high-chromiummartensitic GX12CrMoVNbN9 – 1 (GP91 steel. The material under investigation were samples taken out from a test coupon. Heattreatment of GP91 cast steel was performed at the parameters of temperature and time typical of treatment for multi-ton steel casts. The research has proved that in the as-received condition (as-cast state GP91 cast steel was characterized by a coarse grain, martensitic microstructure which provided the required standard mechanical properties. The heat treatment of GP91 cast steel contributed to obtainment of a fine grain microstructure of high tempered martensite with numerous precipitations of carbides of diverse size. The GP91 cast steel structure received through heat treatment made it possible to obtain high plastic properties, particularly impact strength, maintaining strength properties on the level of the required minimum.

The binary nature of PSR J2032+4127

International Nuclear Information System (INIS)

Lyne, A. G.; Stappers, B. W.; Keith, M. J.; Ray, P. S.; Kerr, M.

2015-01-01

PSR J2032+4127 is a γ-ray and radio-emitting pulsar which has been regarded as a young luminous isolated neutron star. However, its recent spin-down rate has extraordinarily increased by a factor of 2. Here we present evidence that this is due to its motion as a member of a highly-eccentric binary system with an ~15–M⊙ Be star, MT91 213. Timing observations show that, not only are the positions of the two stars coincident within 0.4 arcsec, but timing models of binary motion of the pulsar fit the data much better than a model of a young isolated pulsar. MT91 213, and hence the pulsar, lie in the Cyg OB2 stellar association, which is at a distance of only 1.4–1.7 kpc. The pulsar is currently on the near side of, and accelerating towards, the Be star, with an orbital period of 20–30 yr. Finally, the next periastron is well constrained to occur in early 2018, providing an opportunity to observe enhanced high-energy emission as seen in other Be-star binary systems.

Binary Cepheids: Separations and Mass Ratios in 5 M ⊙ Binaries

Science.gov (United States)

Evans, Nancy Evans; Bond, Howard E.; Schaefer, Gail H.; Mason, Brian D.; Karovska, Margarita; Tingle, Evan

2013-10-01

Deriving the distribution of binary parameters for a particular class of stars over the full range of orbital separations usually requires the combination of results from many different observing techniques (radial velocities, interferometry, astrometry, photometry, direct imaging), each with selection biases. However, Cepheids—cool, evolved stars of ~5 M ⊙—are a special case because ultraviolet (UV) spectra will immediately reveal any companion star hotter than early type A, regardless of the orbital separation. We have used International Ultraviolet Explorer UV spectra of a complete sample of all 76 Cepheids brighter than V = 8 to create a list of all 18 Cepheids with companions more massive than 2.0 M ⊙. Orbital periods of many of these binaries are available from radial-velocity studies, or can be estimated for longer-period systems from detected velocity variability. In an imaging survey with the Hubble Space Telescope Wide Field Camera 3, we resolved three of the companions (those of η Aql, S Nor, and V659 Cen), allowing us to make estimates of the periods out to the long-period end of the distribution. Combining these separations with orbital data in the literature, we derive an unbiased distribution of binary separations, orbital periods, and mass ratios. The distribution of orbital periods shows that the 5 M ⊙ binaries have systematically shorter periods than do 1 M ⊙ stars. Our data also suggest that the distribution of mass ratios depends on both binary separation and system multiplicity. The distribution of mass ratios as a function of orbital separation, however, does not depend on whether a system is a binary or a triple. Based in part on observations made with the NASA/ESA Hubble Space Telescope, obtained by the Space Telescope Science Institute. STScI is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS5-26555.

The formation of eccentric compact binary inspirals and the role of gravitational wave emission in binary-single stellar encounters

International Nuclear Information System (INIS)

Samsing, Johan; MacLeod, Morgan; Ramirez-Ruiz, Enrico

2014-01-01

The inspiral and merger of eccentric binaries leads to gravitational waveforms distinct from those generated by circularly merging binaries. Dynamical environments can assemble binaries with high eccentricity and peak frequencies within the LIGO band. In this paper, we study binary-single stellar scatterings occurring in dense stellar systems as a source of eccentrically inspiraling binaries. Many interactions between compact binaries and single objects are characterized by chaotic resonances in which the binary-single system undergoes many exchanges before reaching a final state. During these chaotic resonances, a pair of objects has a non-negligible probability of experiencing a very close passage. Significant orbital energy and angular momentum are carried away from the system by gravitational wave (GW) radiation in these close passages, and in some cases this implies an inspiral time shorter than the orbital period of the bound third body. We derive the cross section for such dynamical inspiral outcomes through analytical arguments and through numerical scattering experiments including GW losses. We show that the cross section for dynamical inspirals grows with increasing target binary semi-major axis a and that for equal-mass binaries it scales as a 2/7 . Thus, we expect wide target binaries to predominantly contribute to the production of these relativistic outcomes. We estimate that eccentric inspirals account for approximately 1% of dynamically assembled non-eccentric merging binaries. While these events are rare, we show that binary-single scatterings are a more effective formation channel than single-single captures for the production of eccentrically inspiraling binaries, even given modest binary fractions.

Isothermal (vapour + liquid) equilibrium for binary mixtures of polyethylene glycol mono-4-nonylphenyl ether (PEGNPE) with methanol, ethanol, or 2-propanol

International Nuclear Information System (INIS)

Khoiroh, Ianatul; Lee, Ming-Jer

2011-01-01

Highlights: → An autoclave apparatus was used for binary (vapour + liquid) equilibrium data measurement. → The studied systems are polyethylene glycol mono-4-nonylphenyl ether with alcohols. → The saturated pressure data were fitted accurately to the Antoine equation. → The NRTL model correlated well the phase equilibrium data. → The solvent activities have been calculated. - Abstract: Saturated pressures of three binary systems of oligomeric polyethylene glycol mono-4-nonylphenyl ether (PEGNPE) with methanol, ethanol, and 2-propanol have been measured by using an autoclave (vapour + liquid) equilibrium (VLE) apparatus at temperatures ranging from (340 to 455) K and the oligomer content ranging from 0.100 to 0.400 in mole fraction. With a given feed composition, equilibrium pressures were measured at various temperatures to obtain VLE data. The experimental data were fitted to the Antoine equation and also correlated with activity coefficient models, the NRTL and the UNIQUAC. The correlation results showed good agreement between the calculated values and the experimental data. In general, the NRTL model yielded better results. Additionally, the solvent activities were evaluated from the experimental results and were compared with those from the NRTL and the UNIQUAC models.

Properties of the Binary Black Hole Merger GW150914

OpenAIRE

Abbott, BP; Abbott, R; Abbott, TD; Abernathy, MR; Acernese, F; Ackley, K; Adams, C; Adams, T; Addesso, P; Adhikari, RX; Adya, VB; Affeldt, C; Agathos, M; Agatsuma, K; Aggarwal, N

2016-01-01

On September 14, 2015, the Laser Interferometer Gravitational-Wave Observatory (LIGO) detected a gravitational-wave transient (GW150914); we characterize the properties of the source and its parameters. The data around the time of the event were analyzed coherently across the LIGO network using a suite of accurate waveform models that describe gravitational waves from a compact binary system in general relativity. GW150914 was produced by a nearly equal mass binary black hole of masses 36+5−4...

N-Bit Binary Resistor

Science.gov (United States)

Tcheng, Ping

1989-01-01

Binary resistors in series tailored to precise value of resistance. Desired value of resistance obtained by cutting appropriate traces across resistors. Multibit, binary-based, adjustable resistor with high resolution used in many applications where precise resistance required.

Some properties of spectral binary stars

International Nuclear Information System (INIS)

Krajcheva, Z.T.; Popova, E.I.; Tutukov, A.V.; Yungel'son, L.R.; AN SSSR, Moscow. Astronomicheskij Sovet)

1978-01-01

Statistical investigations of spectra binary stars are carried out. Binary systems consisting of main sequence stars are considered. For 826 binary stars masses of components, ratios of component masses, semiaxes of orbits and orbital angular momenta are calculated. The distributions of these parameters and their correlations are analyzed. The dependences of statistical properties of spectral binary stars on their origin and evolution are discussed

Microlensing Binaries Discovered through High-magnification Channel

DEFF Research Database (Denmark)

Shin, I.-G.; Choi, J.-Y.; Park, S.-Y.

2012-01-01

Microlensing can provide a useful tool to probe binary distributions down to low-mass limits of binary companions. In this paper, we analyze the light curves of eight binary-lensing events detected through the channel of high-magnification events during the seasons from 2007 to 2010. The perturba......Microlensing can provide a useful tool to probe binary distributions down to low-mass limits of binary companions. In this paper, we analyze the light curves of eight binary-lensing events detected through the channel of high-magnification events during the seasons from 2007 to 2010...

Synthesis and characterization of binary (CuO)0.6(CeO2)0.4 nanoparticles via a simple heat treatment method

Science.gov (United States)

Baqer, Anwar Ali; Matori, Khamirul Amin; Al-Hada, Naif Mohammed; Shaari, Abdul Halim; Kamari, Halimah Mohamed; Saion, Elias; Chyi, Josephine Liew Ying; Abdullah, Che Azurahanim Che

2018-06-01

A binary (CuO)0.6 (CeO2)0.4 nanoparticles were prepared via thermal treatment method, using copper nitrate, cerium nitrate as precursors, PVP as capping agent and de-ionized water as a solvent. The structures, morphology, composition of the element and optical properties of these nanoparticles have been studied under different temperatures using various techniques. The XRD spectrum of the samples at 500 °C and above confirmed the existence of both monoclinic (CuO) and cubic fluorite (CeO2) structures. The findings of FESEM and TEM exhibited the average practical size and agglomeration increment with an elevation in the calcination temperature. The synthesized nanoparticles were also characterized by FTIR, which indicated the formation of binary Cu-O and Ce-O bonds. The EDX analysis was performed to indicate the chemical composition of the sample. The double energy band gaps of (CuO)0.6(CeO2)0.4 reduction with rising calcination temperature, can be referred to the enhancement of the crystallinity of the samples. PL intensity of (CuO)0.6(CeO2)0.4 nanoparticles peaks, which increased with the elevation of the calcination temperature to 800 °C was observed from the PL spectrum; this was due to the increment of the particle size that occurred.

Performance analysis and binary working fluid selection of combined flash-binary geothermal cycle

International Nuclear Information System (INIS)

Zeyghami, Mehdi

2015-01-01

Performance of the combined flash-binary geothermal power cycle for geofluid temperatures between 150 and 250 °C is studied. A thermodynamic model is developed, and the suitable binary working fluids for different geofluid temperatures are identified from a list of thirty working fluid candidates, consisting environmental friendly refrigerants and hydrocarbons. The overall system exergy destruction and Vapor Expansion Ratio across the binary cycle turbine are selected as key performance indicators. The results show that for low-temperature heat sources using refrigerants as binary working fluids result in higher overall cycle efficiency and for medium and high-temperature resources, hydrocarbons are more suitable. For combined flash-binary cycle, secondary working fluids; R-152a, Butane and Cis-butane show the best performances at geofluid temperatures 150, 200 and 250 °C respectively. The overall second law efficiency is calculated as high as 0.48, 0.55 and 0.58 for geofluid temperatures equal 150, 200 and 250 °C respectively. The flash separator pressure found to has important effects on cycle operation and performance. Separator pressure dictates the work production share of steam and binary parts of the system. And there is an optimal separator pressure at which overall exergy destruction of the cycle achieves its minimum value. - Highlights: • Performance of the combined flash-binary geothermal cycle is investigated. • Thirty different fluids are screened to find the most suitable ORC working fluid. • Optimum cycle operation conditions presented for geofluids between 150 °C and 250 °C. • Refrigerants are more suitable for the ORC at geothermal sources temperature ≤200 °C. • Hydrocarbons are more suitable for the ORC at geothermal sources temperature >200 °C

Project DWARF - using eclipsing binaries for searching for exoplanets and brown dwarfs

Science.gov (United States)

Kudak, V.; Parimucha, Š.

2016-12-01

Project DWARF is a long-term observation campaign for about 60 selected eclipsing binaries aimed for detection of exoplanets or other objects (brown dwarfs) in low-mass detached binaries of different types (low-mass eclipsing binaries with M and K components, short-period binaries with sdB or sdO component, post-common-envelope systems containing a white dwarf). Existence of other bodies in systems are determined by analysing of O-C diagrams, constructed from observed minima times of binaries. Objects are selected with intention to determine minima with high precision. About 40 observatories are involved into the network at present time, mostly situated in Europe. The observations are made by small or middle class telescopes with apertures of 20-200 cm. In this contribution we give information about current status of the project, we present main goals and results of 4 years observations.

BINARY CEPHEIDS: SEPARATIONS AND MASS RATIOS IN 5 M {sub ☉} BINARIES

Energy Technology Data Exchange (ETDEWEB)

Evans, Nancy Remage; Karovska, Margarita; Tingle, Evan [Smithsonian Astrophysical Observatory, MS 4, 60 Garden Street, Cambridge, MA 02138 (United States); Bond, Howard E. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Schaefer, Gail H. [The CHARA Array, Georgia State University, P.O. Box 3965, Atlanta, GA 30302-3965 (United States); Mason, Brian D., E-mail: nevans@cfa.harvard.edu, E-mail: heb11@psu.edu, E-mail: schaefer@chara-array.org [US Naval Observatory, 3450 Massachusetts Avenue, NW, Washington, DC 20392-5420 (United States)

2013-10-01

Deriving the distribution of binary parameters for a particular class of stars over the full range of orbital separations usually requires the combination of results from many different observing techniques (radial velocities, interferometry, astrometry, photometry, direct imaging), each with selection biases. However, Cepheids—cool, evolved stars of ∼5 M {sub ☉}—are a special case because ultraviolet (UV) spectra will immediately reveal any companion star hotter than early type A, regardless of the orbital separation. We have used International Ultraviolet Explorer UV spectra of a complete sample of all 76 Cepheids brighter than V = 8 to create a list of all 18 Cepheids with companions more massive than 2.0 M {sub ☉}. Orbital periods of many of these binaries are available from radial-velocity studies, or can be estimated for longer-period systems from detected velocity variability. In an imaging survey with the Hubble Space Telescope Wide Field Camera 3, we resolved three of the companions (those of η Aql, S Nor, and V659 Cen), allowing us to make estimates of the periods out to the long-period end of the distribution. Combining these separations with orbital data in the literature, we derive an unbiased distribution of binary separations, orbital periods, and mass ratios. The distribution of orbital periods shows that the 5 M {sub ☉} binaries have systematically shorter periods than do 1 M {sub ☉} stars. Our data also suggest that the distribution of mass ratios depends on both binary separation and system multiplicity. The distribution of mass ratios as a function of orbital separation, however, does not depend on whether a system is a binary or a triple.

Spectral evolution of the Atoll source 4U 1728-34 with RXTE and INTEGRAL: evidence for hard X-ray tail

NARCIS (Netherlands)

Tarana, A.; Belloni, T.; Bazzano, A.; Homan, J.; Méndez, M.; Ubertini, P.; Comastri, A.; Angelini, L.; Cappi, M.

We report the temporal and spectral results on the INTEGRAL and RXTE 2006-2007 observation campaign of the Atoll source 4U 1728-34 (GX 354-0). The source shows, more than once, spectral evolution as revealed by the hardness intensity diagram. The soft state is well described by a Comptonization with

Dissipative binary collisions

International Nuclear Information System (INIS)

Aboufirassi, M; Angelique, J.C.; Bizard, G.; Bougault, R.; Brou, R.; Buta, A.; Colin, J.; Cussol, D.; Durand, D.; Genoux-Lubain, A.; Horn, D.; Kerambrun, A.; Laville, J.L.; Le Brun, C.; Lecolley, J.F.; Lefebvres, F.; Lopez, O.; Louvel, M.; Meslin, C.; Metivier, V.; Nakagawa, T.; Peter, J.; Popescu, R.; Regimbart, R.; Steckmeyer, J.C.; Tamain, B.; Vient, E.; Wieloch, A.; Yuasa-Nakagawa, K.

1998-01-01

The binary character of the heavy ion collisions at intermediate energies in the exit channel has been observed under 30 MeV/n in medium and heavy systems. Measurements in light systems at energies approaching ∼ 100 MeV/nucleon as well as in very heavy systems have allowed to extend considerably the investigations of this binary process. Thus, the study of the Pb + Au system showed that the complete charge events indicated two distinct sources: the quasi-projectile and the quasi-target. The characteristics of these two sources are rather well reproduced by a trajectory computation which takes into account the Coulomb and nuclear forces and the friction appearing from the projectile-target interaction. The Wilczynski diagram is used to probe the correlation between the kinetic energy quenching and the deflecting angle. In case of the system Pb + Au at 29 MeV/nucleon the diagram indicate dissipative binary collisions typical for low energies. This binary aspect was also detected in the systems Xe + Ag at 44 MeV/nucleon, 36 Ar + 27 Al and 64 Zn + nat Ti. Thus, it was possible to reconstruct the quasi-projectile and to study its mass and excitation energy evolution as a function of the impact parameter. The dissipative binary collisions represent for the systems and energies under considerations the main contribution to the cross section. This does not implies that there are not other processes; particularly, the more or less complete fusion is also observed but with a low cross section which decreases with the increase of bombardment energy. More exclusive measurements with the INDRA detector on quasi-symmetric systems as Ar + KCl and Xe + Sn seem to confirm the importance of the binary collisions. The two source reconstruction of the Xe + Sn data at 50 MeV/nucleon reproduces the same behaviour as that observed in the system Pb + Au at 29 MeV/nucleon

Contact Binaries on Their Way Towards Merging

Science.gov (United States)

Gazeas, K.

2015-07-01

Contact binaries are the most frequently observed type of eclipsing star system. They are small, cool, low-mass binaries belonging to a relatively old stellar population. They follow certain empirical relationships that closely connect a number of physical parameters with each other, largely because of constraints coming from the Roche geometry. As a result, contact binaries provide an excellent test of stellar evolution, specifically for stellar merger scenarios. Observing campaigns by many authors have led to the cataloging of thousands of contact binaries and enabled statistical studies of many of their properties. A large number of contact binaries have been found to exhibit extraordinary behavior, requiring follow-up observations to study their peculiarities in detail. For example, a doubly-eclipsing quadruple system consisting of a contact binary and a detached binary is a highly constrained system offering an excellent laboratory to test evolutionary theories for binaries. A new observing project was initiated at the University of Athens in 2012 in order to investigate the possible lower limit for the orbital period of binary systems before coalescence, prior to merging.

Permutation Entropy for Random Binary Sequences

Directory of Open Access Journals (Sweden)

Lingfeng Liu

2015-12-01

Full Text Available In this paper, we generalize the permutation entropy (PE measure to binary sequences, which is based on Shannon’s entropy, and theoretically analyze this measure for random binary sequences. We deduce the theoretical value of PE for random binary sequences, which can be used to measure the randomness of binary sequences. We also reveal the relationship between this PE measure with other randomness measures, such as Shannon’s entropy and Lempel–Ziv complexity. The results show that PE is consistent with these two measures. Furthermore, we use PE as one of the randomness measures to evaluate the randomness of chaotic binary sequences.

Particle acceleration in binaries

Directory of Open Access Journals (Sweden)

Sinitsyna V.G.

2017-01-01

Full Text Available Cygnus X-3 massive binary system is one of the powerful sources of radio and X-ray emission consisting of an accreting compact object, probably a black hole, with a Wolf-Rayet star companion. Based on the detections of ultra high energy gamma-rays by Kiel and Havera Park, Cygnus X-3 has been proposed to be one of the most powerful sources of charged cosmic ray particles in the Galaxy. The results of long-term observations of the Cyg X-3 binary at energies 800 GeV–85 TeV detected by SHALON in 1995 are presented with images, integral spectra and spectral energy distribution. The identification of source with Cygnus X-3 detected by SHALON was secured by the detection of its 4.8 hour orbital period in TeV gamma-rays. During the whole observation period of Cyg X-3 with SHALON significant flux increases were detected at energies above 0.8 TeV. These TeV flux increases are correlated with flaring activity at a lower energy range of X-ray and/or at observations of Fermi LAT as well as with radio emission from the relativistic jets of Cygnus X-3. The variability of very high-energy gamma-radiation and correlation of radiation activity in the wide energy range can provide essential information on particle mechanism production up to very high energies. Whereas, modulation of very high energy emission connected to the orbital motion of the binary system, provides an understanding of the emission processes, nature and location of particle acceleration.

Circumstellar disks around binary stars in Taurus

International Nuclear Information System (INIS)

Akeson, R. L.; Jensen, E. L. N.

2014-01-01

We have conducted a survey of 17 wide (>100 AU) young binary systems in Taurus with the Atacama Large Millimeter Array (ALMA) at two wavelengths. The observations were designed to measure the masses of circumstellar disks in these systems as an aid to understanding the role of multiplicity in star and planet formation. The ALMA observations had sufficient resolution to localize emission within the binary system. Disk emission was detected around all primaries and 10 secondaries, with disk masses as low as 10 –4 M ☉ . We compare the properties of our sample to the population of known disks in Taurus and find that the disks from this binary sample match the scaling between stellar mass and millimeter flux of F mm ∝M ∗ 1.5--2.0 to within the scatter found in previous studies. We also compare the properties of the primaries to those of the secondaries and find that the secondary/primary stellar and disk mass ratios are not correlated; in three systems, the circumsecondary disk is more massive than the circumprimary disk, counter to some theoretical predictions.

Transformation of Lesquerella fendleri with the new binary vector pGPro4-35S

Science.gov (United States)

Crop genetic engineering requires the use of various promoters to control the expression of introduced transgenes. Some of the binary vectors currently available for promoter characterization in dicotyledonous plants have pitfalls due to their construction, such as containing a selectable marker ca...

Pulsed Accretion in the T Tauri Binary TWA 3A

Energy Technology Data Exchange (ETDEWEB)

Tofflemire, Benjamin M.; Mathieu, Robert D. [Department of Astronomy, University of Wisconsin–Madison, 475 North Charter Street, Madison, WI 53706 (United States); Herczeg, Gregory J. [The Kavli Institute for Astronomy and Astrophysics, Peking University, Beijing 100871 (China); Akeson, Rachel L.; Ciardi, David R. [NASA Exoplanet Science Institute, IPAC/Caltech, Pasadena, CA 91125 (United States)

2017-06-20

TWA 3A is the most recent addition to a small group of young binary systems that both actively accrete from a circumbinary disk and have spectroscopic orbital solutions. As such, it provides a unique opportunity to test binary accretion theory in a well-constrained setting. To examine TWA 3A’s time-variable accretion behavior, we have conducted a two-year, optical photometric monitoring campaign, obtaining dense orbital phase coverage (∼20 observations per orbit) for ∼15 orbital periods. From U -band measurements we derive the time-dependent binary mass accretion rate, finding bursts of accretion near each periastron passage. On average, these enhanced accretion events evolve over orbital phases 0.85 to 1.05, reaching their peak at periastron. The specific accretion rate increases above the quiescent value by a factor of ∼4 on average but the peak can be as high as an order of magnitude in a given orbit. The phase dependence and amplitude of TWA 3A accretion is in good agreement with numerical simulations of binary accretion with similar orbital parameters. In these simulations, periastron accretion bursts are fueled by periodic streams of material from the circumbinary disk that are driven by the binary orbit. We find that TWA 3A’s average accretion behavior is remarkably similar to DQ Tau, another T Tauri binary with similar orbital parameters, but with significantly less variability from orbit to orbit. This is only the second clear case of orbital-phase-dependent accretion in a T Tauri binary.

Binary Systems and the Initial Mass Function

Science.gov (United States)

Malkov, O. Yu.

2017-07-01

In the present paper we discuss advantages and disadvantages of binary stars, which are important for star formation history determination. We show that to make definite conclusions of the initial mass function shape, it is necessary to study binary population well enough to correct the luminosity function for unresolved binaries; to construct the mass-luminosity relation based on wide binaries data, and to separate observational mass functions of primaries, of secondaries, and of unresolved binaries.

The effects of binary UV filter mixtures on the midge Chironomus riparius

International Nuclear Information System (INIS)

Ozáez, Irene; Morcillo, Gloria; Martínez-Guitarte, José-Luis

2016-01-01

Organic ultraviolet (UV) filters are used in a wide variety of products, including cosmetics, to prevent damage from UV light in tissues and industrial materials. Their extensive use has raised concerns about potential adverse effects in human health and aquatic ecosystems that accumulate these pollutants. To increase sun radiation protection, UV filters are commonly used in mixtures. Here, we studied the toxicity of binary mixtures of 4-methylbenzylidene camphor (4MBC), octyl-methoxycinnamate (OMC), and benzophenone-3 (BP-3), by evaluating the larval mortality of Chironomus riparius. Also molecular endpoints have been analyzed, including alterations in the expression levels of a gene related with the endocrine system (EcR, ecdysone receptor) and a gene related with the stress response (hsp70, heat shock protein 70). The results showed that the mortality caused by binary mixtures was similar to that observed for each compound alone; however, some differences in LC50 were observed between groups. Gene expression analysis showed that EcR mRNA levels increased in the presence of 0.1 mg/L 4MBC but returned to normal levels after exposure to mixtures of 4MBC with 0.1, 1, and 10 mg/L of BP-3 or OMC. In contrast, the hsp70 mRNA levels increased after exposure to the combinations tested of 4MBC and BP-3 or OMC mixtures. These data suggest that 4MBC, BP-3, and OMC may have antagonist effects on EcR gene transcription and a synergistic effect on hsp70 gene activation. This is the first experimental study to show the complex patterned effects of UV filter mixtures on invertebrates. The data suggest that the interactions within these chemicals mixtures are complex and show diverse effects on various endpoints. - Highlights: • Chironomus riparius is sensitive to UV filter binary mixtures. • UV filters binary mixtures show antagonism on survival of 4th instar larvae. • BP-3 and OMC antagonize the stimulatory effect of 4MBC on EcR gene. • 4MBC, OMC, and BP-3 induce hsp70

The effects of binary UV filter mixtures on the midge Chironomus riparius

Energy Technology Data Exchange (ETDEWEB)

Ozáez, Irene; Morcillo, Gloria; Martínez-Guitarte, José-Luis, E-mail: jlmartinez@ccia.uned.es

2016-06-15

Organic ultraviolet (UV) filters are used in a wide variety of products, including cosmetics, to prevent damage from UV light in tissues and industrial materials. Their extensive use has raised concerns about potential adverse effects in human health and aquatic ecosystems that accumulate these pollutants. To increase sun radiation protection, UV filters are commonly used in mixtures. Here, we studied the toxicity of binary mixtures of 4-methylbenzylidene camphor (4MBC), octyl-methoxycinnamate (OMC), and benzophenone-3 (BP-3), by evaluating the larval mortality of Chironomus riparius. Also molecular endpoints have been analyzed, including alterations in the expression levels of a gene related with the endocrine system (EcR, ecdysone receptor) and a gene related with the stress response (hsp70, heat shock protein 70). The results showed that the mortality caused by binary mixtures was similar to that observed for each compound alone; however, some differences in LC50 were observed between groups. Gene expression analysis showed that EcR mRNA levels increased in the presence of 0.1 mg/L 4MBC but returned to normal levels after exposure to mixtures of 4MBC with 0.1, 1, and 10 mg/L of BP-3 or OMC. In contrast, the hsp70 mRNA levels increased after exposure to the combinations tested of 4MBC and BP-3 or OMC mixtures. These data suggest that 4MBC, BP-3, and OMC may have antagonist effects on EcR gene transcription and a synergistic effect on hsp70 gene activation. This is the first experimental study to show the complex patterned effects of UV filter mixtures on invertebrates. The data suggest that the interactions within these chemicals mixtures are complex and show diverse effects on various endpoints. - Highlights: • Chironomus riparius is sensitive to UV filter binary mixtures. • UV filters binary mixtures show antagonism on survival of 4th instar larvae. • BP-3 and OMC antagonize the stimulatory effect of 4MBC on EcR gene. • 4MBC, OMC, and BP-3 induce hsp70

Accuracy of binary black hole waveform models for aligned-spin binaries

Science.gov (United States)

Kumar, Prayush; Chu, Tony; Fong, Heather; Pfeiffer, Harald P.; Boyle, Michael; Hemberger, Daniel A.; Kidder, Lawrence E.; Scheel, Mark A.; Szilagyi, Bela

2016-05-01

Coalescing binary black holes are among the primary science targets for second generation ground-based gravitational wave detectors. Reliable gravitational waveform models are central to detection of such systems and subsequent parameter estimation. This paper performs a comprehensive analysis of the accuracy of recent waveform models for binary black holes with aligned spins, utilizing a new set of 84 high-accuracy numerical relativity simulations. Our analysis covers comparable mass binaries (mass-ratio 1 ≤q ≤3 ), and samples independently both black hole spins up to a dimensionless spin magnitude of 0.9 for equal-mass binaries and 0.85 for unequal mass binaries. Furthermore, we focus on the high-mass regime (total mass ≳50 M⊙ ). The two most recent waveform models considered (PhenomD and SEOBNRv2) both perform very well for signal detection, losing less than 0.5% of the recoverable signal-to-noise ratio ρ , except that SEOBNRv2's efficiency drops slightly for both black hole spins aligned at large magnitude. For parameter estimation, modeling inaccuracies of the SEOBNRv2 model are found to be smaller than systematic uncertainties for moderately strong GW events up to roughly ρ ≲15 . PhenomD's modeling errors are found to be smaller than SEOBNRv2's, and are generally irrelevant for ρ ≲20 . Both models' accuracy deteriorates with increased mass ratio, and when at least one black hole spin is large and aligned. The SEOBNRv2 model shows a pronounced disagreement with the numerical relativity simulation in the merger phase, for unequal masses and simultaneously both black hole spins very large and aligned. Two older waveform models (PhenomC and SEOBNRv1) are found to be distinctly less accurate than the more recent PhenomD and SEOBNRv2 models. Finally, we quantify the bias expected from all four waveform models during parameter estimation for several recovered binary parameters: chirp mass, mass ratio, and effective spin.

Binary CuO/Co{sub 3}O{sub 4} nanofibers for ultrafast and amplified electrochemical sensing of fructose

Energy Technology Data Exchange (ETDEWEB)

Wang Yang [College of Chemistry, Jilin University, Changchun 130012 (China); Wang Wen [Yantai Wanhua Polyurethanes Co., Ltd., Shandong 264002 (China); Song Wenbo, E-mail: wbsong@jlu.edu.cn [College of Chemistry, Jilin University, Changchun 130012 (China)

2011-11-30

Highlights: > Binary CuO/Co{sub 3}O{sub 4} nanofiber as active electrode material. > Dramatically enhanced catalytic activity and direct fructose detection. > Significantly lowered overpotential, ultrafast (1 s) and sensitive (18.988 {mu}A mM{sup -1}) response. - Abstract: Cobalt oxide-doped copper oxide composite nanofibers (CCNFs) were successfully achieved via electrospinning followed by thermal treatment processes and then exploited as active electrode material for direct enzyme-free fructose detection. The morphology and the structure of as-prepared samples were investigated by X-ray diffraction spectrum (XRD) and scanning electron microscopy (SEM). The electrocatalytic activity of CCNFs films towards fructose oxidation and sensing performances were evaluated by conventional electrochemical techniques. Cyclic voltammetry (CV) and chronoamperometry (I-t) revealed the distinctly enhanced sensing properties towards fructose compared to pure copper oxide nanofibers (CNFs), i.e., showing significantly lowered overpotential of 0.30 V, ultrafast (1 s) and ultrasensitive (18.988 {mu}A mM{sup -1}) current response in a wide linear range of 1.0 x 10{sup -5} M to 6.0 x 10{sup -3} M with satisfied reproducibility and stability, which could be ascribed to the synergic catalytic effect of the binary CuO/Co{sub 3}O{sub 4} composite nanofibers and the highly porous three-dimensional network films structure of the CCNFs. In addition, a good selectivity for fructose detection was achieved. Results in this work demonstrated that CCNFs is one of the promising catalytic electrode materials for enzymeless fructose sensor fabrication.

Radial Velocities of 41 Kepler Eclipsing Binaries

Science.gov (United States)

Matson, Rachel A.; Gies, Douglas R.; Guo, Zhao; Williams, Stephen J.

2017-12-01

Eclipsing binaries are vital for directly determining stellar parameters without reliance on models or scaling relations. Spectroscopically derived parameters of detached and semi-detached binaries allow us to determine component masses that can inform theories of stellar and binary evolution. Here we present moderate resolution ground-based spectra of stars in close binary systems with and without (detected) tertiary companions observed by NASA’s Kepler mission and analyzed for eclipse timing variations. We obtain radial velocities and spectroscopic orbits for five single-lined and 35 double-lined systems, and confirm one false positive eclipsing binary. For the double-lined spectroscopic binaries, we also determine individual component masses and examine the mass ratio {M}2/{M}1 distribution, which is dominated by binaries with like-mass pairs and semi-detached classical Algol systems that have undergone mass transfer. Finally, we constrain the mass of the tertiary component for five double-lined binaries with previously detected companions.

Planets in Binary Star Systems

CERN Document Server

Haghighipour, Nader

2010-01-01

The discovery of extrasolar planets over the past decade has had major impacts on our understanding of the formation and dynamical evolution of planetary systems. There are features and characteristics unseen in our solar system and unexplainable by the current theories of planet formation and dynamics. Among these new surprises is the discovery of planets in binary and multiple-star systems. The discovery of such "binary-planetary" systems has confronted astrodynamicists with many new challenges, and has led them to re-examine the theories of planet formation and dynamics. Among these challenges are: How are planets formed in binary star systems? What would be the notion of habitability in such systems? Under what conditions can binary star systems have habitable planets? How will volatiles necessary for life appear on such planets? This volume seeks to gather the current research in the area of planets in binary and multistar systems and to familiarize readers with its associated theoretical and observation...

Binary nucleation of water and sodium chloride

Czech Academy of Sciences Publication Activity Database

Němec, Tomáš; Maršík, František; Palmer, A.

2006-01-01

Roč. 124, č. 4 (2006), 0445091-0445096 ISSN 0021-9606 R&D Projects: GA ČR(CZ) GA101/05/2536 Institutional research plan: CEZ:AV0Z20760514 Keywords : binary nucleation * sodium chloride * water Subject RIV: BJ - Thermodynamics Impact factor: 3.166, year: 2006

Theoretical studies of binaries in astrophysics

Science.gov (United States)

Dischler, Johann Sebastian

This thesis introduces and summarizes four papers dealing with computer simulations of astrophysical processes involving binaries. The first part gives the rational and theoretical background to these papers. In paper I and II a statistical approach to studying eclipsing binaries is described. By using population synthesis models for binaries the probabilities for eclipses are calculated for different luminosity classes of binaries. These are compared with Hipparcos data and they agree well if one uses a standard input distribution for the orbit sizes. If one uses a random pairing model, where both companions are independently picked from an IMF, one finds too feclipsing binaries by an order of magnitude. In paper III we investigate a possible scenario for the origin of the stars observed close to the centre of our galaxy, called S stars. We propose that a cluster falls radially cowards the central black hole. The binaries within the cluster can then, if they have small impact parameters, be broken up by the black hole's tidal held and one of the components of the binary will be captured by the black hole. Paper IV investigates how the onset of mass transfer in eccentric binaries depends on the eccentricity. To do this we have developed a new two-phase SPH scheme where very light particles are at tire outer edge of our simulated star. This enables us to get a much better resolution of the very small mass that is transferred in close binaries. Our simulations show that the minimum required distance between the stars to have mass transfer decreases with the eccentricity.

Mining frequent binary expressions

NARCIS (Netherlands)

Calders, T.; Paredaens, J.; Kambayashi, Y.; Mohania, M.K.; Tjoa, A.M.

2000-01-01

In data mining, searching for frequent patterns is a common basic operation. It forms the basis of many interesting decision support processes. In this paper we present a new type of patterns, binary expressions. Based on the properties of a specified binary test, such as reflexivity, transitivity

Can black-hole MACHO binaries be detected by the Brazilian spherical antenna?

International Nuclear Information System (INIS)

Araujo, J C N de; Miranda, O D; Castro, C S; Paleo, B W; Aguiar, O D

2004-01-01

Different studies show that dark matter of non-baryonic origin might exist. There is experimental evidence that at least one form of dark matter has been detected through microlensing effects. This form of dark matter is named MACHOs (massive astrophysical compact halo objects). The MACHO collaboration estimated that the masses of these objects are to be in the range 0.15-0.95M o-dot , where the most probable mass is of 0.5M o-dot . Some authors argue that MACHOs could be black holes, and that they could form binary systems, BHMACHO binaries. As is well known, binary systems are sources of gravitational waves. The Brazilian spherical antenna will operate in the frequency band of 3.0-3.4 kHz, sensitive to binaries of a pair of 0.5M o-dot black holes just before coalescing. In the present work we study the detectability of these putative BHMACHO binaries by the Brazilian spherical antenna Mario Schenberg

Survival of planets around shrinking stellar binaries.

Science.gov (United States)

Muñoz, Diego J; Lai, Dong

2015-07-28

The discovery of transiting circumbinary planets by the Kepler mission suggests that planets can form efficiently around binary stars. None of the stellar binaries currently known to host planets has a period shorter than 7 d, despite the large number of eclipsing binaries found in the Kepler target list with periods shorter than a few days. These compact binaries are believed to have evolved from wider orbits into their current configurations via the so-called Lidov-Kozai migration mechanism, in which gravitational perturbations from a distant tertiary companion induce large-amplitude eccentricity oscillations in the binary, followed by orbital decay and circularization due to tidal dissipation in the stars. Here we explore the orbital evolution of planets around binaries undergoing orbital decay by this mechanism. We show that planets may survive and become misaligned from their host binary, or may develop erratic behavior in eccentricity, resulting in their consumption by the stars or ejection from the system as the binary decays. Our results suggest that circumbinary planets around compact binaries could still exist, and we offer predictions as to what their orbital configurations should be like.

Close-binary central stars of planetary nebulae

International Nuclear Information System (INIS)

Bond, H.E.; Grauer, A.D.

1987-01-01

Recent observations of PN central stars identified as binary systems are reviewed. The theoretical significance of binary central stars is discussed, and the characteristics of UU Sge, V 477 Lyr, MT Ser, LSS 2018, VW Pyx, and the central star of HFG 1 are briefly summarized. All of these binaries are shown to have periods less than 1 day, and it is estimated that about 10 percent of all binary central stars are close binaries. 27 references

Bondi-Hoyle-Lyttleton Accretion onto Binaries

Science.gov (United States)

Antoni, Andrea; MacLeod, Morgan; Ramírez-Ruiz, Enrico

2018-01-01

Binary stars are not rare. While only close binary stars will eventually interact with one another, even the widest binary systems interact with their gaseous surroundings. The rates of accretion and the gaseous drag forces arising in these interactions are the key to understanding how these systems evolve. This poster examines accretion flows around a binary system moving supersonically through a background gas. We perform three-dimensional hydrodynamic simulations of Bondi-Hoyle-Lyttleton accretion using the adaptive mesh refinement code FLASH. We simulate a range of values of semi-major axis of the orbit relative to the gravitational focusing impact parameter of the pair. On large scales, gas is gravitationally focused by the center-of-mass of the binary, leading to dynamical friction drag and to the accretion of mass and momentum. On smaller scales, the orbital motion imprints itself on the gas. Notably, the magnitude and direction of the forces acting on the binary inherit this orbital dependence. The long-term evolution of the binary is determined by the timescales for accretion, slow down of the center-of-mass, and decay of the orbit. We use our simulations to measure these timescales and to establish a hierarchy between them. In general, our simulations indicate that binaries moving through gaseous media will slow down before the orbit decays.

Phase lags of quasi-periodic oscillations across source states in the low-mass X-ray binary 4U 1636-53

Science.gov (United States)

de Avellar, Marcio G. B.

2017-06-01

The majority of attempts to explain the origin and phenomenology of the quasi-periodic oscillations (QPOs) detected in low-mass X-ray binaries invoke dynamical models, and it was just in recent years that renewed attention has been given on how radiative processes occurring in these extreme environments gives rise to the variability features observed in the X-ray light curves of these systems. The study of the dependence of the phase lags upon the energy and frequency of the QPOs is a step towards this end. The methodology we developed here allowed us to study for the first time these dependencies for all QPOs detected in the range of 1 to 1300 Hz in the low-mass X-ray binary 4U 1636-53 as the source changes its state during its cycle in the colour-colour diagram. Our results suggest that within the context of models of up-scattering Comptonization, the phase lags dependencies upon frequency and energy can be used to extract size scales and physical conditions of the medium that produces the lags.

Modelling binary data

CERN Document Server

Collett, David

2002-01-01

INTRODUCTION Some Examples The Scope of this Book Use of Statistical Software STATISTICAL INFERENCE FOR BINARY DATA The Binomial Distribution Inference about the Success Probability Comparison of Two Proportions Comparison of Two or More Proportions MODELS FOR BINARY AND BINOMIAL DATA Statistical Modelling Linear Models Methods of Estimation Fitting Linear Models to Binomial Data Models for Binomial Response Data The Linear Logistic Model Fitting the Linear Logistic Model to Binomial Data Goodness of Fit of a Linear Logistic Model Comparing Linear Logistic Models Linear Trend in Proportions Comparing Stimulus-Response Relationships Non-Convergence and Overfitting Some other Goodness of Fit Statistics Strategy for Model Selection Predicting a Binary Response Probability BIOASSAY AND SOME OTHER APPLICATIONS The Tolerance Distribution Estimating an Effective Dose Relative Potency Natural Response Non-Linear Logistic Regression Models Applications of the Complementary Log-Log Model MODEL CHECKING Definition of Re...

ATF4, A Novel Mediator of the Anabolic Actions of PTH on Bone

Science.gov (United States)

2012-01-01

poster) A5. Xiao G. Critical role of activating transcription factor 4 in parathyroid hormone-mediated bone formation. Military Health Research...C, Pittsburgh, Pennsylvania 15240. E-mail: xiaog@upmc.edu. This work was supported by National Institutes of Health Grants DK072230 (to G.X.) and...Ahn JD, Takeda S, Starbuck M, Yang X, Liu X, Kondo H, Richards WG, Bannon TW, Noda M, Clement K, Vaisse C, Karsenty G 2005 Leptin regulation of bone

Binary model for the coma cluster of galaxies

International Nuclear Information System (INIS)

Valtonen, M.J.; Byrd, G.G.

1979-01-01

We study the dynamics of galaxies in the Coma cluster and find that the cluster is probably dominated by a central binary of galaxies NGC 4874--NGC4889. We estimate their total mass to be about 3 x 10 14 M/sub sun/ by two independent methods (assuming in Hubble constant of 100 km s -1 Mpc -1 ). This binary is efficient in dynamically ejecting smaller galaxies, some of of which are seen in projection against the inner 3 0 radius of the cluster and which, if erroneously considered as bound members, cause a serious overestimate of the mass of the entire cluster. Taking account of the ejected galaxies, we estimate the total cluster mass to be 4--9 x 10 14 M/sub sun/, with a corresponding mass-to-light ratio for a typical galaxy in the range of 20--120 solar units. The origin of the secondary maximum observed in the radial surface density profile is studied. We consider it to be a remnant of a shell of galaxies which formed around the central binary. This shell expanded, then collapsed into the binary, and is now reexpanding. This is supported by the coincidence of the minimum in the cluster eccentricity and radical velocity dispersion at the same radial distance as the secondary maximum. Numerical simulations of a cluster model with a massive central binary and a spherical shell of test particles are performed, and they reproduce the observed shape, galaxy density, and radial velocity distributions in the Coma cluster fairly well. Consequences of extending the model to other clusters are discussed

Do stellar clusters form fewer binaries? Using moderate separation binaries to distinguish between nature and nurture

Science.gov (United States)

Reiter, Megan

2017-08-01

Fewer wide-separation binaries are found in dense stellar clusters than in looser stellar associations. It is therefore unclear whether feedback in clusters prevents the formation of multiple systems or dynamical interactions destroy them. Measuring the prevalence of close, bound binary systems provide a key test to distinguish between these possibilities. Systems with separations of 10-50 AU will survive interactions in the cluster environment, and therefore are more representative of the natal population of multiple systems. By fitting a double-star PSF, we will identify visual binaries in the Orion Nebula with separations as small as 0.03. At the distance of Orion, this corresponds to a physical separation of 12 AU, effectively closing the observational gap in the binary separation distribution left between known visual and spectroscopic binaries (>65 AU or PhD thesis.

Origin of very-short orbital-period binary systems

International Nuclear Information System (INIS)

Miyaji, S.

1983-01-01

Recent observations of four close binaries have established that there is a group of very-short orbital-period (VSOP) binaries whose orbital periods are less than 60 minutes. The VSOP binaries consist of both X-ray close binaries and cataclysmic variables. Their orbital periods are too short to have a main-sequence companion. However, four binaries, none of which belongs to any globular cluster, are too abundant to be explained by the capturing mechanism of a white dwarf. Therefore it seemed to be worthwhile to present an evolutionary scenario from an original binary system which can be applied for all VSOP binaries. (Auth.)

Separation in 5 Msun Binaries

Science.gov (United States)

Evans, Nancy R.; Bond, H. E.; Schaefer, G.; Mason, B. D.; Karovska, M.; Tingle, E.

2013-01-01

Cepheids (5 Msun stars) provide an excellent sample for determining the binary properties of fairly massive stars. International Ultraviolet Explorer (IUE) observations of Cepheids brighter than 8th magnitude resulted in a list of ALL companions more massive than 2.0 Msun uniformly sensitive to all separations. Hubble Space Telescope Wide Field Camera 3 (WFC3) has resolved three of these binaries (Eta Aql, S Nor, and V659 Cen). Combining these separations with orbital data in the literature, we derive an unbiased distribution of binary separations for a sample of 18 Cepheids, and also a distribution of mass ratios. The distribution of orbital periods shows that the 5 Msun binaries prefer shorter periods than 1 Msun stars, reflecting differences in star formation processes.

Astronomy of binary and multiple stars

International Nuclear Information System (INIS)

Tokovinin, A.A.

1984-01-01

Various types of binary stars and methods for their observation are described in a popular form. Some models of formation and evolution of binary and multiple star systems are presented. It is concluded that formation of binary and multiple stars is a regular stage in the process of star production

A ROSAT Survey of Contact Binary Stars

Science.gov (United States)

Geske, M. T.; Gettel, S. J.; McKay, T. A.

2006-01-01

Contact binary stars are common variable stars that are all believed to emit relatively large fluxes of X-rays. In this work we combine a large new sample of contact binary stars derived from the ROTSE-I telescope with X-ray data from the ROSAT All Sky Survey (RASS) to estimate the X-ray volume emissivity of contact binary stars in the Galaxy. We obtained X-ray fluxes for 140 contact binaries from the RASS, as well as two additional stars observed by the XMM-Newton observatory. From these data we confirm the emission of X-rays from all contact binary systems, with typical luminosities of approximately 1.0×1030 ergs s-1. Combining calculated luminosities with an estimated contact binary space density, we find that contact binaries do not have strong enough X-ray emission to account for a significant portion of the Galactic X-ray background.

GALAXY ROTATION AND RAPID SUPERMASSIVE BINARY COALESCENCE

Energy Technology Data Exchange (ETDEWEB)

Holley-Bockelmann, Kelly [Vanderbilt University, Nashville, TN (United States); Khan, Fazeel Mahmood, E-mail: k.holley@vanderbilt.edu [Institute of Space Technology (IST), Islamabad (Pakistan)

2015-09-10

Galaxy mergers usher the supermassive black hole (SMBH) in each galaxy to the center of the potential, where they form an SMBH binary. The binary orbit shrinks by ejecting stars via three-body scattering, but ample work has shown that in spherical galaxy models, the binary separation stalls after ejecting all the stars in its loss cone—this is the well-known final parsec problem. However, it has been shown that SMBH binaries in non-spherical galactic nuclei harden at a nearly constant rate until reaching the gravitational wave regime. Here we use a suite of direct N-body simulations to follow SMBH binary evolution in both corotating and counterrotating flattened galaxy models. For N > 500 K, we find that the evolution of the SMBH binary is convergent and is independent of the particle number. Rotation in general increases the hardening rate of SMBH binaries even more effectively than galaxy geometry alone. SMBH binary hardening rates are similar for co- and counterrotating galaxies. In the corotating case, the center of mass of the SMBH binary settles into an orbit that is in corotation resonance with the background rotating model, and the coalescence time is roughly a few 100 Myr faster than a non-rotating flattened model. We find that counterrotation drives SMBHs to coalesce on a nearly radial orbit promptly after forming a hard binary. We discuss the implications for gravitational wave astronomy, hypervelocity star production, and the effect on the structure of the host galaxy.

GALAXY ROTATION AND RAPID SUPERMASSIVE BINARY COALESCENCE

International Nuclear Information System (INIS)

Holley-Bockelmann, Kelly; Khan, Fazeel Mahmood

2015-01-01

Galaxy mergers usher the supermassive black hole (SMBH) in each galaxy to the center of the potential, where they form an SMBH binary. The binary orbit shrinks by ejecting stars via three-body scattering, but ample work has shown that in spherical galaxy models, the binary separation stalls after ejecting all the stars in its loss cone—this is the well-known final parsec problem. However, it has been shown that SMBH binaries in non-spherical galactic nuclei harden at a nearly constant rate until reaching the gravitational wave regime. Here we use a suite of direct N-body simulations to follow SMBH binary evolution in both corotating and counterrotating flattened galaxy models. For N > 500 K, we find that the evolution of the SMBH binary is convergent and is independent of the particle number. Rotation in general increases the hardening rate of SMBH binaries even more effectively than galaxy geometry alone. SMBH binary hardening rates are similar for co- and counterrotating galaxies. In the corotating case, the center of mass of the SMBH binary settles into an orbit that is in corotation resonance with the background rotating model, and the coalescence time is roughly a few 100 Myr faster than a non-rotating flattened model. We find that counterrotation drives SMBHs to coalesce on a nearly radial orbit promptly after forming a hard binary. We discuss the implications for gravitational wave astronomy, hypervelocity star production, and the effect on the structure of the host galaxy

Hidden slow pulsars in binaries

Science.gov (United States)

Tavani, Marco; Brookshaw, Leigh

1993-01-01

The recent discovery of the binary containing the slow pulsar PSR 1718-19 orbiting around a low-mass companion star adds new light on the characteristics of binary pulsars. The properties of the radio eclipses of PSR 1718-19 are the most striking observational characteristics of this system. The surface of the companion star produces a mass outflow which leaves only a small 'window' in orbital phase for the detection of PSR 1718-19 around 400 MHz. At this observing frequency, PSR 1718-19 is clearly observable only for about 1 hr out of the total 6.2 hr orbital period. The aim of this Letter is twofold: (1) to model the hydrodynamical behavior of the eclipsing material from the companion star of PSR 1718-19 and (2) to argue that a population of binary slow pulsars might have escaped detection in pulsar surveys carried out at 400 MHz. The possible existence of a population of partially or totally hidden slow pulsars in binaries will have a strong impact on current theories of binary evolution of neutron stars.

Perceptual biases for rhythm: The Mismatch Negativity latency indexes the privileged status of binary vs non-binary interval ratios.

Science.gov (United States)

Pablos Martin, X; Deltenre, P; Hoonhorst, I; Markessis, E; Rossion, B; Colin, C

2007-12-01

Rhythm perception appears to be non-linear as human subjects are better at discriminating, categorizing and reproducing rhythms containing binary vs non-binary (e.a. 1:2 vs 1:3) as well as metrical vs non-metrical (e.a. 1:2 vs 1:2.5) interval ratios. This study examined the representation of binary and non-binary interval ratios within the sensory memory, thus yielding a truly sensory, pre-motor, attention-independent neural representation of rhythmical intervals. Five interval ratios, one binary, flanked by four non-binary ones, were compared on the basis of the MMN they evoked when contrasted against a common standard interval. For all five intervals, the larger the contrast was, the larger the MMN amplitude was. The binary interval evoked a significantly much shorter (by at least 23 ms) MMN latency than the other intervals, whereas no latency difference was observed between the four non-binary intervals. These results show that the privileged perceptual status of binary rhythmical intervals is already present in the sensory representations found in echoic memory at an early, automatic, pre-perceptual and pre-motor level. MMN latency can be used to study rhythm perception at a truly sensory level, without any contribution from the motor system.

submitter Thermodynamics of the formation of sulfuric acid dimers in the binary (H2SO4–H2O) and ternary (H2SO4–H2O–NH3) system

CERN Document Server

Kürten, A; Rondo, L; Bianchi, F; Duplissy, J; Jokinen, T; Junninen, H; Sarnela, N; Schobesberger, S; Simon, M; Sipilä, M; Almeida, J; Amorim, A; Dommen, J; Donahue, N M; Dunne, E M; Flagan, R C; Franchin, A; Kirkby, J; Kupc, A; Makhmutov, V; Petäjä, T; Praplan, A P; Riccobono, F; Steiner, G; Tomé, A; Tsagkogeorgas, G; Wagner, P E; Wimmer, D; Baltensperger, U; Kulmala, M; Worsnop, D R; Curtius, J

2015-01-01

Sulfuric acid is an important gas influencing atmospheric new particle formation (NPF). Both the binary $(H_2SO_4–H_2O)$ system and the ternary system involving ammonia $(H_2SO_4–H_2O–NH_3)$ may be important in the free troposphere. An essential step in the nucleation of aerosol particles from gas-phase precursors is the formation of a dimer, so an understanding of the thermodynamics of dimer formation over a wide range of atmospheric conditions is essential to describe NPF. We have used the CLOUD chamber to conduct nucleation experiments for these systems at temperatures from 208 to 248 K. Neutral monomer and dimer concentrations of sulfuric acid were measured using a chemical ionization mass spectrometer (CIMS). From these measurements, dimer evaporation rates in the binary system were derived for temperatures of 208 and 223 K. We compare these results to literature data from a previous study that was conducted at higher temperatures but is in good agreement with the present study. For the ternary sys...

SECULAR EVOLUTION OF BINARIES NEAR MASSIVE BLACK HOLES: FORMATION OF COMPACT BINARIES, MERGER/COLLISION PRODUCTS AND G2-LIKE OBJECTS

International Nuclear Information System (INIS)

Prodan, Snezana; Antonini, Fabio; Perets, Hagai B.

2015-01-01

Here we discuss the evolution of binaries around massive black holes (MBHs) in nuclear stellar clusters. We focus on their secular evolution due to the perturbation by the MBHs, while simplistically accounting for their collisional evolution. Binaries with highly inclined orbits with respect to their orbits around MBHs are strongly affected by secular processes, which periodically change their eccentricities and inclinations (e.g., Kozai-Lidov cycles). During periapsis approach, dissipative processes such as tidal friction may become highly efficient, and may lead to shrinkage of a binary orbit and even to its merger. Binaries in this environment can therefore significantly change their orbital evolution due to the MBH third-body perturbative effects. Such orbital evolution may impinge on their later stellar evolution. Here we follow the secular dynamics of such binaries and its coupling to tidal evolution, as well as the stellar evolution of such binaries on longer timescales. We find that stellar binaries in the central parts of nuclear stellar clusters (NSCs) are highly likely to evolve into eccentric and/or short-period binaries, and become strongly interacting binaries either on the main sequence (at which point they may even merge), or through their later binary stellar evolution. The central parts of NSCs therefore catalyze the formation and evolution of strongly interacting binaries, and lead to the enhanced formation of blue stragglers, X-ray binaries, gravitational wave sources, and possible supernova progenitors. Induced mergers/collisions may also lead to the formation of G2-like cloud-like objects such as the one recently observed in the Galactic center

Galactic binaries with eLISA

OpenAIRE

Nelemans, G.

2013-01-01

I review what eLISA will see from Galactic binaries -- double stars with orbital periods less than a few hours and white dwarf (or neutron star/black hole) components. I discuss the currently known binaries that are guaranteed (or verification) sources and explain why the expected total number of eLISA Galactic binaries is several thousand, even though there are large uncertainties in our knowledge of this population, in particular that of the interacting AM CVn systems. I very briefly sketch...

Numerical Simulations of Wind Accretion in Symbiotic Binaries

Science.gov (United States)

de Val-Borro, M.; Karovska, M.; Sasselov, D.

2009-08-01

About half of the binary systems are close enough to each other for mass to be exchanged between them at some point in their evolution, yet the accretion mechanism in wind accreting binaries is not well understood. We study the dynamical effects of gravitational focusing by a binary companion on winds from late-type stars. In particular, we investigate the mass transfer and formation of accretion disks around the secondary in detached systems consisting of an asymptotic giant branch (AGB) mass-losing star and an accreting companion. The presence of mass outflows is studied as a function of mass-loss rate, wind temperature, and binary orbital parameters. A two-dimensional hydrodynamical model is used to study the stability of mass transfer in wind accreting symbiotic binary systems. In our simulations we use an adiabatic equation of state and a modified version of the isothermal approximation, where the temperature depends on the distance from the mass losing star and its companion. The code uses a block-structured adaptive mesh refinement method that allows us to have high resolution at the position of the secondary and resolve the formation of bow shocks and accretion disks. We explore the accretion flow between the components and formation of accretion disks for a range of orbital separations and wind parameters. Our results show the formation of stream flow between the stars and accretion disks of various sizes for certain orbital configurations. For a typical slow and massive wind from an AGB star the flow pattern is similar to a Roche lobe overflow with accretion rates of 10% of the mass loss from the primary. Stable disks with exponentially decreasing density profiles and masses of the order 10-4 solar masses are formed when wind acceleration occurs at several stellar radii. The disks are geometrically thin with eccentric streamlines and close to Keplerian velocity profiles. The formation of tidal streams and accretion disks is found to be weakly dependent on

NUMERICAL SIMULATIONS OF WIND ACCRETION IN SYMBIOTIC BINARIES

International Nuclear Information System (INIS)

De Val-Borro, M.; Karovska, M.; Sasselov, D.

2009-01-01

About half of the binary systems are close enough to each other for mass to be exchanged between them at some point in their evolution, yet the accretion mechanism in wind accreting binaries is not well understood. We study the dynamical effects of gravitational focusing by a binary companion on winds from late-type stars. In particular, we investigate the mass transfer and formation of accretion disks around the secondary in detached systems consisting of an asymptotic giant branch (AGB) mass-losing star and an accreting companion. The presence of mass outflows is studied as a function of mass-loss rate, wind temperature, and binary orbital parameters. A two-dimensional hydrodynamical model is used to study the stability of mass transfer in wind accreting symbiotic binary systems. In our simulations we use an adiabatic equation of state and a modified version of the isothermal approximation, where the temperature depends on the distance from the mass losing star and its companion. The code uses a block-structured adaptive mesh refinement method that allows us to have high resolution at the position of the secondary and resolve the formation of bow shocks and accretion disks. We explore the accretion flow between the components and formation of accretion disks for a range of orbital separations and wind parameters. Our results show the formation of stream flow between the stars and accretion disks of various sizes for certain orbital configurations. For a typical slow and massive wind from an AGB star the flow pattern is similar to a Roche lobe overflow with accretion rates of 10% of the mass loss from the primary. Stable disks with exponentially decreasing density profiles and masses of the order 10 -4 solar masses are formed when wind acceleration occurs at several stellar radii. The disks are geometrically thin with eccentric streamlines and close to Keplerian velocity profiles. The formation of tidal streams and accretion disks is found to be weakly dependent

A parallel algorithm for filtering gravitational waves from coalescing binaries

International Nuclear Information System (INIS)

Sathyaprakash, B.S.; Dhurandhar, S.V.

1992-10-01

Coalescing binary stars are perhaps the most promising sources for the observation of gravitational waves with laser interferometric gravity wave detectors. The waveform from these sources can be predicted with sufficient accuracy for matched filtering techniques to be applied. In this paper we present a parallel algorithm for detecting signals from coalescing compact binaries by the method of matched filtering. We also report the details of its implementation on a 256-node connection machine consisting of a network of transputers. The results of our analysis indicate that parallel processing is a promising approach to on-line analysis of data from gravitational wave detectors to filter out coalescing binary signals. The algorithm described is quite general in that the kernel of the algorithm is applicable to any set of matched filters. (author). 15 refs, 4 figs

On central ideals of finitely generated binary (-1,1)-algebras

International Nuclear Information System (INIS)

Pchelintsev, S V

2002-01-01

In 1975 the author proved that the centre of a free finitely generated (-1,1)-algebra contains a non-zero ideal of the whole algebra. Filippov proved that in a free alternative algebra of rank ≥4 there exists a trivial ideal contained in the associative centre. Il'tyakov established that the associative nucleus of a free alternative algebra of rank 3 coincides with the ideal of identities of the Cayley-Dickson algebra. In the present paper the above-mentioned theorem of the author is extended to free finitely generated binary (-1,1)-algebras. Theorem. The centre of a free finitely generated binary (-1,1)-algebra of rank ≥3 over a field of characteristic distinct from 2 and 3 contains a non-zero ideal of the whole algebra. As a by-product, we shall prove that the T-ideal generated by the function (z,x,(x,x,y)) in a free binary (-1,1)-algebra of finite rank is soluble. We deduce from this that the basis rank of the variety of binary (-1,1)-algebras is infinite

The O-type eclipsing binary SZ Camelopardalis revisited

Czech Academy of Sciences Publication Activity Database

Mayer, P.; Drechsel, H.; Kubát, Jiří; Šlechta, Miroslav

2010-01-01

Roč. 524, Dec (2010), A1/1-A1/5 ISSN 0004-6361 Institutional research plan: CEZ:AV0Z10030501 Keywords : eclipsing binaries * early-type stars * fundamental parameters Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.410, year: 2010

The origin of the RS CVn binaries

International Nuclear Information System (INIS)

Biermann, P.

1976-01-01

Six possible origins for the RS CVn binaries are considered based on the following possibilities. RS CVn binaries might now be either pre-main-sequence or post-main-sequence. A pre-main-sequence binary might not always have been a binary but might have resulted from fission of a rapidly rotating single pre-main-sequence star. The main-sequence counterparts might be either single stars or binaries. To decide which of the six origins is possible, the following observed data for the RS CVn binaries are considered: total mass, total angular momentum, lack of observed connection with regions of star formation, large space density, kinematical age, and the visual companion of WW Dra. In addition lifetimes and space densities of single stars and other types of binaries are considered. The only origin possible is that the RS CVn binaries are in a thermal phase following fission of a main-sequence single star. In this explanation the single star had a rapidly rotating core which became unstable due to the core contraction which made it begin to evolve off the main sequence. The present Be stars might be examples of such parent single stars. (Auth.)

Evolution of dwarf binaries

International Nuclear Information System (INIS)

Tutukov, A.V.; Fedorova, A.V.; Yungel'son, L.R.

1982-01-01

The conditions of mass exchange in close binary systems with masses of components less or equal to one solar mass have been analysed for the case, when the system radiates gravitational waves. It has been shown that the mass exchange rate depends in a certain way on the mass ratio of components and on the mass of component that fills its inner critical lobe. The comparison of observed periods, masses of contact components, and mass exchange rates of observed cataclysmic binaries have led to the conclusion that the evolution of close binaries WZ Sge, OY Car, Z Cha, TT Ari, 2A 0311-227, and G 61-29 may be driven by the emission of gravitational waves [ru

Circumstellar disks around binary stars in Taurus

Energy Technology Data Exchange (ETDEWEB)

Akeson, R. L. [NASA Exoplanet Science Institute, IPAC/Caltech, Pasadena, CA 91125 (United States); Jensen, E. L. N. [Swarthmore College, Department of Physics and Astronomy, Swarthmore, PA 19081 (United States)

2014-03-20

We have conducted a survey of 17 wide (>100 AU) young binary systems in Taurus with the Atacama Large Millimeter Array (ALMA) at two wavelengths. The observations were designed to measure the masses of circumstellar disks in these systems as an aid to understanding the role of multiplicity in star and planet formation. The ALMA observations had sufficient resolution to localize emission within the binary system. Disk emission was detected around all primaries and 10 secondaries, with disk masses as low as 10{sup –4} M {sub ☉}. We compare the properties of our sample to the population of known disks in Taurus and find that the disks from this binary sample match the scaling between stellar mass and millimeter flux of F{sub mm}∝M{sub ∗}{sup 1.5--2.0} to within the scatter found in previous studies. We also compare the properties of the primaries to those of the secondaries and find that the secondary/primary stellar and disk mass ratios are not correlated; in three systems, the circumsecondary disk is more massive than the circumprimary disk, counter to some theoretical predictions.

EVOLUTION OF THE BINARY FRACTION IN DENSE STELLAR SYSTEMS

International Nuclear Information System (INIS)

Fregeau, John M.; Ivanova, Natalia; Rasio, Frederic A.

2009-01-01

Using our recently improved Monte Carlo evolution code, we study the evolution of the binary fraction in globular clusters. In agreement with previous N-body simulations, we find generally that the hard binary fraction in the core tends to increase with time over a range of initial cluster central densities for initial binary fractions ∼<90%. The dominant processes driving the evolution of the core binary fraction are mass segregation of binaries into the cluster core and preferential destruction of binaries there. On a global scale, these effects and the preferential tidal stripping of single stars tend to roughly balance, leading to overall cluster binary fractions that are roughly constant with time. Our findings suggest that the current hard binary fraction near the half-mass radius is a good indicator of the hard primordial binary fraction. However, the relationship between the true binary fraction and the fraction of main-sequence stars in binaries (which is typically what observers measure) is nonlinear and rather complicated. We also consider the importance of soft binaries, which not only modify the evolution of the binary fraction, but can also drastically change the evolution of the cluster as a whole. Finally, we briefly describe the recent addition of single and binary stellar evolution to our cluster evolution code.

HD 161306: a radiatively interacting Be binary?

Czech Academy of Sciences Publication Activity Database

Koubský, Pavel; Kotková, Lenka; Kraus, Michaela; Yang, S.; Šlechta, Miroslav; Harmanec, P.; Wolf, M.; Votruba, Viktor; Kubát, Jiří; Kubátová, Brankica; Niemczura, E.; Škoda, Petr

2014-01-01

Roč. 567, July (2014), A57/1-A57/4 ISSN 0004-6361 R&D Projects: GA ČR(CZ) GA14-21373S; GA MŠk LG14026 Grant - others:ESA(XE) ESA- PECS project no. 98058; GA ČR(CZ) GAP209/10/0715 Program:GA Institutional support: RVO:67985815 Keywords : binaries: spectroscopic * stars: emission-line * Be: stars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.378, year: 2014

Activity coefficients of solutes in binary solvents

International Nuclear Information System (INIS)

Gokcen, N.A.

1982-01-01

The activity coefficients in dilute ternary systems are discussed in detail by using the Margules equations. Analyses of some relevant data at high temperatures show that the sparingly dissolved solutes in binary solvents follow complex behavior even when the binary solvents are very nearly ideal. It is shown that the activity data on the solute or the binary system cannot permit computation of the remaining activities except for the regular solutions. It is also shown that a fourth-order equation is usually adequate in expressing the activity coefficient of a solute in binary solvents at high temperatures. When the activity data for a binary solvent are difficult to obtain in a certain range of composition, the activity data for a sparingly dissolved solute can be used to supplement determination of the binary activities

TWENTY-FIVE SUBARCSECOND BINARIES DISCOVERED BY LUNAR OCCULTATIONS

Energy Technology Data Exchange (ETDEWEB)

Richichi, A. [National Astronomical Research Institute of Thailand, 191 Siriphanich Bldg., Huay Kaew Rd., Suthep, Muang, Chiang Mai 50200 (Thailand); Fors, O. [Departament Astronomia i Meteorologia and Institut de Ciencies del Cosmos (ICC), Universitat de Barcelona (UB/IEEC), Marti i Franques 1, E-08028 Barcelona (Spain); Cusano, F. [INAF-Osservatorio Astronomico di Bologna, Via Ranzani 1, I-40127 Bologna (Italy); Moerchen, M., E-mail: andrea4work@gmail.com [European Southern Observatory, Casilla 19001, Santiago 19 (Chile)

2013-09-15

We report on 25 subarcsecond binaries, detected for the first time by means of lunar occultations in the near-infrared (near-IR) as part of a long-term program using the ISAAC instrument at the ESO Very Large Telescope. The primaries have magnitudes in the range K = 3.8-10.4, and the companions in the range K = 6.4-12.1. The magnitude differences have a median value of 2.8, with the largest being 5.4. The projected separations are in the range 6-748 mas and with a median of 18 mas, or about three times less than the diffraction limit of the telescope. Among our binary detections are a pre-main-sequence star and an enigmatic Mira-like variable previously suspected to have a companion. Additionally, we quote an accurate first-time near-IR detection of a previously known wider binary. We discuss our findings on an individual basis as far as made possible by the available literature, and we examine them from a statistical point of view. We derive a typical frequency of binarity among field stars of Almost-Equal-To 10%, in the resolution and sensitivity range afforded by the technique ( Almost-Equal-To 0.''003 to Almost-Equal-To 0.''5, and K Almost-Equal-To 12 mag, respectively). This is in line with previous results using the same technique but we point out interesting differences that we can trace up to sensitivity, time sampling, and average distance of the targets. Finally, we discuss the prospects for further follow-up studies.

All-optical conversion scheme: Binary to quaternary and quaternary to binary number

Science.gov (United States)

Chattopadhyay, Tanay; Roy, Jitendra Nath

2009-04-01

To achieve the inherent parallelism in optics a suitable number system and efficient encoding/decoding scheme for handling the data are very much essential. Binary number is accepted as the best representing number system in almost all types of existing electronic computers. But, binary number (0 and 1) is insufficient in respect to the demand of the coming generation. Multi-valued logic (with radix >2) can be viewed as an alternative approach to solve many problems in transmission, storage and processing of large amount of information in digital signal processing. Here, in this paper all-optical scheme for the conversion of binary to quaternary number and vice versa have been proposed and described. Simulation has also been done. In this all-optical scheme the numbers are represented by different discrete polarized state of light.

COSMIC probes into compact binary formation and evolution

Science.gov (United States)

Breivik, Katelyn

2018-01-01

The population of compact binaries in the galaxy represents the final state of all binaries that have lived up to the present epoch. Compact binaries present a unique opportunity to probe binary evolution since many of the interactions binaries experience can be imprinted on the compact binary population. By combining binary evolution simulations with catalogs of observable compact binary systems, we can distill the dominant physical processes that govern binary star evolution, as well as predict the abundance and variety of their end products.The next decades herald a previously unseen opportunity to study compact binaries. Multi-messenger observations from telescopes across all wavelengths and gravitational-wave observatories spanning several decades of frequency will give an unprecedented view into the structure of these systems and the composition of their components. Observations will not always be coincident and in some cases may be separated by several years, providing an avenue for simulations to better constrain binary evolution models in preparation for future observations.I will present the results of three population synthesis studies of compact binary populations carried out with the Compact Object Synthesis and Monte Carlo Investigation Code (COSMIC). I will first show how binary-black-hole formation channels can be understood with LISA observations. I will then show how the population of double white dwarfs observed with LISA and Gaia could provide a detailed view of mass transfer and accretion. Finally, I will show that Gaia could discover thousands black holes in the Milky Way through astrometric observations, yielding view into black-hole astrophysics that is complementary to and independent from both X-ray and gravitational-wave astronomy.

Measurement of the electron density of a plasma by interferometry with a He - Ne laser ({lambda} = 3.39 {mu}); Mesure de la densite electronique d'un plasma par interferometrie avec un laser He - Ne ({lambda} = 3.39 {mu})

Energy Technology Data Exchange (ETDEWEB)

Belland, P [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

1968-07-01

The characteristics of the He-Ne gas laser used in a simple interferometric technique have been studied. After passing through the plasma, the beam is reflected back into the laser cavity, and the intensity of the laser itself, modulated by this optical feedback, is used to observe the fringes. Furthermore, owing to the coupling of the two laser transitions 0.63{mu} (red) and 3.39{mu} (infra red), interferences in the infra red can be detected by a simple photomultiplier monitoring the red line. This method has been applied to two plasma machines (E.P.P.E. and SABLIER) for spatial and temporal measurements of the mean electron density. (author) [French] Nous avons etudie les caracteristiques d'un laser a gaz He-Ne utilise dans une technique simple d'interferometrie. La lumiere qui traverse le plasma est reinjectee dans le laser, et l'intensite propre de celui-ci, modulee par cette reinjection, sert a observer les franges. De plus, a cause du couplage des deux transitions laser: 0.63{mu} (rouge) et 3.39{mu} (infrarouge), les interferences dans l'infrarouge peuvent etre detectees par un simple photomultiplicateur sensible au rouge. Nous avons applique cette methode a deux machines a plasma (E.P.P.E. et SABLIER) pour la mesure de la densite electronique moyenne en fonction du temps et de l'espace. (auteur)

Binary versus non-binary information in real time series: empirical results and maximum-entropy matrix models

Science.gov (United States)

Almog, Assaf; Garlaschelli, Diego

2014-09-01

The dynamics of complex systems, from financial markets to the brain, can be monitored in terms of multiple time series of activity of the constituent units, such as stocks or neurons, respectively. While the main focus of time series analysis is on the magnitude of temporal increments, a significant piece of information is encoded into the binary projection (i.e. the sign) of such increments. In this paper we provide further evidence of this by showing strong nonlinear relations between binary and non-binary properties of financial time series. These relations are a novel quantification of the fact that extreme price increments occur more often when most stocks move in the same direction. We then introduce an information-theoretic approach to the analysis of the binary signature of single and multiple time series. Through the definition of maximum-entropy ensembles of binary matrices and their mapping to spin models in statistical physics, we quantify the information encoded into the simplest binary properties of real time series and identify the most informative property given a set of measurements. Our formalism is able to accurately replicate, and mathematically characterize, the observed binary/non-binary relations. We also obtain a phase diagram allowing us to identify, based only on the instantaneous aggregate return of a set of multiple time series, a regime where the so-called ‘market mode’ has an optimal interpretation in terms of collective (endogenous) effects, a regime where it is parsimoniously explained by pure noise, and a regime where it can be regarded as a combination of endogenous and exogenous factors. Our approach allows us to connect spin models, simple stochastic processes, and ensembles of time series inferred from partial information.

Binary versus non-binary information in real time series: empirical results and maximum-entropy matrix models

International Nuclear Information System (INIS)

Almog, Assaf; Garlaschelli, Diego

2014-01-01

The dynamics of complex systems, from financial markets to the brain, can be monitored in terms of multiple time series of activity of the constituent units, such as stocks or neurons, respectively. While the main focus of time series analysis is on the magnitude of temporal increments, a significant piece of information is encoded into the binary projection (i.e. the sign) of such increments. In this paper we provide further evidence of this by showing strong nonlinear relations between binary and non-binary properties of financial time series. These relations are a novel quantification of the fact that extreme price increments occur more often when most stocks move in the same direction. We then introduce an information-theoretic approach to the analysis of the binary signature of single and multiple time series. Through the definition of maximum-entropy ensembles of binary matrices and their mapping to spin models in statistical physics, we quantify the information encoded into the simplest binary properties of real time series and identify the most informative property given a set of measurements. Our formalism is able to accurately replicate, and mathematically characterize, the observed binary/non-binary relations. We also obtain a phase diagram allowing us to identify, based only on the instantaneous aggregate return of a set of multiple time series, a regime where the so-called ‘market mode’ has an optimal interpretation in terms of collective (endogenous) effects, a regime where it is parsimoniously explained by pure noise, and a regime where it can be regarded as a combination of endogenous and exogenous factors. Our approach allows us to connect spin models, simple stochastic processes, and ensembles of time series inferred from partial information. (paper)

PERIODIC SIGNALS IN BINARY MICROLENSING EVENTS

International Nuclear Information System (INIS)

Guo, Xinyi; Stefano, Rosanne Di; Esin, Ann; Taylor, Jeffrey

2015-01-01

Gravitational microlensing events are powerful tools for the study of stellar populations. In particular, they can be used to discover and study a variety of binary systems. A large number of binary lenses have already been found through microlensing surveys and a few of these systems show strong evidence of orbital motion on the timescale of the lensing event. We expect that more binary lenses of this kind will be detected in the future. For binaries whose orbital period is comparable to the event duration, the orbital motion can cause the lensing signal to deviate drastically from that of a static binary lens. The most striking property of such light curves is the presence of quasi-periodic features, which are produced as the source traverses the same regions in the rotating lens plane. These repeating features contain information about the orbital period of the lens. If this period can be extracted, then much can be learned about the lensing system even without performing time-consuming, detailed light-curve modeling. However, the relative transverse motion between the source and the lens significantly complicates the problem of period extraction. To resolve this difficulty, we present a modification of the standard Lomb–Scargle periodogram analysis. We test our method for four representative binary lens systems and demonstrate its efficiency in correctly extracting binary orbital periods

Improving geothermal power plants with a binary cycle

Science.gov (United States)

Tomarov, G. V.; Shipkov, A. A.; Sorokina, E. V.

2015-12-01

The recent development of binary geothermal technology is analyzed. General trends in the introduction of low-temperature geothermal sources are summarized. The use of single-phase low-temperature geothermal fluids in binary power plants proves possible and expedient. The benefits of power plants with a binary cycle in comparison with traditional systems are shown. The selection of the working fluid is considered, and the influence of the fluid's physicochemical properties on the design of the binary power plant is discussed. The design of binary power plants is based on the chemical composition and energy potential of the geothermal fluids and on the landscape and climatic conditions at the intended location. Experience in developing a prototype 2.5 MW Russian binary power unit at Pauzhetka geothermal power plant (Kamchatka) is outlined. Most binary systems are designed individually for a specific location. Means of improving the technology and equipment at binary geothermal power plants are identified. One option is the development of modular systems based on several binary systems that employ the heat from the working fluid at different temperatures.

Topological and categorical properties of binary trees

Directory of Open Access Journals (Sweden)

H. Pajoohesh

2008-04-01

Full Text Available Binary trees are very useful tools in computer science for estimating the running time of so-called comparison based algorithms, algorithms in which every action is ultimately based on a prior comparison between two elements. For two given algorithms A and B where the decision tree of A is more balanced than that of B, it is known that the average and worst case times of A will be better than those of B, i.e., ₸A(n ≤₸B(n and TWA (n≤TWB (n. Thus the most balanced and the most imbalanced binary trees play a main role. Here we consider them as semilattices and characterize the most balanced and the most imbalanced binary trees by topological and categorical properties. Also we define the composition of binary trees as a commutative binary operation, *, such that for binary trees A and B, A * B is the binary tree obtained by attaching a copy of B to any leaf of A. We show that (T,* is a commutative po-monoid and investigate its properties.

Optimally cloned binary coherent states

Science.gov (United States)

Müller, C. R.; Leuchs, G.; Marquardt, Ch.; Andersen, U. L.

2017-10-01

Binary coherent state alphabets can be represented in a two-dimensional Hilbert space. We capitalize this formal connection between the otherwise distinct domains of qubits and continuous variable states to map binary phase-shift keyed coherent states onto the Bloch sphere and to derive their quantum-optimal clones. We analyze the Wigner function and the cumulants of the clones, and we conclude that optimal cloning of binary coherent states requires a nonlinearity above second order. We propose several practical and near-optimal cloning schemes and compare their cloning fidelity to the optimal cloner.

Binaries and triples among asteroid pairs

Science.gov (United States)

Pravec, Petr; Scheirich, Peter; Kušnirák, Peter; Hornoch, Kamil; Galád, Adrián

2015-08-01

Despite major achievements obtained during the past two decades, our knowledge of the population and properties of small binary and multiple asteroid systems is still far from advanced. There is a numerous indirect evidence for that most small asteroid systems were formed by rotational fission of cohesionless parent asteroids that were spun up to the critical frequency presumably by YORP, but details of the process are lacking. Furthermore, as we proceed with observations of more and more binary and paired asteroids, we reveal new facts that substantially refine and sometimes change our understanding of the asteroid systems. One significant new finding we have recently obtained is that primaries of many asteroid pairs are actually binary or triple systems. The first such case found is (3749) Balam (Vokrouhlický, ApJL 706, L37, 2009). We have found 9 more binary systems among asteroid pairs within our ongoing NEOSource photometric project since October 2012. They are (6369) 1983 UC, (8306) Shoko, (9783) Tensho-kan, (10123) Fideoja, (21436) Chaoyichi, (43008) 1999 UD31, (44620) 1999 RS43, (46829) 1998 OS14 and (80218) 1999 VO123. We will review their characteristics. These paired binaries as we call them are mostly similar to binaries in the general ("background") population (of unpaired asteroids), but there are a few trends. The paired binaries tend to have larger secondaries with D_2/D_1 = 0.3 to 0.5 and they also tend to be wider systems with 8 of the 10 having orbital periods between 30 and 81 hours, than average among binaries in the general population. There may be also a larger fraction of triples; (3749) Balam is a confirmed triple, having a larger close and a smaller distant satellite, and (8306) Shoko and (10123) Fideoja are suspect triples as they show additional rotational lightcurve components with periods of 61 and 38.8 h that differ from the orbital period of 36.2 and 56.5 h, respectively. The unbound secondaries tend to be of the same size or

Detecting Malicious Code by Binary File Checking

Directory of Open Access Journals (Sweden)

Marius POPA

2014-01-01

Full Text Available The object, library and executable code is stored in binary files. Functionality of a binary file is altered when its content or program source code is changed, causing undesired effects. A direct content change is possible when the intruder knows the structural information of the binary file. The paper describes the structural properties of the binary object files, how the content can be controlled by a possible intruder and what the ways to identify malicious code in such kind of files. Because the object files are inputs in linking processes, early detection of the malicious content is crucial to avoid infection of the binary executable files.

Phase lags of quasi-periodic oscillations across source states in the low-mass X-ray binary 4U 1636–53

International Nuclear Information System (INIS)

De Avellar, Marcio G B

2017-01-01

The majority of attempts to explain the origin and phenomenology of the quasi-periodic oscillations (QPOs) detected in low-mass X-ray binaries invoke dynamical models, and it was just in recent years that renewed attention has been given on how radiative processes occurring in these extreme environments gives rise to the variability features observed in the X-ray light curves of these systems. The study of the dependence of the phase lags upon the energy and frequency of the QPOs is a step towards this end. The methodology we developed here allowed us to study for the first time these dependencies for all QPOs detected in the range of 1 to 1300 Hz in the low-mass X-ray binary 4U 1636–53 as the source changes its state during its cycle in the colour-colour diagram. Our results suggest that within the context of models of up-scattering Comptonization, the phase lags dependencies upon frequency and energy can be used to extract size scales and physical conditions of the medium that produces the lags. (paper)

Dietary 2-oxoglutarate mitigates gastrectomy-evoked structural changes in cartilage of female rats.

Science.gov (United States)

Dobrowolski, Piotr; Tomaszewska, Ewa; Kurlak, Paulina; Pierzynowski, Stefan G

2016-01-01

Gastrectomy (Gx) leads to osteopenia/osteoporosis in humans and animals. However, little is known about the influence of Gx on the cartilage in this regard. Recent studies have demonstrated a protective effect of 2-oxoglutaric acid (2-Ox) on bone and cartilage. Hence, the purpose of this study was to investigate whether 2-Ox can mitigate eventual Gx-induced cartilage impairment. Twenty female Sprague-Dawley rats were subjected to Gx and randomly divided into two groups: Gx + 2-Ox and Gx. Another 20 rats were sham-operated (ShO) and randomly divided into two groups: ShO + 2-Ox and ShO. The daily dose of 2-Ox administered to the rats in the drinking water was 0.43 g per 100 g rat. After eight weeks, rats were euthanized and femora and tibiae were collected. Histology and histomorphometry analyses of the articular cartilage and the growth plate were done. Gx resulted in a 32% (±44.5 femur, ±35.8 tibia) decrease in overall thickness of articular cartilage in both bones (femur: ShO 279.1 ± 48.5 vs. Gx 190.2 ± 38.4 µm, tibia: ShO 222.9 ± 50.3 µm vs. Gx 151.3 ± 52.6 µm) (in some zones up to 58 ± 28.0%), and in the growth plate up to 20% (±22.4) (femur: ShO 243.0 ± 34.0 vs. Gx 207.0 ± 33.7 µm, tibia: ShO 220.0 ± 24.6 µm vs. Gx 171.1 ± 16.1 µm). Gx altered the spatial distribution of thick and thin collagen fibers, and chondrocyte shape and size. 2-Ox administration prevented the reduction in both cartilages thickness (Gx + 2-Ox: articular cartilage 265.2 ± 53.8 µm, 235.6 ± 42.7 µm, growth plate 236.7 ± 39.2 µm, 191.3 ± 16.5 µm in femur and tibia, respectively), and abolished the spatial changes in collagen distribution and structure induced by Gx. Gx affects cartilage structure and thickness, however, 2-Ox administration mitigates these effects and showed protective and stimulatory properties. Our observations suggest that dietary 2-Ox can be used to offset

Mass Transfer in Mira-Type Binaries

Directory of Open Access Journals (Sweden)

Mohamed S.

2012-06-01

Full Text Available Detached, symbiotic binaries are generally assumed to interact via Bondi-Hoyle-Littleton (BHL wind accretion. However, the accretion rates and outflow geometries that result from this mass-transfer mechanism cannot adequately explain the observations of the nearest and best studied symbiotic binary, Mira, or the formation of some post-AGB binaries, e.g. barium stars. We propose a new mass-transfer mode for Mira-type binaries, which we call ‘wind Roche-lobe overflow’ (WRLOF, and which we demonstrate with 3D hydrodynamic simulations. Importantly, we show that the circumstellar outflows which result from WRLOF tend to be highly aspherical and strongly focused towards the binary orbital plane. Furthermore, the subsequent mass-transfer rates are at least an order of magnitude greater than the analogous BHL values. We discuss the implications of these results for the shaping of bipolar (proto-planetary nebulae and other related systems.

Roche-Lobe overflow in X-ray binaries, ch. 2

International Nuclear Information System (INIS)

Savonije, G.J.

1977-01-01

It is examined whether Roche-lobe overflow can be the main mechanism of mass transfer that powers the low-mass as well as the massive X-ray binaries. Detailed numerical computations of the initial phase of Roche-lobe overflow were performed in order to determine the precise time development of the mass transfer from normal stars with masses ranging from 1.5 M(sun) up to 20 M(sun) to compact companions with masses of 1 and 1.5 M(sun). The binary code includes a simplified hydrodynamical treatment of Roche-lobe overflow. For massive primaries this hydrodynamical treatment appears to result in much longer X-ray lifetimes than obtained in previous investigations. The calculations also include effects of slow, non-synchronous rotation of the contact star and loss of mass and angular momentum from the binary system. For Her X-1 and Cen X-3 X-ray lifetimes of the order of 10 5 and 10 4 yrs are predicted, respectively

RADIAL VELOCITY STUDIES OF CLOSE BINARY STARS. XIV

International Nuclear Information System (INIS)

Pribulla, Theodor; Rucinski, Slavek M.; DeBond, Heide; De Ridder, Archie; Karmo, Toomas; Thomson, J. R.; Croll, Bryce; Ogloza, Waldemar; Pilecki, Bogumil; Siwak, Michal

2009-01-01

Radial velocity (RV) measurements and sine curve fits to the orbital RV variations are presented for 10 close binary systems: TZ Boo, VW Boo, EL Boo, VZ CVn, GK Cep, RW Com, V2610 Oph, V1387 Ori, AU Ser, and FT UMa. Our spectroscopy revealed two quadruple systems, TZ Boo and V2610 Oph, while three stars showing small photometric amplitudes, EL Boo, V1387 Ori, and FT UMa, were found to be triple systems. GK Cep is a close binary with a faint third component. While most of the studied eclipsing systems are contact binaries, VZ CVn and GK Cep are detached or semidetached double-lined binaries, and EL Boo, V1387 Ori, and FT UMa are close binaries of uncertain binary type. The large fraction of triple and quadruple systems found in this sample supports the hypothesis of formation of close binaries in multiple stellar systems; it also demonstrates that low photometric amplitude binaries are a fertile ground for further discoveries of multiple systems.

Microlensing Signature of Binary Black Holes

Science.gov (United States)

Schnittman, Jeremy; Sahu, Kailash; Littenberg, Tyson

2012-01-01

We calculate the light curves of galactic bulge stars magnified via microlensing by stellar-mass binary black holes along the line-of-sight. We show the sensitivity to measuring various lens parameters for a range of survey cadences and photometric precision. Using public data from the OGLE collaboration, we identify two candidates for massive binary systems, and discuss implications for theories of star formation and binary evolution.

Thermodynamic stability of binary systems involving metal ions and the 4-methoxy benzylidenepyruvate in aqueous solution

International Nuclear Information System (INIS)

Redigolo, H.

1989-01-01

A review on studies previously carried out in this laboratory involving metal ions and benzylidene-pyruvate, in aqueous solutions, is presented; emphasis is mainly placed on complexes comprising 4-Dimethyl-amino-benzylidene-pyruvate (DMBP, p K a 3.79) and 2-Chloro-4-Dimethyl-amino-benzylidene-pyruvate (2 Cl-DMBP, p k a = 3.08). In an endeavour to extend the previous work, the dissociation constant of 4-methoxy-benzylidene-pyruvic acid (H-4-Me O-BP) was determined spectrophotometrically at 25.0 +- 0.1 0 C and ionic strength 0.500 M, held with sodium perchlorate (p k a = 1.473). The complex formation equilibria in M-4-Me O-BP systems, where M = Cu(II), La(III), Pr(III), Sm(III), Lu(III), Sc (III), In(III), Ga(III) or Th(IV) were investigated, also spectrophotometrically, in the above mentioned experimental conditions. In addition, the system involving Sm(III) was reinvestigated at ionic strengths 0.100 and 2.00 M, the remaining experimental conditions being maintained. The study is mostly concerned with the determination of formation constants of 1:1 complex species (β 1 ) and spectrophotometric parameters associated with these species. The investigation of possible higher binary complexes (ML n , n > 1) was prevented by solubility limitations. For all considered metal ions, log β 1 (DMBP) > log β 1 (4-Me O-BP) indicating that the stability is governed, at least in part, by ligand basicity. (author). 121 refs, 36 figs, 20 tabs

Formation and Evolution of X-ray Binaries

Science.gov (United States)

Fragkos, Anastasios

X-ray binaries - mass-transferring binary stellar systems with compact object accretors - are unique astrophysical laboratories. They carry information about many complex physical processes such as star formation, compact object formation, and evolution of interacting binaries. My thesis work involves the study of the formation and evolution of Galactic and extra-galacticX-ray binaries using both detailed and realistic simulation tools, and population synthesis techniques. I applied an innovative analysis method that allows the reconstruction of the full evolutionary history of known black hole X-ray binaries back to the time of compact object formation. This analysis takes into account all the available observationally determined properties of a system, and models in detail four of its evolutionary evolutionary phases: mass transfer through the ongoing X-ray phase, tidal evolution before the onset of Roche-lobe overflow, motion through the Galactic potential after the formation of the black hole, and binary orbital dynamics at the time of core collapse. Motivated by deep extra-galactic Chandra survey observations, I worked on population synthesis models of low-mass X-ray binaries in the two elliptical galaxies NGC3379 and NGC4278. These simulations were targeted at understanding the origin of the shape and normalization of the observed X-ray luminosity functions. In a follow up study, I proposed a physically motivated prescription for the modeling of transient neutron star low-mass X-ray binary properties, such as duty cycle, outburst duration and recurrence time. This prescription enabled the direct comparison of transient low-mass X-ray binary population synthesis models to the Chandra X-ray survey of the two ellipticals NGC3379 and NGC4278. Finally, I worked on population synthesismodels of black holeX-ray binaries in the MilkyWay. This work was motivated by recent developments in observational techniques for the measurement of black hole spin magnitudes in

Detectability of Gravitational Waves from High-Redshift Binaries.

Science.gov (United States)

Rosado, Pablo A; Lasky, Paul D; Thrane, Eric; Zhu, Xingjiang; Mandel, Ilya; Sesana, Alberto

2016-03-11

Recent nondetection of gravitational-wave backgrounds from pulsar timing arrays casts further uncertainty on the evolution of supermassive black hole binaries. We study the capabilities of current gravitational-wave observatories to detect individual binaries and demonstrate that, contrary to conventional wisdom, some are, in principle, detectable throughout the Universe. In particular, a binary with rest-frame mass ≳10^{10}M_{⊙} can be detected by current timing arrays at arbitrarily high redshifts. The same claim will apply for less massive binaries with more sensitive future arrays. As a consequence, future searches for nanohertz gravitational waves could be expanded to target evolving high-redshift binaries. We calculate the maximum distance at which binaries can be observed with pulsar timing arrays and other detectors, properly accounting for redshift and using realistic binary waveforms.

A NEW CLASS OF NASCENT ECLIPSING BINARIES WITH EXTREME MASS RATIOS

Energy Technology Data Exchange (ETDEWEB)

Moe, Maxwell; Stefano, Rosanne Di, E-mail: mmoe@cfa.harvard.edu [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, MS-10, Cambridge, MA 02138 (United States)

2015-03-10

Early B-type main-sequence (MS) stars (M {sub 1} ≈ 5-16 M {sub ☉}) with closely orbiting low-mass stellar companions (q = M {sub 2}/M {sub 1} < 0.25) can evolve to produce Type Ia supernovae, low-mass X-ray binaries, and millisecond pulsars. However, the formation mechanism and intrinsic frequency of such close extreme mass-ratio binaries have been debated, especially considering none have hitherto been detected. Utilizing observations of the Large Magellanic Cloud galaxy conducted by the Optical Gravitational Lensing Experiment, we have discovered a new class of eclipsing binaries in which a luminous B-type MS star irradiates a closely orbiting low-mass pre-MS companion that has not yet fully formed. The primordial pre-MS companions have large radii and discernibly reflect much of the light they intercept from the B-type MS primaries (ΔI {sub refl} ≈ 0.02-0.14 mag). For the 18 definitive MS + pre-MS eclipsing binaries in our sample with good model fits to the observed light-curves, we measure short orbital periods P = 3.0-8.5 days, young ages τ ≈ 0.6-8 Myr, and small secondary masses M {sub 2} ≈ 0.8-2.4 M {sub ☉} (q ≈ 0.07-0.36). The majority of these nascent eclipsing binaries are still associated with stellar nurseries, e.g., the system with the deepest eclipse ΔI {sub 1} = 2.8 mag and youngest age τ = 0.6 ± 0.4 Myr is embedded in the bright H II region 30 Doradus. After correcting for selection effects, we find that (2.0 ± 0.6)% of B-type MS stars have companions with short orbital periods P = 3.0-8.5 days and extreme mass ratios q ≈ 0.06-0.25. This is ≈10 times greater than that observed for solar-type MS primaries. We discuss how these new eclipsing binaries provide invaluable insights, diagnostics, and challenges for the formation and evolution of stars, binaries, and H II regions.

miR-339-5p regulates the p53 tumor-suppressor pathway by targeting MDM2

DEFF Research Database (Denmark)

Jansson, M D; Djodji Damas, Nkerorema; Lees, M

2014-01-01

MicroRNAs (miRNAs) regulate many key cancer-relevant pathways and may themselves possess oncogenic or tumor-suppressor functions. Consequently, miRNA dysregulation has been shown to be a prominent feature in many human cancers. The p53 tumor suppressor acts as a negative regulator of cell prolife...... tumor cells. Furthermore, we show that a negative correlation between miR-339-5p and MDM2 expression exists in human cancer, implying that the interaction is important for cancer development.Oncogene advance online publication, 2 June 2014; doi:10.1038/onc.2014.130....

Non-binary Entanglement-assisted Stabilizer Quantum Codes

OpenAIRE

Riguang, Leng; Zhi, Ma

2011-01-01

In this paper, we show how to construct non-binary entanglement-assisted stabilizer quantum codes by using pre-shared entanglement between the sender and receiver. We also give an algorithm to determine the circuit for non-binary entanglement-assisted stabilizer quantum codes and some illustrated examples. The codes we constructed do not require the dual-containing constraint, and many non-binary classical codes, like non-binary LDPC codes, which do not satisfy the condition, can be used to c...

Mesoscopic model for binary fluids

Science.gov (United States)

Echeverria, C.; Tucci, K.; Alvarez-Llamoza, O.; Orozco-Guillén, E. E.; Morales, M.; Cosenza, M. G.

2017-10-01

We propose a model for studying binary fluids based on the mesoscopic molecular simulation technique known as multiparticle collision, where the space and state variables are continuous, and time is discrete. We include a repulsion rule to simulate segregation processes that does not require calculation of the interaction forces between particles, so binary fluids can be described on a mesoscopic scale. The model is conceptually simple and computationally efficient; it maintains Galilean invariance and conserves the mass and energy in the system at the micro- and macro-scale, whereas momentum is conserved globally. For a wide range of temperatures and densities, the model yields results in good agreement with the known properties of binary fluids, such as the density profile, interface width, phase separation, and phase growth. We also apply the model to the study of binary fluids in crowded environments with consistent results.

Relativistic apsidal motion in eccentric eclipsing binaries

Czech Academy of Sciences Publication Activity Database

Wolf, M.; Claret, L.; Kotková, Lenka; Kučáková, Hana; Kocián, R.; Brát, L.; Svoboda, P.; Šmelcer, L.

2010-01-01

Roč. 509, January (2010), A18/1-A18/14 ISSN 0004-6361 Grant - others:GA ČR(CZ) GA205/04/2063; GA ČR(CZ) GA205/06/0217 Institutional research plan: CEZ:AV0Z10030501 Keywords : binaries eclipsing Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.410, year: 2010

Kepler eclipsing binary stars. IV. Precise eclipse times for close binaries and identification of candidate three-body systems

International Nuclear Information System (INIS)

Conroy, Kyle E.; Stassun, Keivan G.; Prša, Andrej; Orosz, Jerome A.; Welsh, William F.; Fabrycky, Daniel C.

2014-01-01

We present a catalog of precise eclipse times and analysis of third-body signals among 1279 close binaries in the latest Kepler Eclipsing Binary Catalog. For these short-period binaries, Kepler's 30 minute exposure time causes significant smearing of light curves. In addition, common astrophysical phenomena such as chromospheric activity, as well as imperfections in the light curve detrending process, can create systematic artifacts that may produce fictitious signals in the eclipse timings. We present a method to measure precise eclipse times in the presence of distorted light curves, such as in contact and near-contact binaries which exhibit continuously changing light levels in and out of eclipse. We identify 236 systems for which we find a timing variation signal compatible with the presence of a third body. These are modeled for the light travel time effect and the basic properties of the third body are derived. This study complements J. A. Orosz et al. (in preparation), which focuses on eclipse timing variations of longer period binaries with flat out-of-eclipse regions. Together, these two papers provide comprehensive eclipse timings for all binaries in the Kepler Eclipsing Binary Catalog, as an ongoing resource freely accessible online to the community.

Physical characteristics of the binary PHA 2003 YT1

Czech Academy of Sciences Publication Activity Database

Larson, S. M.; Grauer, A. D.; Beshore, E.; Christensen, E.; Pravec, Petr; Kaasalainen, M.; Nolan, M. C.; Howell, E. S.; Hine, A. A.; Galád, Adrián; Gajdoš, Š.; Kornoš, L.; Világi, J.

2004-01-01

Roč. 36, č. 4 (2004), s. 1139 ISSN 0002-7537 R&D Projects: GA AV ČR IAA3003204 Institutional research plan: CEZ:AV0Z1003909 Keywords : binary * asteroids * photometry Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

MESA models of the evolutionary state of the interacting binary epsilon Aurigae

Science.gov (United States)

Gibson, Justus L.; Stencel, Robert E.

2018-06-01

Using MESA code (Modules for Experiments in Stellar Astrophysics, version 9575), an evaluation was made of the evolutionary state of the epsilon Aurigae binary system (HD 31964, F0Iap + disc). We sought to satisfy several observational constraints: (1) requiring evolutionary tracks to pass close to the current temperature and luminosity of the primary star; (2) obtaining a period near the observed value of 27.1 years; (3) matching a mass function of 3.0; (4) concurrent Roche lobe overflow and mass transfer; (5) an isotopic ratio 12C/13C = 5 and, (6) matching the interferometrically determined angular diameter. A MESA model starting with binary masses of 9.85 + 4.5 M⊙, with a 100 d initial period, produces a 1.2 + 10.6 M⊙ result having a 547 d period, and a single digit 12C/13C ratio. These values were reached near an age of 20 Myr, when the donor star comes close to the observed luminosity and temperature for epsilon Aurigae A, as a post-RGB/pre-AGB star. Contemporaneously, the accretor then appears as an upper main-sequence, early B-type star. This benchmark model can provide a basis for further exploration of this interacting binary, and other long-period binary stars.

CIRCUMBINARY MAGNETOHYDRODYNAMIC ACCRETION INTO INSPIRALING BINARY BLACK HOLES

Energy Technology Data Exchange (ETDEWEB)

Noble, Scott C.; Mundim, Bruno C.; Nakano, Hiroyuki; Campanelli, Manuela; Zlochower, Yosef [Center for Computational Relativity and Gravitation, Rochester Institute of Technology, Rochester, NY 14623 (United States); Krolik, Julian H. [Physics and Astronomy Department, Johns Hopkins University, Baltimore, MD 21218 (United States); Yunes, Nicolas, E-mail: scn@astro.rit.edu [Department of Physics, Montana State University, Bozeman, MT 59717 (United States)

2012-08-10

We have simulated the magnetohydrodynamic evolution of a circumbinary disk surrounding an equal-mass binary comprising two non-spinning black holes during the period in which the disk inflow time is comparable to the binary evolution time due to gravitational radiation. Both the changing spacetime and the binary orbital evolution are described by an innovative technique utilizing high-order post-Newtonian approximations. Prior to the beginning of the inspiral, the structure of the circumbinary disk is predicted well by extrapolation from Newtonian results: a gap of roughly two binary separation radii is cleared, and matter piles up at the outer edge of this gap as inflow is retarded by torques exerted by the binary; the accretion rate is roughly half its value at large radius. During inspiral, the inner edge of the disk initially moves inward in coordination with the shrinking binary, but-as the orbital evolution accelerates-the inward motion of the disk edge falls behind the rate of binary compression. In this stage, the binary torque falls substantially, but the accretion rate decreases by only 10%-20%. When the binary separation is tens of gravitational radii, the rest-mass efficiency of disk radiation is a few percent, suggesting that supermassive binary black holes could be very luminous at this stage of their evolution. Inner disk heating is modulated at a beat frequency comparable to the binary orbital frequency. However, a disk with sufficient surface density to be luminous may be optically thick, suppressing periodic modulation of the luminosity.

Binary and Millisecond Pulsars

Directory of Open Access Journals (Sweden)

Lorimer Duncan R.

2008-11-01

Full Text Available We review the main properties, demographics and applications of binary and millisecond radio pulsars. Our knowledge of these exciting objects has greatly increased in recent years, mainly due to successful surveys which have brought the known pulsar population to over 1800. There are now 83 binary and millisecond pulsars associated with the disk of our Galaxy, and a further 140 pulsars in 26 of the Galactic globular clusters. Recent highlights include the discovery of the young relativistic binary system PSR J1906+0746, a rejuvination in globular cluster pulsar research including growing numbers of pulsars with masses in excess of 1.5M_⊙, a precise measurement of relativistic spin precession in the double pulsar system and a Galactic millisecond pulsar in an eccentric (e = 0.44 orbit around an unevolved companion.

Observations of new Wolf-Rayet binaries

International Nuclear Information System (INIS)

Niemela, V.S.

1982-01-01

The author reports here preliminary results of spectrographic observations for three southern WR stars, whose binary nature had not been previously verified: HDE 320102, CD -45 0 4482, HD 62910. The observations were carried out at the Cerro Tololo Inter-American Observatory, Chile, mostly with the Cassegrain spectrograph with IT attached to the 1-m reflector. These spectrograms were secured on Kodak IIIaJ emulsion, and have a dispersion of 45 A/mm. The results suggest that HDE 320102 must be a double-lined 05-7 + WN3 spectroscopic binary, that CD -45 0 4482 appears to be a single-lined spectroscopic binary and that HD 62910 may be a binary. (Auth.)

Apsidal Motion in Eccentric Eclipsing Binary WW Camelopardalis

Czech Academy of Sciences Publication Activity Database

Wolf, M.; Kotková, Lenka; Kocián, R.; Dřevěný, R.; Hanžl, D.

2010-01-01

Roč. 139, č. 3 (2010), s. 1028-1030 ISSN 0004-6256 R&D Projects: GA ČR GA205/08/0003 Institutional research plan: CEZ:AV0Z10030501 Keywords : eclipsing Binaries * WW Camelopardali Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.548, year: 2010

Noble gas, binary mixtures for commercial gas-cooled reactor systems

International Nuclear Information System (INIS)

El-Genk, M. S.; Tournier, J. M.

2007-01-01

Commercial gas cooled reactors employ helium as a coolant and working fluid for the Closed Brayton Cycle (CBC) turbo-machines. Helium has the highest thermal conductivity and lowest dynamic viscosity of all noble gases. This paper compares the relative performance of pure helium to binary mixtures of helium and other noble gases of higher molecular weights. The comparison is for the same molecular flow rate, and same operating temperatures and geometry. Results show that although helium is a good working fluid because of its high heat transfer coefficient and significantly lower pumping requirement, a binary gas mixture of He-Xe with M = 15 gm/mole has a heat transfer coefficient that is ∼7% higher than that of helium and requires only 25% of the number stages of the turbo-machines. The binary mixture, however, requires 3.5 times the pumping requirement with helium. The second best working fluid is He-Kr binary mixture with M = 10 gm/mole. It has 4% higher heat transfer coefficient than He and requires 30% of the number of stages in the turbo-machines, but requires twice the pumping power

Asteroseismic effects in close binary stars

Science.gov (United States)

Springer, Ofer M.; Shaviv, Nir J.

2013-09-01

Turbulent processes in the convective envelopes of the Sun and stars have been shown to be a source of internal acoustic excitations. In single stars, acoustic waves having frequencies below a certain cut-off frequency propagate nearly adiabatically and are effectively trapped below the photosphere where they are internally reflected. This reflection essentially occurs where the local wavelength becomes comparable to the pressure scale height. In close binary stars, the sound speed is a constant on equipotentials, while the pressure scale height, which depends on the local effective gravity, varies on equipotentials and may be much greater near the inner Lagrangian point (L1). As a result, waves reaching the vicinity of L1 may propagate unimpeded into low-density regions, where they tend to dissipate quickly due to non-linear and radiative effects. We study the three-dimensional propagation and enhanced damping of such waves inside a set of close binary stellar models using a WKB approximation of the acoustic field. We find that these waves can have much higher damping rates in close binaries, compared to their non-binary counterparts. We also find that the relative distribution of acoustic energy density at the visible surface of close binaries develops a ring-like feature at specific acoustic frequencies and binary separations.

In what sense a neutron star-black hole binary is the holy grail for testing gravity?

International Nuclear Information System (INIS)

Bagchi, Manjari; Torres, Diego F.

2014-01-01

Pulsars in binary systems have been very successful to test the validity of general relativity in the strong field regime [1-4]. So far, such binaries include neutron star-white dwarf (NS-WD) and neutron star-neutron star (NS-NS) systems. It is commonly believed that a neutron star-black hole (NS-BH) binary will be much superior for this purpose. But in what sense is this true? Does it apply to all possible deviations?

Hexagonal pixel detector with time encoded binary readout

International Nuclear Information System (INIS)

Hoedlmoser, H.; Varner, G.; Cooney, M.

2009-01-01

The University of Hawaii is developing continuous acquisition pixel (CAP) detectors for vertexing applications in lepton colliding experiments such as SuperBelle or ILC. In parallel to the investigation of different technology options such as MAPS or SOI, both analog and binary readout concepts have been tested. First results with a binary readout scheme in which the hit information is time encoded by means of a signal shifting mechanism have recently been published. This paper explains the hit reconstruction for such a binary detector with an emphasis on fake hit reconstruction probabilities in order to evaluate the rate capability in a high background environment such as the planned SuperB factory at KEK. The results show that the binary concept is at least comparable to any analog readout strategy if not better in terms of occupancy. Furthermore, we present a completely new binary readout strategy in which the pixel cells are arranged in a hexagonal grid allowing the use of three independent output directions to reduce reconstruction ambiguities. The new concept uses the same signal shifting mechanism for time encoding, however, in dedicated transfer lines on the periphery of the detector, which enables higher shifting frequencies. Detailed Monte Carlo simulations of full size pixel matrices including hit and BG generation, signal generation, and data reconstruction show that by means of multiple signal transfer lines on the periphery the pixel can be made smaller (higher resolution), the number of output channels and the data volume per triggered event can be reduced dramatically, fake hit reconstruction is lowered to a minimum and the resulting effective occupancies are less than 10 -4 . A prototype detector has been designed in the AMS 0.35μm Opto process and is currently under fabrication.

Logistic chaotic maps for binary numbers generations

International Nuclear Information System (INIS)

Kanso, Ali; Smaoui, Nejib

2009-01-01

Two pseudorandom binary sequence generators, based on logistic chaotic maps intended for stream cipher applications, are proposed. The first is based on a single one-dimensional logistic map which exhibits random, noise-like properties at given certain parameter values, and the second is based on a combination of two logistic maps. The encryption step proposed in both algorithms consists of a simple bitwise XOR operation of the plaintext binary sequence with the keystream binary sequence to produce the ciphertext binary sequence. A threshold function is applied to convert the floating-point iterates into binary form. Experimental results show that the produced sequences possess high linear complexity and very good statistical properties. The systems are put forward for security evaluation by the cryptographic committees.

Converting optical scanning holograms of real objects to binary Fourier holograms using an iterative direct binary search algorithm.

Science.gov (United States)

Leportier, Thibault; Park, Min Chul; Kim, You Seok; Kim, Taegeun

2015-02-09

In this paper, we present a three-dimensional holographic imaging system. The proposed approach records a complex hologram of a real object using optical scanning holography, converts the complex form to binary data, and then reconstructs the recorded hologram using a spatial light modulator (SLM). The conversion from the recorded hologram to a binary hologram is achieved using a direct binary search algorithm. We present experimental results that verify the efficacy of our approach. To the best of our knowledge, this is the first time that a hologram of a real object has been reconstructed using a binary SLM.

Volumetric and viscometric properties of binary and ternary mixtures of 1-butyl-3-methylimidazolium tetrafluoroborate, monoethanolamine and water

International Nuclear Information System (INIS)

Yin, Yaran; Zhu, Chunying; Ma, Youguang

2016-01-01

Highlights: • Densities and viscosities of [Bmim][BF 4 ] + MEA + H 2 O solutions were measured. • Volumetric and viscometric properties were deduced from experimental results. • Intermolecular interactions were analysed by volumetric and viscometric properties. - Abstract: Densities and viscosities of binary {[Bmim][BF 4 ] + H 2 O}, {[Bmim][BF 4 ] + MEA}, (MEA + H 2 O) and ternary mixtures {[Bmim][BF 4 ] + MEA + H 2 O} were measured at T = (293.15–333.15) K. The volumetric and viscometric properties, such as excess molar volume V E , viscosity deviation Δη, and excess Gibbs energy of activation of viscous flow ΔG ∗E for all mixtures, and apparent molar volume, excess partial molar volume and Grunberg-Nissan interaction parameter G 12 for binary mixtures, were deduced from experimental results, and the intermolecular interactions in solutions were also analysed. The excess molar volumes were correlated using the Redlich-Kister polynomial equation for binary mixtures, and Singh et al. equation for the ternary mixture with corresponding binary parameters. The viscosities of binary and ternary solutions were respectively fitted by Jouyban-Acree equation and its extended equation at each measurement temperature, the correlated values are in good agreement with the corresponding experimental data.

EXTRASOLAR BINARY PLANETS. II. DETECTABILITY BY TRANSIT OBSERVATIONS

International Nuclear Information System (INIS)

Lewis, K. M.; Ida, S.; Ochiai, H.; Nagasawa, M.

2015-01-01

We discuss the detectability of gravitationally bound pairs of gas-giant planets (which we call “binary planets”) in extrasolar planetary systems that are formed through orbital instability followed by planet–planet dynamical tides during their close encounters, based on the results of N-body simulations by Ochiai et al. (Paper I). Paper I showed that the formation probability of a binary is as much as ∼10% for three giant planet systems that undergo orbital instability, and after post-capture long-term tidal evolution, the typical binary separation is three to five times the sum of the physical radii of the planets. The binary planets are stable during the main-sequence lifetime of solar-type stars, if the stellarcentric semimajor axis of the binary is larger than 0.3 AU. We show that detecting modulations of transit light curves is the most promising observational method to detect binary planets. Since the likely binary separations are comparable to the stellar diameter, the shape of the transit light curve is different from transit to transit, depending on the phase of the binary’s orbit. The transit durations and depth for binary planet transits are generally longer and deeper than those for the single planet case. We point out that binary planets could exist among the known inflated gas-giant planets or objects classified as false positive detections at orbital radii ≳0.3 AU, propose a binary planet explanation for the CoRoT candidate SRc01 E2 1066, and show that binary planets are likely to be present in, and could be detected using, Kepler-quality data

Interaction of Massive Black Hole Binaries with Their Stellar Environment. II. Loss Cone Depletion and Binary Orbital Decay

Science.gov (United States)

Sesana, Alberto; Haardt, Francesco; Madau, Piero

2007-05-01

We study the long-term evolution of massive black hole binaries (MBHBs) at the centers of galaxies using detailed scattering experiments to solve the full three-body problem. Ambient stars drawn from an isotropic Maxwellian distribution unbound to the binary are ejected by the gravitational slingshot. We construct a minimal, hybrid model for the depletion of the loss cone and the orbital decay of the binary and show that secondary slingshots-stars returning on small-impact parameter orbits to have a second superelastic scattering with the MBHB-may considerably help the shrinking of the pair in the case of large binary mass ratios. In the absence of loss cone refilling by two-body relaxation or other processes, the mass ejected before the stalling of a MBHB is half the binary reduced mass. About 50% of the ejected stars are expelled in a ``burst'' lasting ~104 yr M1/46, where M6 is the binary mass in units of 106 Msolar. The loss cone is completely emptied in a few bulge crossing timescales, ~107 yr M1/46. Even in the absence of two-body relaxation or gas dynamical processes, unequal mass and/or eccentric binaries with M6>~0.1 can shrink to the gravitational wave emission regime in less than a Hubble time and are therefore ``safe'' targets for the planned Laser Interferometer Space Antenna.

Candidate Binary Trojan and Hilda Asteroids from Rotational Light Curves

Science.gov (United States)

Sonnett, Sarah M.; Mainzer, Amy K.; Grav, Tommy; Masiero, Joseph R.; Bauer, James M.; Kramer, Emily A.

2017-10-01

Jovian Trojans (hereafter, Trojans) are asteroids in stable orbits at Jupiter's L4 and L5 Lagrange points, and Hilda asteroids are inwards of the Trojans in 3:2 mean-motion resonance with Jupiter. Due to their special dynamical properties, observationally constraining the formation location and dynamical histories of Trojans and HIldas offers key input for giant planet migration models. A fundamental parameter in assessing formation location is the bulk density - with low-density objects associated with an ice-rich formation environment in the outer solar system and high-density objects typically linked to the warmer inner solar system. Bulk density can only be directly measured during a close fly-by or by determining the mutual orbits of binary asteroid systems. With the aim of determining densities for a statistically significant sample of Trojans and Hildas, we are undertaking an observational campaign to confirm and characterize candidate binary asteroids published in Sonnett et al. (2015). These objects were flagged as binary candidates because their large NEOWISE brightness variations imply shapes so elongated that they are not likely explained by a singular equilibrium rubble pile and instead may be two elongated, gravitationally bound asteroids. We are obtaining densely sampled rotational light curves of these possible binaries to search for light curve features diagnostic of binarity and to determine the orbital properties of any confirmed binary systems by modeling the light curve. We compare the We present an update on this follow-up campaign and comment on future steps.

Genders and Individual Treatment Progress in (Non-)Binary Trans Individuals.

Science.gov (United States)

Koehler, Andreas; Eyssel, Jana; Nieder, Timo O

2018-01-01

Health care for transgender and transsexual (ie, trans) individuals has long been based on a binary understanding of gender (ie, feminine vs masculine). However, the existence of non-binary or genderqueer (NBGQ) genders is increasingly recognized by academic and/or health care professionals. To gain insight into the individual health care experiences and needs of binary and NBGQ individuals to improve their health care outcomes and experience. Data were collected using an online survey study on experiences with trans health care. The non-clinical sample consisted of 415 trans individuals. An individual treatment progress score was calculated to report and compare participants' individual progress toward treatment completion and consider the individual treatment needs and definitions of completed treatment (ie, amount and types of different treatments needed to complete one's medical transition). Main outcome measures were (i) general and trans-related sociodemographic data and (ii) received and planned treatments. Participants reported binary (81.7%) and different NBGQ (18.3%) genders. The 2 groups differed significantly in basic demographic data (eg, mean age; P < .05). NBGQ participants reported significantly fewer received treatments compared with binary participants. For planned treatments, binary participants reported more treatments related to primary sex characteristics only. Binary participants required more treatments for a completed treatment than NBGQ participants (6.0 vs 4.0). There were no differences with regard to individual treatment progress score. Because traditional binary-focused treatment practice could have hindered NBGQ individuals from accessing trans health care or sufficiently articulating their needs, health care professionals are encouraged to provide a holistic and individual treatment approach and acknowledge genders outside the gender binary to address their needs appropriately. Because the study was made inclusive for non

SuperWASP J015100.23-100524.2: A SPOTTED SHALLOW-CONTACT BINARY BELOW THE PERIOD LIMIT

Energy Technology Data Exchange (ETDEWEB)

Qian, S. B.; Zhang, B.; He, J. J.; Liu, L.; Zhu, L. Y.; Zhao, E. G.; Zhou, X.; Thawicharat, S. [Yunnan Observatories, Chinese Academy of Sciences (CAS), P.O. Box 110, 650011 Kunming (China); Soonthornthum, B.; Rattanasoon, S.; Aukkaravittayapun, S., E-mail: qsb@ynao.ac.cn [National Astronomical Research Institute of Thailand, 191 Siriphanich Bldg., Huay Kaew Road, Chiang Mai 50200 (Thailand)

2015-10-15

SuperWASP J015100.23-100524.2 (hereafter J015100) is an eclipsing binary with an orbital period of 0.d2145 that is below the short-period limit of contact binary stars. Complete light curves of J015100 in B, V, R, and I bands are presented and are analyzed with the Wilson–Devinney method. It has been discovered that J015100 is a shallow-contact binary (f = 14.6(±2.7)%) with a mass ratio of 3.128. It is a W-type contact binary where the less massive component is about 130 K hotter than the more massive one. The asymmetries of light curves are explained as one dark spot on the more massive component. The detection of J015100 as a contact binary below the period limit suggests that contact binaries below this limit are not rapidly destroyed. This shallow-contact system may be formed from a detached short-period binary similar to DV Psc (Sp. = K4/K5; P = 0.d30855) via orbital shrinkage due to angular momentum loss through magnetic stellar wind.

Merger rate of primordial black-hole binaries

Science.gov (United States)

Ali-Haïmoud, Yacine; Kovetz, Ely D.; Kamionkowski, Marc

2017-12-01

Primordial black holes (PBHs) have long been a candidate for the elusive dark matter (DM), and remain poorly constrained in the ˜20 - 100 M⊙ mass range. PBH binaries were recently suggested as the possible source of LIGO's first detections. In this paper, we thoroughly revisit existing estimates of the merger rate of PBH binaries. We compute the probability distribution of orbital parameters for PBH binaries formed in the early Universe, accounting for tidal torquing by all other PBHs, as well as standard large-scale adiabatic perturbations. We then check whether the orbital parameters of PBH binaries formed in the early Universe can be significantly affected between formation and merger. Our analytic estimates indicate that the tidal field of halos and interactions with other PBHs, as well as dynamical friction by unbound standard DM particles, do not do significant work on nor torque PBH binaries. We estimate the torque due to baryon accretion to be much weaker than previous calculations, albeit possibly large enough to significantly affect the eccentricity of typical PBH binaries. We also revisit the PBH-binary merger rate resulting from gravitational capture in present-day halos, accounting for Poisson fluctuations. If binaries formed in the early Universe survive to the present time, as suggested by our analytic estimates, they dominate the total PBH merger rate. Moreover, this merger rate would be orders of magnitude larger than LIGO's current upper limits if PBHs make a significant fraction of the dark matter. As a consequence, LIGO would constrain ˜10 - 300 M⊙ PBHs to constitute no more than ˜1 % of the dark matter. To make this conclusion fully robust, though, numerical study of several complex astrophysical processes—such as the formation of the first PBH halos and how they may affect PBH binaries, as well as the accretion of gas onto an extremely eccentric binary—is needed.

MICROLENSING BINARIES DISCOVERED THROUGH HIGH-MAGNIFICATION CHANNEL

Energy Technology Data Exchange (ETDEWEB)

Shin, I.-G.; Choi, J.-Y.; Park, S.-Y.; Han, C. [Department of Physics, Institute for Astrophysics, Chungbuk National University, Cheongju 371-763 (Korea, Republic of); Gould, A.; Gaudi, B. S. [Department of Astronomy, Ohio State University, 140 W. 18th Ave., Columbus, OH 43210 (United States); Sumi, T. [Department of Earth and Space Science, Osaka University, Osaka 560-0043 (Japan); Udalski, A. [Warsaw University Observatory, Al. Ujazdowskie 4, 00-478 Warszawa (Poland); Beaulieu, J.-P. [Institut d' Astrophysique de Paris, UMR7095 CNRS-Universite Pierre and Marie Curie, 98 bis Boulevard Arago, 75014 Paris (France); Dominik, M. [School of Physics and Astronomy, SUPA, University of St. Andrews, North Haugh, St. Andrews, KY16 9SS (United Kingdom); Allen, W. [Vintage Lane Observatory, Blenheim (New Zealand); Bos, M. [Molehill Astronomical Observatory, North Shore (New Zealand); Christie, G. W. [Auckland Observatory, P.O. Box 24-180, Auckland (New Zealand); Depoy, D. L. [Department of Physics, Texas A and M University, College Station, TX (United States); Dong, S. [Institute for Advanced Study, Einstein Drive, Princeton, NJ 08540 (United States); Drummond, J. [Possum Observatory, Patutahi (New Zealand); Gal-Yam, A. [Benoziyo Center for Astrophysics, the Weizmann Institute (Israel); Hung, L.-W. [Department of Physics and Astronomy, University of California Los Angeles, Los Angeles, CA 90095 (United States); Janczak, J. [Department of Physics, Ohio State University, 191 W. Woodruff, Columbus, OH 43210 (United States); Kaspi, S. [School of Physics and Astronomy, Tel-Aviv University, Tel Aviv 69978 (Israel); Collaboration: muFUN Collaboration; MOA Collaboration; OGLE Collaboration; PLANET Collaboration; RoboNet Collaboration; MiNDSTEp Consortium; and others

2012-02-20

Microlensing can provide a useful tool to probe binary distributions down to low-mass limits of binary companions. In this paper, we analyze the light curves of eight binary-lensing events detected through the channel of high-magnification events during the seasons from 2007 to 2010. The perturbations, which are confined near the peak of the light curves, can be easily distinguished from the central perturbations caused by planets. However, the degeneracy between close and wide binary solutions cannot be resolved with a 3{sigma} confidence level for three events, implying that the degeneracy would be an important obstacle in studying binary distributions. The dependence of the degeneracy on the lensing parameters is consistent with a theoretical prediction that the degeneracy becomes severe as the binary separation and the mass ratio deviate from the values of resonant caustics. The measured mass ratio of the event OGLE-2008-BLG-510/MOA-2008-BLG-369 is q {approx} 0.1, making the companion of the lens a strong brown dwarf candidate.

Eclipsing binary stars with a delta Scuti component

Czech Academy of Sciences Publication Activity Database

Alicavus, F.K.; Soydugan, E.; Smalley, B.; Kubát, Jiří

2017-01-01

Roč. 470, č. 1 (2017), s. 915-931 ISSN 0035-8711 R&D Projects: GA ČR(CZ) GA16-01116S Institutional support: RVO:67985815 Keywords : stars * eclipsing binaries * fundamental parameters Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 4.961, year: 2016

Precessional Instability in Binary Black Holes with Aligned Spins.

Science.gov (United States)

Gerosa, Davide; Kesden, Michael; O'Shaughnessy, Richard; Klein, Antoine; Berti, Emanuele; Sperhake, Ulrich; Trifirò, Daniele

2015-10-02

Binary black holes on quasicircular orbits with spins aligned with their orbital angular momentum have been test beds for analytic and numerical relativity for decades, not least because symmetry ensures that such configurations are equilibrium solutions to the spin-precession equations. In this work, we show that these solutions can be unstable when the spin of the higher-mass black hole is aligned with the orbital angular momentum and the spin of the lower-mass black hole is antialigned. Spins in these configurations are unstable to precession to large misalignment when the binary separation r is between the values r(ud±)=(√(χ(1))±√(qχ(2)))(4)(1-q)(-2)M, where M is the total mass, q≡m(2)/m(1) is the mass ratio, and χ(1) (χ(2)) is the dimensionless spin of the more (less) massive black hole. This instability exists for a wide range of spin magnitudes and mass ratios and can occur in the strong-field regime near the merger. We describe the origin and nature of the instability using recently developed analytical techniques to characterize fully generic spin precession. This instability provides a channel to circumvent astrophysical spin alignment at large binary separations, allowing significant spin precession prior to merger affecting both gravitational-wave and electromagnetic signatures of stellar-mass and supermassive binary black holes.

ENHANCED TIDAL DISRUPTION RATES FROM MASSIVE BLACK HOLE BINARIES

International Nuclear Information System (INIS)

Chen Xian; Liu, F. K.; Madau, Piero; Sesana, Alberto

2009-01-01

'Hard' massive black hole (MBH) binaries embedded in steep stellar cusps can shrink via three-body slingshot interactions. We show that this process will inevitably be accompanied by a burst of stellar tidal disruptions, at a rate that can be several orders of magnitude larger than that appropriate for a single MBH. Our numerical scattering experiments reveal that (1) a significant fraction of stars initially bound to the primary hole are scattered into its tidal disruption loss cone by gravitational interactions with the secondary hole, an enhancement effect that is more pronounced for very unequal mass binaries; (2) about 25% (40%) of all strongly interacting stars are tidally disrupted by an MBH binary of mass ratio q = 1/81 (q = 1/243) and eccentricity 0.1; and (3) two mechanisms dominate the fueling of the tidal disruption loss cone, a Kozai nonresonant interaction that causes the secular evolution of the stellar angular momentum in the field of the binary, and the effect of close encounters with the secondary hole that change the stellar orbital parameters in a chaotic way. For a hard MBH binary of 10 7 M sun and mass ratio 10 -2 , embedded in an isothermal stellar cusp of velocity dispersion σ * = 100 km s -1 , the tidal disruption rate can be as large as N-dot * ∼1 yr -1 . This is 4 orders of magnitude higher than estimated for a single MBH fed by two-body relaxation. When applied to the case of a putative intermediate-mass black hole inspiraling onto Sgr A*, our results predict tidal disruption rates N-dot * ∼0.05-0.1 yr -1 .

Volumetric behaviour of the (2,2,4-trimethylpentane + methylbenzene + butan-1-ol) ternary system and its binary sub-systems within the temperature range (298.15–328.15) K

International Nuclear Information System (INIS)

Morávková, Lenka; Troncoso, Jacobo; Machanová, Karolina; Sedláková, Zuzana

2013-01-01

Highlights: • Density measurements. • Excess molar volume at atmospheric pressure. • Redlich–Kister equation. • ERAS model. • Comparison of our data with literature data. -- Abstract: Densities and speeds of sound of the (2,2,4-trimethylpentane + methylbenzene + butan-1-ol) ternary system as well as all its binary sub-systems were measured at four temperatures, namely 298.15 K, 308.15 K, 318.15 K, and 328.15 K at atmospheric pressure by a vibrating-tube densimeter DSA 5000. The binary (isooctane + toluene) system was studied previously. Excess quantities (molar volume, adiabatic compressibility, and isobaric thermal expansivity) of the mixtures studied were calculated from the experimental densities and speed of sounds. The excess molar volume data were correlated using the Redlich–Kister equation. Both the positive and S-shaped excess molar volume curves were found for the systems studied. The excess molar volumes versus concentration of binary systems differed in the shape and temperature dependence. The experimental binary data were compared with literature data. The experimental excess molar volumes were analyzed by means of the Extended Real Associated Solution (ERAS) model. The experimental data and the ERAS model can help to estimate real behaviour of the systems studied

Clostridial Binary Toxins: Iota and C2 Family Portraits

Science.gov (United States)

Stiles, Bradley G.; Wigelsworth, Darran J.; Popoff, Michel R.; Barth, Holger

2011-01-01

There are many pathogenic Clostridium species with diverse virulence factors that include protein toxins. Some of these bacteria, such as C. botulinum, C. difficile, C. perfringens, and C. spiroforme, cause enteric problems in animals as well as humans. These often fatal diseases can partly be attributed to binary protein toxins that follow a classic AB paradigm. Within a targeted cell, all clostridial binary toxins destroy filamentous actin via mono-ADP-ribosylation of globular actin by the A component. However, much less is known about B component binding to cell-surface receptors. These toxins share sequence homology amongst themselves and with those produced by another Gram-positive, spore-forming bacterium also commonly associated with soil and disease: Bacillus anthracis. This review focuses upon the iota and C2 families of clostridial binary toxins and includes: (1) basics of the bacterial source; (2) toxin biochemistry; (3) sophisticated cellular uptake machinery; and (4) host–cell responses following toxin-mediated disruption of the cytoskeleton. In summary, these protein toxins aid diverse enteric species within the genus Clostridium. PMID:22919577

Recent achievements in the Hamiltonian treatment of the dynamics and motion of compact binaries in general relativity

International Nuclear Information System (INIS)

Schäfer, Gerhard

2014-01-01

The current knowledge in the post-Newtonian (PN) dynamics and motion of non-spinning and spinning compact binaries will be presented based on the Arnowitt-Deser-Misner Hamiltonian approach to general relativity. The presentation will cover the binary dynamics with non-spinning components up to the 4PN order and for spinning binaries up to the next-to-next-to-leading order in the spin-orbit and spin-spin couplings. Radiation reaction will be treated for both non-spinning and spinning binaries. Explicit analytic expressions for the motion will be given, innermost stable circular orbits will be discussed

Binary and ternary systems

International Nuclear Information System (INIS)

Petrov, D.A.

1986-01-01

Conditions for thermodynamical equilibrium in binary and ternary systems are considered. Main types of binary and ternary system phase diagrams are sequently constructed on the basis of general regularities on the character of transition from one equilibria to others. New statements on equilibrium line direction in the diagram triple points and their isothermal cross sections are developed. New represenations on equilibria in case of monovariant curve minimum and maximum on three-phase equilibrium formation in ternary system are introduced

Planet formation in Binaries

OpenAIRE

Thebault, Ph.; Haghighipour, N.

2014-01-01

Spurred by the discovery of numerous exoplanets in multiple systems, binaries have become in recent years one of the main topics in planet formation research. Numerous studies have investigated to what extent the presence of a stellar companion can affect the planet formation process. Such studies have implications that can reach beyond the sole context of binaries, as they allow to test certain aspects of the planet formation scenario by submitting them to extreme environments. We review her...

Non-negative Matrix Factorization for Binary Data

DEFF Research Database (Denmark)

Larsen, Jacob Søgaard; Clemmensen, Line Katrine Harder

We propose the Logistic Non-negative Matrix Factorization for decomposition of binary data. Binary data are frequently generated in e.g. text analysis, sensory data, market basket data etc. A common method for analysing non-negative data is the Non-negative Matrix Factorization, though...... this is in theory not appropriate for binary data, and thus we propose a novel Non-negative Matrix Factorization based on the logistic link function. Furthermore we generalize the method to handle missing data. The formulation of the method is compared to a previously proposed method (Tome et al., 2015). We compare...... the performance of the Logistic Non-negative Matrix Factorization to Least Squares Non-negative Matrix Factorization and Kullback-Leibler (KL) Non-negative Matrix Factorization on sets of binary data: a synthetic dataset, a set of student comments on their professors collected in a binary term-document matrix...

Binary and Millisecond Pulsars.

Science.gov (United States)

Lorimer, Duncan R

2008-01-01

We review the main properties, demographics and applications of binary and millisecond radio pulsars. Our knowledge of these exciting objects has greatly increased in recent years, mainly due to successful surveys which have brought the known pulsar population to over 1800. There are now 83 binary and millisecond pulsars associated with the disk of our Galaxy, and a further 140 pulsars in 26 of the Galactic globular clusters. Recent highlights include the discovery of the young relativistic binary system PSR J1906+0746, a rejuvination in globular cluster pulsar research including growing numbers of pulsars with masses in excess of 1.5 M ⊙ , a precise measurement of relativistic spin precession in the double pulsar system and a Galactic millisecond pulsar in an eccentric ( e = 0.44) orbit around an unevolved companion. Supplementary material is available for this article at 10.12942/lrr-2008-8.

Mixing process of a binary gas in a density stratified layer

Energy Technology Data Exchange (ETDEWEB)

Takeda, Tetsuaki [Japan Atomic Energy Research Inst., Oarai, Ibaraki (Japan). Oarai Research Establishment

1997-09-01

This study is to investigate the effect of natural convection on the mixing process by molecular diffusion in a vertical stratified layer of a binary fluid. There are many experimental and analytical studies on natural convection in the vertical fluid layer. However, there are few studies on natural convection with molecular diffusion in the vertical stratified layer of a binary gas. Experimental study has been performed on the combined phenomena of molecular diffusion and natural convection in a binary gas system to investigate the mixing process of the binary gas in a vertical slot consisting of one side heated and the other side cooled. The range of Rayleigh number based on the slot width was about 0 < Ra{sub d} < 7.5 x 10{sup 4}. The density change of the gas mixture and the temperature distribution in the slot was obtained and the mixing process when the heavier gas ingress into the vertical slot filled with the lighter gas from the bottom side of the slot was discussed. The experimental results showed that the mixing process due to molecular diffusion was affected significantly by the natural convection induced by the slightly temperature difference between both vertical walls even if a density difference by the binary gas is larger than that by the temperature difference. (author). 81 refs.

Flip-flopping binary black holes.

Science.gov (United States)

Lousto, Carlos O; Healy, James

2015-04-10

We study binary spinning black holes to display the long term individual spin dynamics. We perform a full numerical simulation starting at an initial proper separation of d≈25M between equal mass holes and evolve them down to merger for nearly 48 orbits, 3 precession cycles, and half of a flip-flop cycle. The simulation lasts for t=20 000M and displays a total change in the orientation of the spin of one of the black holes from an initial alignment with the orbital angular momentum to a complete antialignment after half of a flip-flop cycle. We compare this evolution with an integration of the 3.5 post-Newtonian equations of motion and spin evolution to show that this process continuously flip flops the spin during the lifetime of the binary until merger. We also provide lower order analytic expressions for the maximum flip-flop angle and frequency. We discuss the effects this dynamics may have on spin growth in accreting binaries and on the observational consequences for galactic and supermassive binary black holes.

X-ray observations of the colliding wind binary WR 25

Science.gov (United States)

Arora, Bharti; Pandey, Jeewan Chandra

2018-04-01

Using the archival data obtained from Chandra and Suzaku spanning over '8 years, we present an analysis of a WN6h+O4f Wolf-Rayet binary, WR 25. The X-ray light curves folded over a period of '208 d in the 0.3 - 10.0 keV energy band showed phase-locked variability where the count rates were found to be maximum near the periastron passage. The X-ray spectra of WR 25 were well explained by a two-temperature plasma model with temperatures of 0.64 ± 0.01 and 2.96 ± 0.05 keV and are consistent with previous results. The orbital phase dependent local hydrogen column density was found to be maximum just after the periastron passage, when the WN type star is in front of the O star. The hard (2.0 - 10.0 keV) X-ray luminosity was linearly dependent on the inverse of binary separation which confirms that WR 25 is a colliding wind binary.

UBVRc Ic ANALYSIS OF THE RECENTLY DISCOVERED TOTALLY ECLIPSING EXTREME MASS RATIO BINARY V1853 ORIONIS, AND A STATISTICAL LOOK AT 25 OTHER EXTREME MASS RATIO SOLAR-TYPE CONTACT BINARIES

International Nuclear Information System (INIS)

Samec, R. G.; Labadorf, C. M.; Hawkins, N. C.; Faulkner, D. R.; Van Hamme, W.

2011-01-01

We present precision CCD light curves, a period study, photometrically derived standard magnitudes, and a five-color simultaneous Wilson code solution of the totally eclipsing, yet shallow amplitude (A v ∼ 0.4 mag) eclipsing, binary V1853 Orionis. It is determined to be an extreme mass ratio, q = 0.20, W-type W UMa overcontact binary. From our standard star observations, we find that the variable is a late-type F spectral-type dwarf, with a secondary component of about 0.24 solar masses (stellar type M5V). Its long eclipse duration (41 minutes) as compared to its period, 0.383 days, attests to the small relative size of the secondary. Furthermore, it has reached a Roche lobe fill-out of ∼50% of its outer critical lobe as it approaches its final stages of binary star evolution, that of a fast spinning single star. Finally, a summary of about 25 extreme mass ratio solar-type binaries is given.

WHITE-LIGHT FLARES ON CLOSE BINARIES OBSERVED WITH KEPLER

International Nuclear Information System (INIS)

Gao, Qing; Xin, Yu; Liu, Ji-Feng; Zhang, Xiao-Bin; Gao, Shuang

2016-01-01

Based on Kepler data, we present the results of a search for white light flares on 1049 close binaries. We identify 234 flare binaries, of which 6818 flares are detected. We compare the flare-binary fraction in different binary morphologies (“detachedness”). The result shows that the fractions in over-contact and ellipsoidal binaries are approximately 10%–20% lower than those in detached and semi-detached systems. We calculate the binary flare activity level (AL) of all the flare binaries, and discuss its variations along the orbital period ( P orb ) and rotation period ( P rot , calculated for only detached binaries). We find that the AL increases with decreasing P orb or P rot , up to the critical values at P orb ∼ 3 days or P rot ∼ 1.5 days, and thereafter the AL starts decreasing no matter how fast the stars rotate. We examine the flaring rate as a function of orbital phase in two eclipsing binaries on which a large number of flares are detected. It appears that there is no correlation between flaring rate and orbital phase in these two binaries. In contrast, when we examine the function with 203 flares on 20 non-eclipse ellipsoidal binaries, bimodal distribution of amplitude-weighted flare numbers shows up at orbital phases 0.25 and 0.75. Such variation could be larger than what is expected from the cross section modification.

Spectrophotometric determination of rare earths in binary mixtures

International Nuclear Information System (INIS)

Krasnova, A.V.; Shvarev, V.S.

1978-01-01

The possibility was investigated of using the reaction with brompyrogallol red (BPR) (dibrompyrogallosulfophthalein) for analyzing binary mixtures of rare earth metals close in ordinal numbers (La-Y, La-Eu, La-Sm, La-Nd, Nd-Y, Nd-Eu). Heavy REM are masked by nitrile-acetic acid (NAA). The experimental design method was used to determine optimum conditions. The optimizing parameters were the optical density measured with respect to water and the amount of the component bound into the complex. It was found that optimum conditions for the analysis of investigated mixtures differ only in the amount of NAA necessary to mask the heavy element [NAA]/[Sm 3+ ]=4; [NAA]/[Eu 3+ ]=5; [NAA]/Nb 3+ ]=10; [NAA]/[Y 3+ ]=2.5. The optimum acidity and the amount of BPR are always the same: pH 6.5; [BPR]/[La 3+ ]=[BPR]/[Nd 3+ ]=4. The given method for analyzing binary mixtures of lanthanoids surpasses considerably in sensitivity the methods based on intrinsic absorption spectra, while retaining the same reproducibility

Rotational properties of the binary and non-binary populations in the Trans-Neptunian belt

Science.gov (United States)

Thirouin, Audrey; Noll, Keith S.; Ortiz Moreno, Jose Luis; Morales , Nicolas

2014-11-01

An exhaustive study about short-term variability as well as derived properties from lightcurves allowed us to draw some conclusions for the Trans-Neptunian belt binary population. Based on Maxwellian fit distributions of the spin rate, we suggested that the binary population rotates slower than the non-binary one. This slowing-down can be attributed to tidal effects between the satellite and the primary, as expected. We showed that no system in this work is tidally locked, but the primary despinning process may have already affected the primary rate (as well as the satellite rotational rate). We used the Gladman et al. (1996) formula to compute the time required to tidally lock the systems, but this formula is based on several assumptions and approximations that do not always hold. The computed times are reasonable in most cases and confirm that none of the systems is tidally locked, assuming that the satellite densities are low and have a high rigidity or have a higher dissipation than usually assumed. The rotational properties of small bodies provide information about important physical properties, such as shape, density, and cohesion (Pravec & Harris 2000; Holsapple 2001, 2004; Thirouin et al. 2010, 2012). For binaries it is also possible to derive several physical parameters of the system components, such as diameters of the primary/secondary and albedo under some assumptions. We compare our results as well as our technique for deriving this information from the lightcurve with other methods, such as: i) thermal or thermophysical modeling, ii) from the mutual orbit of the binary component, iii) from direct imaging or iv) from stellar occultation by Trans-Neptunian Objects (TNOs). Finally, by studying the specific angular momentum of the sample, we proposed possible formation models for several binary TNOs. In several cases, we obtained hints of the formation mechanism from the angular momentum, but for other cases we do not have enough information about the

Herschel OBSERVATIONS OF DUST AROUND THE HIGH-MASS X-RAY BINARY GX 301-2

Energy Technology Data Exchange (ETDEWEB)

Servillat, M. [Laboratoire Univers et Théories (CNRS/INSU, Observatoire de Paris, Université Paris Diderot), 5 place Jules Janssen, F-92190 Meudon (France); Coleiro, A.; Chaty, S. [Laboratoire AIM (CEA/Irfu/SAp, CNRS/INSU, Universit Paris Diderot), CEA Saclay, Bat. 709, F-91191 Gif-sur-Yvette (France); Rahoui, F. [Harvard University, Department of Astronomy, 60 Garden Street, Cambridge, MA 02138 (United States); Zurita Heras, J. A., E-mail: mathieu.servillat@obspm.fr [AstroParticule et Cosmologie (Université Paris Diderot, CNRS/IN2P3, CEA/DSM, Observatoire de Paris, Sorbonne Paris Cité), 10 rue Alice Domon et Léonie Duquet, F-75205 Paris Cedex 13 (France)

2014-12-20

We aim at characterizing the structure of the gas and dust around the high-mass X-ray binary GX 301-2, a highly obscured X-ray binary hosting a hypergiant (HG) star and a neutron star, in order to better constrain its evolution. We used Herschel PACS to observe GX 301-2 in the far infrared and completed the spectral energy distribution of the source using published data or catalogs from the optical to the radio range (0.4 to 4 × 10{sup 4} μm). GX 301-2 is detected for the first time at 70 and 100 μm. We fitted different models of circumstellar (CS) environments to the data. All tested models are statistically acceptable, and consistent with an HG star at ∼3 kpc. We found that the addition of a free-free emission component from the strong stellar wind is required and could dominate the far-infrared flux. Through comparisons with similar systems and discussion on the estimated model parameters, we favor a disk-like CS environment of ∼8 AU that would enshroud the binary system. The temperature goes down to ∼200 K at the edge of the disk, allowing for dust formation. This disk is probably a rimmed viscous disk with an inner rim at the temperature of the dust sublimation temperature (∼1500 K). The similarities between the HG GX 301-2, B[e] supergiants, and the highly obscured X-ray binaries (particularly IGR J16318-4848) are strengthened. GX 301-2 might represent a transition stage in the evolution of massive stars in binary systems, connecting supergiant B[e] systems to luminous blue variables.

Texture classification by texton: statistical versus binary.

Directory of Open Access Journals (Sweden)

Zhenhua Guo

Full Text Available Using statistical textons for texture classification has shown great success recently. The maximal response 8 (Statistical_MR8, image patch (Statistical_Joint and locally invariant fractal (Statistical_Fractal are typical statistical texton algorithms and state-of-the-art texture classification methods. However, there are two limitations when using these methods. First, it needs a training stage to build a texton library, thus the recognition accuracy will be highly depended on the training samples; second, during feature extraction, local feature is assigned to a texton by searching for the nearest texton in the whole library, which is time consuming when the library size is big and the dimension of feature is high. To address the above two issues, in this paper, three binary texton counterpart methods were proposed, Binary_MR8, Binary_Joint, and Binary_Fractal. These methods do not require any training step but encode local feature into binary representation directly. The experimental results on the CUReT, UIUC and KTH-TIPS databases show that binary texton could get sound results with fast feature extraction, especially when the image size is not big and the quality of image is not poor.

Absolute Dimensions of Contact Binary Stars in Baade Window

Directory of Open Access Journals (Sweden)

Young Woon Kang

1999-12-01

Full Text Available The light curves of the representative 6 contact binary stars observed by OGLE Project of searching for dark matter in our Galaxy have been analyzed by the method of the Wilson and Devinney Differential Correction to find photometric solutions. The orbital inclinations of these binaries are in the range of 52 deg - 69 deg which is lower than that of the solar neighborhood binaries. The Roche lobe filling factor of these binaries are distributed in large range of 0.12 - 0.90. Since absence of spectroscopic observations for these binaries we have found masses of the 6 binary systems based on the intersection between Kepler locus and locus derived from Vandenberg isochrones in the mass - luminosity plane. Then absolute dimensions and distances have been found by combining the masses and the photometric solutions. The distances of the 6 binary systems are distributed in the range of 1 kpc - 6 kpc. This distance range is the limiting range where the contact binaries which have period shorter than a day are visible. Most contact binaries discovered in the Baade window do not belong to the Galactic bulge.

Orbital motion in pre-main sequence binaries

Energy Technology Data Exchange (ETDEWEB)

Schaefer, G. H. [The CHARA Array of Georgia State University, Mount Wilson Observatory, Mount Wilson, CA 91023 (United States); Prato, L. [Lowell Observatory, 1400 West Mars Hill Road, Flagstaff, AZ 86001 (United States); Simon, M. [Department of Physics and Astronomy, Stony Brook University, Stony Brook, NY 11794 (United States); Patience, J., E-mail: schaefer@chara-array.org [Astrophysics Group, School of Physics, University of Exeter, Exeter, EX4 4QL (United Kingdom)

2014-06-01

We present results from our ongoing program to map the visual orbits of pre-main sequence (PMS) binaries in the Taurus star forming region using adaptive optics imaging at the Keck Observatory. We combine our results with measurements reported in the literature to analyze the orbital motion for each binary. We present preliminary orbits for DF Tau, T Tau S, ZZ Tau, and the Pleiades binary HBC 351. Seven additional binaries show curvature in their relative motion. Currently, we can place lower limits on the orbital periods for these systems; full solutions will be possible with more orbital coverage. Five other binaries show motion that is indistinguishable from linear motion. We suspect that these systems are bound and might show curvature with additional measurements in the future. The observations reported herein lay critical groundwork toward the goal of measuring precise masses for low-mass PMS stars.

The Binary Dwarf Carbon Star SDSS J125017.90+252427.6

Science.gov (United States)

Margon, Bruce; Kupfer, Thomas; Burdge, Kevin; Prince, Thomas A.; Kulkarni, Shrinivas R.; Shupe, David L.

2018-03-01

Although dwarf carbon (dC) stars are universally thought to be binaries in order to explain the presence of C 2 in their spectra while still near main-sequence luminosity, direct observational evidence for their binarity is remarkably scarce. Here, we report the detection of a 2.92 day periodicity in both the photometry and radial velocity of SDSS J125017.90+252427.6, an r = 16.4 dC star. This is the first photometric binary dC, and only the second dC spectroscopic binary. The relative phase of the photometric period to the spectroscopic observations suggests that the photometric variations are a reflection effect due to heating from an unseen companion. The observed radial velocity amplitude of the dC component (K = 98.8 ± 10.7 km s‑1) is consistent with a white dwarf companion, presumably the evolved star that earlier donated the carbon to the dC, although substantial orbital evolution must have occurred. Large synoptic photometric surveys such as the Palomar Transient Factory, which was used for this work, may prove useful for identifying binaries among the shorter-period dC stars.

Comparative study of binary and ternary complexes of some rare earths

International Nuclear Information System (INIS)

Makhijani, S.D.; Sangal, S.P.

1978-01-01

Modified form of Irving and Rossotti's pH titration technique has been used to evaluate and compare the stability constants of the binary and ternary complexes of Sc(III), Y(III), La(III), Pr(III), Nd(III) and Sm(III) at 30 0 at an ionic strength of 0.2M NaClO 4 . For the study of ternary complexes, nitrilotriacetic acid has been used as a primary ligand and polyhydroxy phenols i.e. pyrocatechol (PYC), pyrogallol (PYG) and gallic acid (GA) as secondary ligands. The stability constants of the binary complexes were found to be more than those of the corresponding ternary complexes which can reasonably be explained on the basis of electrostatic force between primary complex (metal in the case of binary complex) and secondary ligand, and space available to accommodate the secondary ligand. The stability decreases with the increase in ionic radii, i.e. Sc(III)>Y(III)>Sm(III)>Nd(III)>Pr(III)>La(III). In terms of secondary ligand, it follows the order PYC>GA>PYG. Rare earths form only 1:1 binary complex, and 1:1:1 mixed ligand complex in all the cases. (author)

Binary catalogue of exoplanets

Science.gov (United States)

Schwarz, Richard; Bazso, Akos; Zechner, Renate; Funk, Barbara

2016-02-01

Since 1995 there is a database which list most of the known exoplanets (The Extrasolar Planets Encyclopaedia at http://exoplanet.eu/). With the growing number of detected exoplanets in binary and multiple star systems it became more important to mark and to separate them into a new database, which is not available in the Extrasolar Planets Encyclopaedia. Therefore we established an online database (which can be found at: http://www.univie.ac.at/adg/schwarz/multiple.html) for all known exoplanets in binary star systems and in addition for multiple star systems, which will be updated regularly and linked to the Extrasolar Planets Encyclopaedia. The binary catalogue of exoplanets is available online as data file and can be used for statistical purposes. Our database is divided into two parts: the data of the stars and the planets, given in a separate list. We describe also the different parameters of the exoplanetary systems and present some applications.

A photometric analysis of the neglected EW-type binary V336 TrA

Science.gov (United States)

Kriwattanawong, W.; Sarotsakulchai, T.; Maungkorn, S.; Reichart, D. E.; Haislip, J. B.; Kouprianov, V. V.; LaCluyze, A. P.; Moore, J. P.

2018-05-01

This study presents an analysis of photometric light curves and absolute parameters for the EW-type binary V336 TrA. VRI imaging observations were taken in 2013 by using the robotic telescopes PROMPT 4 and PROMPT 5 at Cerro Tololo Inter-American Observatory (CTIO), Chile. The observed light curves were fitted by using the Wilson-Devinney method. The results showed that V336 TrA is a W-type contact binary with a mass ratio of q = 1.396. The binary is a weak contact system with a fill-out factor of f = 15.69%. The system contains components with masses of 0.653 M⊙ and 0.912 M⊙ for the hotter and the cooler, respectively. The location of the secondary (less massive) component on the log M - log L diagram was found to be near the TAMS. The component has evolved to be oversize and overluminous. The orbital angular momentum of the binary was found to be log Jo = 51.61 cgs, less than all detached systems for same mass. The system has undergone angular momentum and/or mass loss, during the binary evolution from the detached to contact system.

BHDD: Primordial black hole binaries code

Science.gov (United States)

Kavanagh, Bradley J.; Gaggero, Daniele; Bertone, Gianfranco

2018-06-01

BHDD (BlackHolesDarkDress) simulates primordial black hole (PBH) binaries that are clothed in dark matter (DM) halos. The software uses N-body simulations and analytical estimates to follow the evolution of PBH binaries formed in the early Universe.

Tidal and magnetic interactions in close binary stars

International Nuclear Information System (INIS)

Campbell, C.G.

1983-03-01

The thesis investigates the nature of non-synchronous motions in members of close binary stars under the influence of gravitational and magnetic fields existing in these systems, and the evolution of such motions in different classes of binaries. Largely convective stars are considered and a solution is found for the fluid flow associated with the non-synchronous rotation of such a secondary in a close binary system, taking tidal and rotational forces into account. The tidal velocity field is calculated for a low mass white dwarf secondary star in a twin - degenerate binary. It is found that the synchronisation times can be comparable to the lifetime of the binary so that some asynchronism may remain present. (U.K.)

Planetary Formation and Dynamics in Binary Systems

Science.gov (United States)

Xie, J. W.

2013-01-01

dissipating gas disk, all the planetesimals eventually converge toward the same forced orbits regardless of their size, leading to the much lower impact velocities. This process progressively increases the net mass accretion and can even trigger the runaway growth for large planetesimals. In chapter 3, for the first time, we adopt a 3-dimensional approach to investigate the planetesimals' mutual accretion in binary systems. We find that the inclusion of a small inclination between the binary orbital plane and the circumstellar disk plane leads to the realization of the differential orbital phasing in 3-dimensional space. In such a case, impacts mainly occur between similar-sized bodies with the impact velocities being significantly reduced, and thus the planetesimal accretion is more favored. In chapter 4, we investigate the planet formation in a specific system, the habitable zone of Alpha Centauri B. For the first time, we develop a scaling method to estimate the planetesimal collisional timescale in binary systems. We find that the accretion-favorable conditions satisfied at 1˜2 AU from Alpha Centauri B after the first 10^5 years. However, the planetesimal accretion is significantly less efficient as compared to the single star case. Our results suggest that the formation of Earth-like planets through the accretion of km-sized planetesimals is possible in Alpha Centauri B, while the formation of gaseous giant planets is not favorable. In chapter 5, we outline a new concept, which we call the ``snowball'' growth mode. In this snowball phase, the isolated planetesimals move in the Keplerian orbits, and grow solely via the direct accretion of subcentimeter-sized dust entrained with the gas in the protoplanetary disk. Using a simplified model in which the planetesimals are progressively produced from the dust, we find that the snowball growth phase can be the dominant mode to transfer mass from the dust to planetesimals. The snowball growth mode could provide an alternative

Dynamical Formation and Merger of Binary Black Holes

Science.gov (United States)

Stone, Nicholas

2017-01-01

The advent of gravitational wave (GW) astronomy began with Advanced LIGO's 2015 discovery of GWs from coalescing black hole (BH) binaries. GW astronomy holds great promise for testing general relativity, but also for investigating open astrophysical questions not amenable to traditional electromagnetic observations. One such question concerns the origin of stellar mass BH binaries in the universe: do these form primarily from evolution of isolated binaries of massive stars, or do they form through more exotic dynamical channels? The best studied dynamical formation channel involves multibody interactions of BHs and stars in dense globular cluster environments, but many other dynamical scenarios have recently been proposed, ranging from the Kozai effect in hierarchical triple systems to BH binary formation in the outskirts of Toomre-unstable accretion disks surrounding supermassive black holes. The BH binaries formed through these processes will have different distributions of observable parameters (e.g. mass ratios, spins) than BH binaries formed through the evolution of isolated binary stars. In my talk I will overview these and other dynamical formation scenarios, and summarize the key observational tests that will enable Advanced LIGO or other future detectors to determine what formation pathway creates the majority of binary BHs in the universe. NCS thanks NASA, which has funded his work through Einstein postdoctoral grant PF5-160145.

Black Hole/Pulsar Binaries in the Galaxy

Science.gov (United States)

Shao, Yong; Li, Xiang-Dong

2018-04-01

We have performed population synthesis calculation on the formation of binaries containing a black hole (BH) and a neutron star (NS) in the Galactic disk. Some of important input parameters, especially for the treatment of common envelope evolution, are updated in the calculation. We have discussed the uncertainties from the star formation rate of the Galaxy and the velocity distribution of NS kicks on the birthrate (˜ 0.6-13 Myr^{-1}) of BH/NS binaries. From incident BH/NS binaries, by modelling the orbital evolution duo to gravitational wave radiation and the NS evolution as radio pulsars, we obtain the distributions of the observable parameters such as the orbital period, eccentricity and pulse period of the BH/pulsar binaries. We estimate that there may be ˜3 - 80 BH/pulsar binaries in the Galactic disk and around 10% of them could be detected by the Five-hundred-meter Aperture Spherical radio Telescope.

Investigating Dark Energy with Black Hole Binaries

International Nuclear Information System (INIS)

Mersini-Houghton, Laura; Kelleher, Adam

2009-01-01

The accelerated expansion of the universe is ascribed to the existence of dark energy. Black holes accrete dark energy. The accretion induces a mass change proportional to the energy density and pressure of the background dark energy fluid. The time scale during which the mass of black holes changes considerably is long relative to the age of the universe, thus beyond detection possibilities. We propose to take advantage of the modified black hole masses for exploring the equation of state w[z] of dark energy, by investigating the evolution of supermassive black hole binaries on a dark energy background. Deriving the signatures of dark energy accretion on the evolution of binaries, we find that dark energy imprints on the emitted gravitational radiation and on the changes in the orbital radius of the binary can be within detection limits for certain supermassive black hole binaries. This talk describes how binaries can provide a useful tool in obtaining complementary information on the nature of dark energy.

Black hole/pulsar binaries in the Galaxy

Science.gov (United States)

Shao, Yong; Li, Xiang-Dong

2018-06-01

We have performed population synthesis calculation on the formation of binaries containing a black hole (BH) and a neutron star (NS) in the Galactic disc. Some of important input parameters, especially for the treatment of common envelope evolution, are updated in the calculation. We have discussed the uncertainties from the star formation rate of the Galaxy and the velocity distribution of NS kicks on the birthrate (˜ 0.6-13 M yr^{-1}) of BH/NS binaries. From incident BH/NS binaries, by modelling the orbital evolution due to gravitational wave radiation and the NS evolution as radio pulsars, we obtain the distributions of the observable parameters such as the orbital period, eccentricity, and pulse period of the BH/pulsar binaries. We estimate that there may be ˜3-80 BH/pulsar binaries in the Galactic disc and around 10 per cent of them could be detected by the Five-hundred-metre Aperture Spherical radio Telescope.

Star formation history: Modeling of visual binaries

Science.gov (United States)

Gebrehiwot, Y. M.; Tessema, S. B.; Malkov, O. Yu.; Kovaleva, D. A.; Sytov, A. Yu.; Tutukov, A. V.

2018-05-01

Most stars form in binary or multiple systems. Their evolution is defined by masses of components, orbital separation and eccentricity. In order to understand star formation and evolutionary processes, it is vital to find distributions of physical parameters of binaries. We have carried out Monte Carlo simulations in which we simulate different pairing scenarios: random pairing, primary-constrained pairing, split-core pairing, and total and primary pairing in order to get distributions of binaries over physical parameters at birth. Next, for comparison with observations, we account for stellar evolution and selection effects. Brightness, radius, temperature, and other parameters of components are assigned or calculated according to approximate relations for stars in different evolutionary stages (main-sequence stars, red giants, white dwarfs, relativistic objects). Evolutionary stage is defined as a function of system age and component masses. We compare our results with the observed IMF, binarity rate, and binary mass-ratio distributions for field visual binaries to find initial distributions and pairing scenarios that produce observed distributions.

Inferring Binary and Trinary Stellar Populations in Photometric and Astrometric Surveys

Science.gov (United States)

Widmark, Axel; Leistedt, Boris; Hogg, David W.

2018-04-01

Multiple stellar systems are ubiquitous in the Milky Way but are often unresolved and seen as single objects in spectroscopic, photometric, and astrometric surveys. However, modeling them is essential for developing a full understanding of large surveys such as Gaia and connecting them to stellar and Galactic models. In this paper, we address this problem by jointly fitting the Gaia and Two Micron All Sky Survey photometric and astrometric data using a data-driven Bayesian hierarchical model that includes populations of binary and trinary systems. This allows us to classify observations into singles, binaries, and trinaries, in a robust and efficient manner, without resorting to external models. We are able to identify multiple systems and, in some cases, make strong predictions for the properties of their unresolved stars. We will be able to compare such predictions with Gaia Data Release 4, which will contain astrometric identification and analysis of binary systems.

Irradiation creep in simple binary alloys

International Nuclear Information System (INIS)

Nagakawa, J.; Sethi, V.K.; Turner, A.P.L.

1981-07-01

Creep enhancement during 21-MeV deuteron irradiation was examined at 350 0 C for two simple binary alloys with representative microstructures, i.e., solid-solution (Ni - 4 at. % Si) and precipitation-hardened (Ni - 12.8 at. % Al) alloys. Coherent precipitates were found to be very effective in suppressing irradiation-enhanced creep. Si solute atoms depressed irradiation creep moderately and caused irradiation hardening via radiation-induced segregation. The stress-dependence of irradiation creep in Ni - 4 at. % Si should a transition, which seems to reflect a change of mechanism from dislocation climb due to stress-induced preferential absorption (SIPA) to climb-controlled dislocation glide enhanced by irradiation

THE ELM SURVEY. V. MERGING MASSIVE WHITE DWARF BINARIES

International Nuclear Information System (INIS)

Brown, Warren R.; Kenyon, Scott J.; Kilic, Mukremin; Gianninas, A.; Allende Prieto, Carlos

2013-01-01

We present the discovery of 17 low-mass white dwarfs (WDs) in short-period (P ≤ 1 day) binaries. Our sample includes four objects with remarkable log g ≅ 5 surface gravities and orbital solutions that require them to be double degenerate binaries. All of the lowest surface gravity WDs have metal lines in their spectra implying long gravitational settling times or ongoing accretion. Notably, six of the WDs in our sample have binary merger times 0.9 M ☉ companions. If the companions are massive WDs, these four binaries will evolve into stable mass transfer AM CVn systems and possibly explode as underluminous supernovae. If the companions are neutron stars, then these may be millisecond pulsar binaries. These discoveries increase the number of detached, double degenerate binaries in the ELM Survey to 54; 31 of these binaries will merge within a Hubble time.

THE ELM SURVEY. V. MERGING MASSIVE WHITE DWARF BINARIES

Energy Technology Data Exchange (ETDEWEB)

Brown, Warren R.; Kenyon, Scott J. [Smithsonian Astrophysical Observatory, 60 Garden St, Cambridge, MA 02138 (United States); Kilic, Mukremin; Gianninas, A. [Homer L. Dodge Department of Physics and Astronomy, University of Oklahoma, 440 W. Brooks St., Norman, OK, 73019 (United States); Allende Prieto, Carlos, E-mail: wbrown@cfa.harvard.edu, E-mail: skenyon@cfa.harvard.edu, E-mail: kilic@ou.edu, E-mail: alexg@nhn.ou.edu, E-mail: callende@iac.es [Instituto de Astrofisica de Canarias, E-38205, La Laguna, Tenerife (Spain)

2013-05-20

We present the discovery of 17 low-mass white dwarfs (WDs) in short-period (P {<=} 1 day) binaries. Our sample includes four objects with remarkable log g {approx_equal} 5 surface gravities and orbital solutions that require them to be double degenerate binaries. All of the lowest surface gravity WDs have metal lines in their spectra implying long gravitational settling times or ongoing accretion. Notably, six of the WDs in our sample have binary merger times <10 Gyr. Four have {approx}>0.9 M{sub Sun} companions. If the companions are massive WDs, these four binaries will evolve into stable mass transfer AM CVn systems and possibly explode as underluminous supernovae. If the companions are neutron stars, then these may be millisecond pulsar binaries. These discoveries increase the number of detached, double degenerate binaries in the ELM Survey to 54; 31 of these binaries will merge within a Hubble time.

Supernova explosions in close binary systems. Pt. 2

International Nuclear Information System (INIS)

Sutantyo, W.

1975-01-01

The effects of a spherically symmetric explosion on the runaway velocity of a close binary system with an initial circular orbit is considered. It is shown that the runaway velocity is completely determined by the final orbital parameters regardless of the initial condition. The galactic z distribution of the known massive X-ray binaries indicates that the runaway velocities of these systems are very probably smaller than approximately 100 km/s with the most likely values of approximately 25-50 km/s. Such runaway velocities can be obtained if the post-explosion eccentricities are less than approximately 0.25. This then has the concequence that the mass of the exploded star which produced the neutron stars in the massive X-ray binaries can in most cases not have been larger than approximately 7-8 M(S) with the most likely values of approximately 3-4 M(S) if the supergiants in these systems have mass (M 2 ) of approximately 20 M(S). For Cyg X-1, the upper mass limit of the exploded star is found to be approximately 16 M(S). For M 2 = 30 M(S) these upper limit becomes approximately 9-10 M(S) and 19 M(S) respectively. (orig.) [de

Eliciting Subjective Probabilities with Binary Lotteries

DEFF Research Database (Denmark)

Harrison, Glenn W.; Martínez-Correa, Jimmy; Swarthout, J. Todd

objective probabilities. Drawing a sample from the same subject population, we find evidence that the binary lottery procedure induces linear utility in a subjective probability elicitation task using the Quadratic Scoring Rule. We also show that the binary lottery procedure can induce direct revelation...

A Comparative Study of the Compaction Properties of Binary and ...

African Journals Online (AJOL)

Halder et al. Trop J Pharm Res, August 2012;11 (4): 585 ... No significant difference was observed between the tensile strength of binary and ... porosity, particle size, particle shape, etc [5-. 9]. ... °C until they were dried properly and constant ...

Variance in binary stellar population synthesis

Science.gov (United States)

Breivik, Katelyn; Larson, Shane L.

2016-03-01

In the years preceding LISA, Milky Way compact binary population simulations can be used to inform the science capabilities of the mission. Galactic population simulation efforts generally focus on high fidelity models that require extensive computational power to produce a single simulated population for each model. Each simulated population represents an incomplete sample of the functions governing compact binary evolution, thus introducing variance from one simulation to another. We present a rapid Monte Carlo population simulation technique that can simulate thousands of populations in less than a week, thus allowing a full exploration of the variance associated with a binary stellar evolution model.

Viscosity of binary mixtures of 1-ethyl-3-methylimidazolium tetrafluoroborate ionic liquid with four organic solvents

International Nuclear Information System (INIS)

Ciocirlan, Oana; Croitoru, Oana; Iulian, Olga

2016-01-01

Highlights: • Viscosities of four binary mixtures of [Emim][BF4] with organic solvents. • Viscosity models based on Eyring’s theory. • Excess functions calculated. • Data for binaries new in the literature, except for system with DMSO. - Abstract: This paper reports experimental values of dynamic viscosity for four binary systems of 1-ethyl-3-methylimidazolium tetrafluoroborate, [Emim][BF4], with dimethyl sulfoxide (DMSO), acetonitrile (ACN), ethylene glycol (EG) and 1,4-dioxane over the temperature ranges from 293.15 K to 353.15 K at p = 0.1 MPa. All binary mixtures were completely miscible over the entire range of mole fraction, except the system with 1,4-dioxane. The viscosity results have been correlated by the one parameter Grunberg–Nissan and Fang and He equations and the two-parameter McAllister, Eyring-UNIQUAC, Eyring-NRTL and Eyring-Wilson models and the results were compared. Additionally, the viscosity deviations, Δη, and the excess Gibbs energy of activation for viscous flow, G"∗"E, were calculated and fitted to the Redlich–Kister equation. The results show that all Δη values are negative over the whole composition range and the G"∗"E values are positive, except for the system with EG. The results of the excess functions are discussed in terms of molecular interactions.

STABILITY OF BINARY COMPLEXES OF L-ASPARTIC ACID IN ...

African Journals Online (AJOL)

Preferred Customer

KEY WORDS: Binary complexes, Stability constants, Aspartic acid, Speciation, Dioxan. INTRODUCTION. 1,4-Dioxan (Dox) is ... It is miscible with water, oils, and most organic solvents, including aromatic .... of mineral acid in metal ion and ligand solutions was determined using the Gran plot method. [28, 29]. To assess the ...

WIYN Open Cluster Study: Binary Orbits and Tidal Circularization in NGC 6819

Science.gov (United States)

Morscher, Meagan B.; Mathieu, R. D.; Kaeppler, S.; Hole, K. T.; Meibom, S.

2006-12-01

We are conducting a comprehensive stellar radial-velocity survey in NGC 6819, a rich, intermediate age ( 2.4 Gyr) open cluster with [Fe/H] -0.05. As of October 2006, we have obtained 7065 radial-velocity measurements of 1409 stars using the WIYN Hydra Multi-Object Spectrograph, with typical velocity measurement precisions of 0.4 km/s. Using an E/I criterion of 3, we have identified 282 velocity variables. In the past year we have expanded the number of final orbital solutions by 45 to a total of more than 80 solutions. In coeval stellar populations, circular binaries tend to have the shortest orbital periods, while longer period binaries show a distribution of non-zero eccentricities. The circularization of the shortest period orbits is the result of an exchange of stellar and orbital angular momentum due to tidal interactions. We defined a population’s tidal circularization period as the longest orbital period at which a binary of typical initial eccentricity has become circularized (e.g., has evolved to an eccentricity e = 0.01) over the lifetime of the cluster (Meibom & Mathieu, 2005, ApJ, 620, 970). We are studying the trend of increasing tidal circularization periods with population age. Preliminary results in NGC 6819 indicate a tidal circularization period of 7.5 days, which is consistent with this overall trend. We will recalculate the tidal circularization period in order to include the latest sample of orbital solutions. This comprehensive survey also allows us to investigate the relative spatial distributions of spectroscopic binaries and other constant-velocity cluster members of similar mass. We find the spectroscopic binaries to be more centrally concentrated at a statistically significant level, which we attribute to energy equipartition processes. MM was supported by REU NSF grant AST-0453442. RDM, SK, KTH, and SM were supported by NSF grant AST-0406615.

On the accuracy of Hipparcos using binary stars as a calibration tool

Energy Technology Data Exchange (ETDEWEB)

Docobo, J. A.; Andrade, M., E-mail: joseangel.docobo@usc.es, E-mail: manuel.andrade@usc.es [R. M. Aller Astronomical Observatory, University of Santiago de Compostela (USC), Santiago de Compostela E-15782, Galiza, P.O. Box 197 (Spain)

2015-02-01

Stellar binary systems, specifically those that present the most accurate available orbital elements, are a reliable tool to test the accuracy of astrometric observations. We selected all 35 binaries with these characteristics. Our objective is to provide standard uncertainties for the positions and parallaxes measured by Hipparcos relative to this trustworthy set, as well as to check supposed correlations between several parameters (measurement residuals, positions, magnitudes, and parallaxes). In addition, using the high-confidence subset of visual–spectroscopic binaries, we implemented a validation test of the Hipparcos trigonometric parallaxes of binary systems that allowed the evaluation of their reliability. Standard and non-standard statistical analysis techniques were applied in order to achieve well-founded conclusions. In particular, errors-in-variables models such as the total least-squares method were used to validate Hipparcos parallaxes by comparison with those obtained directly from the orbital elements. Previously, we executed Thompson's τ technique in order to detect suspected outliers in the data. Furthermore, several statistical hypothesis tests were carried out to verify if our results were statistically significant. A statistically significant trend indicating larger Hipparcos angular separations with respect to the reference values in 5.2 ± 1.4 mas was found at the 10{sup −8} significance level. Uncertainties in the polar coordinates θ and ρ of 1.°8 and 6.3 mas, respectively, were estimated for the Hipparcos observations of binary systems. We also verified that the parallaxes of binary systems measured in this mission are absolutely compatible with the set of orbital parallaxes obtained from the most accurate orbits at least at the 95% confidence level. This methodology allows us to better estimate the accuracy of Hipparcos observations of binary systems. Indeed, further application to the data collected by Gaia should yield a

Mesoporous binary metal oxide nanocomposites: Synthesis, characterization and decontamination of sulfur mustard

Energy Technology Data Exchange (ETDEWEB)

Praveen Kumar, J., E-mail: praveenjella10@gmail.com; Prasad, G.K.; Ramacharyulu, P.V.R.K.; Singh, Beer; Gopi, T.; Krishna, R.

2016-04-15

Mesoporous MnO{sub 2}–ZnO, Fe{sub 2}O{sub 3}–ZnO, NiO–ZnO, and CeO{sub 2}–ZnO binary metal oxide nanocomposites were studied as sorbent decontaminants against sulfur mustard. They were synthesized by precipitation pyrolysis method and characterized by means of transmission electron microscopy, scanning electron microscopy coupled with energy dispersive analysis of X rays, X ray diffraction, and nitrogen adsorption techniques. The transmission electron microscopy and nitrogen adsorption data indicated the presence of pores with diameter ranging from 10 to 70 nm in the binary metal oxide nanocomposites and these materials exhibited surface area values in the range of 76–134 m{sup 2}/g. These binary metal oxide nanocomposites demonstrated large decontamination efficiencies against sulfur mustard when compared to their single component metal oxide nanoparticles. The binary metal oxide nanocomposites effectively decontaminated sulfur mustard into relatively non toxic products such as chloro ethyl vinyl sulfide, divinyl sulfide, 1,4-oxathiane, etc. The promising decontamination properties of binary metal oxide nanocomposites against sulfur mustard were attributed to the basic sites, Lewis acid sites, and the presence of these sites was confirmed by CO{sub 2} and NH{sub 3} temperature programmed desorption. - Graphical abstract: Mesoporous MnO{sub 2}–ZnO, Fe{sub 2}O{sub 3}–ZnO, NiO–ZnO, and CeO{sub 2}–ZnO binary metal oxide nanocomposites were studied as sorbent decontaminants against sulfur mustard. - Highlights: • Binary metal oxide nanocomposites were synthesized by co-precipitation method. • They were studied as sorbent decontaminants against sulfur mustard. • They decontaminated sulfur mustard into non toxic products. • MnO{sub 2}–ZnO and CeO{sub 2}–ZnO nanocomposites showed greater decontamination efficiency.

"Binary" and "non-binary" detection tasks: are current performance measures optimal?

Science.gov (United States)

Gur, David; Rockette, Howard E; Bandos, Andriy I

2007-07-01

We have observed that a very large fraction of responses for several detection tasks during the performance of observer studies are in the extreme ranges of lower than 11% or higher than 89% regardless of the actual presence or absence of the abnormality in question or its subjectively rated "subtleness." This observation raises questions regarding the validity and appropriateness of using multicategory rating scales for such detection tasks. Monte Carlo simulation of binary and multicategory ratings for these tasks demonstrate that the use of the former (binary) often results in a less biased and more precise summary index and hence may lead to a higher statistical power for determining differences between modalities.

Short gamma-ray bursts and gravitational-wave observations from eccentric compact binaries

Science.gov (United States)

Tan, Wei-Wei; Fan, Xi-Long; Wang, F. Y.

2018-03-01

Mergers of compact binaries, such as binary neutron stars (BNSs), neutron star-black hole binaries (NSBHs) and binary black holes (BBHs), are expected to be the best candidates for sources of gravitational waves (GWs) and the leading theoretical models for short gamma-ray bursts (SGRBs). Based on observations of SGRBs, we can derive the merger rates of these compact binaries and study stochastic GW backgrounds (SGWBs) or the co-detection rates of GWs associated with SGRBs (GW-SGRBs). Before that, however, the most important thing is to derive the GW spectrum from a single GW source. Usually, a GW spectrum from a circular-orbit binary is assumed. However, observations of the large spatial offsets of SGRBs from their host galaxies imply that SGRB progenitors may be formed by dynamical processes and will merge with residual eccentricities (er). The orbital eccentricity has an important effect on GW spectra and therefore on the SGWB and GW-SGRB co-detection rate. Our results show that the power spectra of SGWBs from eccentric compact binaries are greatly suppressed at low frequencies (e.g. f ≲ 1 Hz). In particular, SGWBs from binaries with high residual eccentricities (e.g. er ≳ 0.1 for BNSs) will be hard to detect (above the detection frequency of ˜ 100 Hz). Regarding the co-detection rates of GW-SGRB events, they could be ˜1.4 times higher than the circular case within some particular ranges of er (e.g. 0.01 ≲ er ≲ 0.1 for BBHs), but greatly reduced for high residual eccentricities (e.g. er > 0.1 for BNSs). In general, BBH progenitors produce 200 and 10 times higher GW-SGRB events than BNS and NSBH progenitors, respectively. Therefore, binaries with low residual eccentricities (e.g. 0.001 ≲ er ≲ 0.1) and high total masses will be easier to detect by Advanced LIGO (aLIGO). However, only a small fraction of BBHs can be SGRB progenitors (if they can produce SGRBs), because the predicted GW-SGRB event rate (60˜100 per year) is too high compared with recent

Thirty New Low-mass Spectroscopic Binaries

Science.gov (United States)

Shkolnik, Evgenya L.; Hebb, Leslie; Liu, Michael C.; Reid, I. Neill; Collier Cameron, Andrew

2010-06-01

As part of our search for young M dwarfs within 25 pc, we acquired high-resolution spectra of 185 low-mass stars compiled by the NStars project that have strong X-ray emission. By cross-correlating these spectra with radial velocity standard stars, we are sensitive to finding multi-lined spectroscopic binaries. We find a low-mass spectroscopic binary fraction of 16% consisting of 27 SB2s, 2 SB3s, and 1 SB4, increasing the number of known low-mass spectroscopic binaries (SBs) by 50% and proving that strong X-ray emission is an extremely efficient way to find M-dwarf SBs. WASP photometry of 23 of these systems revealed two low-mass eclipsing binaries (EBs), bringing the count of known M-dwarf EBs to 15. BD-22 5866, the ESB4, was fully described in 2008 by Shkolnik et al. and CCDM J04404+3127 B consists of two mid-M stars orbiting each other every 2.048 days. WASP also provided rotation periods for 12 systems, and in the cases where the synchronization time scales are short, we used P rot to determine the true orbital parameters. For those with no P rot, we used differential radial velocities to set upper limits on orbital periods and semimajor axes. More than half of our sample has near-equal-mass components (q > 0.8). This is expected since our sample is biased toward tight orbits where saturated X-ray emission is due to tidal spin-up rather than stellar youth. Increasing the samples of M-dwarf SBs and EBs is extremely valuable in setting constraints on current theories of stellar multiplicity and evolution scenarios for low-mass multiple systems. Based on observations collected at the W. M. Keck Observatory, the Canada-France-Hawaii Telescope and by the WASP Consortium. The Keck Observatory is operated as a scientific partnership between the California Institute of Technology, the University of California, and NASA, and was made possible by the generous financial support of the W. M. Keck Foundation. The CFHT is operated by the National Research Council of Canada

PLANETESIMAL ACCRETION IN BINARY SYSTEMS: ROLE OF THE COMPANION'S ORBITAL INCLINATION

International Nuclear Information System (INIS)

Xie Jiwei; Zhou Jilin

2009-01-01

Recent observations show that planets can reside in close binary systems with stellar separation of only ∼20 AU. However, planet formation in such close binary systems is a challenge to current theory. One of the major theoretical problems occurs in the intermediate stage-planetesimals accretion into planetary embryos-during which the companion's perturbations can stir up the relative velocities (utriV) of planetesimals and thus slow down or even cease their growth. Recent studies have shown that conditions could be even worse for accretion if the gas-disk evolution was included. However, all previous studies assumed a two-dimensional disk and a coplanar binary orbit. Extending previous studies by including a three-dimensional gas disk and an inclined binary orbit with small relative inclination of i B = 0. 0 1-5 0 , we numerically investigate the conditions for planetesimal accretion at 1-2 AU, an extension of the habitable zone (∼1-1.3 AU), around α Centauri A in this paper. Inclusion of the binary inclination leads to the following: (1) differential orbital phasing is realized in the three-dimensional space, and thus different-sized bodies are separated from each other, (2) total impact rate is lower, and impacts mainly occur between similar-sized bodies, (3) accretion is more favored, but the balance between accretion and erosion remains uncertain, and the 'possible accretion region' extends up to 2 AU when assuming an optimistic Q* (critical specific energy that leads to catastrophic fragmentation), and (4) impact velocities (utriV) are significantly reduced but still much larger than their escape velocities, which infers that planetesimals grow by means of type II runaway mode. As a conclusion, the inclusion of a small binary inclination is a promising mechanism that favors accretion, opening a possibility that planet formation in close binary systems can go through the difficult stage of planetesimals accretion into planetary embryos.

78 FR 62676 - Anthony E. Wicks, M.D. Decision and Order

Science.gov (United States)

2013-10-22

... registration BW7987184, while listing his address as Pain Management of Winter Springs, 165 W. SR 434, Winter... practice address. Id. at 2, ] 5. \\2\\ Documentary evidence, which the Government acquired through... prescriptions for oxycodone,\\4\\ diazepam, and lorazepam.\\5\\ GX 15, at 2, ] 7; GX 13. \\3\\ The documentary...

Electrodeposition and Thermoelectric Properties of Cu-Se Binary Compound Films

Science.gov (United States)

Yang, Mengqian; Shen, Zhengwu; Liu, Xiaoqing; Wang, Wei

2016-03-01

Cu-Se binary compound films have been prepared by electrodeposition from solutions containing CuSO4, H2SeO3, and H2SO4 and their composition, structure, and thermoelectric performance analyzed. Moving the depositing potential negatively increased the Cu content in the film, remarkably so for relatively low Cu2+ concentration in the solution. X-ray diffraction analysis showed that the phase composition of the films varied with their Cu content. Cu-Se binary compound films electrodeposited from solutions with different concentration ratios of CuSO4 to H2SeO3 showed two different phases: α-Cu2- x Se (monoclinic) with Se content in the range of 33.3 at.% to 33.8 at.%, and β-Cu2Se (cubic) with Se content in the range of 35.3 at.% to 36.0 at.%. The highest power factor for electrodeposited Cu2- x Se film was 0.13 mW/(K2 m) with Seebeck coefficient of 56.0 μV/K.

Synthesis of binary bismuth-cadmium oxide nanorods with sensitive electrochemical sensing performance

International Nuclear Information System (INIS)

Wen, Yong; Pei, Lizhai; Wei, Tian

2017-01-01

Binary bismuth-cadmium oxide nanorods have been synthesized by a simple hydrothermal process without templates and additives. X-ray diffraction and high-resolution transmission electron microscopy reveal that the nanorods possess single crystalline tetragonal Bi 2 CdO 4 phase. Scanning electron microscopy and transmission electron microscopy images show that the length and diameter of the nanorods are 20-300 nm and 5-10 μm, respectively. The formation of the binary bismuth-cadmium oxide nanorods is closely related to the hydrothermal parameters. The electrochemical sensing performance of the binary bismuth-cadmium oxide nanorods has been investigated using the nanorods as glassy carbon electrode modifiers. The detection limit is 0.19 μM with a linear range of 0.0005-2 mM. The nanorod-modified glassy carbon electrode exhibits good electrocatalytic activity toward L-cysteine and great application potential for electrochemical sensors.

MARVELS Radial Velocity Solutions to Seven Kepler Eclipsing Binaries

Science.gov (United States)

Heslar, Michael Francis; Thomas, Neil B.; Ge, Jian; Ma, Bo; Herczeg, Alec; Reyes, Alan; SDSS-III MARVELS Team

2016-01-01

Eclipsing binaries serve momentous purposes to improve the basis of understanding aspects of stellar astrophysics, such as the accurate calculation of the physical parameters of stars and the enigmatic mass-radius relationship of M and K dwarfs. We report the investigation results of 7 eclipsing binary candidates, initially identified by the Kepler mission, overlapped with the radial velocity observations from the SDSS-III Multi-Object APO Radial-Velocity Exoplanet Large-Area Survey (MARVELS). The RV extractions and spectroscopic solutions of these eclipsing binaries were generated by the University of Florida's 1D data pipeline with a median RV precision of ~60-100 m/s, which was utilized for the DR12 data release. We performed the cross-reference fitting of the MARVELS RV data and the Kepler photometric fluxes obtained from the Kepler Eclipsing Binary Catalog (V2) and modelled the 7 eclipsing binaries in the BinaryMaker3 and PHOEBE programs. This analysis accurately determined the absolute physical and orbital parameters of each binary. Most of the companion stars were determined to have masses of K and M dwarf stars (0.3-0.8 M⊙), and allowed for an investigation into the mass-radius relationship of M and K dwarfs. Among the cases are KIC 9163796, a 122.2 day period "heartbeat star", a recently-discovered class of eccentric binaries known for tidal distortions and pulsations, with a high eccentricity (e~0.75) and KIC 11244501, a 0.29 day period, contact binary with a double-lined spectrum and mass ratio (q~0.45). We also report on the possible reclassification of 2 Kepler eclipsing binary candidates as background eclipsing binaries based on the analysis of the flux measurements, flux ratios of the spectroscopic and photometric solutions, the differences in the FOVs, the image processing of Kepler, and RV and spectral analysis of MARVELS.

Compact stars and the evolution of binary systems

NARCIS (Netherlands)

van den Heuvel, E.P.J.

2011-01-01

The Chandrasekhar limit is of key importance for the evolution of white dwarfs in binary systems and for the formation of neutron stars and black holes in binaries. Mass transfer can drive a white dwarf in a binary over the Chandrasekhar limit, which may lead to a Type Ia supernova (in case of a CO

WHITE-DWARF-MAIN-SEQUENCE BINARIES IDENTIFIED FROM THE LAMOST PILOT SURVEY

International Nuclear Information System (INIS)

Ren Juanjuan; Luo Ali; Li Yinbi; Wei Peng; Zhao Jingkun; Zhao Yongheng; Song Yihan; Zhao Gang

2013-01-01

We present a set of white-dwarf-main-sequence (WDMS) binaries identified spectroscopically from the Large sky Area Multi-Object fiber Spectroscopic Telescope (LAMOST, also called the Guo Shou Jing Telescope) pilot survey. We develop a color selection criteria based on what is so far the largest and most complete Sloan Digital Sky Survey (SDSS) DR7 WDMS binary catalog and identify 28 WDMS binaries within the LAMOST pilot survey. The primaries in our binary sample are mostly DA white dwarfs except for one DB white dwarf. We derive the stellar atmospheric parameters, masses, and radii for the two components of 10 of our binaries. We also provide cooling ages for the white dwarf primaries as well as the spectral types for the companion stars of these 10 WDMS binaries. These binaries tend to contain hot white dwarfs and early-type companions. Through cross-identification, we note that nine binaries in our sample have been published in the SDSS DR7 WDMS binary catalog. Nineteen spectroscopic WDMS binaries identified by the LAMOST pilot survey are new. Using the 3σ radial velocity variation as a criterion, we find two post-common-envelope binary candidates from our WDMS binary sample

THE ELM SURVEY. II. TWELVE BINARY WHITE DWARF MERGER SYSTEMS

International Nuclear Information System (INIS)

Kilic, Mukremin; Brown, Warren R.; Kenyon, S. J.; Prieto, Carlos Allende; Agueeros, M. A.; Heinke, Craig

2011-01-01

We describe new radial velocity and X-ray observations of extremely low-mass white dwarfs (ELM WDs, ∼0.2 M sun ) in the Sloan Digital Sky Survey Data Release 4 and the MMT Hypervelocity Star survey. We identify four new short period binaries, including two merger systems. These observations bring the total number of short period binary systems identified in our survey to 20. No main-sequence or neutron star companions are visible in the available optical photometry, radio, and X-ray data. Thus, the companions are most likely WDs. Twelve of these systems will merge within a Hubble time due to gravitational wave radiation. We have now tripled the number of known merging WD systems. We discuss the characteristics of this merger sample and potential links to underluminous supernovae, extreme helium stars, AM CVn systems, and other merger products. We provide new observational tests of the WD mass-period distribution and cooling models for ELM WDs. We also find evidence for a new formation channel for single low-mass WDs through binary mergers of two lower mass objects.

THE ROLE OF ZAKAH AND BINARY ECONOMICS IN POVERTY REDUCTION

Directory of Open Access Journals (Sweden)

Muniaty Aisyah

2015-09-01

Full Text Available Poverty reduction remains the most important challenge for every countries. Zakah, as an Islamic faith-based institution, is a strategic tool for combating poverty.  This study aims to identify the role of zakah and compare its principles with an overview of the characteristics and practices within binary economics which also provides a systemic solution for poverty. The study shows that zakah has an essential role to  the economic growth and poverty reduction in Muslim community, as well as, binary economics which also offers a way of enhanching everyone’s economic well-being and fundamentally different from all forms of conventional economics.DOI: 10.15408/ess.v4i1.1964

A NuSTAR Observation of the Reflection Spectrum of the Low-Mass X-Ray Binary 4U 1728-34

Science.gov (United States)

Sleator, Clio C.; Tomsick, John A.; King, Ashley L.; Miller, Jon M.; Boggs, Steven E.; Bachetti, Matteo; Barret, Didier; Chenevez, Jerome; Christensen, Finn E.; Craig, William W.;

Maximum mass ratio of AM CVn-type binary systems and maximum white dwarf mass in ultra-compact X-ray binaries

Directory of Open Access Journals (Sweden)

Arbutina Bojan

2011-01-01

Full Text Available AM CVn-type stars and ultra-compact X-ray binaries are extremely interesting semi-detached close binary systems in which the Roche lobe filling component is a white dwarf transferring mass to another white dwarf, neutron star or a black hole. Earlier theoretical considerations show that there is a maximum mass ratio of AM CVn-type binary systems (qmax ≈ 2/3 below which the mass transfer is stable. In this paper we derive slightly different value for qmax and more interestingly, by applying the same procedure, we find the maximum expected white dwarf mass in ultra-compact X-ray binaries.

A potentiometric study of molecular heteroconjugation equilibria in (n-butylamine+acetic acid) systems in binary (acetonitrile +1,4-dioxane) solvent mixtures

International Nuclear Information System (INIS)

Czaja, Malgorzata; Makowski, Mariusz; Chmurzynski, Lech

2006-01-01

By using the potentiometric method the following quantities have been determined: acidity constants of molecular acid, K a (HA), of cationic acid, K a (BH + ), anionic and cationic homoconjugation constants, K AHA - and K BHB + , respectively, as well as molecular heteroconjugation constants, K AHB , in (n-butylamine+acetic acid) systems without proton transfer in binary (acetonitrile+1,4-dioxane), AN+D, solvent mixtures. The results of these measurements have shown that the magnitudes of the molecular heteroconjugation constants do not depend on the 1,4-dioxane content in the mixed solvent, i.e., on solvent polarity. It has also been found that in the (acid+base) systems without proton transfer, the manner of carrying out the titration (direct B+HA vs. reverse HA+B) does not affect the magnitudes of the molecular heteroconjugation constants

Complete waveform model for compact binaries on eccentric orbits

Science.gov (United States)

Huerta, E. A.; Kumar, Prayush; Agarwal, Bhanu; George, Daniel; Schive, Hsi-Yu; Pfeiffer, Harald P.; Haas, Roland; Ren, Wei; Chu, Tony; Boyle, Michael; Hemberger, Daniel A.; Kidder, Lawrence E.; Scheel, Mark A.; Szilagyi, Bela

2017-01-01

We present a time domain waveform model that describes the inspiral, merger and ringdown of compact binary systems whose components are nonspinning, and which evolve on orbits with low to moderate eccentricity. The inspiral evolution is described using third-order post-Newtonian equations both for the equations of motion of the binary, and its far-zone radiation field. This latter component also includes instantaneous, tails and tails-of-tails contributions, and a contribution due to nonlinear memory. This framework reduces to the post-Newtonian approximant TaylorT4 at third post-Newtonian order in the zero-eccentricity limit. To improve phase accuracy, we also incorporate higher-order post-Newtonian corrections for the energy flux of quasicircular binaries and gravitational self-force corrections to the binding energy of compact binaries. This enhanced prescription for the inspiral evolution is combined with a fully analytical prescription for the merger-ringdown evolution constructed using a catalog of numerical relativity simulations. We show that this inspiral-merger-ringdown waveform model reproduces the effective-one-body model of Ref. [Y. Pan et al., Phys. Rev. D 89, 061501 (2014)., 10.1103/PhysRevD.89.061501] for quasicircular black hole binaries with mass ratios between 1 to 15 in the zero-eccentricity limit over a wide range of the parameter space under consideration. Using a set of eccentric numerical relativity simulations, not used during calibration, we show that our new eccentric model reproduces the true features of eccentric compact binary coalescence throughout merger. We use this model to show that the gravitational-wave transients GW150914 and GW151226 can be effectively recovered with template banks of quasicircular, spin-aligned waveforms if the eccentricity e0 of these systems when they enter the aLIGO band at a gravitational-wave frequency of 14 Hz satisfies e0GW 150914≤0.15 and e0GW 151226≤0.1 . We also find that varying the spin

Study of complex formation process between 4′-nitrobenzo-18-crown-6 and yttrium(III cation in some binary mixed non-aqueous solvents using the conductometry method

Directory of Open Access Journals (Sweden)

Mahboobeh Vafi

2017-07-01

Full Text Available The complexation reaction between Y3+ cation and macrocyclic ligand, 4′-nitrobenzo-18-crown-6 (4′NB18C6, was studied in acetonitrile–methanol (AN–MeOH, acetonitrile–1,2-dichloroethane (AN–DCE, acetonitrile–dimethylformamide (AN–DMF and acetonitrile–ethylacetate (AN–EtOAc binary mixed solvent solutions at different temperatures using the conductometric method. The conductance data show that in most cases, the stoichiometry of the complex formed between 4′NB18C6 and Y3+ cation is 1:1 [M:L], but in the case of AN-DCE binary solution (mol% DCE = 50 at 15, 25 and 35 °C, a 2:1 [M2:L] and also a 2:2 [M2:L2] complexes are formed in solution. The results show that the stoichiometry of the complex formed between 4′NB18C6 and Y3+ cation changes with the composition of the mixed solvents and even with temperature. The stability constant of the 1:1 complex was determined using a computer program, GENPLOT. The stability order of (4′NB18C6.Y3+ complex in pure studied solvents at 25 °C was found to be: EtOAc > AN > MeOH > DMF and in the case of the mixed solvent solutions with 25 mol percent of AN at 25 °C was: AN-DCE > AN-EtOAc > AN-MeOH ∼ AN-DMF. The values of stability constant (logKf of (4′NB18C6.Y3+ complex which were obtained from conductometric data, show that the stability of the complex is not only affected by the nature and composition of the solvent system, but it is also influenced by the temperature. In all cases, a non-linear behavior is observed for changes of logKf of the (4′NB18C6.Y3+ complex versus the composition of the binary mixed solvents. The values of standard thermodynamic quantities (ΔH°c and ΔS°c for the complexation process which were obtained from temperature dependence of the stability constant of (4′NB18C6.Y3+ complex, show that depending on the solvent system, in most cases, the complex is enthalpy and also entropy stabilized, but in some cases, it is stabilized or

Non-binary or genderqueer genders.

Science.gov (United States)

Richards, Christina; Bouman, Walter Pierre; Seal, Leighton; Barker, Meg John; Nieder, Timo O; T'Sjoen, Guy

2016-01-01

Some people have a gender which is neither male nor female and may identify as both male and female at one time, as different genders at different times, as no gender at all, or dispute the very idea of only two genders. The umbrella terms for such genders are 'genderqueer' or 'non-binary' genders. Such gender identities outside of the binary of female and male are increasingly being recognized in legal, medical and psychological systems and diagnostic classifications in line with the emerging presence and advocacy of these groups of people. Population-based studies show a small percentage--but a sizable proportion in terms of raw numbers--of people who identify as non-binary. While such genders have been extant historically and globally, they remain marginalized, and as such--while not being disorders or pathological in themselves--people with such genders remain at risk of victimization and of minority or marginalization stress as a result of discrimination. This paper therefore reviews the limited literature on this field and considers ways in which (mental) health professionals may assist the people with genderqueer and non-binary gender identities and/or expressions they may see in their practice. Treatment options and associated risks are discussed.

The Young Visual Binary Survey

Science.gov (United States)

Prato, Lisa; Avilez, Ian; Lindstrom, Kyle; Graham, Sean; Sullivan, Kendall; Biddle, Lauren; Skiff, Brian; Nofi, Larissa; Schaefer, Gail; Simon, Michal

2018-01-01

Differences in the stellar and circumstellar properties of the components of young binaries provide key information about star and disk formation and evolution processes. Because objects with separations of a few to a few hundred astronomical units share a common environment and composition, multiple systems allow us to control for some of the factors which play into star formation. We are completing analysis of a rich sample of about 100 pre-main sequence binaries and higher order multiples, primarily located in the Taurus and Ophiuchus star forming regions. This poster will highlight some of out recent, exciting results. All reduced spectra and the results of our analysis will be publicly available to the community at http://jumar.lowell.edu/BinaryStars/. Support for this research was provided in part by NSF award AST-1313399 and by NASA Keck KPDA funding.

A Survey of Binary Similarity and Distance Measures

Directory of Open Access Journals (Sweden)

Seung-Seok Choi

2010-02-01

Full Text Available The binary feature vector is one of the most common representations of patterns and measuring similarity and distance measures play a critical role in many problems such as clustering, classification, etc. Ever since Jaccard proposed a similarity measure to classify ecological species in 1901, numerous binary similarity and distance measures have been proposed in various fields. Applying appropriate measures results in more accurate data analysis. Notwithstanding, few comprehensive surveys on binary measures have been conducted. Hence we collected 76 binary similarity and distance measures used over the last century and reveal their correlations through the hierarchical clustering technique.

Structural transformations of sVI tert-butylamine hydrates to sII binary hydrates with methane.

Science.gov (United States)

Prasad, Pinnelli S R; Sugahara, Takeshi; Sloan, E Dendy; Sum, Amadeu K; Koh, Carolyn A

2009-10-22

Binary clathrate hydrates with methane (CH(4), 4.36 A) and tert-butylamine (t-BuNH(2), 6.72 A) as guest molecules were synthesized at different molar concentrations of t-BuNH(2) (1.00-9.31 mol %) with methane at 7.0 MPa and 250 K, and were characterized by powder X-ray diffraction (PXRD) and Raman microscopy. A structural transformation from sVI to sII of t-BuNH(2) hydrate was clearly observed on pressurizing with methane. The PXRD showed sII signatures and the remnant sVI signatures were insignificant, implying the metastable nature of sVI binary hydrates. Raman spectroscopic data on these binary hydrates suggest that the methane molecules occupy the small cages and vacant large cages. The methane storage capacity in this system was nearly doubled to approximately 6.86 wt % for 5.56 mol % > t-BuNH(2) > 1.0 mol %.

Search for gravitational waves from low mass compact binary coalescence in 186 days of LIGO's fifth science run

International Nuclear Information System (INIS)

Abbott, B. P.; Abbott, R.; Adhikari, R.; Anderson, S. B.; Araya, M.; Armandula, H.; Aso, Y.; Ballmer, S.; Barton, M. A.; Betzwieser, J.; Billingsley, G.; Black, E.; Blackburn, J. K.; Bork, R.; Boschi, V.; Brooks, A. F.; Cannon, K. C.; Cardenas, L.; Cepeda, C.; Chalermsongsak, T.

2009-01-01

We report on a search for gravitational waves from coalescing compact binaries, of total mass between 2 and 35M · , using LIGO observations between November 14, 2006 and May 18, 2007. No gravitational-wave signals were detected. We report upper limits on the rate of compact binary coalescence as a function of total mass. The LIGO cumulative 90%-confidence rate upper limits of the binary coalescence of neutron stars, black holes and black hole-neutron star systems are 1.4x10 -2 , 7.3x10 -4 and 3.6x10 -3 yr -1 L 10 -1 , respectively, where L 10 is 10 10 times the blue solar luminosity.

New binaries among UV-selected, hot subdwarf stars and population properties

Czech Academy of Sciences Publication Activity Database

Kawka, Adela; Vennes, Stephane; O' Toole, S.; Nemeth, P.; Burton, D.; Kotze, E.; Buckley, D.A.H.

2015-01-01

Roč. 450, č. 4 (2015), s. 3514-3548 ISSN 0035-8711 R&D Projects: GA ČR GAP209/12/0217; GA ČR GA13-14581S; GA MŠk LG14013 Institutional support: RVO:67985815 Keywords : close binaries * spectroscopic * subdwarfs Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.952, year: 2015

Phase behaviour, interactions, and structural studies of (amines+ionic liquids) binary mixtures.

Science.gov (United States)

Jacquemin, Johan; Bendová, Magdalena; Sedláková, Zuzana; Blesic, Marijana; Holbrey, John D; Mullan, Claire L; Youngs, Tristan G A; Pison, Laure; Wagner, Zdeněk; Aim, Karel; Costa Gomes, Margarida F; Hardacre, Christopher

2012-05-14

We present a study on the phase equilibrium behaviour of binary mixtures containing two 1-alkyl-3-methylimidazolium bis{(trifluoromethyl)sulfonyl}imide-based ionic liquids, [C(n)mim] [NTf(2)] (n=2 and 4), mixed with diethylamine or triethylamine as a function of temperature and composition using different experimental techniques. Based on this work, two systems showing an LCST and one system with a possible hourglass shape are measured. Their phase behaviours are then correlated and predicted by using Flory-Huggins equations and the UNIQUAC method implemented in Aspen. The potential of the COSMO-RS methodology to predict the phase equilibria was also tested for the binary systems studied. However, this methodology is unable to predict the trends obtained experimentally, limiting its use for systems involving amines in ionic liquids. The liquid-state structure of the binary mixture ([C(2)mim] [NTf(2)]+diethylamine) is also investigated by molecular dynamics simulation and neutron diffraction. Finally, the absorption of gaseous ethane by the ([C(2)mim][NTf(2)]+diethylamine) binary mixture is determined and compared with that observed in the pure solvents. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

A white dwarf companion to the main-sequence star 4 Omicron(1) Orionis and the binary hypothesis for the origin of peculiar red giants

Science.gov (United States)

Ake, Thomas B.; Johnson, Hollis R.

1988-01-01

Ultraviolet spectra of the peculiar red giants (PRGs) called MS stars are investigated, and the discovery of a white dwarf (WD) companion to the MS star 4 Omicron(1) Orionis is reported. The observations and data analysis are discussed and compared with those for field WDs in order to derive parameters for the WD and the luminosity of the primary. Detection limits for the other MS stars investigated are derived, and the binary hypothesis for PRGs is reviewed.

Binary and Millisecond Pulsars

Directory of Open Access Journals (Sweden)

Lorimer Duncan R.

2005-11-01

Full Text Available We review the main properties, demographics and applications of binary and millisecond radio pulsars. Our knowledge of these exciting objects has greatly increased in recent years, mainly due to successful surveys which have brought the known pulsar population to over 1700. There are now 80 binary and millisecond pulsars associated with the disk of our Galaxy, and a further 103 pulsars in 24 of the Galactic globular clusters. Recent highlights have been the discovery of the first ever double pulsar system and a recent flurry of discoveries in globular clusters, in particular Terzan 5.

Eclipsing binary stars with a δ Scuti component

Science.gov (United States)

Kahraman Aliçavuş, F.; Soydugan, E.; Smalley, B.; Kubát, J.

2017-09-01

Eclipsing binaries with a δ Sct component are powerful tools to derive the fundamental parameters and probe the internal structure of stars. In this study, spectral analysis of six primary δ Sct components in eclipsing binaries has been performed. Values of Teff, v sin I, and metallicity for the stars have been derived from medium-resolution spectroscopy. Additionally, a revised list of δ Sct stars in eclipsing binaries is presented. In this list, we have only given the δ Sct stars in eclipsing binaries to show the effects of the secondary components and tidal-locking on the pulsations of primary δ Sct components. The stellar pulsation, atmospheric and fundamental parameters (e.g. mass, radius) of 92 δ Sct stars in eclipsing binaries have been gathered. Comparison of the properties of single and eclipsing binary member δ Sct stars has been made. We find that single δ Sct stars pulsate in longer periods and with higher amplitudes than the primary δ Sct components in eclipsing binaries. The v sin I of δ Sct components is found to be significantly lower than that of single δ Sct stars. Relationships between the pulsation periods, amplitudes and stellar parameters in our list have been examined. Significant correlations between the pulsation periods and the orbital periods, Teff, log g, radius, mass ratio, v sin I and the filling factor have been found.

Tidal Disruption of Inclined or Eccentric Binaries by Massive Black Holes

Science.gov (United States)

Brown, Harriet; Kobayashi, Shiho; Rossi, Elena M.; Sari, Re'em

2018-04-01

Binary stars that are on close orbits around massive black holes (MBH) such as Sgr A* in the centre of the Milky Way are liable to undergo tidal disruption and eject a hypervelocity star. We study the interaction between such a MBH and circular binaries for general binary orientations and penetration depths (i.e. binaries penetrate into the tidal radius around the BH). We show that for very deep penetrators, almost all binaries are disrupted when the binary rotation axis is roughly oriented toward the BH or it is in the opposite direction. The surviving chance becomes significant when the angle between the binary rotation axis and the BH direction is between 0.15π and 0.85π. The surviving chance is as high as ˜20% when the binary rotation axis is perpendicular to the BH direction. However, for shallow penetrators, the highest disruption chance is found in such a perpendicular case, especially in the prograde case. This is because the dynamics of shallow penetrators is more sensitive to the relative orientation of the binary and orbital angular momenta. We provide numerical fits to the disruption probability and energy gain at the the BH encounter as a function of the penetration depth. The latter can be simply rescaled in terms of binary masses, their initial separation and the binary-to-BH mass ratio to evaluate the ejection velocity of a binary members in various systems. We also investigate the disruption of coplanar, eccentric binaries by a MBH. It is shown that for highly eccentric binaries retrograde orbits have a significantly increased disruption probability and ejection velocities compared to the circular binaries.

Compositional Investigation of Binary Near-Earth Asteroid 66063 (1998 RO1): A Potentially Undifferentiated Assemblage

Science.gov (United States)

Abell, P. A.; Gaffey, M. J.; Landis, R. R.; Jarvis, K. S.

2005-01-01

It is now thought that approximately 16% of all asteroids among the near-Earth population may be binary objects. Several independent lines of evidence, such as the presence of doublet craters on the Earth and Moon [1, 2], complex lightcurves of near-Earth objects exhibiting mutual events [3], and radar images of near-Earth asteroids revealing distinct primary and secondary objects, have supported this conclusion [4]. To date at least 23 near-Earth objects have been discovered as binary systems with expectations that many more have yet to be identified or recognized. Little is known about the physical characteristics of binary objects except that they seem to have fairly rapid rotation rates, generally have primaries in the approx. 1 km diameter range with smaller secondaries on the order of a few hundred meters, and apart from a few exceptions, are in synchronous orbits [4, 5]. Previously only two of these binary near-Earth asteroids (1998 ST27 and 2003 YT1) have been characterized in terms of detailed mineralogical investigations [6, 7]. Such investigations are required to fully understand the formation mechanisms of these binary objects and their possible source regions. In addition, detailed knowledge of these objects may play an important role for planning future spacecraft missions and for the development of impact mitigation strategies. The work presented here represents a continued effort to characterize this particular sub-group of the near- Earth asteroid population.

Evolution of binaries with compact objects in globular clusters

OpenAIRE

Ivanova, Natalia

2017-01-01

Dynamical interactions that take place between objects in dense stellar systems lead to frequent formation of exotic stellar objects, unusual binaries, and systems of higher multiplicity. They are most important for the formation of binaries with neutron stars and black holes, which are usually observationally revealed in mass-transferring binaries. Here we review the current understanding of compact object's retention, of the metallicity dependence on the formation of low-mass X-ray binaries...

Non-Binary Protograph-Based LDPC Codes: Analysis,Enumerators and Designs

OpenAIRE

Sun, Yizeng

2013-01-01

Non-binary LDPC codes can outperform binary LDPC codes using sum-product algorithm with higher computation complexity. Non-binary LDPC codes based on protographs have the advantage of simple hardware architecture. In the first part of this thesis, we will use EXIT chart analysis to compute the thresholds of different protographs over GF(q). Based on threshold computation, some non-binary protograph-based LDPC codes are designed and their frame error rates are compared with binary LDPC codes. ...

Armenian Expedition of Emperor Constantius II in 338/339 A.D. and Military Units of Thracian Expeditionary Army at the Near East: on the Late Roman Military Organization in the Mid-4th Century

Directory of Open Access Journals (Sweden)

10.15688/jvolsu4.2017.5.26

2017-11-01

Full Text Available The present paper deals with the history of military corps, which Roman emperor Constantius II sent to Great Armenia in 338/339 A.D. for to fight with the Persians. The main evidence on Constantius II’s Persian expedition are preserved in the works of prominent Armenian historians, that are Moses Khorenatsi and Pawstos Buzand. Constantius II held this campaign in order to free Armenia from the Persians and to bring back its state freedom. According to Moses Khorenatsi and Pawstos Buzand, Constantius II sent in Armenia bodyguards, who were representatives of Armenian noble families allied to the Romans, but the Roman regular forces themselves collected in Galatia (the Asia Minor, moved in Mesopotamia and Atropatene (south of modern Azerbaijan and Iranian Azerbaijan. As the author supposes, Roman troops arrived in Armenia and took part in fight with the Persians, strictly due to Roman military help Armenian naχarars could expel the Persians from Armenia. In this connection the author poses a question – which military units arrived at the Roman Near East (in Mesopotamia from the Asia Minor and how Constantius II’s military campaign in Armenia influenced on the further development of Roman-Persian frontier and its defence system. On the ground of epigraphic data (inscriptions from Mesopotamia and Arabia author made a conclusion that in 338/339 A.D. Constantius II moved at the Near East military units which previously were parts of Thracian expeditionary army and garrisoned in Thracia, since inscriptions under discussion mention soldiers who bear Thracian names that reveal their Thracian origin.

Reconciliation with non-binary species trees.

Science.gov (United States)

Vernot, Benjamin; Stolzer, Maureen; Goldman, Aiton; Durand, Dannie

2008-10-01

Reconciliation extracts information from the topological incongruence between gene and species trees to infer duplications and losses in the history of a gene family. The inferred duplication-loss histories provide valuable information for a broad range of biological applications, including ortholog identification, estimating gene duplication times, and rooting and correcting gene trees. While reconciliation for binary trees is a tractable and well studied problem, there are no algorithms for reconciliation with non-binary species trees. Yet a striking proportion of species trees are non-binary. For example, 64% of branch points in the NCBI taxonomy have three or more children. When applied to non-binary species trees, current algorithms overestimate the number of duplications because they cannot distinguish between duplication and incomplete lineage sorting. We present the first algorithms for reconciling binary gene trees with non-binary species trees under a duplication-loss parsimony model. Our algorithms utilize an efficient mapping from gene to species trees to infer the minimum number of duplications in O(|V(G) | x (k(S) + h(S))) time, where |V(G)| is the number of nodes in the gene tree, h(S) is the height of the species tree and k(S) is the size of its largest polytomy. We present a dynamic programming algorithm which also minimizes the total number of losses. Although this algorithm is exponential in the size of the largest polytomy, it performs well in practice for polytomies with outdegree of 12 or less. We also present a heuristic which estimates the minimal number of losses in polynomial time. In empirical tests, this algorithm finds an optimal loss history 99% of the time. Our algorithms have been implemented in NOTUNG, a robust, production quality, tree-fitting program, which provides a graphical user interface for exploratory analysis and also supports automated, high-throughput analysis of large data sets.

BD -22 5866: A Low-Mass, Quadruple-lined Spectroscopic and Eclipsing Binary

Science.gov (United States)

Shkolnik, Evgenya; Liu, Michael C.; Reid, I. Neill; Hebb, Leslie; Cameron, Andrew C.; Torres, Carlos A.; Wilson, David M.

2008-08-01

We report our discovery of an extremely rare, low-mass, quadruple-lined spectroscopic binary BD -22 5866 (=NLTT 53279, integrated spectral type = M0 V), found during an ongoing search for the youngest M dwarfs in the solar neighborhood. From the cross-correlation function, we are able to measure relative flux levels, estimate the spectral types of the components, and set upper limits on the orbital periods and separations. The resulting system is hierarchical, composed of a K7 + K7 binary and an M1 + M2 binary with semimajor axes of aAsin iA system was unresolved with published adaptive optics imaging, limits the projected physical separation of the two binaries at the time of the observation to dABlesssim 4.1 AU at the photometric distance of 51 pc. The maximum observed radial velocity difference between the A and B binaries limits the orbit to aABsin iAB systems, we speculate that an early dynamical process reduced the size of the system, such as the interaction of the two binaries with a circumquadruple disk. Intensive photometric, spectroscopic, and interferometric monitoring, as well as a parallax measurement of this rare quadruple system, is certainly warranted. Based on observations collected at the W. M. Keck Observatory and the Canada-France-Hawaii Telescope (CFHT). The Keck Observatory is operated as a scientific partnership between the California Institute of Technology, the University of California, and NASA, and was made possible by the generous financial support of the W. M. Keck Foundation. The CFHT is operated by the National Research Council of Canada, the Centre National de la Recherche Scientifique of France, and the University of Hawaii.

NONLINEAR TIDES IN CLOSE BINARY SYSTEMS

International Nuclear Information System (INIS)

Weinberg, Nevin N.; Arras, Phil; Quataert, Eliot; Burkart, Josh

2012-01-01

We study the excitation and damping of tides in close binary systems, accounting for the leading-order nonlinear corrections to linear tidal theory. These nonlinear corrections include two distinct physical effects: three-mode nonlinear interactions, i.e., the redistribution of energy among stellar modes of oscillation, and nonlinear excitation of stellar normal modes by the time-varying gravitational potential of the companion. This paper, the first in a series, presents the formalism for studying nonlinear tides and studies the nonlinear stability of the linear tidal flow. Although the formalism we present is applicable to binaries containing stars, planets, and/or compact objects, we focus on non-rotating solar-type stars with stellar or planetary companions. Our primary results include the following: (1) The linear tidal solution almost universally used in studies of binary evolution is unstable over much of the parameter space in which it is employed. More specifically, resonantly excited internal gravity waves in solar-type stars are nonlinearly unstable to parametric resonance for companion masses M' ∼> 10-100 M ⊕ at orbital periods P ≈ 1-10 days. The nearly static 'equilibrium' tidal distortion is, however, stable to parametric resonance except for solar binaries with P ∼ 3 [P/10 days] for a solar-type star) and drives them as a single coherent unit with growth rates that are a factor of ≈N faster than the standard three-wave parametric instability. These are local instabilities viewed through the lens of global analysis; the coherent global growth rate follows local rates in the regions where the shear is strongest. In solar-type stars, the dynamical tide is unstable to this collective version of the parametric instability for even sub-Jupiter companion masses with P ∼< a month. (4) Independent of the parametric instability, the dynamical and equilibrium tides excite a wide range of stellar p-modes and g-modes by nonlinear inhomogeneous forcing

(Pressure + volume + temperature) properties for binary oligomeric solutions of poly(ethylene glycol mono-4-octylphenyl ether) with 1-octanol or acetophenone at pressures up to 50 MPa

International Nuclear Information System (INIS)

Lee, M.-J.; Ku, T.-J.; Lin Homu

2009-01-01

Densities were measured with a high-pressure densitometer for two binary oligomeric systems of poly(ethylene glycol mono-4-octylphenyl ether) (PEGOPE) with 1-octanol or acetophenone at temperatures from 298.15 K to 348.15 K and pressures up to 50 MPa. While the excess volumes are negative in (acetophenone + PEGOPE) over the entire composition range, those are found to change from positive to negative with increasing mole fraction of the solvent in (1-octanol + PEGOPE). The pressure-effect on the liquid densities can be represented accurately by the Tait equation. Moreover, an empirical equation with two characteristic parameters correlates well the PVT data over the entire experimental conditions for each binary system. The experimental specific volumes were also correlated with the Flory-Orwoll-Vrij (FOV) and the Schotte equations of state to within the experimental uncertainty.

Synthesis of binary bismuth-cadmium oxide nanorods with sensitive electrochemical sensing performance

Energy Technology Data Exchange (ETDEWEB)

Wen, Yong [Xinjiang Univ., Xinjiang (China). School of Civil Engineering and Architecture; Pei, Lizhai; Wei, Tian [Anhui Univ. of Technology, Anhui (China). School of Materials Science and Engineering

2017-07-15

Binary bismuth-cadmium oxide nanorods have been synthesized by a simple hydrothermal process without templates and additives. X-ray diffraction and high-resolution transmission electron microscopy reveal that the nanorods possess single crystalline tetragonal Bi{sub 2}CdO{sub 4} phase. Scanning electron microscopy and transmission electron microscopy images show that the length and diameter of the nanorods are 20-300 nm and 5-10 μm, respectively. The formation of the binary bismuth-cadmium oxide nanorods is closely related to the hydrothermal parameters. The electrochemical sensing performance of the binary bismuth-cadmium oxide nanorods has been investigated using the nanorods as glassy carbon electrode modifiers. The detection limit is 0.19 μM with a linear range of 0.0005-2 mM. The nanorod-modified glassy carbon electrode exhibits good electrocatalytic activity toward L-cysteine and great application potential for electrochemical sensors.

Influence of non-binary effects on intranuclear cascade method

International Nuclear Information System (INIS)

Gomes, E.H.C.

1985-01-01

The importance of non binary process effects in the intranuclear cascade method is analysed. It is shown that, in the higher density steps, the non binary collisions lead to baryon density distribution and rapidity differents from the one obtained using the usual intranuclear cascade method (limited to purely binary collisions). The validity of the applications of binary intranuclear cascade method to the simulation of the thermal equilibrium, nuclear transparency and particle production, is discussed. (M.C.K.) [pt

Binary Cockroach Swarm Optimization for Combinatorial Optimization Problem

Directory of Open Access Journals (Sweden)

Ibidun Christiana Obagbuwa

2016-09-01

Full Text Available The Cockroach Swarm Optimization (CSO algorithm is inspired by cockroach social behavior. It is a simple and efficient meta-heuristic algorithm and has been applied to solve global optimization problems successfully. The original CSO algorithm and its variants operate mainly in continuous search space and cannot solve binary-coded optimization problems directly. Many optimization problems have their decision variables in binary. Binary Cockroach Swarm Optimization (BCSO is proposed in this paper to tackle such problems and was evaluated on the popular Traveling Salesman Problem (TSP, which is considered to be an NP-hard Combinatorial Optimization Problem (COP. A transfer function was employed to map a continuous search space CSO to binary search space. The performance of the proposed algorithm was tested firstly on benchmark functions through simulation studies and compared with the performance of existing binary particle swarm optimization and continuous space versions of CSO. The proposed BCSO was adapted to TSP and applied to a set of benchmark instances of symmetric TSP from the TSP library. The results of the proposed Binary Cockroach Swarm Optimization (BCSO algorithm on TSP were compared to other meta-heuristic algorithms.

A binary mixture operated heat pump

International Nuclear Information System (INIS)

Hihara, E.; Saito, T.

1991-01-01

This paper evaluates the performance of possible binary mixtures as working fluids in high- temperature heat pump applications. The binary mixtures, which are potential alternatives of fully halogenated hydrocarbons, include HCFC142b/HCFC22, HFC152a/HCFC22, HFC134a/HCFC22. The performance of the mixtures is estimated by a thermodynamic model and a practical model in which the heat transfer is considered in heat exchangers. One of the advantages of binary mixtures is a higher coefficient of performance, which is caused by the small temperature difference between the heat-sink/-source fluid and the refrigerant. The mixture HCFC142b/HCFC22 is promising from the stand point of thermodynamic performance

Wide- and contact-binary formation in substructured young stellar clusters

Science.gov (United States)

Dorval, J.; Boily, C. M.; Moraux, E.; Roos, O.

2017-02-01

We explore with collisional gravitational N-body models the evolution of binary stars in initially fragmented and globally subvirial clusters of stars. Binaries are inserted in the (initially) clumpy configurations so as to match the observed distributions of the field-binary-stars' semimajor axes a and binary fraction versus primary mass. The dissolution rate of wide binaries is very high at the start of the simulations, and is much reduced once the clumps are eroded by the global infall. The transition between the two regimes is sharper as the number of stars N is increased, from N = 1.5 k up to 80 k. The fraction of dissolved binary stars increases only mildly with N, from ≈15 per cent to ≈25 per cent for the same range in N. We repeated the calculation for two initial system mean number densities of 6 per pc3 (low) and 400 per pc3 (high). We found that the longer free-fall time of the low-density runs allows for prolonged binary-binary interactions inside clumps and the formation of very tight (a ≈ 0.01 au) binaries by exchange collisions. This is an indication that the statistics of such compact binaries bear a direct link to their environment at birth. We also explore the formation of wide (a ≳ 5 × 104 au) binaries and find a low (≈0.01 per cent) fraction mildly bound to the central star cluster. The high-precision astrometric mission Gaia could identify them as outflowing shells or streams.

An Efficient Binary Differential Evolution with Parameter Adaptation

Directory of Open Access Journals (Sweden)

Dongli Jia

2013-04-01

Full Text Available Differential Evolution (DE has been applied to many scientific and engineering problems for its simplicity and efficiency. However, the standard DE cannot be used in a binary search space directly. This paper proposes an adaptive binary Differential Evolution algorithm, or ABDE, that has a similar framework as the standard DE but with an improved binary mutation strategy in which the best individual participates. To further enhance the search ability, the parameters of the ABDE are slightly disturbed in an adaptive manner. Experiments have been carried out by comparing ABDE with two binary DE variants, normDE and BDE, and the most used binary search technique, GA, on a set of 13 selected benchmark functions and the classical 0-1 knapsack problem. Results show that the ABDE performs better than, or at least comparable to, the other algorithms in terms of search ability, convergence speed, and solution accuracy.

Beyond binaries : a way forward for comparativeeducation

Directory of Open Access Journals (Sweden)

Marianne Larsen

2012-09-01

Full Text Available Binary discourses shape and produce the stories we construct about the field of comparative education. In the first part of this article, I review a set of binary discourses that have characterized social science research since the Enlightenment, including: quantitative-qualitative, nomotheticidiographic, inductive-deductive, and practice-theory. We can think of each of these binaries at opposite ends of a set of spectrums. In the second section of the paper, I show some of the ways in which these binaries have influenced the ways that we write and talk about research within the field of comparative education. I refer to the notion of binary discourses and the productive capacity of these discourses to shape our field. I then outline some critiques of these binaries to demonstrate the inherent limitations of binary discourses, and why we need to move beyond binaries in our research, and in the histories about our field. Finally, I present some tentative conclusions on ways to get ourselves out of the trap of binary thinking.Los discursos binarios moldean y producen los argumentos que construimos sobre la disciplina de la Educación Comparada. En la primera parte de este artículo, analizo un conjunto de discursos binarios que han caracterizado la investigación en Ciencias Sociales desde la Ilustración, incluyendo la cuantitativa-cualitativa, nomotética-idiográfica, inductivadeductiva, y la práctica-teoría. Podemos pensar sobre cada uno de estos discursos binarios como argumentos en los polos de un conjunto de posibilidades. En la segunda sección del artículo, revelo algunos modos en los que estos discursos binarios han influenciado las formas a través de las cuales escribimos y analizamos la investigación en el ámbito de la Educación Comparada. Analizo la noción de discursos binarios y la capacidad productiva de estos discursos de impactar nuestra ciencia. Seguidamente expongo algunas críticas de estos discursos binarios con el

Characterization of the deviation of the ideality of concentrated electrolytic solutions: plutonium 4 and uranium 4 nitrate salts study; Contribution a la caracterisation de l'ecart a l'idealite des solutions concentrees d'electrolytes: application aux cas de nitrates de plutonium (4) et d'uranium (4)

Energy Technology Data Exchange (ETDEWEB)

Charrin, N

2000-07-01

The purpose of this work was to establish a new binary data base by compiling the activity coefficients of plutonium and uranium at oxidation state +IV to better account for media effects in the liquid-liquid extraction operations implemented to reprocess spent nuclear fuel. Chapter 1: first reviews the basic thermodynamic concepts before describing the issues involved in acquiring binary data for the tetravalent actinides. The difficulties arise from two characteristics of this type of electrolyte: its radioactive properties (high specific activity requiring nuclearization of the experimental instrumentation) and its physicochemical properties (strong hydrolysis). After defining the notion of fictive binary data, an approach based on the thermodynamic concept of simple solutions is described in which the activity coefficient of an aqueous phase constituent is dependent on two parameters: the water activity of the system and the total concentration of dissolved constituents. The method of acquiring fictive binary electrolyte data is based on water activity measurements for ternary or quaternary actinide mixtures in nitric acid media, and binary data for nitric acid. The experimental value is then correlated with the characteristics of the fictive binary solution of the relevant electrolyte. Chapter 2: proposes more reliable binary data for nitric acid than the published equivalents, the disparities of which are discussed. The validation of the method described in Chapter 1 for acquiring fictive binary data is then addressed. The test electrolyte, for which binary data are available in the literature, is thorium(IV) nitrate. The method is validated by comparing the published binary data obtained experimentally for binary solutions with the data determined for the ternary Th(NO{sub 3}){sub 4}/HNO{sub 3}/H{sub 2}O system investigated in this study. The very encouraging results of this comparison led us to undertake further research in this area. Chapter 3 discusses

Grammar-Based Specification and Parsing of Binary File Formats

Directory of Open Access Journals (Sweden)

William Underwood

2012-03-01

Full Text Available The capability to validate and view or play binary file formats, as well as to convert binary file formats to standard or current file formats, is critically important to the preservation of digital data and records. This paper describes the extension of context-free grammars from strings to binary files. Binary files are arrays of data types, such as long and short integers, floating-point numbers and pointers, as well as characters. The concept of an attribute grammar is extended to these context-free array grammars. This attribute grammar has been used to define a number of chunk-based and directory-based binary file formats. A parser generator has been used with some of these grammars to generate syntax checkers (recognizers for validating binary file formats. Among the potential benefits of an attribute grammar-based approach to specification and parsing of binary file formats is that attribute grammars not only support format validation, but support generation of error messages during validation of format, validation of semantic constraints, attribute value extraction (characterization, generation of viewers or players for file formats, and conversion to current or standard file formats. The significance of these results is that with these extensions to core computer science concepts, traditional parser/compiler technologies can potentially be used as a part of a general, cost effective curation strategy for binary file formats.

Antigen-specific and non-specific CD4+ T cell recruitment and proliferation during influenza infection

International Nuclear Information System (INIS)

Chapman, Timothy J.; Castrucci, Maria R.; Padrick, Ryan C.; Bradley, Linda M.; Topham, David J.

2005-01-01

To track epitope-specific CD4 + T cells at a single-cell level during influenza infection, the MHC class II-restricted OVA 323-339 epitope was engineered into the neuraminidase stalk of influenza/A/WSN, creating a surrogate viral antigen. The recombinant virus, influenza A/WSN/OVA II , replicated well, was cleared normally, and stimulated both wild-type and DO11.10 or OT-II TCR transgenic OVA-specific CD4 + T cells. OVA-specific CD4 T cells proliferated during infection only when the OVA epitope was present. However, previously primed (but not naive) transgenic CD4 + T cells were recruited to the infected lung both in the presence and absence of the OVA 323-339 epitope. These data show that, when primed, CD4 + T cells may traffic to the lung in the absence of antigen, but do not proliferate. These results also document a useful tool for the study of CD4 T cells in influenza infection

Big Bang Observer and the neutron-star-binary subtraction problem

International Nuclear Information System (INIS)

Cutler, Curt; Harms, Jan

2006-01-01

The Big Bang Observer (BBO) is a proposed space-based gravitational-wave (GW) mission designed primarily to search for an inflation-generated GW background in the frequency range ∼10 -1 Hz-1 Hz. The major astrophysical foreground in this range is gravitational radiation from inspiralling compact binaries. This foreground is expected to be much larger than the inflation-generated background, so to accomplish its main goal, BBO must be sensitive enough to identify and subtract out practically all such binaries in the observable universe. It is somewhat subtle to decide whether BBO's current baseline design is sufficiently sensitive for this task, since, at least initially, the dominant noise source impeding identification of any one binary is confusion noise from all the others (rather than instrumental noise). Here we present a self-consistent scheme for deciding whether BBO's baseline design is indeed adequate for subtracting out the binary foreground. We conclude that the current baseline should be sufficient. However, if BBO's sensitivity were degraded by a factor 2 from the current baseline, then its ability to detect an underlying primordial background would depend critically on the value of ρ th , the threshold signal-to-noise ratio marking the boundary between detectable and undetectable sources. If BBO's sensitivity were degraded by a factor 4 from the current baseline, it could not detect a primordial background below Ω GW ∼10 -15 . It is impossible to perfectly subtract out each of the binary inspiral waveforms, so an important question is how to deal with the 'residual' errors in the post-subtraction data stream. We sketch a strategy of 'projecting out' these residual errors, at the cost of some effective bandwidth. We also provide estimates of the sizes of various post-Newtonian effects in the inspiral waveforms that must be accounted for in the BBO analysis

Comments on the evolution and origin of cataclysmic binaries

International Nuclear Information System (INIS)

Whyte, C.A.; Eggleton, P.P.

1980-01-01

Aspects of the observational data on cataclysmic binaries are discussed and possible correlations between type of behaviour and binary period are noted. A gap between 2 and 3 hr in binary periods is judged to be real. A simple numerical procedure for evolving Roche-lobe-filling stars is described, and applied to white dwarf-red dwarf binaries for various mass loss and angular momentum loss mechanisms, and initial conditions. The results, in which the short-time-scale behaviour of the systems is ignored, are classified into four modes of evolution: normal, nuclear evolution dominated, angular momentum loss dominated and hydrodynamical. The clustering below 2 hr is interpreted in terms of evolution following the hydrodynamical mode, and it is suggested that both stars in such systems are of low mass. This may be the commonest type of cataclysmic binary. A possible explanation for the apparent clustering of classical novae to periods of 3 to 5 hr is given, and evolutionary schemes for cataclysmic binaries outlined. It is suggested that the short-period systems (approximately < 2 hr) arise mainly from late case B mass transfer in the original binary and the longer period systems mainly from case C. (author)

Synthesis of Binary Magnesium-Transition Metal Oxides via Inverse Coprecipitation

Science.gov (United States)

Yagi, Shunsuke; Ichikawa, Yuya; Yamada, Ikuya; Doi, Takayuki; Ichitsubo, Tetsu; Matsubara, Eiichiro

2013-02-01

Synthesis of binary magnesium-transition metal oxides, MgM2O4 (M: Cr, Mn, Fe, Co) and MgNiO2, was performed by calcination at relatively low temperatures of 500 and 750 °C for 24 h through inverse coprecipitation of carbonate hydroxide precursors. The important roles of the precipitation agent, sodium carbonate, were clarified by considering equilibria in an aqueous solution. The structure parameters of the obtained binary magnesium-transition metal oxide powders, specifically the occupancy of atomic sites, were evaluated from synchrotron X-ray diffraction (XRD) profiles by Rietveld refinement in addition to the magnetic properties at room temperature. The present work provides general guidelines for low-cost and high-volume synthesis of complex oxides, which are easily decomposed at high temperatures.

IUE spectrophotometry of the DA4 primary in the short-period white dwarf-red dwarf spectroscopic binary Case 1

Science.gov (United States)

Sion, E. M.; Guinan, E. F.; Wesemael, F.

1984-01-01

Low-resolution ultraviolet International Ultraviolet Explorer spectra of the DA white dwarf Case 1 are presented. The spectra show the presence of the 1400 A feature, already discovered in several other DA stars, and of a shallower trough in the 1550-1700 A range. A model atmosphere analysis of the ultraviolet energy distribution of the Ly-alpha red wing yields T(e) = 13,000 + or - 500 K. Possible interpretations of the 1400 A feature are reviewed. Case 1 is the coolest white dwarf found in a short-period, detached white dwarf-red dwarf binary, and its cooling time is consistent with estimates of the efficiency of angular momentum removal mechanisms in the phases subsequent to common envelope binary evolution.

A potentiometric study of molecular heteroconjugation equilibria in (n-butylamine+acetic acid) systems in binary (acetonitrile +1,4-dioxane) solvent mixtures

Energy Technology Data Exchange (ETDEWEB)

Czaja, Malgorzata [Department of General Chemistry, University of Gdansk, Sobieskiego 18, 80-952 Gdansk (Poland); Makowski, Mariusz [Department of General Chemistry, University of Gdansk, Sobieskiego 18, 80-952 Gdansk (Poland); Chmurzynski, Lech [Department of General Chemistry, University of Gdansk, Sobieskiego 18, 80-952 Gdansk (Poland)]. E-mail: lech@chem.univ.gda.pl

2006-05-15

By using the potentiometric method the following quantities have been determined: acidity constants of molecular acid, K{sub a}(HA), of cationic acid, K{sub a}(BH{sup +}), anionic and cationic homoconjugation constants, K{sub AHA{sup -}} and K{sub BHB{sup +}}, respectively, as well as molecular heteroconjugation constants, K{sub AHB}, in (n-butylamine+acetic acid) systems without proton transfer in binary (acetonitrile+1,4-dioxane), AN+D, solvent mixtures. The results of these measurements have shown that the magnitudes of the molecular heteroconjugation constants do not depend on the 1,4-dioxane content in the mixed solvent, i.e., on solvent polarity. It has also been found that in the (acid+base) systems without proton transfer, the manner of carrying out the titration (direct B+HA vs. reverse HA+B) does not affect the magnitudes of the molecular heteroconjugation constants.