WorldWideScience

Sample records for binary bx pegasi

  1. The Solar-Type Contact Binary BX Pegasi Revisited

    CERN Document Server

    Lee, Jae Woo; Lee, Chung-Uk; Youn, Jae-Hyuck

    2009-01-01

    We present the results of new CCD photometry for the contact binary BX Peg, made during three successive months beginning on September 2008. As do historical light curves, our observations display an O'Connell effect and the November data by themselves indicate clear evidence for very short-time brightness disturbance. For these variations, model spots are applied separately to the two data set of Group I (Sep.--Oct.) and Group II (Nov.). The former is described by a single cool spot on the secondary photosphere and the latter by a two-spot model with a cool spot on the cool star and a hot one on either star. These are generalized manifestations of the magnetic activity of the binary system. Twenty light-curve timings calculated from Wilson-Devinney code were used for a period study, together with all other minimum epochs. The complex period changes of BX Peg can be sorted into a secular period decrease caused dominantly by angular momentum loss due to magnetic stellar wind braking, a light-travel-time (LTT) ...

  2. Four color light curves and period changes investigation of the contact binary BX Peg

    Science.gov (United States)

    Li, Kai; Hu, Shaoming; Guo, Difu; Jiang, Yunguo; Gao, Dongyang; Chen, Xu

    2015-11-01

    We presented BVRcIc light curves of BX Peg obtained by the Weihai Observatory 1.0-m telescope of Shandong University. The W-D code was used to analyze the four color light curves, it is shown that BX Peg is a W-subtype shallow contact binary with a fill-out factor of f = 14.6 % . The asymmetric light curves were explained by a dark spot on the less massive hot component. A total of 328 times of minimum light were used to study the orbital period variation of BX Peg. We found that the orbital period of BX Peg was continuous decrease with a rate of dp / dt = - 2.07 ×10-7 d yr-1 superimposed on a cyclic oscillation with a period of 57.8 yr. The secular period decrease should be caused by the angular momentum loss via magnetic stellar wind. The cyclic modulation is very likely to be produced by the light travel time effect due to a tertiary companion.

  3. V421 Pegasi: a detached eclipsing binary with a possible γ Doradus component

    Science.gov (United States)

    Özdarcan, O.; Çakırlı, Ö.; Akan, C.

    2016-07-01

    We present spectroscopic and photometric study of V421 Peg. This eclipsing binary displays lines from both components that are well separated. This allowed us to classify the primary and secondary component as F(1 ± 0.5) V and F(2 ± 0.5) V, respectively. We use our radial velocity measurements together with Hipparcos and ASAS photometry and apply simultaneous analysis, which yields masses and radii of the primary and secondary components as M1 = 1.594 ± 0.029 M⊙, M2 = 1.356 ± 0.029 M⊙ and R1 = 1.584 ± 0.028 R⊙, R2 = 1.328 ± 0.029 R⊙, respectively. Positions of the components in HR diagram suggest that the primary component is a γ Doradus variable candidate. Spectroscopic and photometric properties of the system indicates reddening value of E(B - V) = 0m.021 which puts the system to the distance of 158 ± 4 pc.

  4. Regular Elements of the Complete Semigroups BX(D of Binary Relations of the Class ∑2(X,8

    Directory of Open Access Journals (Sweden)

    Nino Tsinaridze

    2015-03-01

    Full Text Available As we know if D is a complete X-semilattice of unions then semigroup Bx(D possesses a right unit iff D is an XI-semilattice of unions. The investigation of those a-idempotent and regular elements of semigroups Bx(D requires an investigation of XI-subsemilattices of semilattice D for which V(D,a=Q∈∑2(X,8 . Because the semilattice Q of the class ∑2(X,8 are not always XI -semilattices, there is a need of full description for those idempotent and regular elements when V(D,a=Q . For the case where X is a finite set we derive formulas by calculating the numbers of such regular elements and right units for which V(D,a=Q .

  5. A PERIOD INVESTIGATION OF THE SX PHOENICIS STAR DY PEGASI

    International Nuclear Information System (INIS)

    We measure two new times of light maximum of the SX Phoenicis star DY Pegasi in 2008 December and collect 410 pe/CCD times of light maximum that had been published. These data could be modeled with a nonlinear fit including a continuously decreasing period change (dP/dt = -9.04 x 10-12 days day-1) and a periodic change with a period of 42.2 yr. If this periodic change is caused by the light traveling time effect of an orbital motion of DY Pegasi in a binary system, the deduced mass of the companion could be 0.028 Msun and it is probably a brown dwarf.

  6. Analysis of the symbiotic star AG Pegasi

    Science.gov (United States)

    Keyes, C. D.; Plavec, M. J.

    1981-01-01

    High and low dispersion IUE data are analyzed in conjunction with coincident ground based spectrophotometric scans and supplementary infrared photometry of the symbiotic object AG Pegasi. The IUE observations yield an improved value of E(B-V) = 0.12. The two stellar components are easily recognized in the spectra. The cool component may be an M1.7 III star and the hot component appears to have T (sub eff) of approximately 30000 K. The emission lines observed in the ultraviolet indicate two or three distince emitting regions. Nebular component ultraviolet intercombination lines suggest an electron density of several times 10 billion/cu cm.

  7. Pegasys: software for executing and integrating analyses of biological sequences

    Directory of Open Access Journals (Sweden)

    Lett Drew

    2004-04-01

    Full Text Available Abstract Background We present Pegasys – a flexible, modular and customizable software system that facilitates the execution and data integration from heterogeneous biological sequence analysis tools. Results The Pegasys system includes numerous tools for pair-wise and multiple sequence alignment, ab initio gene prediction, RNA gene detection, masking repetitive sequences in genomic DNA as well as filters for database formatting and processing raw output from various analysis tools. We introduce a novel data structure for creating workflows of sequence analyses and a unified data model to store its results. The software allows users to dynamically create analysis workflows at run-time by manipulating a graphical user interface. All non-serial dependent analyses are executed in parallel on a compute cluster for efficiency of data generation. The uniform data model and backend relational database management system of Pegasys allow for results of heterogeneous programs included in the workflow to be integrated and exported into General Feature Format for further analyses in GFF-dependent tools, or GAME XML for import into the Apollo genome editor. The modularity of the design allows for new tools to be added to the system with little programmer overhead. The database application programming interface allows programmatic access to the data stored in the backend through SQL queries. Conclusions The Pegasys system enables biologists and bioinformaticians to create and manage sequence analysis workflows. The software is released under the Open Source GNU General Public License. All source code and documentation is available for download at http://bioinformatics.ubc.ca/pegasys/.

  8. Youth plus experience: the discovery of 51 Pegasi b

    Science.gov (United States)

    Cenadelli, Davide; Bernagozzi, Andrea

    2015-12-01

    In 1995, Michel Mayor and Didier Queloz announced they discovered 51 Pegasi b, the first planet ever found around a star other than the Sun. This discovery turned out to be a milestone of recent astronomy, as it opened up a new field of research that is growing impressively these days. However, 51 Pegasi b has surprising properties as compared to the planets of the Solar System, as it is a giant planet on a very close-in orbit around its parent star. Hence, its discovery was unexpected and its actual existence did not go unchallenged. In the following years, a passionate debate sprang up, and finally astronomers accepted it, but at the price of a deep revision of our understanding of how planetary systems are formed and evolve. In the present paper, we reconstruct the dynamics of the discovery of 51 Pegasi b and the first exoplanets, the quarrel that arose among astronomers and the final acceptance of the existence of planets with unexpected characteristics. This remarkable story is recounted by means of published literature as well as interviews with several of its main protagonists.

  9. Tank 241-BX-103 tank characterization plan

    International Nuclear Information System (INIS)

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, and WHC 222-S Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples for tank 241-BX-103

  10. Tank 241-BX-104 tank characterization plan

    International Nuclear Information System (INIS)

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-BX-104

  11. Tank 241-BX-103 tank characterization plan

    Energy Technology Data Exchange (ETDEWEB)

    Bell, K.E. [Westinghouse Hanford Co., Richland, WA (United States)

    1995-04-21

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, and WHC 222-S Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples for tank 241-BX-103.

  12. Main: 1BX9 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available Pm24 Name=Pm24.1; Orderedlocusnames=At4g02520; Orfnames=T10p11.18; Arabidopsis Thaliana Molecule: Glutathione S-Transferase; Chai...n: A; Molecule: Ggl-Foe-Gly; Chain: B; Engineered: Yes Transferase L.Prade, R.Huber, B...r weight: 23997 Da AGIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAI...GMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ arabi_1BX9.jpg ...

  13. The magnetic field of the B3V star 16 Pegasi

    NARCIS (Netherlands)

    H.F. Henrichs; C. Neiner; R.S. Schnerr; E. Verdugo; A. Alecian; C. Catala; F. Cochard; J. Gutiérrez; A.L. Huat; J. Silvester; O. Thizy

    2008-01-01

    The slowly pulsating B3V star 16 Pegasi was discovered by Hubrig et al. (2006) to be magnetic, based on low-resolution spectropolarimetric observations with FORS1 at the VLT. We have confirmed the presence of a magnetic field with new measurements with the spectropolarimeters Narval at TBL, France a

  14. A spectroscopic study of the hybrid pulsator Gamma Pegasi

    CERN Document Server

    Pandey, C P; Briquet, M; Jayakumar, K; Bisht, S; Sanwal, B B

    2011-01-01

    The recent detection of both pressure and high-order gravity modes in the classical B-type pulsator Gamma Pegasi offers promising prospects for probing its internal structure through seismic studies. To aid further modelling of this star, we present the results of a detailed NLTE abundance analysis based on a large number of time-resolved, high-quality spectra. A chemical composition typical of nearby B-type stars is found. The hybrid nature of this star is consistent with its location in the overlapping region of the instability strips for beta Cephei and slowly pulsating B stars computed using OP opacity tables, although OPAL calculations may also be compatible with the observations once the uncertainties in the stellar parameters and the current limitations of the stability calculations are taken into account. The two known frequencies f1 = 6.58974 and f2 = 0.68241 c/d are detected in the spectroscopic time series. A mode identification is attempted for the low-frequency signal, which can be associated to ...

  15. Waves In Accretion Disks, Observed With Fresno State'S Station At Sierra Remote Observatories: Hv Andromedae, Lq Pegasi, And Ln Ursae Majoris

    Science.gov (United States)

    Rude, Gerald; Ringwald, F. A.

    2012-01-01

    We present observations of three cataclysmic variable stars: HV Andromedae, LQ Pegasi, and LN Ursae Majoris. A cataclysmic variable star is a binary star system composed of a red dwarf orbiting a white dwarf. These stars orbit closely, typically in 3-4 hours. Due to this close orbit, gas spills from the red dwarf into orbit around the white dwarf. This forms an accretion disk. Accretion disks are found throughout the Universe: from planetary formation, Saturn's rings, black holes that swallow stars, to the Milky Way's spiral structure. Our goal in studying these three cataclysmic variables was to search for evidence of waves, warping, or bending of their accretion disks. Photometry is the study of how the brightness of an object changes over time. With cataclysmic variables much of the fluctuation in brightness is from the accretion disk. We collected time-resolved differential photometry of three cataclysmic variables using Fresno State's remotely controlled telescope at Sierra Remote Observatories. After measuring our photometry, we searched for waves in the data. We have surprising results for each of the stars studied. All of these objects have prominent low-frequency periodicities not seen in the literature. This can be attributed to Fresno State's Remote Observatory's ability to observe stars for extended periods of time. We found strong evidence for both warping and bending waves in LQ Pegasi. In LN Ursae Majoris, we discovered apparently chaotic behavior, with the low-frequency wave changing significantly in just under a month. We also see clear evidence for short-period waves in HV Andromedae, also with some rumbling at low frequencies. Our observations of these three cataclysmic variables, especially of LN Ursae Majoris, warrant further study in the form of radial-velocity studies.

  16. A Follow-up Study for Chinese Chronic Hepatitis C Patients Treated with the Combination of PEG-IFNα-2a (PEGASYS) and Ribavirin

    Institute of Scientific and Technical Information of China (English)

    2014-01-01

    Objective To compare the efifcacy of peginterferon alfa-2a (PEGASYS) plus ribavirin (RBV) with interferon alfa-2a plus RBV, and evaluate the safety. Methods Total of 117 patients with chronic hepatitis C were enrolled to receive either PEGASYS (135 μg or 180 μg) subcutaneously once per week, plus RBV (800 mg-1 200 mg) per day for 48 weeks (79 patients, PEGASYS group), or 5 million units of interferon alfa-2a subcutaneously every other day, plus RBV as above dosage for 48 weeks (38 patients, IFNα group). Results Sixty-three of 79 (79.7%) patients reached sustained virological response (SVR) in PEGASYS group, while 14 of 38 (36.8%) patients reached SVR in IFNα group. PEGASYS group was associated with a higher rate of virologic response than IFNα group at week 4, 12, 36, 48 and week 72. Sustained normalization of serum ALT concentrations at week 36, 48 and week 72 was also more common in PEGASYS group than in IFNα group. Baseline levels of ALT and HCV RNA had no effect on SVR in either PEGASYS group or IFNαgroup. Both groups were similar in the frequency and severity of adverse events. Conclusions PEGASYS plus RBV produced similar adverse events but higher rate of SVR. Meanwhile, complications should be prevented and treated promptly in order to increase compliances and effects.

  17. Engineering task plan for BX/BY compressor upgrade

    International Nuclear Information System (INIS)

    This Engineering Task Plan outlines the remaining work to be completed for the BX/BY Instrument Air upgrade. Initial work efforts were guided by Engineering Work Plan, ''BX-BY Compressor Upgrade'' dated 1-25-93 (see Attachment A) which is provided for information. The overall engineering task is to provide a permanent replacement for the instrument air supply system for the 241-BX/BY Tank Farms. The existing system consists of a 25 horsepower Worthington non-lube compressor and an Oriad air dryer. The existing equipment is dated, requires high maintenance and is located in a contaminated zone making it unusable. The BX/BY instrument air replacement unit will be one of the 100 SCFM generic air stations. This station will be permanently sited with the addition of drawing changes to provide a concrete foundation, air piping to existing lines and electrical power supply tie-ins

  18. Tank 241-BX-103 tank characterization plan. Revision 1

    International Nuclear Information System (INIS)

    This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-BX-103

  19. Tank 241-BX-109 tank characterization plan. Revision 1

    International Nuclear Information System (INIS)

    This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-BX-109

  20. Tank 241-BX-106 tank characterization plan. Revision 1

    International Nuclear Information System (INIS)

    This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-BX-106

  1. 76 FR 77862 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2011-12-14

    ... using BX. \\3\\ Securities Exchange Act Release No. 65470 (October 3, 2011), 76 FR 62489 (October 7, 2011... route a specified volume of orders using BX. Because members that use the BX router will pay a fee for... may partially execute at BX, increased use of the BX router has the potential both to increase...

  2. The magnetic field of the B3V star 16 Pegasi

    OpenAIRE

    Henrichs, H. F.; Neiner, C.; Schnerr, R. S.; Verdugo, E.; Alecian, A.; Catala, C.; Cochard, F.; Gutiérrez, J.; Huat, A. -L.; Silvester, J.; Thizy, O.

    2008-01-01

    The Slowly Pulsating B3V star 16 Pegasi was discovered by Hubrig (2006) to be magnetic, based on low-resolution spectropolarimetric observations with FORS1 at the VLT. We have confirmed the presence of a magnetic field with new measurements with the spectropolarimeters Narval at TBL, France and Espadons at CFHT, Hawaii during 2007. The most likely period is about 1.44 d for the modulation of the field, but this could not be firmly established with the available data set. No variability has be...

  3. Complex asteroseismology of the hybrid B-type pulsator $\\gamma$ Pegasi: a test of stellar opacities

    CERN Document Server

    Walczak, Przemysław

    2010-01-01

    Using the updated oscillation spectrum of $\\gamma$ Pegasi, we construct a set of seismic models which reproduce two pulsational frequencies corresponding to the $\\ell=0$, p$_1$ and $\\ell=1$, g$_1$ modes. Then, we single out models which reproduce other well identified modes. Finally, we extend our seismic modelling by a requirement of fitting also values of the complex, nonadiabatic parameter $f$ associated to each mode frequency. Such complex asteroseismology of the B-type pulsators provides a unique test of stellar metallicity and opacities. In contrast to our previous studies, results for $\\gamma$ Peg indicate that both opacity tables, OPAL and OP, are equally preferred.

  4. Low-temperature sequential pulsed chemical vapor deposition of ternary BxGa1-xN and BxIn1-xN thin film alloys

    International Nuclear Information System (INIS)

    In this work, the authors have performed sequential pulsed chemical vapor deposition of ternary BxGa1-xN and BxIn1-xN alloys at a growth temperature of 450 °C. Triethylboron, triethylgallium, trimethylindium, and N2 or N2/H2 plasma have been utilized as boron, gallium, indium, and nitrogen precursors, respectively. The authors have studied the compositional dependence of structural, optical, and morphological properties of BxGa1-xN and BxIn1-xN ternary thin film alloys. Grazing incidence X-ray diffraction measurements showed that boron incorporation in wurtzite lattice of GaN and InN diminishes the crystallinity of BxGa1-xN and BxIn1-xN sample. Refractive index decreased from 2.24 to 1.65 as the B concentration of BxGa1-xN increased from 35% to 88%. Similarly, refractive index of BxIn1-xN changed from 1.98 to 1.74 for increase in B concentration value from 32% to 87%, respectively. Optical transmission band edge values of the BxGa1-xN and BxIn1-xN films shifted to lower wavelengths with increasing boron content, indicating the tunability of energy band gap with alloy composition. Atomic force microscopy measurements revealed an increase in surface roughness with boron concentration of BxGa1-xN, while an opposite trend was observed for BxIn1-xN thin films

  5. 77 FR 14843 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2012-03-13

    ... of Proposed Rule Change To Modify Pricing for BX Members Using the NASDAQ OMX BX Equities System... order routing strategy. BX will implement the proposed change immediately on March 1, 2012. The text of... modify its fees for orders that are routed using BX's BTFY order routing strategy. BTFY is a...

  6. Three years of photometry of IM Pegasi = HR 8703

    Science.gov (United States)

    Eaton, J. A.; Hall, D. S.; Henry, G. W.; Lovell, L. P.; Stephan, C. A.; Chambliss, C. R.; Detterline, P. K.; Landis, H. J.; Louth, H.; Renner, T. R.

    1983-01-01

    Differential photometry of this K1 IV-III p RS CVn-type binary in 1978-79, 1979-80, and 1980-81 at eight different observatories shows that the variability, discovered originally by Herbst, is periodic. The mean of three different determinations of the photometric period was 24(d).39 + or 0(d).03, about 1 percent shorter than the orbital period of 24(d).649 determined spectroscopically by Harper. The total range observed during these three years was for V from 5(m).60 to 5(m).85. The light curve was nearly sinusoidal but always noticieably asymmetric, with the sense reversing sometime between 1979-80 and 1980-81.

  7. Structural characteristics of ScBx genes controlling the biosynthesis of hydroxamic acids in rye (Secale cereale L.)

    OpenAIRE

    Bakera, Beata; Makowska, Bogna; Groszyk, Jolanta; Niziołek, Michał; Orczyk, Wacław; Bolibok-Brągoszewska, Hanna; Hromada-Judycka, Aneta; Rakoczy-Trojanowska, Monika

    2015-01-01

    Benzoxazinoids (BX) are major secondary metabolites of gramineous plants that play an important role in disease resistance and allelopathy. They also have many other unique properties including anti-bacterial and anti-fungal activity, and the ability to reduce alfa–amylase activity. The biosynthesis and modification of BX are controlled by the genes Bx1 ÷ Bx10, GT and glu, and the majority of these Bx genes have been mapped in maize, wheat and rye. However, the genetic basis of BX biosynthesi...

  8. Identification of Autophagy in the Pine Wood Nematode Bursaphelenchus xylophilus and the Molecular Characterization and Functional Analysis of Two Novel Autophagy-Related Genes, BxATG1 and BxATG8

    Directory of Open Access Journals (Sweden)

    Li-Na Deng

    2016-03-01

    Full Text Available The pine wood nematode, Bursaphelenchus xylophilus, causes huge economic losses in pine forests, has a complex life cycle, and shows the remarkable ability to survive under unfavorable and changing environmental conditions. This ability may be related to autophagy, which is still poorly understood in B. xylophilus and no autophagy-related genes have been previously characterized. In this study, transmission electron microscopy was used to confirm that autophagy exists in B. xylophilus. The full-length cDNAs of BxATG1 and BxATG8 were first cloned from B. xylophilus, and BxATG1 and BxATG8 were characterized using bioinformatics methods. The expression pattern of the autophagy marker BxATG8 was investigated using in situ hybridization (ISH. BxATG8 was expressed in esophageal gland and hypodermal seam cells. We tested the effects of RNA interference (RNAi on BxATG1 and BxATG8. The results revealed that BxATG1 and BxATG8 were likely associated with propagation of nematodes on fungal mats. This study confirmed the molecular characterization and functions of BxATG1 and BxATG8 in B. xylophilus and provided fundamental information between autophagy and B. xylophilus.

  9. Structural characteristics of ScBx genes controlling the biosynthesis of hydroxamic acids in rye (Secale cereale L.).

    Science.gov (United States)

    Bakera, Beata; Makowska, Bogna; Groszyk, Jolanta; Niziołek, Michał; Orczyk, Wacław; Bolibok-Brągoszewska, Hanna; Hromada-Judycka, Aneta; Rakoczy-Trojanowska, Monika

    2015-08-01

    Benzoxazinoids (BX) are major secondary metabolites of gramineous plants that play an important role in disease resistance and allelopathy. They also have many other unique properties including anti-bacterial and anti-fungal activity, and the ability to reduce alfa-amylase activity. The biosynthesis and modification of BX are controlled by the genes Bx1 ÷ Bx10, GT and glu, and the majority of these Bx genes have been mapped in maize, wheat and rye. However, the genetic basis of BX biosynthesis remains largely uncharacterized apart from some data from maize and wheat. The aim of this study was to isolate, sequence and characterize five genes (ScBx1, ScBx2, ScBx3, ScBx4 and ScBx5) encoding enzymes involved in the synthesis of DIBOA, an important defense compound of rye. Using a modified 3D procedure of BAC library screening, seven BAC clones containing all of the ScBx genes were isolated and sequenced. Bioinformatic analyses of the resulting contigs were used to examine the structure and other features of these genes, including their promoters, introns and 3'UTRs. Comparative analysis showed that the ScBx genes are similar to those of other Poaceae species, especially to the TaBx genes. The polymorphisms present both in the coding sequences and non-coding regions of ScBx in relation to other Bx genes are predicted to have an impact on the expression, structure and properties of the encoded proteins. PMID:25666974

  10. Tank characterization report for single-shell tank 241-BX-107

    International Nuclear Information System (INIS)

    This study examined and assessed the status, safety issues, composition, and distribution of the wastes contained in the tank 241-BX-107. Historical and most recent information, ranging from engineering structural assessment experiments, process history, monitoring and remediation activities, to analytical core sample data, were compiled and interpreted in an effort to develop a realistic, contemporary profile for the tank BX-107 contents

  11. Calibration Binaries

    Science.gov (United States)

    Drummond, J.

    2011-09-01

    Two Excel Spreadsheet files are offered to help calibrate telescope or camera image scale and orientation with binary stars for any time. One is a personally selected list of fixed position binaries and binaries with well-determined orbits, and the other contains all binaries with published orbits. Both are derived from the web site of the Washington Double Star Library. The spreadsheets give the position angle and separation of the binaries for any entered time by taking advantage of Excel's built in iteration function to solve Kepler's transcendental equation.

  12. 75 FR 1436 - Self-Regulatory Organizations; NASDAQ OMX BX; Notice of Filing and Immediate Effectiveness of a...

    Science.gov (United States)

    2010-01-11

    ... services, including the collection of annual membership fees from BX members pursuant to BX Rule 7001(a). BOX participants are not subject to the BX annual membership fee. Due to a limitation with FINRA's... proposing to allow FINRA to deduct an annual $3,000 membership fee from Boston Options Exchange Group,...

  13. Spectral mapping of the spiral structures in IP Pegasi on the decline from an outburst

    CERN Document Server

    Baptista, R; Thomas, G; Baptista, Raymundo; Haswell, Carole A.; Thomas, Gino

    2002-01-01

    (abridged) We report eclipse mapping of time resolved spectroscopy of the dwarf nova IP Pegasi on the late decline from the May 1993 outburst. The spiral arms are still visible some 8 days after the onset of the outburst. Their fractional contribution to the continuum emission is similar to that measured close to outburst maximum, whereas their orientation is rotated by 58 degrees with respect to the spirals seen in the eclipse map at outburst maximum. Velocity-resolved light curves across the Halpha and the HeI lines show the classical rotational disturbance, with the blue side of the line being eclipsed earlier than the red side. The differences between the Halpha and the HeI maps are significant. The spiral arms are clearly seen in the HeI maps, with the receding arm being stronger in the red side while the approaching arm is stronger in the blue side of the line. The analysis of the Halpha maps suggests that this emission arises mainly from a large and vertically-extended region which we interpret as an o...

  14. Detection of molecular absorption in the dayside of exoplanet 51 Pegasi b?

    CERN Document Server

    Brogi, M; de Kok, R J; Albrecht, S; Birkby, J L; de Mooij, E J W

    2013-01-01

    In this paper we present ground-based high-resolution spectroscopy of 51 Pegasi using CRIRES at the Very Large Telescope. The system was observed for 3x5 hours at 2.3 {\\mu}m at a spectral resolution of R = 100,000, targeting potential signatures from carbon monoxide, water vapour and methane in the planet's dayside spectrum. In the first 2x5 hours of data, we find a combined signal from carbon monoxide and water in absorption at a formal 5.9{\\sigma} confidence level, indicating a non-inverted atmosphere. We derive a planet mass of M_P = (0.46 +- 0.02) M_Jup and an orbital inclination i between 79.6 and 82.2 degrees, with the upper limit set by the non-detection of the planet transit in previous photometric monitoring. However, there is no trace of the signal in the final 5 hours of data. A statistical analysis indicates that the signal from the first two nights is robust, but we find no compelling explanation for its absence in the final night. The latter suffers from stronger noise residuals and greater inst...

  15. Roche tomography of cataclysmic variables - V. A high-latitude star-spot on RU Pegasi

    CERN Document Server

    Dunford, Alexander; Smith, Robert Connon

    2012-01-01

    We present Roche tomograms of the secondary star in the dwarf nova system RU Pegasi derived from blue and red arm ISIS data taken on the 4.2-m William Herschel Telescope. We have applied the entropy landscape technique to determine the system parameters and obtained component masses of M1 = 1.06 Msun, M2 = 0.96 Msun, an orbital inclination angle of i = 43 degrees, and an optimal systemic velocity of gamma = 7 km/s. These are in good agreement with previously published values. Our Roche tomograms of the secondary star show prominent irradiation of the inner Lagrangian point due to illumination by the disc and/or bright spot, which may have been enhanced as RU Peg was in outburst at the time of our observations.We find that this irradiation pattern is axi-symmetric and confined to regions of the star which have a direct view of the accretion regions. This is in contrast to previous attempts to map RU Peg which suggested that the irradiation pattern was non-symmetric and extended beyond the terminator. We also d...

  16. Two-dimensional BX (X = P, As, Sb) semiconductors with mobilities approaching graphene

    Science.gov (United States)

    Xie, Meiqiu; Zhang, Shengli; Cai, Bo; Zhu, Zhen; Zou, Yousheng; Zeng, Haibo

    2016-07-01

    Carrier mobility plays a key role in the performance of microelectronic devices, especially the field effect transistors (FET). To design next generation two-dimensional (2D) FET, stable channel materials with a higher carrier mobility than silicon and a significant band gap are highly desirable, but are still not discovered. Here, we report a group of 2D materials of BX (X = P, As, and Sb), which are semiconducting with an ultrahigh carrier mobility. Using first-principles calculations, we find that all BX configurations are similar to graphene, but possess direct bandgaps of 1.36, 1.14, and 0.49 eV, respectively. Based on deformation potential theory, BX monolayers are predicted to have superior mobilities (>104 cm2 V-1 s-1) to phosphorene. In particular, the electron mobility of monolayer BSb is 3.2 × 105 cm2 V-1 s-1, approaching the figure of merit in graphene (~3 × 105 cm2 V-1 s-1). These results demonstrate that BX monolayers are of paramount significance for next-generation 2D FET manufacture.Carrier mobility plays a key role in the performance of microelectronic devices, especially the field effect transistors (FET). To design next generation two-dimensional (2D) FET, stable channel materials with a higher carrier mobility than silicon and a significant band gap are highly desirable, but are still not discovered. Here, we report a group of 2D materials of BX (X = P, As, and Sb), which are semiconducting with an ultrahigh carrier mobility. Using first-principles calculations, we find that all BX configurations are similar to graphene, but possess direct bandgaps of 1.36, 1.14, and 0.49 eV, respectively. Based on deformation potential theory, BX monolayers are predicted to have superior mobilities (>104 cm2 V-1 s-1) to phosphorene. In particular, the electron mobility of monolayer BSb is 3.2 × 105 cm2 V-1 s-1, approaching the figure of merit in graphene (~3 × 105 cm2 V-1 s-1). These results demonstrate that BX monolayers are of paramount significance for

  17. 45-Day deliverable for Tank 241-BX-105 Auger samples, risers 2 and 6

    International Nuclear Information System (INIS)

    Two auger samples from single-shell tank 241-BX-105 (BX-105) were extruded, broken down, and analyzed for DSC, TGA, and total alpha as prescribed. Analytical results were tracked and reported using the laboratory information management system known as LabCore. This is the final report for the fiscal year 1995 BX-105 auger sample characterization effort. Included are copies of the differential scanning calorimetry (DSC) and thermogravimetric analyses (TGA) scans as requested. Also included is a copy of any immediate notification documentation, chain of custody forms, the hot cell work plan, extruded segment [auger] description sheets, and total alpha data

  18. Interacting binaries

    CERN Document Server

    Shore, S N; van den Heuvel, EPJ

    1994-01-01

    This volume contains lecture notes presented at the 22nd Advanced Course of the Swiss Society for Astrophysics and Astronomy. The contributors deal with symbiotic stars, cataclysmic variables, massive binaries and X-ray binaries, in an attempt to provide a better understanding of stellar evolution.

  19. Analysis of historical gross gamma logging data from BX tank farm

    International Nuclear Information System (INIS)

    Gross gamma ray logs, recorded from January 1975 through mid-year 1994 as part of the Single-Shell Tank Farm Dry Well Surveillance Program, have been reanalyzed for the BX tank farm to locate the presence of mobile radionuclides in the subsurface. This report presents the BX tank farm gross gamma ray data in such a way as to assist others in their study of vadose zone mechanism

  20. Study on the treatment effect of Bx decoction on rat models of reflux esophagitis

    International Nuclear Information System (INIS)

    Objective: To explore the mechanism of BAN-XIA-XIE-XIN Decoction (Bx Decoction) treatment in rat models of reflux esophagitis. Methods: Rat models of reflux esophagitis were prepared with the method previously reported from this laboratory. Twenty-five models each were left untreated, treated with cisapride (2.5 mg/kg/d) or treated with BAN-XIA-XIE-XIN Decoction (BX) 5.78m/kg/d) respectively. All the models were sacrificed after 4 weeks, acid contents in gastric juice, cholic acid contents in duodenal juice as well as calcitonin-gene-related peptide (CGRP) (with RIA) contents in lower esophageal tissue and plasma were measured. Histologic examination of lower esophageal tissue for degree of esophagitis was also performed in all the models. Besides, 25 animals underwent sham operation only and served as controls. Results: The positive rates of pathologic changes (mucosal inflammation, squamous cell hyperplasia, lamina propria extension and mucosal erosion) were all significantly higher in the non-treated models than those in the BX treated models (P<0.01). Acid contents in gastric juice were significantly lowered with pH significantly increased in the BX treated group (P<0.01). The CGRP contents in esophageal tissue in the BX treated models, though remains lower than those in the 25 animals with sham operation only, were significantly higher than those in non-treated models (P<0.01). The plasma contents of CGRP in the BX-treated models remained significantly higher than those in sham-operation animals (P<0.01), decrease from the very high levels in untreated model was not large enough to be significant. Conclusion: BX-decoction might exert its protective effect on esophageal mucosa through lowering of gastric acidity with modulation of CGRP synthesis. (authors)

  1. First-principles calculations of the structural, electronic and optical properties of cubic BxGa1-xAs alloys

    International Nuclear Information System (INIS)

    Density functional calculations are performed to study the structural, electronic and optical properties of technologically important BxGa1-xAs ternary alloys. The calculations are based on the total-energy calculations within the full-potential augmented plane-wave (FP-LAPW) method. For exchange-correlation potential, local density approximation (LDA) and the generalized gradient approximation (GGA) have been used. The structural properties, including lattice constants, bulk modulus and their pressure derivatives, are in very good agreement with the available experimental and theoretical data. The electronic band structure, density of states for the binary compounds and their ternary alloys are given. The dielectric function and the refractive index are also calculated using different models. The obtained results compare very well with previous calculations and experimental measurements.

  2. The band structures of BSb and BxGa1-xSb alloys

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    The band structures of BSb and BxGa1-xSb alloys are studied using first-principles calculations in the generalized gradient approximation. By SQS-8 supercells to model a random alloy, the direct transition energy-gap (Γ15v- Γ1c) bowing of 3.0 eV is obtained for BxGa1-xSb alloys in x = 0-50%, in x = 0-11% the energy-gap is the band-gap and increases by 7 meV/%B with boron composition increasing; by SQS-16 supercells the bowing parameter is about 1.9 eV in x = 0-12.5%. The formation enthalpies of mixing, ΔH, are calculated for BxGa1-xAs and BxGa1-xSb alloys. A comparison of enthalpies indicates that BxGa1-xSb films with boron composition of 7% may be possible.

  3. The band structures of BSb and BxGa1-xSb alloys

    Institute of Scientific and Technical Information of China (English)

    XIONG DePing; ZHOU ShouLi; WANG Qi; LUO Li; HUANG YongQing; REN XiaoMin

    2009-01-01

    The band structures of BSb and BxGa1-xSb alloys are studied using first-principles calculations in the generalized gradient approximation. By SQS-8 supercells to model a random alloy, the direct transition energy-gap (Γ15v-Γ1c) bowing of 3.0 eV is obtained for BxGa1-xSb alloys in x=0-50%, in x=0-11% the energy-gap is the band-gap and increases by 7 meV/%B with boron composition increasing; by SQS-16 supercells the bowing parameter is about 1.9 eV in x= 0-12.5%. The formation enthalpies of mixing, ΔH,are calculated for BxGa1-xAs and BxGa1-xSb alloys. A comparison of enthalpies indicates that BxGa1-xSb films with boron composition of 7% may be possible.

  4. Binary Planets

    Science.gov (United States)

    Ryan, Keegan; Nakajima, Miki; Stevenson, David J.

    2014-11-01

    Can a bound pair of similar mass terrestrial planets exist? We are interested here in bodies with a mass ratio of ~ 3:1 or less (so Pluto/Charon or Earth/Moon do not qualify) and we do not regard the absence of any such discoveries in the Kepler data set to be significant since the tidal decay and merger of a close binary is prohibitively fast well inside of 1AU. SPH simulations of equal mass “Earths” were carried out to seek an answer to this question, assuming encounters that were only slightly more energetic than parabolic (zero energy). We were interested in whether the collision or near collision of two similar mass bodies would lead to a binary in which the two bodies remain largely intact, effectively a tidal capture hypothesis though with the tidal distortion being very large. Necessarily, the angular momentum of such an encounter will lead to bodies separated by only a few planetary radii if capture occurs. Consistent with previous work, mostly by Canup, we find that most impacts are disruptive, leading to a dominant mass body surrounded by a disk from which a secondary forms whose mass is small compared to the primary, hence not a binary planet by our adopted definition. However, larger impact parameter “kissing” collisions were found to produce binaries because the dissipation upon first encounter was sufficient to provide a bound orbit that was then rung down by tides to an end state where the planets are only a few planetary radii apart. The long computational times for these simulation make it difficult to fully map the phase space of encounters for which this outcome is likely but the indications are that the probability is not vanishingly small and since planetary encounters are a plausible part of planet formation, we expect binary planets to exist and be a non-negligible fraction of the larger orbital radius exoplanets awaiting discovery.

  5. 75 FR 47875 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2010-08-09

    ... Starwood Hotels & ACAS American Capital Resorts Ltd. QLD ProShares Ultra QQQ XLNX Xilinx Inc. VRSN Veri... Exchange Act Release No. 60886 (Oct. 27, 2009), 74 FR 56897 (Nov. 3, 2009) (SR-BX-2009-067). This proposal... Release No. 60950 (Nov. 6, 2009), 74 FR 58666 (Nov. 6, 2009) (SR-BX-2009-069); Securities and Exchange...

  6. 77 FR 33257 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2012-06-05

    ... COMMISSION Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness... Rules. BX Members are subject to various charges for membership, services and equipment as noted in the... either solicited or received. III. Date of Effectiveness of the Proposed Rule Change and Timing...

  7. 75 FR 48390 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Order Approving a Proposed Rule Change...

    Science.gov (United States)

    2010-08-10

    ... FR 38571 (``Notice''). In its proposal, BX proposed to establish fees for direct 10Gb circuit... COMMISSION Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Order Approving a Proposed Rule Change...,\\2\\ a proposed rule change to establish pricing for 10Gb direct circuit connections and...

  8. Hanford Tank Farms Vadose Zone, Addendum to the BX Tank Farm Report

    International Nuclear Information System (INIS)

    This addendum to the BX Tank Farm Report (GJO-98-40-TARA, GJO-HAN-19) published in August 1998 incorporates the results of high-rate and repeat logging activities along with shape factor analysis of the logging data. A high-rate logging system was developed and deployed in the BX Tank Farm to measure cesium-137 concentration levels in high gamma flux zones where the spectral gamma logging system was unable to collect usable data because of high dead times and detector saturation. This report presents additional data and revised visualizations of subsurface contaminant distribution in the BX Tank Farm at the DOE Hanford Site in the state of Washington

  9. Final report for tank 241-BX-104 push mode core 126 and 127

    International Nuclear Information System (INIS)

    This is the final sample analysis report for tank 241-BX-104 (BX-104), cores 126 and 127. Two segments from each core yielded a total of 11 samples which were analyzed. The data quality objectives (DQOs) applicable to this sampling event were the Safety Screening DQO (Dukelow et al. 1995) and the Organic Safety DQO (Turner et al. 1995). The samples were received, extruded and analyzed at PNNL 325 Analytical Chemistry Laboratory (ACL). The analyses were performed in accordance with the Sample Analysis Plan (Gretsinger 1996) and indicated that the tank is safe with respect to the criteria in the Safety Screening and Organic DQO. Detailed analytical results were described in the analytical laboratory 45-day Report (Attachment 1, WHC-SD-WM-DP-171, REV. 0) and final report (Attachment 2, PNL-BX-104 REV.1) prepared by PNNL, 325 Laboratory. Corrections and/or exceptions to the PNNL final report are provided

  10. On the wear of TiBx/TiSiyCz coatings deposited on 316L steel

    International Nuclear Information System (INIS)

    Bilayer TiBx/TiSiyCz coatings were formed on AISI 316L steel substrates by dual beam ion beam assisted deposition from TiBx and TiSiyCz targets. Coated and uncoated substrates were subjected to nanoindentation, scratch and friction-wear tests. Scratch and ball-on-disc tests were conducted in non-lubricated sliding, using a diamond pin and 100Cr6 steel ball, respectively. Scanning electron microscopy and atomic force microscopy were used to examine the surfaces of coated samples, before and after tests. To investigate wear mechanisms in the coating-substrate systems, thin foils were prepared from worn areas for transmission electron microscopy observations. TiBx/TiSiyCz coatings proved to be well adherent to steel substrates. The main wear mechanism was of abrasive type. Intensive plastic deformation of steel substrate under critical loads was revealed.

  11. Theoretical Investigation on the Geometries and Properties of Guanine-BX3 (X = F, Cl) Complex

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Geometries and binding energies were predicted at the B3LYP/6-311+G* level for the guanine-BX3 (X = F, Cl) systems and four isomers with no imaginary frequencies have been obtained for both guanine-BF3 and guanine-BCl3, respectively. Single energy calculations using much larger basis sets (6-311+G(2df,p) and aug-cc-pVDZ were carried out as well. It was found that the most stable isomer of guanine-BF3 is BF3 connected to N3 of guanine with the stabilization energy of -19.93 kcal/mol (BSSE corrected), while that of guanine-BCl3 is BCl3 connected to O10 of guanine having stabilization energy of -15.02 kcal/mol at the same level. The analyses for the combining interaction between BX3 and guanine with the atom-in-molecules theory (AIM) and natural bond orbital (NBO) methods have been performed. The results indicated that all the isomers are formed with σ-p type interactions between guanine and BX3, in which pyridine-type nitrogen or carbonyl oxygen or nitrogen atom of amino group offers its lone pair electrons to the empty p orbital of boron atom and the concomitance of charge transfer from guanine to BX3 has occurred. Still, one or two hydrogen bonds exist in some isomers of guanine-BX3 system and contribute to the stability of complex systems. Frequency analysis suggested that the stretching vibration of BX3 undergoes a red shift in complexes. Guanine-BF3 complex is more stable than guanine-BCl3 although the B-Y (Y=N, O) bond distance in the latter is shorter.

  12. Characterization of Vadose Zone Sediment: Borehole 299-E33-45 Near BX-102 in the B-BX-BY Waste Management Area

    Energy Technology Data Exchange (ETDEWEB)

    Serne, R. Jeffrey; Last, George V.; Gee, Glendon W.; Schaef, Herbert T.; Lanigan, David C.; Lindenmeier, Clark W.; Lindberg, Michael J.; Clayton, Ray E.; Legore, Virginia L.; Orr, Robert D.; Kutnyakov, Igor V.; Baum, Steven R.; Geiszler, Keith N.; Brown, Christopher F.; Valenta, Michelle M.; Vickerman, Tanya S.

    2008-09-11

    This report was revised in September 2008 to remove acid-extractable sodium data from Table 4.22. The data was removed due to potential contamination introduced during the acid extraction process. The remaining text is unchanged from the original report issued in 2002. The overall goal of the Tank Farm Vadose Zone Project, led by CH2M HILL Hanford Group, Inc., is to define risks from past and future single-shell tank farm activities. To meet this goal, CH2M HILL Hanford Group, Inc., asked scientists from Pacific Northwest National Laboratory to perform detailed analyses on vadose zone sediments from within Waste Management Area B-BX-BY. This report is the first in a series of four reports to present the results of these analyses. Specifically, this report contains all the geologic, geochemical, and selected physical characterization data collected on vadose zone sediment recovered from borehole 299-E33-45 installed northeast of tank BX-102.

  13. Geometry of BxB-orbit closures in equivariant embeddings

    DEFF Research Database (Denmark)

    He, X.; Thomsen, Jesper Funch

    2005-01-01

    Let X denote an equivariant embedding of a connected reductive group G over an algebraically closed field k. Let B denote a Borel subgroup of G and let Z denote a BxB-orbit closure in X. When the characteristic of k is positive and X is projective we prove that Z is globally F-regular. As a...

  14. Supporting document for the historical tank content estimate for BX-tank farm

    International Nuclear Information System (INIS)

    This Supporting Document provides historical in-depth characterization information on BX-Tank Farm, such as historical waste transfer and level data, tank physical information,temperature plots, liquid observation well plots, chemical analyte and radionuclide inventories for the Historical Tank Content Estimate Report for the northeast quadrant of the Hanford 200 East Area

  15. Supporting document for the historical tank content estimate for BX-tank farm

    Energy Technology Data Exchange (ETDEWEB)

    Brevick, C.H.

    1996-06-28

    This Supporting Document provides historical in-depth characterization information on BX-Tank Farm, such as historical waste transfer and level data, tank physical information,temperature plots, liquid observation well plots, chemical analyte and radionuclide inventories for the Historical Tank Content Estimate Report for the northeast quadrant of the Hanford 200 East Area.

  16. X-ray crystal structure of divalent metal-activated ß-xyloisdase, RS223BX

    Science.gov (United States)

    We report the first X-ray structure of a glycoside hydrolase family 43 ß-xylosidase, RS223BX, which is strongly activated by the addition of divalent metal cations. The 2.69 Å structure reveals that the Ca2+ cation is located at the back of the active site pocket. The Ca2+ coordinates to H274 to sta...

  17. Two-dimensional BX (X = P, As, Sb) semiconductors with mobilities approaching graphene.

    Science.gov (United States)

    Xie, Meiqiu; Zhang, Shengli; Cai, Bo; Zhu, Zhen; Zou, Yousheng; Zeng, Haibo

    2016-07-21

    Carrier mobility plays a key role in the performance of microelectronic devices, especially the field effect transistors (FET). To design next generation two-dimensional (2D) FET, stable channel materials with a higher carrier mobility than silicon and a significant band gap are highly desirable, but are still not discovered. Here, we report a group of 2D materials of BX (X = P, As, and Sb), which are semiconducting with an ultrahigh carrier mobility. Using first-principles calculations, we find that all BX configurations are similar to graphene, but possess direct bandgaps of 1.36, 1.14, and 0.49 eV, respectively. Based on deformation potential theory, BX monolayers are predicted to have superior mobilities (>10(4) cm(2) V(-1) s(-1)) to phosphorene. In particular, the electron mobility of monolayer BSb is 3.2 × 10(5) cm(2) V(-1) s(-1), approaching the figure of merit in graphene (∼3 × 10(5) cm(2) V(-1) s(-1)). These results demonstrate that BX monolayers are of paramount significance for next-generation 2D FET manufacture. PMID:27346538

  18. PEGASYS/Mark II: A program of internal target physics using the Mark II detector at the PEP storage ring

    International Nuclear Information System (INIS)

    This document is a proposal to SLAC on behalf of the PEGASYS Collaboration for a program of internal target physics at PEP utilizing the Mark A detector. Having completed its tour of duty at SLC in November 1990, we propose that the Mark A detector be returned to the PEP storage ring, where it will be used in conjunction with a long gas target for studies of QCD with nucleon and nuclear targets, as well as tests of QED in lepton pair production, and a search for new neutral bosons. We expect that the detector in its new configuration could be commissioned by late 1991 and begin taking data by 1992. This document presents the physics to be accomplished with the Mark A, and describes the minimal changes to the detector that we will need to make it function for internal target experiments. We also show a possible timeline for the project, and indicate the makeup of the collaboration that will carry out the work

  19. 76 FR 28838 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2011-05-18

    ... corresponding FINRA rules. This filing addresses BX Rule 3011 pertaining to anti-money laundering compliance... Exchange Act Release No. 60645 (September 9, 2009) , 74 FR 47630 (September 16, 2009)...

  20. Vapor and gas sampling of single-shell tank 241-BX-103 using the in situ vapor sampling system

    International Nuclear Information System (INIS)

    The Vapor Issue Resolution Program tasked the Vapor Team (VT) to collect representative headspace samples from Hanford Site single-shell tank (SST) 241-BX-103. This document presents In Situ Vapor Sampling System (ISVS) data resulting from the August 1, 1996 sampling of SST 241-BX-103. Analytical results will be presented in separate reports issued by the Pacific Northwest National Laboratory (PNNL) which supplied and analyzed the sample media

  1. Vapor and gas sampling of single-shell tank 241-BX-102 using the in situ vapor sampling system

    International Nuclear Information System (INIS)

    The Vapor Issue Resolution Program tasked the Vapor Team (VT) to collect representative headspace samples from Hanford Site single-shell tank (SST) 241-BX-102. This document presents In Situ vapor Sampling System (ISVS) data resulting from the July 31, 1996 sampling of SST 241-BX-102. Analytical results will be presented in separate reports issued by the Pacific Northwest National Laboratory (PNNL) which supplied and analyzed the sample media

  2. Predicted electronic and structural properties of BxIn1-xAs

    International Nuclear Information System (INIS)

    Structural and electronic properties of the BxIn1-xAs ternary alloy are studied using the tight binding method. The optical band gap bowing is calculated for the first time in the full range of Boron composition x. It is found to be strong. A small deviation from virtual crystal approximation is found for the bond length. New results on elastic constants are reported. The obtained results are in good agreement with the available data in the literature.

  3. Tank characterization report for Single-Shell Tank 241-BX-107

    International Nuclear Information System (INIS)

    This study examined and assessed the status, safety issues, composition, and distribution of the wastes contained in the tank 241-BX-107. Historical and most recent information, ranging from engineering structural assessment experiments, process history, monitoring and remediation activities, to analytical core sample data, were compiled and interpreted in an effort to develop a realistic, contemporary profile for the tank BX-107 contents. The results of this is study revealed that tank BX-107, a 2,006,050 L (530,000 gal) cylindrical single-shell, dished-bottom carbon-steel tank in the 200 East Area of the Hanford Site, was classified as sound. It has been interim stabilized and thus contains less than 189,250 L (50,000 gal) of interstitial liquid, and less than 18,925 L (5,000 gal) of supernatant. It has also been partially interim isolated, whereby all inlets to the tank are sealed to prevent inadvertent addition of liquid. At a residual waste level of ∼3.07 m (120.7 ± 2 in. from sidewall bottom or ∼132.9 in. from center bottom), it is estimated that the tank BX-107 contents are equivalent to 1,305,825 L (345,000 gal). The vapor space pressure is at atmospheric. The latest temperature readings, which were taken in July 1994, show a moderate temperature value of 19 degrees C (66 degrees F). Two supernatant samples were collected in 1974 and 1990, prior to interim stabilization. Sludge core samples were obtained in 1979 and 1992

  4. Tank 241-BX-104 vapor sampling and analysis tank characterization report

    International Nuclear Information System (INIS)

    This report presents the details of the Hanford waste tank characterization study for tank 241-BX-104. The drivers and objectives of the headspace vapor sampling and analysis were in accordance with procedure that were presented in other reports. The vapor and headspace gas samples were collected and analyzed to determine the potential risks to tank farm workers due to fugitive emissions from the tank

  5. Tank characterization report for Single-Shell Tank 241-BX-107

    Energy Technology Data Exchange (ETDEWEB)

    Raphael, G.F.

    1994-09-01

    This study examined and assessed the status, safety issues, composition, and distribution of the wastes contained in the tank 241-BX-107. Historical and most recent information, ranging from engineering structural assessment experiments, process history, monitoring and remediation activities, to analytical core sample data, were compiled and interpreted in an effort to develop a realistic, contemporary profile for the tank BX-107 contents. The results of this is study revealed that tank BX-107, a 2,006,050 L (530,000 gal) cylindrical single-shell, dished-bottom carbon-steel tank in the 200 East Area of the Hanford Site, was classified as sound. It has been interim stabilized and thus contains less than 189,250 L (50,000 gal) of interstitial liquid, and less than 18,925 L (5,000 gal) of supernatant. It has also been partially interim isolated, whereby all inlets to the tank are sealed to prevent inadvertent addition of liquid. At a residual waste level of {approximately}3.07 m (120.7 {+-} 2 in. from sidewall bottom or {approximately}132.9 in. from center bottom), it is estimated that the tank BX-107 contents are equivalent to 1,305,825 L (345,000 gal). The vapor space pressure is at atmospheric. The latest temperature readings, which were taken in July 1994, show a moderate temperature value of 19{degrees}C (66{degrees}F). Two supernatant samples were collected in 1974 and 1990, prior to interim stabilization. Sludge core samples were obtained in 1979 and 1992.

  6. Subsurface Conditions Description of the B and BX and BY Waste Management Area

    International Nuclear Information System (INIS)

    This document provides a discussion of the subsurface conditions relevant to the occurrence and migration of contaminants in the vadose zone and groundwater underlying the 241-B, -BX, and -BY tank farms. This document provides a concise summary of existing information in support of characterization planning. This document includes a description of the available environmental contamination data and a limited, qualitative interpretation of these data

  7. Magnetic Compton scattering study of the ferromagnetic amorphous alloys Fe1-xBx

    International Nuclear Information System (INIS)

    The boron contribution to the total spin moment in the amorphous alloys Fe1-xBx (x=0.2,0.24) has been determined using magnetic Compton scattering. The magnitude of the induced boron moment was found to be ∼-0.04μB per formula unit which is a factor of ∼2 less than that suggested by supercell linearized muffin-tin orbital electronic structure calculations

  8. Interpretation of the Coefficients in the Fit y = at + bx + c

    Science.gov (United States)

    Farnsworth, David L.

    2006-01-01

    The goals of this note are to derive formulas for the coefficients a and b in the least-squares regression plane y = at + bx + c for observations (t[subscript]i,x[subscript]i,y[subscript]i), i = 1, 2, ..., n, and to present meanings for the coefficients a and b. In this note, formulas for the coefficients a and b in the least-squares fit are…

  9. Subsurface Conditions Description of the B and BX and BY Waste Management Area

    Energy Technology Data Exchange (ETDEWEB)

    WOOD, M.I.

    2000-03-13

    This document provides a discussion of the subsurface conditions relevant to the occurrence and migration of contaminants in the vadose zone and groundwater underlying the 241-B, -BX, and -BY tank farms. This document provides a concise summary of existing information in support of characterization planning. This document includes a description of the available environmental contamination data and a limited, qualitative interpretation of these data.

  10. First-principles investigation of BAs and BxGa1-xAs alloys

    Institute of Scientific and Technical Information of China (English)

    Xiong De-Ping; Zhou Shou-Li; Wang Qi; Ren Xiao-Min

    2008-01-01

    Using first-principles calculations in the generalized gradient approximation, the electronic properties of BAs and BxGa1-xAs alloys are studied. At the Brillouin-zone centre, the lowest conduction band is the three-degenerate p-like Γ15c state rather than s-like Γ1c state, and the conduction band minimum (CBM) is along the △ line between the Γ and X points-at approximately 11/14(1,0,0)2π/a. With boron content at 0%-18.75%, BxGa1-xAs alloys have a small (2.6 eV) and relatively composition-independent band-gap bowing parameter, the band-gap increases monotonically by ~18meV/B% with increasing boron content. In addition, the formation enthalpies of mixing for BxGa1-xAs alloys with boron content at 6.25% and 12.5% are calculated, and the large formation enthalpies may explain the difficulty in alloying boron to GaAs.

  11. Binary effectivity rules

    DEFF Research Database (Denmark)

    Keiding, Hans; Peleg, Bezalel

    2006-01-01

    Abstract  A social choice rule (SCR) is a collection of social choice correspondences, one for each agenda. An effectivity rule is a collection of effectivity functions, one for each agenda. We prove that every monotonic and superadditive effectivity rule is the effectivity rule of some SCR. A SCR...... is binary if it is rationalized by an acyclic binary relation. The foregoing result motivates our definition of a binary effectivity rule as the effectivity rule of some binary SCR. A binary SCR is regular if it satisfies unanimity, monotonicity, and independence of infeasible alternatives. A binary...... effectivity rule is regular if it is the effectivity rule of some regular binary SCR. We characterize completely the family of regular binary effectivity rules. Quite surprisingly, intrinsically defined von Neumann-Morgenstern solutions play an important role in this characterization...

  12. Eclipsing binaries in open clusters

    DEFF Research Database (Denmark)

    Southworth, John; Clausen, J.V.

    Stars: fundamental parameters - Stars : binaries : eclipsing - Stars: Binaries: spectroscopic - Open clusters and ass. : general Udgivelsesdato: 5 August......Stars: fundamental parameters - Stars : binaries : eclipsing - Stars: Binaries: spectroscopic - Open clusters and ass. : general Udgivelsesdato: 5 August...

  13. Vapor and gas sampling of single-shell tank 241-BX-104 using the in situ vapor sampling system

    International Nuclear Information System (INIS)

    The Vapor Issue Resolution Program tasked the Vapor Team (VT) to collect representative headspace samples from Hanford Site single-shell tank (SST) 241-BX-104. This document presents In Situ Vapor Sampling System (ISVS) data resulting from the August 22, 1996 sampling of SST 241-BX-104. Analytical results will be presented in separate reports issued by the Pacific Northwest National Laboratory (PNNL) which supplied and analyzed the sample media. This is the first in a series of temporal sampling events on SST 241-BX-104. The strategy of temporal sampling is to measure the compositional changes of the waste tank headspace as related to seasonal effects and gradual changes of waste chemistry

  14. Improvement of confinement times of lithium ion and electron plasmas in BX-U

    International Nuclear Information System (INIS)

    Confinements of both electron (e−) and Lithium ion (Li+) plasmas in the BX-U machine are improved experimentally. For the e− plasma, the longest confinement time so far has been ∼ 10 s, which is much longer than the classical electron-electron collision time: τee ∼ 0.6 s. On the other hand, for the Li+ plasma, the longest confinement time has been about 0.5 s, which is still much shorter than the classical ion-ion collision time

  15. Synthesis and hydride transfer reactions of cobalt and nickel hydride complexes to BX3 compounds.

    Science.gov (United States)

    Mock, Michael T; Potter, Robert G; O'Hagan, Molly J; Camaioni, Donald M; Dougherty, William G; Kassel, W Scott; DuBois, Daniel L

    2011-12-01

    Hydrides of numerous transition metal complexes can be generated by the heterolytic cleavage of H(2) gas such that they offer alternatives to using main group hydrides in the regeneration of ammonia borane, a compound that has been intensely studied for hydrogen storage applications. Previously, we reported that HRh(dmpe)(2) (dmpe = 1,2-bis(dimethylphosphinoethane)) was capable of reducing a variety of BX(3) compounds having a hydride affinity (HA) greater than or equal to the HA of BEt(3). This study examines the reactivity of less expensive cobalt and nickel hydride complexes, HCo(dmpe)(2) and [HNi(dmpe)(2)](+), to form B-H bonds. The hydride donor abilities (ΔG(H(-))°) of HCo(dmpe)(2) and [HNi(dmpe)(2)](+) were positioned on a previously established scale in acetonitrile that is cross-referenced with calculated HAs of BX(3) compounds. The collective data guided our selection of BX(3) compounds to investigate and aided our analysis of factors that determine favorability of hydride transfer. HCo(dmpe)(2) was observed to transfer H(-) to BX(3) compounds with X = H, OC(6)F(5), and SPh. The reaction with B(SPh)(3) is accompanied by the formation of dmpe-(BH(3))(2) and dmpe-(BH(2)(SPh))(2) products that follow from a reduction of multiple B-SPh bonds and a loss of dmpe ligands from cobalt. Reactions between HCo(dmpe)(2) and B(SPh)(3) in the presence of triethylamine result in the formation of Et(3)N-BH(2)SPh and Et(3)N-BH(3) with no loss of a dmpe ligand. Reactions of the cationic complex [HNi(dmpe)(2)](+) with B(SPh)(3) under analogous conditions give Et(3)N-BH(2)SPh as the final product along with the nickel-thiolate complex [Ni(dmpe)(2)(SPh)](+). The synthesis and characterization of HCo(dedpe)(2) (dedpe = Et(2)PCH(2)CH(2)PPh(2)) from H(2) and a base is also discussed, including the formation of an uncommon trans dihydride species, trans-[(H)(2)Co(dedpe)(2)][BF(4)]. PMID:22040085

  16. Intermediate valence to single ion Kondo behaviour in CePd3Bx alloys

    International Nuclear Information System (INIS)

    Susceptibility, resistivity thermopower and magnetoresistivity data are presented for CePd3Bx alloys, where the boron enters the lattice interstitially. All the data are consistent with a smooth cross-over from intermediate valence in CePd3 to trivalent local moment behaviour in CePd3B0.3. For x3, but on reduced temperature scales. For 0.15≤x<0.3 the alloys obey single impurity Kondo theory, while the x=0.3 alloy is close to the localised limit. (orig.)

  17. Intracellular Distributing and Interferon-γ Secretion of Human Interleukin-18 in BxPC-3 Cells

    OpenAIRE

    Yang, Jin; Chen, Linlin; Xu, Bin; Xu, Jian; Sun, Jinquan; Shen, Wen; Zhang, Ting

    2014-01-01

    Objective: To investigate the characteristics of interleukin-18 (IL-18) in vitro, explore IL-18, interferon-γ (IFN-γ) and interleukin-2 (IL-2) secretive activity in BxPC-3 line cells with interleukin-18 mutants. Methods: Human IL-18 full-length gene (hIL-18-F) and the hIL-18 presumed mature protein gene (hIL-18-M) were inserted into the expression vector pEGFP-N1, to construct recombinant plasmids as Mu0, Mu1, Mu2, Mu3, and Mu4, and the recombinant plasmids were then transferred into BxPC-3 l...

  18. Time-series Doppler images and surface differential rotation of the effectively-single rapidly-rotating K-giant KU Pegasi

    CERN Document Server

    Kővári, Zs; Strassmeier, K G; Carroll, T A; Weber, M; Kriskovics, L; Oláh, K; Vida, K; Granzer, T

    2016-01-01

    According to most stellar dynamo theories, differential rotation (DR) plays a crucial role for the generation of toroidal magnetic fields. Numerical models predict surface differential rotation to be anti-solar for rapidly-rotating giant stars, i.e., their surface angular velocity could increase with stellar latitude. However, surface differential rotation has been derived only for a handful of individual giant stars to date. The spotted surface of the K-giant KU Pegasi is investigated in order to detect its time evolution and quantify surface differential rotation. We present altogether 11 Doppler images from spectroscopic data collected with the robotic telescope STELLA between 2006--2011. All maps are obtained with the surface reconstruction code iMap. Differential rotation is extracted from these images by detecting systematic (latitude-dependent) spot displacements. We apply a cross-correlation technique to find the best differential rotation law. The surface of KU Peg shows cool spots at all latitudes a...

  19. Prolonged expression of the BX1 signature enzyme is associated with a recombination hotspot in the benzoxazinoid gene cluster in Zea mays.

    Science.gov (United States)

    Zheng, Linlin; McMullen, Michael D; Bauer, Eva; Schön, Chris-Carolin; Gierl, Alfons; Frey, Monika

    2015-07-01

    Benzoxazinoids represent preformed protective and allelopathic compounds. The main benzoxazinoid in maize (Zea mays L.) is 2,4-dihydroxy-7-methoxy-1,4-benzoxazin-3-one (DIMBOA). DIMBOA confers resistance to herbivores and microbes. Protective concentrations are found predominantly in young plantlets. We made use of the genetic diversity present in the maize nested association mapping (NAM) panel to identify lines with significant benzoxazinoid concentrations at later developmental stages. At 24 d after imbibition (dai), only three lines, including Mo17, showed effective DIMBOA concentrations of 1.5mM or more; B73, by contrast, had low a DIMBOA content. Mapping studies based on Mo17 and B73 were performed to reveal mechanisms that influence the DIMBOA level in 24 dai plants. A major quantitative trait locus mapped to the Bx gene cluster located on the short arm of chromosome 4, which encodes the DIMBOA biosynthetic genes. Mo17 was distinguished from all other NAM lines by high transcriptional expression of the Bx1 gene at later developmental stages. Bx1 encodes the signature enzyme of the pathway. In Mo17×B73 hybrids at 24 dai, only the Mo17 Bx1 allele transcript was detected. A 3.9kb cis-element, termed DICE (distal cis-element), that is located in the Bx gene cluster approximately 140 kb upstream of Bx1, was required for high Bx1 transcript levels during later developmental stages in Mo17. The DICE region was a hotspot of meiotic recombination. Genetic analysis revealed that high 24 dai DIMBOA concentrations were not strictly dependent on high Bx1 transcript levels. However, constitutive expression of Bx1 in transgenics increased DIMBOA levels at 24 dai, corroborating a correlation between DIMBOA content and Bx1 transcription. PMID:25969552

  20. PHOEBE: PHysics Of Eclipsing BinariEs

    Science.gov (United States)

    Prsa, Andrej; Matijevic, Gal; Latkovic, Olivera; Vilardell, Francesc; Wils, Patrick

    2011-06-01

    PHOEBE (PHysics Of Eclipsing BinariEs) is a modeling package for eclipsing binary stars, built on top of the widely used WD program (Wilson & Devinney 1971). This introductory paper overviews most important scientific extensions (incorporating observational spectra of eclipsing binaries into the solution-seeking process, extracting individual temperatures from observed color indices, main-sequence constraining and proper treatment of the reddening), numerical innovations (suggested improvements to WD's Differential Corrections method, the new Nelder & Mead's downhill Simplex method) and technical aspects (back-end scripter structure, graphical user interface). While PHOEBE retains 100% WD compatibility, its add-ons are a powerful way to enhance WD by encompassing even more physics and solution reliability.

  1. Tank characterization report for single-shell tank 241-BX-110

    Energy Technology Data Exchange (ETDEWEB)

    RASMUSSEN, J.H.

    1999-02-23

    A major function of the Tank Waste Remediation System (TWRS) is to characterize waste in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis and other available information about a tank are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for single-shell tank 241-BX-110. The objectives of this report are (1) to use characterization data in response to technical issues associated with tank 241-BX-110 waste, and (2) to provide a standard characterization of the waste in terms of a best-basis inventory estimate. Section 2.0 summarizes the response to technical issues, Section 3.0 shows the best-basis inventory estimate, and Section 4.0 makes recommendations about the tank's safety status and additional sampling needs. The appendices contain supporting data and information. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1997), Milestone M-44-15b, change request M-44-97-03 to ''issue characterization deliverables consistent with the Waste Information Requirements Document developed for 1998.''

  2. Tank characterization report for single-shell tank 241-BX-110

    International Nuclear Information System (INIS)

    A major function of the Tank Waste Remediation System (TWRS) is to characterize waste in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis and other available information about a tank are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for single-shell tank 241-BX-110. The objectives of this report are (1) to use characterization data in response to technical issues associated with tank 241-BX-110 waste, and (2) to provide a standard characterization of the waste in terms of a best-basis inventory estimate. Section 2.0 summarizes the response to technical issues, Section 3.0 shows the best-basis inventory estimate, and Section 4.0 makes recommendations about the tank's safety status and additional sampling needs. The appendices contain supporting data and information. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1997), Milestone M-44-15b, change request M-44-97-03 to ''issue characterization deliverables consistent with the Waste Information Requirements Document developed for 1998.''

  3. Encounters of binaries

    International Nuclear Information System (INIS)

    Numerical integrations of encounters of pairs of binaries have been used to study the class of interactions, called fly-bys, in which the two-binary configuration survives. It is shown that these typically weak interactions can be treated by means of a first-order perturbation theory. A simple simulation model for obtaining the energy transfer rate between various degrees of freedom has been constructed. The model was employed to estimate the additional energy transfer arising from impact parameters larger than those used in the numerical experiments. In the hard binary limit the total energy transfer caused by binary-binary encounters is dominated by the collisional interactions in which the two-binary configuration is destroyed. (author)

  4. Interacting binary stars

    CERN Document Server

    Sahade, Jorge; Ter Haar, D

    1978-01-01

    Interacting Binary Stars deals with the development, ideas, and problems in the study of interacting binary stars. The book consolidates the information that is scattered over many publications and papers and gives an account of important discoveries with relevant historical background. Chapters are devoted to the presentation and discussion of the different facets of the field, such as historical account of the development in the field of study of binary stars; the Roche equipotential surfaces; methods and techniques in space astronomy; and enumeration of binary star systems that are studied

  5. 78 FR 55318 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2013-09-10

    ..., 2011), 76 FR 49807 (August 11, 2011) (SR-BX-2011-051). At this time, the new continuing education... system for the registration of associated persons of Exchange members that are not also FINRA members: (1... on the content outline for the Series 56 exam, which covers the main categories of rules...

  6. Supporting document for the North East Quandrant Historical Tank Content Estimate Report for BX-Tank Farm

    International Nuclear Information System (INIS)

    This supporting document provides historical in-depth characterization information gathered on BX-Tank Farm, such as historical waste transfer and level data, tank physical information, temperature data, sampling data, and drywell and liquid observation well data for Historical Tank Content Estimate Report of the NE Quandrant and the Hanford 200 East Areas

  7. 78 FR 39046 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Order Approving a Proposed Rule Change for...

    Science.gov (United States)

    2013-06-28

    ... 22, 2009), 74 FR 5014 (January 28, 2009) (SR-NYSE-2008-120) (order approving a joint venture between... advantage it may have because of its affiliation with the Exchange.\\20\\ \\20\\ See Notice, 78 FR 29796. In the... (May 15, 2013), 78 FR 29795 (``Notice''). II. Background BX Rule 2140(a) prohibits the Exchange or...

  8. 78 FR 15385 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing of Proposed Rule Change To...

    Science.gov (United States)

    2013-03-11

    ... Exchange Act Release No. 51759 (May 27, 2005), 70 FR 32860 (June 6, 2005) (SR-Phlx-2004-91). B. Self... COMMISSION Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing of Proposed Rule Change To.... Self-Regulatory Organization's Statement of the Terms of Substance of the Proposed Rule Change...

  9. 78 FR 76353 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2013-12-17

    ... costs associated with operating NOS, membership fees at away markets, Options Regulatory Fees (``ORFs... and technical costs associated with operating NOS, membership fees at away markets, ORFs and technical..., 2013), 78 FR 51242 (August 20, 2013) (SR-Topaz-2013-01). 2. Statutory Basis BX believes that...

  10. 78 FR 3053 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2013-01-15

    ... routing fee in addition to the away market's transaction fee. \\3\\ In addition to membership fees and... associated with operating the order router, membership fees at away markets, and technical costs associated... 26, 2012) 77 FR 39277 (July 2, 2012) (SR-BX-2012-030). The Exchange also believes that the...

  11. 77 FR 43883 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2012-07-26

    ... addition to membership fees and transaction fees, the Exchange also incurs an Options Regulatory Fee when... the order router, membership fees at away markets, and technical costs associated with routing.\\5\\ For... FR 405688 (July 10, 2012) (SR-BX-2012-043). Firm/market Exchange Customer maker/broker-...

  12. 76 FR 79734 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing of Proposed Rule Change...

    Science.gov (United States)

    2011-12-22

    ... the Act. C. Self-Regulatory Organization's Statement on Comments on the Proposed Rule Change Received... COMMISSION Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing of Proposed Rule Change Relating to Amending the BOX Trading Rules To Reduce the PIP From One Second to 100 Milliseconds...

  13. 78 FR 3924 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2013-01-17

    ... COMMISSION Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness of Proposed Rule Change To Reduce Fees Assessed for Certain Co-Location Services January 11, 2013. Pursuant to Section 19(b)(1) of the Securities Exchange Act of 1934 (``Act''),\\1\\ and Rule 19b-4...

  14. 76 FR 13676 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2011-03-14

    ... COMMISSION Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness... particular product, service, or piece of equipment. It should be noted, however, that the costs associated... nor received. III. Date of Effectiveness of the Proposed Rule Change and Timing for Commission...

  15. 75 FR 4129 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing of Proposed Rule Change To...

    Science.gov (United States)

    2010-01-26

    ... Organization's Statement of the Purpose of, and Statutory Basis for, the Proposed Rule Change In its filing...-Regulatory Organization's Statement of the Purpose of, and Statutory Basis for, the Proposed Rule Change 1... 27, 2009), 74 FR 106 (June 4, 2009) (SR-FINRA-2009-016). BX is adopting the new FINRA rule in...

  16. 75 FR 4438 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing of Proposed Rule Change To...

    Science.gov (United States)

    2010-01-27

    ...-Regulatory Organization's Statement of the Purpose of, and Statutory Basis for, the Proposed Rule Change In...), 74 FR 1069 (June 4, 2009) (SR-FINRA-2009-016). BX is adopting the new FINRA rule in full and is re... amended. C. Self-Regulatory Organization's Statement on Comments on the Proposed Rule Change Received...

  17. 78 FR 16746 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2013-03-18

    ... 4613. \\6\\ See Securities Exchange Act Release No. 67091 (May 31, 2012), 77 FR 33498 (June 6, 2012.... 67090 (May 31, 2012), 77 FR 33531 (June 6, 2012) (SR-BATS-2011-038; SR-BYX-2011- 025; SR-BX-2011-068; SR... response to the Regulation NMS Plan to Address Extraordinary Market Volatility, and paragraph (e) to...

  18. 77 FR 30576 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing of Proposed Rule Change With...

    Science.gov (United States)

    2012-05-23

    .... 64090 (March 17, 2011), 76 FR 16462 (March 23, 2011) (SR-BX-2011-007); 65514 (October 7, 2011), 76 FR... receiving responses to immediate or cancel (``IOC'') orders that it sent to the routing destination, and... systems issue does not exist), NES should receive an immediate response to an IOC order from a...

  19. Supporting document for the North East Quandrant Historical Tank Content Estimate Report for BX-Tank Farm

    Energy Technology Data Exchange (ETDEWEB)

    Brevick, C.H.

    1994-06-01

    This supporting document provides historical in-depth characterization information gathered on BX-Tank Farm, such as historical waste transfer and level data, tank physical information, temperature data, sampling data, and drywell and liquid observation well data for Historical Tank Content Estimate Report of the NE Quandrant and the Hanford 200 East Areas.

  20. 76 FR 64416 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2011-10-18

    ... COMMISSION Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness... neither solicited nor received. III. Date of Effectiveness of the Proposed Rule Change and Timing for... Commission will post all comments on the Commission's Internet website (...

  1. 75 FR 81687 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2010-12-28

    ... COMMISSION Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness... date of effectiveness of the Directed Order \\3\\ process (``Pilot Program'') from December 31, 2010, to... available on the Exchange's website at http://nasdaqomxbx.cchwallstreet.com/NASDAQOMXBX/Filings/ , on...

  2. 77 FR 62547 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing of Proposed Rule Change To...

    Science.gov (United States)

    2012-10-15

    ... decisions. \\14\\ See Securities Exchange Act Release No. 67220 (June 20, 2012), 77 FR 38422, 38425 (June 27... rules do not impose size requirements on any board committees, other than the audit committee, which... three-member compensation committee, in addition to a three- member audit committee. BX also...

  3. 78 FR 48748 - Self-Regulatory Organizations; NASDAQ OMX BX, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2013-08-09

    ... ``dividend, payment or distribution'' and including stock splits as an example of corporate actions covered... splits.\\11\\ In addition, BX is adding language to the rule to include symbol changes and changes in the... market hours. \\6\\ Securities Exchange Act Release No. 69456 (April 25, 2013), 78 FR 25510 (May 1,...

  4. The binary proletariat

    OpenAIRE

    Bolt, Nate

    2000-01-01

    In the endless quest to transform itself, capitalism has spawned a new working class. The proletariat was an essential product of the industrial revolution, and the lighter, more efficient capitalism of the digital revolution has created the Binary Proletariat.

  5. Eclipsing Binary Pulsars

    CERN Document Server

    Freire, P C C

    2004-01-01

    The first eclipsing binary pulsar, PSR B1957+20, was discovered in 1987. Since then, 13 other eclipsing low-mass binary pulsars have been found, 12 of these are in globular clusters. In this paper we list the known eclipsing binary pulsars and their properties, with special attention to the eclipsing systems in 47 Tuc. We find that there are two fundamentally different groups of eclipsing binary pulsars; separated by their companion masses. The less massive systems (M_c ~ 0.02 M_sun) are a product of predictable stellar evolution in binary pulsars. The systems with more massive companions (M_c ~ 0.2 M_sun) were formed by exchange encounters in globular clusters, and for that reason are exclusive to those environments. This class of systems can be used to learn about the neutron star recycling fraction in the globular clusters actively forming pulsars. We suggest that most of these binary systems are undetectable at radio wavelengths.

  6. Binary Evolutionary Models

    CERN Document Server

    Han, Z

    2008-01-01

    In this talk, we present the general principles of binary evolution and give two examples. The first example is the formation of subdwarf B stars (sdBs) and their application to the long-standing problem of ultraviolet excess (also known as UV-upturn) in elliptical galaxies. The second is for the progenitors of type Ia supernovae (SNe Ia). We discuss the main binary interactions, i.e., stable Roche lobe overflow (RLOF) and common envelope (CE) evolution, and show evolutionary channels leading to the formation of various binary-related objects. In the first example, we show that the binary model of sdB stars of Han et al. (2002, 2003) can reproduce field sdB stars and their counterparts, extreme horizontal branch (EHB) stars, in globular clusters. By applying the binary model to the study of evolutionary population synthesis, we have obtained an ``a priori'' model for the UV-upturn of elliptical galaxies and showed that the UV-upturn is most likely resulted from binary interactions. This has major implications...

  7. Extremely Energetic 4B/X17.2 Flare and Associated Phenomena

    Indian Academy of Sciences (India)

    Wahab Uddin; Ramesh Chandra; Syed Salman Ali

    2006-06-01

    We observed 4B/X17.2 flare in H from super-active region NOAA 10486 at ARIES, Nainital. This is one of the largest flares of current solar cycle 23, which occurred near the Sun’s center and produced extremely energetic emission almost at allwavelengths from -ray to radio-waves. The flare is associated with a bright/fast full-halo earth directed CME, strong type II, type III and type IV radio bursts, an intense proton event and GLE. This flare is well observed by SOHO, RHESSI and TRACE. Our H observations show the stretching/de-twisting and eruption of helically twisted S shaped (sigmoid) filament in the south–west direction of the active region with bright shock front followed by rapid increase in intensity and area of the gigantic flare. The flare shows almost similar evolution in H, EUV and UV. We measure the speed of H ribbon separation and the mean value is ∼ 70 km s-1. This is used together with photospheric magnetic field to infer a magnetic reconnection rate at three HXR sources at the flare maximum. In this paper, we also discuss the energetics of active region filament, flare and associated CME.

  8. Binary Neutron Star Mergers

    Directory of Open Access Journals (Sweden)

    Joshua A. Faber

    2012-07-01

    Full Text Available We review the current status of studies of the coalescence of binary neutron star systems. We begin with a discussion of the formation channels of merging binaries and we discuss the most recent theoretical predictions for merger rates. Next, we turn to the quasi-equilibrium formalisms that are used to study binaries prior to the merger phase and to generate initial data for fully dynamical simulations. The quasi-equilibrium approximation has played a key role in developing our understanding of the physics of binary coalescence and, in particular, of the orbital instability processes that can drive binaries to merger at the end of their lifetimes. We then turn to the numerical techniques used in dynamical simulations, including relativistic formalisms, (magneto-hydrodynamics, gravitational-wave extraction techniques, and nuclear microphysics treatments. This is followed by a summary of the simulations performed across the field to date, including the most recent results from both fully relativistic and microphysically detailed simulations. Finally, we discuss the likely directions for the field as we transition from the first to the second generation of gravitational-wave interferometers and while supercomputers reach the petascale frontier.

  9. Skewed Binary Search Trees

    DEFF Research Database (Denmark)

    Brodal, Gerth Stølting; Moruz, Gabriel

    2006-01-01

    It is well-known that to minimize the number of comparisons a binary search tree should be perfectly balanced. Previous work has shown that a dominating factor over the running time for a search is the number of cache faults performed, and that an appropriate memory layout of a binary search tree...... can reduce the number of cache faults by several hundred percent. Motivated by the fact that during a search branching to the left or right at a node does not necessarily have the same cost, e.g. because of branch prediction schemes, we in this paper study the class of skewed binary search trees. For...... all nodes in a skewed binary search tree the ratio between the size of the left subtree and the size of the tree is a fixed constant (a ratio of 1/2 gives perfect balanced trees). In this paper we present an experimental study of various memory layouts of static skewed binary search trees, where each...

  10. Isolation and Molecular Characterization of High Molecular Weight Glutenin Subunit Genes 1Bx13 and 1By16 from Hexaploid Wheat

    Institute of Scientific and Technical Information of China (English)

    Bin-Shuang Pang; Xue-Yong Zhang

    2008-01-01

    The high molecular weight glutenin subunit (HMW-GS) pair 1Bx13+1Byt6 are recognized to positively correlate with bread-making quality; however, their molecular data remain unknown. In order to reveal the mechanism by which 1By16 and 1Bx13 creates high quality, their open reading frames (ORFs) were amplified from common wheat Atlas66 and Jimai 20 using primers that were designed based on published sequences of HMW glutenin genes. The ORF of 1By16 was 2220bp, deduced into 738 amino acid residues with seven cysteines including 59 hexapeptides and 22 nanopeptides motifs. The ORF of 1Bx13 was 2385bp, deduced into 795 amino acid residues with four cysteines including 68 hexapeptides, 25 nanopeptides and six tripeptides motifs. We found that 1By16 was the largest y-type HMW glutenin gene described to date in common wheat. The 1By16 had 36 amino acid residues inserted in the central repetitive domain compared with 1By15. Expression in bacteria and western-blot tests confirmed that the sequence cloned was the ORF of HMW-GS 1By16, and that 1Bx13 was one of the largest 1Bx genes that have been described so far in common wheat, exhibiting a hexapeptide (PGQGQQ) insertion in the end of central repetitive domain compared with 1Bx7. A phylogenetic tree based on the deduced full-length amino acid sequence alignment of the published HMW-GS genes showed that the 1By16 was clustered with Glu-IB-2, and that the 1Bx13 was clustered with Glu-1B-1 alleles.

  11. Binary Popldation Synthcsis Study

    Institute of Scientific and Technical Information of China (English)

    HAN Zhanwen

    2011-01-01

    Binary population synthesis (BPS), an approach to evolving millions of stars (including binaries) simultaneously, plays a crucial role in our understanding of stellar physics, the structure and evolution of galaxies, and cosmology. We proposed and developed a BPS approach, and used it to investigate the formation of many peculiar stars such as hot subdwarf stars, progenitors of type la supernovae, barium stars, CH stars, planetary nebulae, double white dwarfs, blue stragglers, contact binaries, etc. We also established an evolution population synthesis (EPS) model, the Yunnan Model, which takes into account binary interactions for the first time. We applied our model for the origin of hot subdwarf stars in the study of elliptical galaxies and explained their far-UV radiation.

  12. Binary and Millisecond Pulsars

    Directory of Open Access Journals (Sweden)

    Lorimer Duncan R.

    2008-11-01

    Full Text Available We review the main properties, demographics and applications of binary and millisecond radio pulsars. Our knowledge of these exciting objects has greatly increased in recent years, mainly due to successful surveys which have brought the known pulsar population to over 1800. There are now 83 binary and millisecond pulsars associated with the disk of our Galaxy, and a further 140 pulsars in 26 of the Galactic globular clusters. Recent highlights include the discovery of the young relativistic binary system PSR J1906+0746, a rejuvination in globular cluster pulsar research including growing numbers of pulsars with masses in excess of 1.5M_⊙, a precise measurement of relativistic spin precession in the double pulsar system and a Galactic millisecond pulsar in an eccentric (e = 0.44 orbit around an unevolved companion.

  13. Binary and Millisecond Pulsars

    CERN Document Server

    Lorimer, D R

    2008-01-01

    We review the main properties, demographics and applications of binary and millisecond radio pulsars. Our knowledge of these exciting objects has greatly increased in recent years, mainly due to successful surveys which have brought the known pulsar population to over 1800. There are now 83 binary and millisecond pulsars associated with the disk of our Galaxy, and a further 140 pulsars in 26 of the Galactic globular clusters. Recent highlights include the discovery of the young relativistic binary system PSR J1906+0746, a rejuvination in globular cluster pulsar research including growing numbers of pulsars with masses in excess of 1.5 solar masses, a precise measurement of relativistic spin precession in the double pulsar system and a Galactic millisecond pulsar in an eccentric (e=0.44) orbit around an unevolved companion.

  14. Hypervelocity binary stars: smoking gun of massive binary black holes

    CERN Document Server

    Lu, Youjun; Lin, D N C

    2007-01-01

    The hypervelocity stars recently found in the Galactic halo are expelled from the Galactic center through interactions between binary stars and the central massive black hole or between single stars and a hypothetical massive binary black hole. In this paper, we demonstrate that binary stars can be ejected out of the Galactic center with velocities up to 10^3 km/s, while preserving their integrity, through interactions with a massive binary black hole. Binary stars are unlikely to attain such high velocities via scattering by a single massive black hole or through any other mechanisms. Based on the above theoretical prediction, we propose a search for binary systems among the hypervelocity stars. Discovery of hypervelocity binary stars, even one, is a definitive evidence of the existence of a massive binary black hole in the Galactic center.

  15. Milli-arcsecond Binaries

    CERN Document Server

    Torres, R M; Mioduszewki, A; Rodríguez, L F

    2008-01-01

    As part of an astrometric program, we have used the Very Long Baseline Array to measure the trigonometric parallax of several young stars in the Taurus and Ophiuchus star-forming regions with great accuracy. Additionally, we have obtained an unprecedented sample of high-resolution (~ 1 mas) images of several young stellar systems. These images revealed that about 70% of the stars in our sample are very tight binary stars (with separations of a few mas). Since it is highly unlikely that 70% of all stars are such tight binaries, we argue that selection effects are at work.

  16. Binary Cumulant Varieties

    CERN Document Server

    Sturmfels, Bernd

    2011-01-01

    Algebraic statistics for binary random variables is concerned with highly structured algebraic varieties in the space of 2x2x...x2-tensors. We demonstrate the advantages of representing such varieties in the coordinate system of binary cumulants. Our primary focus lies on hidden subset models. Parametrizations and implicit equations in cumulants are derived for hyperdeterminants, for secant and tangential varieties of Segre varieties, and for certain context-specific independence models. Extending work of Rota and collaborators, we explore the polynomial inequalities satisfied by cumulants.

  17. Formation of binary radio pulsars

    International Nuclear Information System (INIS)

    In the framework of the standard scenario of the evolution of massive binary stars a study is made of the formation of final binary systems in which at least one of the components is a neutron star. It is found that about every fortieth radio pulsar must be a member of a close binary system. This is confirmed by observations. Radio pulsars are not formed in wide binary systems, possibly because of the very slow rotation of the presupernova stars

  18. Compressing Binary Decision Diagrams

    DEFF Research Database (Denmark)

    Hansen, Esben Rune; Satti, Srinivasa Rao; Tiedemann, Peter

    The paper introduces a new technique for compressing Binary Decision Diagrams in those cases where random access is not required. Using this technique, compression and decompression can be done in linear time in the size of the BDD and compression will in many cases reduce the size of the BDD to 1...

  19. Equational binary decision diagrams

    NARCIS (Netherlands)

    Groote, J.F.; Pol, J.C. van de

    2000-01-01

    We incorporate equations in binary decision diagrams (BDD). The resulting objects are called EQ-BDDs. A straightforward notion of ordered EQ-BDDs (EQ-OBDD) is defined, and it is proved that each EQ-BDD is logically equivalent to an EQ-OBDD. Moreover, on EQ-OBDDs satisfiability and tautology checkin

  20. IP Pegasi Investigation of the accretion disk structure. Searching evidences for spiral shocks in the quiescent accretion disk

    CERN Document Server

    Neustroev, V V; Barwig, H; Bobinger, A; Mantel, K H; Simic, D; Wolf, S

    2002-01-01

    We present the results of spectral investigations of the cataclysmic variable IP Peg in quiescence. Optical spectra obtained on the 6-m telescope at the Special Astrophysical Observatory (Russia), and on the 3.5-m telescope at the German-Spanish Astronomical Center (Calar Alto, Spain), have been analysed by means of Doppler tomography and Phase Modelling Technique. From this analysis we conclude that the quiescent accretion disk of IP Peg has a complex structure. There are also explicit indications of spiral shocks. The Doppler maps and the variations of the peak separation of the emission lines confirm this interpretation. We have detected that all the emission lines show a rather considerable asymmetry of their wings varying with time. The wing asymmetry shows quasi-periodic modulations with a period much shorter than the orbital one. This indicates the presence of an emission source in the binary rotating asynchronously with the binary system. We also have found that the brightness of the bright spot chang...

  1. Hα Line Polarization in the 2B/X4.8 Flare of 2002 July 23

    Institute of Scientific and Technical Information of China (English)

    Zhi Xu; N. M. Firstova; Qing-Rong Chen; Cheng Fang

    2003-01-01

    On 2002 July 23, a 2B/X4.8 flare was observed in the Hα line spec-tropolarimetrically by the Large Solar Vacuum Telescope of Baikal AstrophysicalObservatory. Linear polarization of 3%-10% was detected in the Hα line, particu-larly where the line showed central reversal. The linear polarization is mainly radialon the solar disk and appears at the impulsive phase of the hard X-ray and γ-raybursts. It is limited to some relatively small regions of the flare. The polarizationin a limited small region (~ 4″ - 5″) changed its direction within a short period oftime (~ 10s).

  2. Dissemination of the highly expressed Bx7 glutenin subunit (Glu-B1al allele) in wheat as revealed by novel PCR markers and RP-HPLC.

    Science.gov (United States)

    Butow, B J; Gale, K R; Ikea, J; Juhász, A; Bedö, Z; Tamás, L; Gianibelli, M C

    2004-11-01

    Increased expression of the high molecular weight glutenin subunit (HMW-GS) Bx7 is associated with improved dough strength of wheat (Triticum aestivum L.) flour. Several cultivars and landraces of widely different genetic backgrounds from around the world have now been found to contain this so-called 'over-expressing' allelic form of the Bx7 subunit encoded by Glu-B1al. Using three methods of identification, SDS-PAGE, RP-HPLC and PCR marker analysis, as well as pedigree information, we have traced the distribution and source of this allele from a Uruguayan landrace, Americano 44D, in the mid-nineteenth century. Results are supported by knowledge of the movement of wheat lines with migrants. All cultivars possessing the Glu-B1al allele can be identified by the following attributes: (1) the elution of the By sub-unit peak before the Dx sub-unit peak by RP-HPLC, (2) high expression levels of Bx7 (>39% Mol% Bx), (3) a 43 bp insertion in the matrix-attachment region (MAR) upstream of the gene promoter relative to Bx7 and an 18 bp nucleotide duplication in the coding region of the gene. Evidence is presented indicating that these 18 and 43 bp sequence insertions are not causal for the high expression levels of Bx7 as they were also found to be present in a small number of hexaploid species, including Chinese Spring, and species expressing Glu-B1ak and Glu-B1a alleles. In addition, these sequence inserts were found in different isolates of the tetraploid wheat, T. turgidum, indicating that these insertion/deletion events occurred prior to hexaploidization. PMID:15340686

  3. Binary MEMS gas sensors

    International Nuclear Information System (INIS)

    A novel sensing mechanism for electrostatic MEMS that employs static bifurcation-based sensing and binary detection is demonstrated. It is implemented as an ethanol vapour sensor that exploits the static pull-in bifurcation. Sensor detection of 5 ppm of ethanol vapour in dry nitrogen, equivalent to a detectable mass of 165 pg, is experimentally demonstrated. Sensor robustness to external disturbances is also demonstrated. A closed-form expression for the sensitivity of statically detected electrostatic MEMS sensors is derived. It is shown that the sensitivity of static bifurcation-based binary electrostatic MEMS sensors represents an upper bound on the sensitivity of static detection for given sensor dimensions and material properties. (paper)

  4. Binary Tetrahedral Flavor Symmetry

    CERN Document Server

    Eby, David A

    2013-01-01

    A study of the T' Model and its variants utilizing Binary Tetrahedral Flavor Symmetry. We begin with a description of the historical context and motivations for this theory, together with some conceptual background for added clarity, and an account of our theory's inception in previous works. Our model endeavors to bridge two categories of particles, leptons and quarks, a unification made possible by the inclusion of additional Higgs particles, shared between the two fermion sectors and creating a single coherent system. This is achieved through the use of the Binary Tetrahedral symmetry group and an investigation of the Tribimaximal symmetry evidenced by neutrinos. Our work details perturbations and extensions of this T' Model as we apply our framework to neutrino mixing, quark mixing, unification, and dark matter. Where possible, we evaluate model predictions against experimental results and find excellent matching with the atmospheric and reactor neutrino mixing angles, an accurate prediction of the Cabibb...

  5. Compressing Binary Decision Diagrams

    CERN Document Server

    Hansen, Esben Rune; Tiedemann, Peter

    2008-01-01

    The paper introduces a new technique for compressing Binary Decision Diagrams in those cases where random access is not required. Using this technique, compression and decompression can be done in linear time in the size of the BDD and compression will in many cases reduce the size of the BDD to 1-2 bits per node. Empirical results for our compression technique are presented, including comparisons with previously introduced techniques, showing that the new technique dominate on all tested instances.

  6. Headspace vapor characterization of Hanford waste Tank 241-BX-110: Results from samples collected on 04/30/96

    Energy Technology Data Exchange (ETDEWEB)

    Evans, J.C.; Pool, K.H.; Thomas, B.L.; Olsen, K.B.; Fruchter, J.S.; Silvers, K.L.

    1997-01-01

    This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-BX-110 (Tank BX-110) at the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Analyte concentrations were based on analytical results and, where appropriate, sample volumes provided by WHC. A summary of the inorganic analytes, permanent gases, and total non-methane organic compounds is listed in a table. The three highest concentration analytes detected in SUMMA{trademark} canister and triple sorbent trap samples are also listed in the table. Detailed descriptions of the analytical results appear in the appendices.

  7. RCRA Assessment Plan for Single-Shell Tank Waste Management Area B-BX-BY at the Hanford Site

    Energy Technology Data Exchange (ETDEWEB)

    Narbutovskih, Susan M.

    2006-09-29

    This document was prepared as a groundwater quality assessment plan revision for the single-shell tank systems in Waste Management Area B-BX-BY at the Hanford Site. Groundwater monitoring is conducted at this facility in accordance with 40 CFR Part 265, Subpart F. In FY 1996, the groundwater monitoring program was changed from detection-level indicator evaluation to a groundwater quality assessment program when elevated specific conductance in downgradient monitoring well 299 E33-32 was confirmed by verification sampling. During the course of the ensuing investigation, elevated technetium-99 and nitrate were observed above the drinking water standard at well 299-E33-41, a well located between 241-B and 241-BX Tank Farms. Earlier observations of the groundwater contamination and tank farm leak occurrences combined with a qualitative analysis of possible solutions, led to the conclusion that waste from the waste management area had entered the groundwater and were observed in this well. Based on 40 CFR 265.93 [d] paragraph (7), the owner-operator must continue to make the minimum required determinations of contaminant level and rate/extent of migrations on a quarterly basis until final facility closure. These continued determinations are required because the groundwater quality assessment was implemented prior to final closure of the facility.

  8. Headspace vapor characterization of Hanford waste Tank 241-BX-110: Results from samples collected on 04/30/96

    International Nuclear Information System (INIS)

    This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-BX-110 (Tank BX-110) at the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Analyte concentrations were based on analytical results and, where appropriate, sample volumes provided by WHC. A summary of the inorganic analytes, permanent gases, and total non-methane organic compounds is listed in a table. The three highest concentration analytes detected in SUMMA trademark canister and triple sorbent trap samples are also listed in the table. Detailed descriptions of the analytical results appear in the appendices

  9. Binary-Signal Recovery

    Science.gov (United States)

    Griebeler, Elmer L.

    2011-01-01

    Binary communication through long cables, opto-isolators, isolating transformers, or repeaters can become distorted in characteristic ways. The usual solution is to slow the communication rate, change to a different method, or improve the communication media. It would help if the characteristic distortions could be accommodated at the receiving end to ease the communication problem. The distortions come from loss of the high-frequency content, which adds slopes to the transitions from ones to zeroes and zeroes to ones. This weakens the definition of the ones and zeroes in the time domain. The other major distortion is the reduction of low frequency, which causes the voltage that defines the ones or zeroes to drift out of recognizable range. This development describes a method for recovering a binary data stream from a signal that has been subjected to a loss of both higher-frequency content and low-frequency content that is essential to define the difference between ones and zeroes. The method makes use of the frequency structure of the waveform created by the data stream, and then enhances the characteristics related to the data to reconstruct the binary switching pattern. A major issue is simplicity. The approach taken here is to take the first derivative of the signal and then feed it to a hysteresis switch. This is equivalent in practice to using a non-resonant band pass filter feeding a Schmitt trigger. Obviously, the derivative signal needs to be offset to halfway between the thresholds of the hysteresis switch, and amplified so that the derivatives reliably exceed the thresholds. A transition from a zero to a one is the most substantial, fastest plus movement of voltage, and therefore will create the largest plus first derivative pulse. Since the quiet state of the derivative is sitting between the hysteresis thresholds, the plus pulse exceeds the plus threshold, switching the hysteresis switch plus, which re-establishes the data zero to one transition

  10. Massive Black Hole Binary Evolution

    Directory of Open Access Journals (Sweden)

    Merritt David

    2005-11-01

    Full Text Available Coalescence of binary supermassive black holes (SBHs would constitute the strongest sources of gravitational waves to be observed by LISA. While the formation of binary SBHs during galaxy mergers is almost inevitable, coalescence requires that the separation between binary components first drop by a few orders of magnitude, due presumably to interaction of the binary with stars and gas in a galactic nucleus. This article reviews the observational evidence for binary SBHs and discusses how they would evolve. No completely convincing case of a bound, binary SBH has yet been found, although a handful of systems (e.g. interacting galaxies; remnants of galaxy mergers are now believed to contain two SBHs at projected separations of <~ 1kpc. N-body studies of binary evolution in gas-free galaxies have reached large enough particle numbers to reproduce the slow, “diffusive” refilling of the binary’s loss cone that is believed to characterize binary evolution in real galactic nuclei. While some of the results of these simulations - e.g. the binary hardening rate and eccentricity evolution - are strongly N-dependent, others - e.g. the “damage” inflicted by the binary on the nucleus - are not. Luminous early-type galaxies often exhibit depleted cores with masses of ~ 1-2 times the mass of their nuclear SBHs, consistent with the predictions of the binary model. Studies of the interaction of massive binaries with gas are still in their infancy, although much progress is expected in the near future. Binary coalescence has a large influence on the spins of SBHs, even for mass ratios as extreme as 10:1, and evidence of spin-flips may have been observed.

  11. Biclustering Sparse Binary Genomic Data

    OpenAIRE

    Van Uitert, M.; Meuleman, W.; Wessels, L. F. A.

    2008-01-01

    Genomic datasets often consist of large, binary, sparse data matrices. In such a dataset, one is often interested in finding contiguous blocks that (mostly) contain ones. This is a biclustering problem, and while many algorithms have been proposed to deal with gene expression data, only two algorithms have been proposed that specifically deal with binary matrices. None of the gene expression biclustering algorithms can handle the large number of zeros in sparse binary matrices. The two propos...

  12. Evolution of Close Binary Systems

    Energy Technology Data Exchange (ETDEWEB)

    Yakut, K; Eggleton, P

    2005-01-24

    We collected data on the masses, radii, etc. of three classes of close binary stars: low-temperature contact binaries (LTCBs), near-contact binaries (NCBs), and detached close binaries (DCBs). They restrict themselves to systems where (1) both components are, at least arguably, near the Main Sequence, (2) the periods are less than a day, and (3) there is both spectroscopic and photometric analysis leading to reasonably reliable data. They discuss the possible evolutionary connections between these three classes, emphasizing the roles played by mass loss and angular momentum loss in rapidly-rotating cool stars.

  13. 45-day safety screening results and final report for Tank 241-BX-106, auger samples 95-AUG-049 and 95-AUG-050

    International Nuclear Information System (INIS)

    Two Auger Samples from tank 241-BX-106 were received at the 222-S Laboratory and underwent safety screening analyses - differential scanning calorimetry (DSC), thermogravimetric analysis (TGA), total alpha analysis, and bulk density measurements - in accordance with the sampling and analysis plan

  14. Report IAU Comm. 42, Close Binary Stars

    OpenAIRE

    Ribas, Ignasi; Scarfe, Colin D.; Torres, Guillermo; Rucinski, Slavek M.; Sion, Edward M.; Richards, Mercedes T.; Niarchos, Panayiotis; Olah, Katalin

    2008-01-01

    Brief summaries are given about (1) close binary research from the perspective of the Bibliography of Close Binaries, (2) low-mass binaries and model discrepancies, (3) W UMa-type binaries, (4) cataclysmic variables, (5) Algol binaries, (6) the oEA stars, (7) effects of binarity on stellar activity.

  15. Low autocorrelation binary sequences

    Science.gov (United States)

    Packebusch, Tom; Mertens, Stephan

    2016-04-01

    Binary sequences with minimal autocorrelations have applications in communication engineering, mathematics and computer science. In statistical physics they appear as groundstates of the Bernasconi model. Finding these sequences is a notoriously hard problem, that so far can be solved only by exhaustive search. We review recent algorithms and present a new algorithm that finds optimal sequences of length N in time O(N {1.73}N). We computed all optimal sequences for N≤slant 66 and all optimal skewsymmetric sequences for N≤slant 119.

  16. Characterization of Direct-Push Vadose Zone Sediments from the 241-B and 241-BX Tank Farms

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Christopher F.; Icenhower, Jonathan P.; Um, Wooyong; Bjornstad, Bruce N.; Valenta, Michelle M.; Iovin, Cristian; Lanigan, David C.; Clayton, Ray E.; Geiszler, Keith N.; Clayton, Eric T.; Kutnyakov, Igor V.; Baum, Steven R.; Lindberg, Michael J.; Orr, Robert D.

    2007-12-21

    Geochemical tests provide evidence for the transit of a plume of caustic waste solution through the sediment column at the Hanford 241-B and -BX Tank Farms. Direct-push samples recovered from boreholes surrounding Tanks 241-B-110 and 241-BX-102 and related waste transfer lines and diversion boxes included sediments typical of those previously recovered from other localities on the Hanford Site. The Hanford formation sediments are dominantly quartzo-feldspathic sands strewn with lithic fragments, displaying a range of particle size distributions and sorting characteristics. Some moderately well-sorted, fine-grained lithologies are interpreted as lenticular bodies irregularly dispersed in coarser-grained, more poorly sorted sediments. Tier I tests conducted on the vadose zone sediments revealed an inverse correlation between moisture content and sediment size fraction (i.e., there is greater moisture content in finer-grained sediments). The Tier I tests also showed that the pore water solutions were likely sodium-rich, moderately saline, and possessed higher pH values than background (untainted) sediments. These data are characteristic of sediments that have encountered sodium-rich, saline, caustic waste solution, as documented in other reports at other suspect contamination sites around Hanford. Analyses of solutions from 1:1 water extracts reveal relatively balanced cation and anion concentrations, indicating that most of the geochemical species have been accounted for. The water extract data for affected sediments also indicate unusually high concentrations of aluminum, iron, and phosphorus. The relatively high concentrations of aluminum and iron may be the result of dissolution of secondary amorphous phases that precipitated after a reactive plume partially dissolved aluminum- and iron-bearing phases as it migrated through the sediment column. On the other hand, the presence of elevated concentrations of phosphorous may be the tell-tale signature of wastes

  17. Borehole data package for wells 299-E33-334 and 299-E33-335 at single-shell tank waste management Area B-BX-BY

    International Nuclear Information System (INIS)

    Two new Resource Conservation and Recovery Act (RCRA) groundwater monitoring wells were installed at the single-shell tank farm Waste Management Area (WMA) B-BX-BY during December 1999 through February 2000 in fulfillment of Tri-Party Agreement (Ecology 1996) Milestone M-24-45. The wells are 299-E33-334 and 299-E33-335. These wells were installed in support of the WMA B-BX-BY assessment to track the movement of contaminant plumes that appear to be entering the WMA from the northeast. Well 299-E33-334 is located outside the southwest comer of the 241-BX tank farm and well 299-E33-335 is located south of the 241-BX tank farm. The locations of all wells in the extended monitoring network for WMA B-BX-BY are shown in a figure. The new wells were constructed to the specifications and requirements described in Washington Administrative Code (WAC) 173-160 and WAC 173-303, in the assessment groundwater monitoring plan (Narbutovskih 2000), and in the description of work for well drilling and installation. This document compiles information on the drilling, construction, well development, pump installation, and sampling activities applicable to wells 299-E33-334 and 299-E33-335. Appendix A contains copies of the Well Summary Sheets (as-built diagrams), the Well Construction Summary Reports, and the geologist's logs. Appendix B contains results of laboratory analyses of moisture content on samples from 299-E33-334 (moisture data were not collected from well 299-E33-335). Appendix C contains borehole geophysical logs and Appendix D contains analytical results from groundwater samples obtained during well construction. Additional documentation concerning well construction is on file with Bechtel Hanford, Inc

  18. Magnetic binary nanofillers

    International Nuclear Information System (INIS)

    Magnetic binary nanofillers containing multiwall carbon nanotubes (MWCNT) and hercynite were synthesized by Chemical Vapor Deposition (CVD) on Fe/AlOOH prepared by the sol-gel method. The catalyst precursor was fired at 450 °C, ground and sifted through different meshes. Two powders were obtained with different particle sizes: sample A (50-75 μm) and sample B (smaller than 50 μm). These powders are composed of iron oxide particles widely dispersed in the non-crystalline matrix of aluminum oxide and they are not ferromagnetic. After reduction process the powders are composed of α-Fe nanoparticles inside hercynite matrix. These nanofillers are composed of hercynite containing α-Fe nanoparticles and MWCNT. The binary magnetic nanofillers were slightly ferromagnetic. The saturation magnetization of the nanofillers depended on the powder particle size. The nanofiller obtained from powder particles in the range 50-75 μm showed a saturation magnetization 36% higher than the one formed from powder particles smaller than 50 μm. The phenomenon is explained in terms of changes in the magnetic environment of the particles as consequence of the presence of MWCNT.

  19. Computing on Binary Strings

    CERN Document Server

    Bu, Tian-Ming; Zhang, Peng

    2011-01-01

    Many problems in Computer Science can be abstracted to the following question: given a set of objects and rules respectively, which new objects can be produced? In the paper, we consider a succinct version of the question: given a set of binary strings and several operations like conjunction and disjunction, which new binary strings can be generated? Although it is a fundamental problem, to the best of our knowledge, the problem hasn't been studied yet. In this paper, an O(m^2n) algorithm is presented to determine whether a string s is representable by a set W, where n is the number of strings in W and each string has the same length m. However, looking for the minimum subset from a set to represent a given string is shown to be NP-hard. In addition, we prove that counting the number of strings representable is #P-complete. But if the operator negation can be used, the number is some power of 2. This di?erence maybe help us understand the problem more profoundly.

  20. Mesothelin抗体修饰的纳米探针对人胰腺癌细胞BxPC3的体外靶向研究%In vitro study on mesothelin antibody-tagged nanoprobe targeting human pancreatic cell line BxPC3

    Institute of Scientific and Technical Information of China (English)

    卢明智; 乐文俊; 崔少斌; 孙兵妹; 陈炳地; 邵成伟

    2014-01-01

    目的 探讨间皮素(Mesothelin)抗体修饰的荧光纳米Fe3O4@SiO2探针对人胰腺癌细胞BxPC3的靶向性能.方法 经St(o)ber法制备Fe3O4@SiO2磁核,再依次交联CdTe量子点和Mesothelin抗体,获得靶向荧光Fe3O4@SiO2纳米探针.在体外将荧光纳米Fe3O4@SiO2探针与BxPC3细胞共孵育30 min,以低表达Mesothelin的HepG-2和K562细胞作为对照,通过电荷耦合器件(CCD)成像系统和磁分离技术评估探针与癌细胞的靶向吸附性能.结果 制备的荧光纳米Fe3O4@SiO2探针颗粒大小均匀,粒径主要为120 ~ 140 nm.未交联抗体的探针与BxPC3、HepG-2、K562细胞的吸附效率均低于20%,为非特异性吸附.交联Mesothelin抗体的探针与BxPC3、HepG-2、K562细胞的吸附效率分别为(53.9±1.8)%、(8.0±2.1)%、(8.9±2.3)%,其与BxPC3细胞的吸附能力显著提高.结论 Mesothelin抗体修饰的纳米探针可有效识别高表达Mesothelin的BxPC3细胞.%Objective To observe the targeted function of a mesothelin antibody modified nanoprobe in human pancreatic cancer BxPC3 cell.Methods The Fe3O4@SiO2 nanoprobe was prepared by St(o)ber method,and then quantum dots (CdTe) and mesothelin antibody was crosslinked to obtain the properties of targeting and fluorescent.Fluorescent nano Fe3O4@SiO2 probes and BxPC3 cells were incubated in vitro for 30 min.Its targeting performance was tested by the CCD imaging system and magnetic separation technology.HepG-2 and K562 cells with low expression of mesothelin were selected as reference cells.Results This preparation method of nanoprobe could produce a uniform and narrow distribution particle with particle size mainly ranging from 120 to 140 nm.The cell adsorption experiments showed that the adsorption efficiency of BxPC3,HepG-2 and K562 by nanoprobe without crosslinking antibody were less than 20%,as a non-specific adsorption; and the adsorption efficiency of BxPC3,HepG-2 and K562 by crosslinking mesothelin antibody nanoprobe were (53.9

  1. Relativistic Binaries in Globular Clusters

    Directory of Open Access Journals (Sweden)

    Benacquista Matthew J.

    2006-02-01

    Full Text Available The galactic population of globular clusters are old, dense star systems, with a typical cluster containing 10^4 - 10^7 stars. As an old population of stars, globular clusters contain many collapsed and degenerate objects. As a dense population of stars, globular clusters are the scene of many interesting close dynamical interactions between stars. These dynamical interactions can alter the evolution of individual stars and can produce tight binary systems containing one or two compact objects. In this review, we discuss the theoretical models of globular cluster evolution and binary evolution, techniques for simulating this evolution which lead to relativistic binaries, and current and possible future observational evidence for this population. Globular cluster evolution will focus on the properties that boost the production of hard binary systems and on the tidal interactions of the galaxy with the cluster, which tend to alter the structure of the globular cluster with time. The interaction of the components of hard binary systems alters the evolution of both bodies and can lead to exotic objects. Direct N-body integrations and Fokker-Planck simulations of the evolution of globular clusters that incorporate tidal interactions and lead to predictions of relativistic binary populations are also discussed. We discuss the current observational evidence for cataclysmic variables, millisecond pulsars, and low-mass X-ray binaries as well as possible future detection of relativistic binaries with gravitational radiation.

  2. Relativistic Binaries in Globular Clusters

    Directory of Open Access Journals (Sweden)

    Matthew J. Benacquista

    2013-03-01

    Full Text Available Galactic globular clusters are old, dense star systems typically containing 10^4 – 10^6 stars. As an old population of stars, globular clusters contain many collapsed and degenerate objects. As a dense population of stars, globular clusters are the scene of many interesting close dynamical interactions between stars. These dynamical interactions can alter the evolution of individual stars and can produce tight binary systems containing one or two compact objects. In this review, we discuss theoretical models of globular cluster evolution and binary evolution, techniques for simulating this evolution that leads to relativistic binaries, and current and possible future observational evidence for this population. Our discussion of globular cluster evolution will focus on the processes that boost the production of tight binary systems and the subsequent interaction of these binaries that can alter the properties of both bodies and can lead to exotic objects. Direct N-body integrations and Fokker–Planck simulations of the evolution of globular clusters that incorporate tidal interactions and lead to predictions of relativistic binary populations are also discussed. We discuss the current observational evidence for cataclysmic variables, millisecond pulsars, and low-mass X-ray binaries as well as possible future detection of relativistic binaries with gravitational radiation.

  3. PERIODIC COMPLEMENTARY BINARY SEQUENCE PAIRS

    Institute of Scientific and Technical Information of China (English)

    XuChengqian; ZhaoXiaoqun

    2002-01-01

    A new set of binary sequences-Periodic Complementary Binary Sequence Pair (PCSP)is proposed .A new class of block design-Difference Family Pair (DFP)is also proposed .The relationship between PCSP and DFP,the properties and exising conditions of PCSP and the recursive constructions for PCSP are given.

  4. PERIODIC COMPLEMENTARY BINARY SEQUENCE PAIRS

    Institute of Scientific and Technical Information of China (English)

    Xu Chengqian; Zhao Xiaoqun

    2002-01-01

    A new set of binary sequences-Periodic Complementary Binary Sequence Pair (PCSP) is proposed. A new class of block design-Difference Family Pair (DFP) is also proposed.The relationship between PCSP and DFP, the properties and existing conditions of PCSP and the recursive constructions for PCSP are given.

  5. Groundwater quality assessment plan for single-shell waste management area B-BX-BY at the Hanford Site

    International Nuclear Information System (INIS)

    Pacific Northwest National Laboratory conducted a first determination groundwater quality assessment at the Hanford Site. This work was performed for the US Department of Energy, Richland Operations Office, in accordance with the Federal Facility Compliance Agreement during the time period 1996--1998. The purpose of the assessment was to determine if waste from the Single-Shell Tank (SST) Waste Management Area (WMA) B-BX-BY had entered the groundwater at levels above the drinking water standards (DWS). The resulting assessment report documented evidence demonstrating that waste from the WMA has, most likely, impacted groundwater quality. Based on 40 CFR 265.93 [d] paragraph (7), the owner-operator must continue to make the minimum required determinations of contaminant level and of rate/extent of migrations on a quarterly basis until final facility closure. These continued determinations are required because the groundwater quality assessment was implemented prior to final closure of the facility

  6. Groundwater quality assessment plan for single-shell waste management area B-BX-BY at the Hanford Site

    Energy Technology Data Exchange (ETDEWEB)

    SM Narbutovskih

    2000-03-31

    Pacific Northwest National Laboratory conducted a first determination groundwater quality assessment at the Hanford Site. This work was performed for the US Department of Energy, Richland Operations Office, in accordance with the Federal Facility Compliance Agreement during the time period 1996--1998. The purpose of the assessment was to determine if waste from the Single-Shell Tank (SST) Waste Management Area (WMA) B-BX-BY had entered the groundwater at levels above the drinking water standards (DWS). The resulting assessment report documented evidence demonstrating that waste from the WMA has, most likely, impacted groundwater quality. Based on 40 CFR 265.93 [d] paragraph (7), the owner-operator must continue to make the minimum required determinations of contaminant level and of rate/extent of migrations on a quarterly basis until final facility closure. These continued determinations are required because the groundwater quality assessment was implemented prior to final closure of the facility.

  7. Pairing mechanisms for binary stars

    CERN Document Server

    Kouwenhoven, M B N; Goodwin, S P; Zwart, S F Portegies; Kaper, L; 10.1002/asna.200811061

    2008-01-01

    Knowledge of the binary population in stellar groupings provides important information about the outcome of the star forming process in different environments. Binarity is also a key ingredient in stellar population studies and is a prerequisite to calibrate the binary evolution channels. In these proceedings we present an overview of several commonly used methods to pair individual stars into binary systems, which we refer to as the pairing function. Many pairing functions are frequently used by observers and computational astronomers, either for the mathematical convenience, or because they roughly describe the expected outcome of the star forming process. We discuss the consequences of each pairing function for the interpretation of observations and numerical simulations. The binary fraction and mass ratio distribution generally depend strongly on the selection of the range in primary spectral type in a sample. These quantities, when derived from a binary survey with a mass-limited sample of target stars, ...

  8. Planets in Binary Star Systems

    CERN Document Server

    Haghighipour, Nader

    2010-01-01

    The discovery of extrasolar planets over the past decade has had major impacts on our understanding of the formation and dynamical evolution of planetary systems. There are features and characteristics unseen in our solar system and unexplainable by the current theories of planet formation and dynamics. Among these new surprises is the discovery of planets in binary and multiple-star systems. The discovery of such "binary-planetary" systems has confronted astrodynamicists with many new challenges, and has led them to re-examine the theories of planet formation and dynamics. Among these challenges are: How are planets formed in binary star systems? What would be the notion of habitability in such systems? Under what conditions can binary star systems have habitable planets? How will volatiles necessary for life appear on such planets? This volume seeks to gather the current research in the area of planets in binary and multistar systems and to familiarize readers with its associated theoretical and observation...

  9. Towards Physarum Binary Adders

    CERN Document Server

    Jones, Jeff; 10.1016/j.biosystems.2010.04.005

    2010-01-01

    Plasmodium of \\emph{Physarum polycephalum} is a single cell visible by unaided eye. The plasmodium's foraging behaviour is interpreted in terms of computation. Input data is a configuration of nutrients, result of computation is a network of plasmodium's cytoplasmic tubes spanning sources of nutrients. Tsuda et al (2004) experimentally demonstrated that basic logical gates can be implemented in foraging behaviour of the plasmodium. We simplify the original designs of the gates and show --- in computer models --- that the plasmodium is capable for computation of two-input two-output gate $ \\to $ and three-input two-output $ \\to $. We assemble the gates in a binary one-bit adder and demonstrate validity of the design using computer simulation.

  10. Eccentric Binary Millisecond Pulsars

    CERN Document Server

    Freire, Paulo C C

    2009-01-01

    In this paper we review the recent discovery of several millisecond pulsars (MSPs) in eccentric binary systems. Timing these MSPs we were able to estimate (and in one case precisely measure) their masses. These results suggest that, as a class, MSPs have a much wider range of masses (1.3 to > 2 solar masses) than the normal and mildly recycled pulsars found in double neutron star (DNS) systems (1.25 < Mp < 1.44 solar masses). This is very likely to be due to the prolonged accretion episode that is thought to be required to form a MSP. The likely existence of massive MSPs makes them a powerful probe for understanding the behavior of matter at densities larger than that of the atomic nucleus; in particular, the precise measurement of the mass of PSR J1903+0327 ($1.67 +/- 0.01 solar masses) excludes several "soft" equations of state for dense matter.

  11. Binaries and distances

    Science.gov (United States)

    Pourbaix, D.; Arenou, F.; Halbwachs, J.-L.; Siopis, C.

    2013-02-01

    Gaia's five-year observation baseline might naively lead to the expectation that it will be possible to fit the parallax of any sufficiently nearby object with the default five-parameter model (position at a reference epoch, parallax and proper motion). However, simulated Gaia observations of a `model Universe' composed of nearly 107 objects, 50% of which turn out to be multiple stars, show that the single-star hypothesis can severely affect parallax estimation and that more sophisticated models must be adopted. In principle, screening these spurious single-star solutions is rather straightforward, for example by evaluating the quality of the fits. However, the simulated Gaia observations also reveal that some seemingly acceptable single-star solutions can nonetheless lead to erroneous distances. These solutions turn out to be binaries with an orbital period close to one year. Without auxiliary (e.g., spectroscopic) data, they will remain unnoticed.

  12. Binary black hole spectroscopy

    International Nuclear Information System (INIS)

    We study parameter estimation with post-Newtonian (PN) gravitational waveforms for the quasi-circular, adiabatic inspiral of spinning binary compact objects. In particular, the performance of amplitude-corrected waveforms is compared with that of the more commonly used restricted waveforms, in Advanced LIGO and EGO. With restricted waveforms, the properties of the source can only be extracted from the phasing. In the case of amplitude-corrected waveforms, the spectrum encodes a wealth of additional information, which leads to dramatic improvements in parameter estimation. At distances of ∼100 Mpc, the full PN waveforms allow for high-accuracy parameter extraction for total mass up to several hundred solar masses, while with the restricted ones the errors are steep functions of mass, and accurate parameter estimation is only possible for relatively light stellar mass binaries. At the low-mass end, the inclusion of amplitude corrections reduces the error on the time of coalescence by an order of magnitude in Advanced LIGO and a factor of 5 in EGO compared to the restricted waveforms; at higher masses these differences are much larger. The individual component masses, which are very poorly determined with restricted waveforms, become measurable with high accuracy if amplitude-corrected waveforms are used, with errors as low as a few per cent in Advanced LIGO and a few tenths of a per cent in EGO. The usual spin-orbit parameter β is also poorly determined with restricted waveforms (except for low-mass systems in EGO), but the full waveforms give errors that are small compared to the largest possible value consistent with the Kerr bound. This suggests a way of finding out if one or both of the component objects violate this bound. On the other hand, we find that the spin-spin parameter σ remains poorly determined even when the full waveform is used. Generally, all errors have but a weak dependence on the magnitudes and orientations of the spins. We also briefly

  13. Strong Lensing by Binary Galaxies

    CERN Document Server

    Shin, E M

    2008-01-01

    We study the problem of gravitational lensing by binary galaxies, idealized as two isothermal spheres. In a wide binary, each galaxy possesses individual tangential, nearly astroidal, caustics and roundish radial caustics. As the separation of the binary is made smaller, the caustics undergo a sequence of metamorphoses. The first metamorphosis occurs when the tangential caustics merge to form a single six-cusped caustic, lying interior to the radial caustics. At still smaller separations, the six-cusped caustic undergoes the second metamorphosis and splits into a four-cusped caustic and two three-cusped caustics, which shrink to zero size (an elliptic umbilic catastrophe) before they enlarge again and move away from the origin perpendicular to the binary axis. Finally, a third metamorphosis occurs as the three-cusp caustics join the radial caustics, leaving an inner distorted astroid caustic enclosed by two outer caustics. The maximum number of images possible is 7. Classifying the multiple imaging according ...

  14. Magnetic braking in ultracompact binaries

    CERN Document Server

    Farmer, Alison

    2010-01-01

    Angular momentum loss in ultracompact binaries, such as the AM Canum Venaticorum stars, is usually assumed to be due entirely to gravitational radiation. Motivated by the outflows observed in ultracompact binaries, we investigate whether magnetically coupled winds could in fact lead to substantial additional angular momentum losses. We remark that the scaling relations often invoked for the relative importance of gravitational and magnetic braking do not apply, and instead use simple non-empirical expressions for the braking rates. In order to remove significant angular momentum, the wind must be tied to field lines anchored in one of the binary's component stars; uncertainties remain as to the driving mechanism for such a wind. In the case of white dwarf accretors, we find that magnetic braking can potentially remove angular momentum on comparable or even shorter timescales than gravitational waves over a large range in orbital period. We present such a solution for the 17-minute binary AM CVn itself which a...

  15. Discs in misaligned binary systems

    CERN Document Server

    Rawiraswattana, Krisada; Goodwin, Simon P

    2016-01-01

    We perform SPH simulations to study precession and changes in alignment between the circumprimary disc and the binary orbit in misaligned binary systems. We find that the precession process can be described by the rigid-disc approximation, where the disc is considered as a rigid body interacting with the binary companion only gravitationally. Precession also causes change in alignment between the rotational axis of the disc and the spin axis of the primary star. This type of alignment is of great important for explaining the origin of spin-orbit misaligned planetary systems. However, we find that the rigid-disc approximation fails to describe changes in alignment between the disc and the binary orbit. This is because the alignment process is a consequence of interactions that involve the fluidity of the disc, such as the tidal interaction and the encounter interaction. Furthermore, simulation results show that there are not only alignment processes, which bring the components towards alignment, but also anti-...

  16. Cryptography with DNA binary strands.

    Science.gov (United States)

    Leier, A; Richter, C; Banzhaf, W; Rauhe, H

    2000-06-01

    Biotechnological methods can be used for cryptography. Here two different cryptographic approaches based on DNA binary strands are shown. The first approach shows how DNA binary strands can be used for steganography, a technique of encryption by information hiding, to provide rapid encryption and decryption. It is shown that DNA steganography based on DNA binary strands is secure under the assumption that an interceptor has the same technological capabilities as sender and receiver of encrypted messages. The second approach shown here is based on steganography and a method of graphical subtraction of binary gel-images. It can be used to constitute a molecular checksum and can be combined with the first approach to support encryption. DNA cryptography might become of practical relevance in the context of labelling organic and inorganic materials with DNA 'barcodes'. PMID:10963862

  17. AN IMPROVED DESIGN OF REVERSIBLE BINARY TO BINARY CODED DECIMAL CONVERTER FOR BINARY CODED DECIMAL MULTIPLICATION

    Directory of Open Access Journals (Sweden)

    Praveena Murugesan

    2014-01-01

    Full Text Available Reversible logic gates under ideal conditions produce zero power dissipation. This factor highlights the usage of these gates in optical computing, low power CMOS design, quantum optics and quantum computing. The growth of decimal arithmetic in various applications as stressed the need to propose the study on reversible binary to BCD converter which plays a greater role in decimal multiplication for providing faster results. The different parameters such as gate count,garbage output and constant input are more optimized in the proposed fixed bit binary to binary coded decimal converter than the existing design.

  18. Transient Black Hole Binaries

    CERN Document Server

    Belloni, T M

    2016-01-01

    The last two decades have seen a great improvement in our understand- ing of the complex phenomenology observed in transient black-hole binary systems, especially thanks to the activity of the Rossi X-Ray Timing Explorer satellite, com- plemented by observations from many other X-ray observatories and ground-based radio, optical and infrared facilities. Accretion alone cannot describe accurately the intricate behavior associated with black-hole transients and it is now clear that the role played by different kinds of (often massive) outflows seen at different phases of the outburst evolution of these systems is as fundamental as the one played by the accretion process itself. The spectral-timing states originally identified in the X-rays and fundamentally based on the observed effect of accretion, have acquired new importance as they now allow to describe within a coherent picture the phenomenology observed at other wave- length, where the effects of ejection processes are most evident. With a particular focu...

  19. Headspace vapor characterization of Hanford Waste Tank 241-BX-107: Results from samples collected on November 17, 1995. Tank Vapor Characterization Project

    Energy Technology Data Exchange (ETDEWEB)

    Evans, J.C.; Thomas, B.L.; Pool, K.H. [and others

    1996-06-01

    This report describes the results of vapor samples taken from the headspace of waste storage tank 241-BX-107 (Tank BX-107) at the Hanford Site in Washington State. Pacific Northwest National Laboratory (PNNL) contracted with Westinghouse Hanford Company (WHC) to provide sampling devices and analyze samples for inorganic and organic analytes collected from the tank headspace and ambient air near the tank. The analytical work was performed by the PNNL Vapor Analytical Laboratory (VAL) by the Tank Vapor Characterization Project. Work performed was based on a sample and analysis plan (SAP) prepared by WHC. The SAP provided job-specific instructions for samples, analyses, and reporting. The SAP for this sample job was {open_quotes}Vapor Sampling and Analysis Plan{close_quotes}, and the sample job was designated S5080. Samples were collected by WHC on November 17, 1995, using the Vapor Sampling System (VSS), a truck-based sampling method using a heated probe inserted into the tank headspace.

  20. Tank Vapor Characterization Project: Headspace vapor characterization of Hanford Waste Tank 241-BX-105: Results from samples collected on 04/24/96

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, B.L.; Evans, J.C.; Pool, K.H. [and others

    1997-01-01

    This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-BX-105 (Tank BX-105) at the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Analyte concentrations were based on analytical results and, where appropriate, on sample volumes provided by WHC. A summary of the inorganic analytes, permanent gases, and total non-methane organic compounds is listed in Table S.1. Detailed descriptions of the analytical results appear in the appendices.

  1. Headspace vapor characterization of Hanford Waste Tank 241-BX-107: Results from samples collected on November 17, 1995. Tank Vapor Characterization Project

    International Nuclear Information System (INIS)

    This report describes the results of vapor samples taken from the headspace of waste storage tank 241-BX-107 (Tank BX-107) at the Hanford Site in Washington State. Pacific Northwest National Laboratory (PNNL) contracted with Westinghouse Hanford Company (WHC) to provide sampling devices and analyze samples for inorganic and organic analytes collected from the tank headspace and ambient air near the tank. The analytical work was performed by the PNNL Vapor Analytical Laboratory (VAL) by the Tank Vapor Characterization Project. Work performed was based on a sample and analysis plan (SAP) prepared by WHC. The SAP provided job-specific instructions for samples, analyses, and reporting. The SAP for this sample job was open-quotes Vapor Sampling and Analysis Planclose quotes, and the sample job was designated S5080. Samples were collected by WHC on November 17, 1995, using the Vapor Sampling System (VSS), a truck-based sampling method using a heated probe inserted into the tank headspace

  2. Binary nucleation beyond capillarity approximation

    OpenAIRE

    Kalikmanov, V.I.

    2010-01-01

    Large discrepancies between binary classical nucleation theory (BCNT) and experiments result from adsorption effects and inability of BCNT, based on the phenomenological capillarity approximation, to treat small clusters. We propose a model aimed at eliminating both of these deficiencies. Adsorption is taken into account within Gibbsian approximation. Binary clusters are treated by means of statistical-mechanical considerations: tracing out the molecular degrees of freedom of the more volatil...

  3. Clostridium difficile binary toxin CDT

    OpenAIRE

    Gerding, Dale N.; Johnson, Stuart; Rupnik, Maja; Aktories, Klaus

    2013-01-01

    Binary toxin (CDT) is frequently observed in Clostridium difficile strains associated with increased severity of C. difficile infection (CDI). CDT belongs to the family of binary ADP-ribosylating toxins consisting of two separate toxin components: CDTa, the enzymatic ADP-ribosyltransferase which modifies actin, and CDTb which binds to host cells and translocates CDTa into the cytosol. CDTb is activated by serine proteases and binds to lipolysis stimulated lipoprotein receptor. ADP-ribosylatio...

  4. Coalescence of Binary Neutron Stars

    OpenAIRE

    Oohara, Ken-ichi; Namamura, Takashi

    1996-01-01

    The most important sources for laser-interferometric gravitational-wave detectors like LIGO or VIRGO are catastrophic events such as coalescence of a neutron-star binary. The final phase, or the last three milliseconds, of coalescence is considered. We describe results of numerical simulations of coalescing binary neutron stars using Newtonian and post-Newtonian hydrodynamics code and then discuss recent development of our 3D GR code.

  5. Results of phase 1 groundwater quality assessment for Single-Shell Tank Waste Management Areas B-BX-BY at the Hanford Site

    International Nuclear Information System (INIS)

    Pacific Northwest National Laboratory conducted a Phase 1 (or first determination) groundwater quality assessment for the US Department of Energy, Richland Operations Office, in accordance with the Federal Facility Compliance Agreement. The purpose of the assessment was to determine if the Single-Shell Tank Waste Management Area (WMA) B-BX-BY has impacted groundwater quality. This report will document the evidence demonstrating that the WMA has impacted groundwater quality

  6. Tank 241-BX-104 fourth temporal study: Headspace gas and vapor characterization results from samples collected on April 7, 1997. Tank vapor characterization project

    International Nuclear Information System (INIS)

    This report presents the results from analyses of samples taken from the headspace of waste storage tank 241-BX-04 (Tank BX-104) at the Hanford Site in Washington State. Tank headspace samples collected by SGN Eurisys Service Corporation (SESC) were analyzed by Pacific Northwest National Laboratory (PNNL) to determine headspace concentrations of selected non-radioactive analytes. Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Vapor concentrations from sorbent trap samples are based on measured sample volumes provided by SESC. Ammonia was determined to be above the immediate notification limit specified by the sampling and analysis plan (SAP). Hydrogen was the principal flammable constituent of the Tank BX-104 headspace, determined to be present at approximately 0.208% of its lower flammability limit (LFL). Total headspace flammability was estimated to be <0.536% of the LFL. Average measured concentrations of targeted gases, inorganic vapors, and selected organic vapors are provided in Table S.1. A summary of experimental methods, including sampling methodology, analytical procedures, and quality assurance and control methods are presented in Section 2.0. Detailed descriptions of the analytical results are provided in Section 3.0

  7. Mechanical properties of hybrid organic-inorganic CH3NH3BX3 (B = Sn, Pb; X = Br, I perovskites for solar cell absorbers

    Directory of Open Access Journals (Sweden)

    Jing Feng

    2014-08-01

    Full Text Available The crystal structures, elastic and anisotropic properties of CH3NH3BX3 (B = Sn, Pb; X = Br, I compounds as solar cell absorber layers are investigated by the first-principles calculations. The type and strength of chemical bond B-X are found to determine the elastic properties. B-X bonds and the organic cations are therefore crucial to the functionalities of such absorbers. The bulk, shear, Young's modulus ranges from 12 to 30 GPa, 3 to 12 GPa, and 15 to 37 GPa, respectively. Moreover, the interaction among organic and inorganic ions would have negligible effect for elastic properties. The B/G and Poisson's ratio show it would have a good ductile ability for extensive deformation as a flexible/stretchable layer on the polymer substrate. The main reason is attributed to the low shear modulus of such perovskites. The anisotropic indices AU, AB AG, A1, A2, and A3 show ABX3 perovskite have very strong anisotropy derived from the elastic constants, chemical bonds, and symmetry.

  8. Tank 241-BX-104 third temporal study: Headspace gas and vapor characterization results from samples collected on February 6, 1997. Tank vapor characterization project

    International Nuclear Information System (INIS)

    This report presents the results from analyses of samples taken from the headspace of waste storage tank 241-BX-104 (Tank BX-104) at the Hanford Site in Washington State. Tank headspace samples collected by SGN Eurisys Service Corporation (SESC) were analyzed by Pacific Northwest National Laboratory (PNNL) to determine headspace concentrations of selected non-radioactive analytes. Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Vapor concentrations from sorbent trap samples are based on measured sample volumes provided by SESC. Ammonia was determined to be above the immediate notification limit specified by the sampling and analysis plan (SAP). Hydrogen was the principal flammable constituent of the Tank BX-104 headspace, determined to be present at approximately 0.178 % of its lower flammability limit (LFL). Total headspace flammability was estimated to be <0.458% of the LFL. Average measured concentrations of targeted gases, inorganic vapors, and selected organic vapors are provided in Table S.1. A summary of experimental methods, including sampling methodology, analytical procedures, and quality assurance and control methods are presented in Section 2.0. Detailed descriptions of the analytical results are provided in Section 3.0

  9. Tank vapor characterization project: Tank 241-BX-104 fifth temporal study: Headspace gas and vapor characterization results from samples collected on June 10, 1997

    International Nuclear Information System (INIS)

    This report presents the results from analyses of samples taken from the headspace of waste storage tank 241-BX-104 (Tank BX-104) at the Hanford Site in Washington State. Tank headspace samples collected by SGN Eurisys Service Corporation (SESC) were analyzed by Pacific Northwest National Laboratory (PNNL) to determine headspace concentrations of selected non-radioactive analytes. Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Vapor concentrations from sorbent trap samples are based on measured sample volumes provided by SESC. Ammonia was determined to be above the immediate notification limit specified by the sampling and analysis plan (SAP). Hydrogen was the principal flammable constituent of the Tank BX-104 headspace, determined to be present at approximately 0.270% of its lower flammability limit (LFL). Total headspace flammability was estimated to be <0.675% of the LFL. Average measured concentrations of targeted gases, inorganic vapors, and selected organic vapors are provided in Table S.1. A summary of experimental methods, including sampling methodology, analytical procedures, and quality assurance and control methods are presented in Section 2.0. Detailed descriptions of the analytical results are provided in Section 3.0

  10. Tank Vapor Characterization Project: Tank 241-BX-103 headspace gas and vapor characterization results from samples collected on August 1, 1996

    Energy Technology Data Exchange (ETDEWEB)

    Evans, J.C.; Pool, K.H.; Thomas, B.L.; Sklarew, D.S.; Edwards, J.A. [and others

    1997-08-01

    This report presents the results from analyses of samples taken from headspace of waste storage tank 241-BX-103 (Tank BX-103) at the Hanford Site in Washington State. Tank headspace samples collected by Westinghouse Hanford Company (WHC) were analyzed by Pacific Northwest National Laboratory (PNNL) to determine headspace concentrations of selected non-radioactive analytes. Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Vapor concentrations from sorbent trap samples are based on measured sample volumes provided by WHC. No analytes were determined to be above the immediate notification limits specified by the sampling and analysis plan (SAP). Hydrogen was the principal flammable constituent of the Tank BX-103 headspace, determined to be present at approximately 0.385% of its lower flammability limit (LFL). Total headspace flammability was estimated to be <0.633% if the LFL. Average measured concentrations of targeted gases, inorganic vapors, and selected organic vapors are provided in Table S.1. A summary of experimental methods, including sampling methodology, analytical procedures, and quality assurance and control methods are presented in Section 2.0. Detailed descriptions of the analytical results are provided in Section 3.0.

  11. Tank vapor characterization project: Tank 241-BX-104 fifth temporal study: Headspace gas and vapor characterization results from samples collected on June 10, 1997

    Energy Technology Data Exchange (ETDEWEB)

    Hayes, J.C.; Pool, K.H.; Evans, J.C.; Olsen, K.B. [and others

    1997-07-01

    This report presents the results from analyses of samples taken from the headspace of waste storage tank 241-BX-104 (Tank BX-104) at the Hanford Site in Washington State. Tank headspace samples collected by SGN Eurisys Service Corporation (SESC) were analyzed by Pacific Northwest National Laboratory (PNNL) to determine headspace concentrations of selected non-radioactive analytes. Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Vapor concentrations from sorbent trap samples are based on measured sample volumes provided by SESC. Ammonia was determined to be above the immediate notification limit specified by the sampling and analysis plan (SAP). Hydrogen was the principal flammable constituent of the Tank BX-104 headspace, determined to be present at approximately 0.270% of its lower flammability limit (LFL). Total headspace flammability was estimated to be <0.675% of the LFL. Average measured concentrations of targeted gases, inorganic vapors, and selected organic vapors are provided in Table S.1. A summary of experimental methods, including sampling methodology, analytical procedures, and quality assurance and control methods are presented in Section 2.0. Detailed descriptions of the analytical results are provided in Section 3.0.

  12. Tank 241-BX-104 third temporal study: Headspace gas and vapor characterization results from samples collected on February 6, 1997. Tank vapor characterization project

    Energy Technology Data Exchange (ETDEWEB)

    Evans, J.C.; Pool, K.H.; Hayes, J.C. [and others

    1997-09-01

    This report presents the results from analyses of samples taken from the headspace of waste storage tank 241-BX-104 (Tank BX-104) at the Hanford Site in Washington State. Tank headspace samples collected by SGN Eurisys Service Corporation (SESC) were analyzed by Pacific Northwest National Laboratory (PNNL) to determine headspace concentrations of selected non-radioactive analytes. Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Vapor concentrations from sorbent trap samples are based on measured sample volumes provided by SESC. Ammonia was determined to be above the immediate notification limit specified by the sampling and analysis plan (SAP). Hydrogen was the principal flammable constituent of the Tank BX-104 headspace, determined to be present at approximately 0.178 % of its lower flammability limit (LFL). Total headspace flammability was estimated to be <0.458% of the LFL. Average measured concentrations of targeted gases, inorganic vapors, and selected organic vapors are provided in Table S.1. A summary of experimental methods, including sampling methodology, analytical procedures, and quality assurance and control methods are presented in Section 2.0. Detailed descriptions of the analytical results are provided in Section 3.0.

  13. Tank Vapor Characterization Project: Tank 241-BX-106 headspace gas and vapor characterization results from samples collected on August 15, 1996

    Energy Technology Data Exchange (ETDEWEB)

    Pool, K.H.; Evans, J.C.; Thomas, B.L.; Edwards, J.A.; Julya, J.L. [and others

    1997-08-01

    This report presents the results from analyses of samples taken from the headspace of waste storage tank 241-BX-106 (Tank BX-106) at the Hanford Site in Washington State. Tank headspace samples collected by Westinghouse Hanford Company (WHC) were analyzed by Pacific Northwest National Laboratory (PNNL) to determine headspace concentrations of selected non-radioactive analytes. Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Vapor concentrations from sorbent trap samples are based on measured sample volumes provided by WHC. No analytes were determined to be above the immediate notification limits specified by the sampling and analysis plan. Ammonia was the principal flammable constituent of the Tank BX-106 headspace, determined to be present at approximately 0.031% of it lower flammability limit (LFL). Total headspace flammability was estimated to be <0.143% of the LFL. Average measured concentrations of targeted gases, inorganic vapors, and selected organic vapors are provided in Table S.1. A summary of experimental methods, including sampling methodology, analytical procedures, and quality assurance and control methods are presented in Section 2.0. Detailed descriptions of the analytical results are provided in Section 3.0.

  14. Tank Vapor Characterization Project: Tank 241-BX-104 second temporal study headspace gas and vapor characterization results from samples collected on December 12, 1996

    Energy Technology Data Exchange (ETDEWEB)

    Pool, K.H.; Evans, J.C.; Hayes, J.C.; Olsen, K.B. [and others

    1997-08-01

    This report presents the results from analyses of samples taken from the headspace of waste storage tank 241-BX-104 (Tank BX-104) at the Hanford Site in Washington State. Tank headspace samples collected by SGN Eurisys Service Corporation (SESC) were analyzed by Pacific Northwest National Laboratory (PNNL) to determine headspace concentrations of selected non-radioactive analytes. Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Vapor concentrations from sorbent trap samples are based on measured sample provided by SESC. Ammonia was determined to be above the immediate notification limit specified by the sampling and analysis plan (SAP). Hydrogen was the principal flammable constituent of the Tank BX-104 headspace, determined to be present at approximately 0.248% of its lower flammability limit (LFL). Total headspace flammability was estimated to be <0.645% of the LFL. Average measured concentrations of targeted gases, inorganic vapors, and selected organic vapors are provided in Table S.1. A summary of experimental methods, including sampling methodology, analytical procedures, and quality assurance and control methods are presented in Section 2.0. Detailed descriptions of the analytical results are provided in Section 3.0.

  15. Tank 241-BX-104 fourth temporal study: Headspace gas and vapor characterization results from samples collected on April 7, 1997. Tank vapor characterization project

    Energy Technology Data Exchange (ETDEWEB)

    Mitroshkov, A.V.; Hayes, J.C.; Evans, J.C. [and others

    1997-09-01

    This report presents the results from analyses of samples taken from the headspace of waste storage tank 241-BX-04 (Tank BX-104) at the Hanford Site in Washington State. Tank headspace samples collected by SGN Eurisys Service Corporation (SESC) were analyzed by Pacific Northwest National Laboratory (PNNL) to determine headspace concentrations of selected non-radioactive analytes. Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Vapor concentrations from sorbent trap samples are based on measured sample volumes provided by SESC. Ammonia was determined to be above the immediate notification limit specified by the sampling and analysis plan (SAP). Hydrogen was the principal flammable constituent of the Tank BX-104 headspace, determined to be present at approximately 0.208% of its lower flammability limit (LFL). Total headspace flammability was estimated to be <0.536% of the LFL. Average measured concentrations of targeted gases, inorganic vapors, and selected organic vapors are provided in Table S.1. A summary of experimental methods, including sampling methodology, analytical procedures, and quality assurance and control methods are presented in Section 2.0. Detailed descriptions of the analytical results are provided in Section 3.0.

  16. Tank Vapor Characterization Project: Tank 241-BX-111 headspace gas and vapor characterization results from samples collected on August 27, 1996

    Energy Technology Data Exchange (ETDEWEB)

    Pool, K.H.; Evans, J.C.; Thomas, B.L.; Sklarew, D.S. Edwards, J.A. [and others

    1997-08-01

    This report presents the results from analyses of samples taken from the headspace of waste storage tank 241-BX-111 (Tank BX-111) at the Hanford Site in Washington State. Tank headspace samples collected by Westinghouse Hanford Company (WHC) were analyzed by Pacific Northwest National Laboratory (PNNL) to determine headspace concentrations of selected non-radioactive analytes. Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Vapor concentrations from sorbent trap samples are based on measured sample volumes provided by WHC. No analytes were determined to be above the immediate notification limits specified by the sampling and analysis plan (SAP). Ammonia was the principal flammable constituent of the Tank BX-111 headspace, determined to be present at approximately 0.042 of its lower flammability limit (LFL). Total headspace flammability was estimated to be <0.157% of the LFL. Average measured concentrations of targeted gases, inorganic vapors, and selected organic vapors are provided in Table S.1. A summary of experimental methods, including sampling methodology, analytical procedures, and quality assurance and control methods are presented in Section 2.0. Detailed descriptions of the analytical results are provided in Section 3.0.

  17. Tank Vapor Characterization Project: Tank 241-BX-104 headspace gas and vapor characterization results from samples collected on August 22, 1996

    Energy Technology Data Exchange (ETDEWEB)

    Evans, J.C.; Pool, K.H.; Thomas, B.L.; Olsen, K.B.; Julya, J.L. [and others

    1997-08-01

    This report presents the results from analyses of samples taken from the headspace of waste storage tank 241-BX-104 (Tank BX-104) at the Hanford Site in Washington State. Tank headspace samples collected by Westinghouse Hanford Company (WHC) were analyzed by Pacific Northwest National Laboratory (PNNL) to determine headspace concentrations of selected non-radioactive analytes. Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Vapor concentrations from sorbent trap samples are based on measured sample volumes provided by WHC. Ammonia was determined to be above the immediate notification limit specified by the sampling and analyses plan (SAP). Total non-methane organic compounds was the principal flammable constituent of the Tank BX-104 headspace, determined to be present at approximately 0.310% of its lower flammability limit (LFL). Total headspace flammability was estimated to be <0.784% of the LFL. Average measured concentrations of targeted gases, inorganic vapors, and selected organic vapors are provided in Table S.1. A summary of experimental methods, including sampling methodology, analytical procedures, and quality assurance and control methods are presented in Section 2.0. Detailed descriptions of the analytical results are provided in Section 3.0.

  18. Tank Vapor Characterization Project: Tank 241-BX-102 headspace gas and vapor characterization results from samples collected on July 31, 1996

    Energy Technology Data Exchange (ETDEWEB)

    Pool, K.H.; Evans, J.C.; Thomas, B.L.; Olsen, K.B. Edwards, J.A. [and others

    1997-08-01

    This report presents the results from analyses of samples taken from the headspace of waste storage tank 241-BX-102 (Tank BX-102) at the Hanford Site in Washington State. Tank headspace samples collected by Westinghouse Hanford Company (WHC) were analyzed by Pacific Northwest National Laboratory (PNNL) to determine headspace concentrations of selected non-radioactive analytes. Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Vapor concentrations from sorbent trap samples are based on measured volumes provided by WHC. No analytes were determined to be above the immediate notification limits specified by the sampling and and analysis plan. Ammonia and TNMOCs were the principal flammable constituents of the Tank BX-102 headspace, each determined to be present at approximately 0.002% of its lower flammability limit (LFL). Total headspace flammability was estimated to be <0.107% of the LFL. Average measured concentrations of targeted gases, inorganic vapors, and selected organic vapors are provided in Table S.1. A summary of experimental methods, including sampling methodology, analytical procedures, and quality assurance and control methods are presented in Section 2.0. Detailed descriptions of the analytical results are provided in Section 3.0.

  19. Tank Vapor Characterization Project: Tank 241-BX-104 second temporal study headspace gas and vapor characterization results from samples collected on December 12, 1996

    International Nuclear Information System (INIS)

    This report presents the results from analyses of samples taken from the headspace of waste storage tank 241-BX-104 (Tank BX-104) at the Hanford Site in Washington State. Tank headspace samples collected by SGN Eurisys Service Corporation (SESC) were analyzed by Pacific Northwest National Laboratory (PNNL) to determine headspace concentrations of selected non-radioactive analytes. Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Vapor concentrations from sorbent trap samples are based on measured sample provided by SESC. Ammonia was determined to be above the immediate notification limit specified by the sampling and analysis plan (SAP). Hydrogen was the principal flammable constituent of the Tank BX-104 headspace, determined to be present at approximately 0.248% of its lower flammability limit (LFL). Total headspace flammability was estimated to be <0.645% of the LFL. Average measured concentrations of targeted gases, inorganic vapors, and selected organic vapors are provided in Table S.1. A summary of experimental methods, including sampling methodology, analytical procedures, and quality assurance and control methods are presented in Section 2.0. Detailed descriptions of the analytical results are provided in Section 3.0

  20. Binary Encodings of Non-binary Constraint Satisfaction Problems: Algorithms and Experimental Results

    CERN Document Server

    Samaras, N; 10.1613/jair.1776

    2011-01-01

    A non-binary Constraint Satisfaction Problem (CSP) can be solved directly using extended versions of binary techniques. Alternatively, the non-binary problem can be translated into an equivalent binary one. In this case, it is generally accepted that the translated problem can be solved by applying well-established techniques for binary CSPs. In this paper we evaluate the applicability of the latter approach. We demonstrate that the use of standard techniques for binary CSPs in the encodings of non-binary problems is problematic and results in models that are very rarely competitive with the non-binary representation. To overcome this, we propose specialized arc consistency and search algorithms for binary encodings, and we evaluate them theoretically and empirically. We consider three binary representations; the hidden variable encoding, the dual encoding, and the double encoding. Theoretical and empirical results show that, for certain classes of non-binary constraints, binary encodings are a competitive op...

  1. Deteccion Y Estudio De Rayos Cosmicos Y Su Efecto Ionizante En Sales Del Tipo A(2)bx(4) (spanish Text)

    CERN Document Server

    Ninco Ninco, L A

    2003-01-01

    The objective of this research was to detect and to study the ionizing effect of cosmic rays in crystals of the type A2BX4, specifically Cs2CoCl4, Cs2ZnI4 doped to 2% with Mn by weigh and Cs2ZnCl4 pure and doped to 0.5% with Mn by weight, that were grown by slow evaporation. They were selected after making tests of sensitivity to the electromagnetic and radio waves in a RLC circuit. They were also characterized by X-ray diffraction to establish their structure type and family. Once selected they were used to construct a device or detector system. The detectors with crystals presented signals in a range of voltage between 400 and 1800V. Graphs of the count versus voltage were constructed, it was observed that these crystals passed through zones in which the behavior of the crystals due to the ionizing effect of particles that go through can be determined when a high voltage is applied to them. These crystals present a plateau that makes them ideal for detection of particles. The measurements were done at room ...

  2. Airy function approach and Numerov method to study the anharmonic oscillator potentials V(x = Ax2α + Bx2

    Directory of Open Access Journals (Sweden)

    N. Al Sdran

    2016-06-01

    Full Text Available The numerical solutions of the time independent Schrödinger equation of different one-dimensional potentials forms are sometime achieved by the asymptotic iteration method. Its importance appears, for example, on its efficiency to describe vibrational system in quantum mechanics. In this paper, the Airy function approach and the Numerov method have been used and presented to study the oscillator anharmonic potential V(x = Ax2α + Bx2, (A>0, B<0, with (α = 2 for quadratic, (α =3 for sextic and (α =4 for octic anharmonic oscillators. The Airy function approach is based on the replacement of the real potential V(x by a piecewise-linear potential v(x, while, the Numerov method is based on the discretization of the wave function on the x-axis. The first energies levels have been calculated and the wave functions for the sextic system have been evaluated. These specific values are unlimited by the magnitude of A, B and α. It’s found that the obtained results are in good agreement with the previous results obtained by the asymptotic iteration method for α =3.

  3. Binaries and Globular Cluster Dynamics

    CERN Document Server

    Rasio, F A; Joshi, K J; Rasio, Frederic A.; Fregeau, John M.; Joshi, Kriten J.

    2001-01-01

    We summarize the results of recent theoretical work on the dynamical evolution of globular clusters containing primordial binaries. Even a very small initial binary fraction (e.g., 10%) can play a key role in supporting a cluster against gravothermal collapse for many relaxation times. Inelastic encounters between binaries and single stars or other binaries provide a very significant energy source for the cluster. These dynamical interactions also lead to the production of large numbers of exotic systems such as ultracompact X-ray binaries, recycled radio pulsars, double degenerate systems, and blue stragglers. Our work is based on a new parallel supercomputer code implementing Henon's Monte Carlo method for simulating the dynamical evolution of dense stellar systems in the Fokker-Planck approximation. This new code allows us to calculate very accurately the evolution of a cluster containing a realistic number of stars (N ~ 10^5 - 10^6) in typically a few hours to a few days of computing time. The discrete, s...

  4. Exoplanets Bouncing Between Binary Stars

    CERN Document Server

    Moeckel, Nickolas

    2012-01-01

    Exoplanetary systems are found not only among single stars, but also binaries of widely varying parameters. Binaries with separations of 100--1000 au are prevalent in the Solar neighborhood; at these separations planet formation around a binary member may largely proceed as if around a single star. During the early dynamical evolution of a planetary system, planet--planet scattering can eject planets from a star's grasp. In a binary, the motion of a planet ejected from one star has effectively entered a restricted three-body system consisting of itself and the two stars, and the equations of motion of the three body problem will apply as long as the ejected planet remains far from the remaining planets. Depending on its energy, escape from the binary as a whole may be impossible or delayed until the three-body approximation breaks down, and further close interactions with its planetary siblings boost its energy when it passes close to its parent star. Until then this planet may be able to transition from the ...

  5. 莱姆病螺旋体重组质粒pBX1的DNA序列分析及其在大肠杆菌中的诱导表达%DNA Sequence Analysis and Expression of the Recombinant Plasmid pBX1 from Borrelia Burgdorferi B31 Strain

    Institute of Scientific and Technical Information of China (English)

    谢勇恩; 鲍朗; 胡昌华; 李学敏; 陈炜

    2001-01-01

    目的为莱姆病血清学诊断和基因工程亚单位疫苗研制提供靶抗原。方法采用377型DNA自动测序仪对莱姆病螺旋体重组质粒pBX1的插入片段进行DNA序列测定,并通过计算机软件对其进行限制性内切酶酶谱分析。然后将重组质粒pBX1在大肠杆菌中进行诱导表达,并对其表达产物进行免疫印迹分析。结果①重组质粒pBX1插入片段大小为477bp,其核苷酸序列与文献报道的p83基因全序列相应区段相比较仅有一个碱基的变异,②成功绘制了该插入片段的限制性内切酶酶谱;③重组质粒在大肠杆菌中诱导表达后获得了29kd的融合蛋白;④Western-blotting分析表明该融合蛋白能与莱姆病多价抗血清呈强阳性印迹反应。结论该研究成功地对莱姆病螺旋体83kd抗原蛋白特异性区段进行了基因重组和表达,为进一步研究其在莱姆病血清学诊断和基因工程亚单位疫苗研制中的应用奠定了基础。%Objective This study was to provide the target antigen for the development of a Lyme disease vaccine and serodiagnosis reagent.Methods We used the automatic DNA sequencing machine (Model 377) to detect the nucleotide sequence of the inserted part of the recombinant plasmid pBX1 from Borrelia burgdorferi B31 strain. The restriction enzyme map of the inserted part of pBX1 was analysed by using computer software. The expressed product of pBX1 in E.coli XLI-Blue MRF′ was analysed by using SDS-PAGE and western-blotting. Results ①DNA sequencing showed that pBX1 contained a 477bp inserted gene fragment,and when it was compared with the published sequence of the specific region of the gene of the 83kd antigen protein from Borrelia burgdorferi B31 strain,only one amino acid codon was different.②The restriction enzyme map of the inserted part of pBX1 was successfully constructed.③The recombinant plasmid pBX1 expressed a 29kd fusion protein in E.coli XL1-Blue MRF

  6. Study on Cyclin D/Rb/p16 Signal Pathway of BxPC-3 Cell Line Treated with Oridonin%冬凌草甲素对胰腺癌BxPC-3细胞Cyclin D/Rb/p16信号蛋白的影响研究

    Institute of Scientific and Technical Information of China (English)

    沈雯; 许健; 孙金权; 牟一平; 吴晓莉

    2013-01-01

      [目的]通过观察冬凌草甲素对胰腺癌BxPC-3细胞形态和DNA变化的影响,研究其对Cyclin D/Rb/p16信号通路中基因表达的调节作用,分析冬凌草甲素对胰腺癌BxPC-3细胞的诱导与Cyclin D/Rb/p16信号通路之间的内在联系,为冬凌草甲素抗肿瘤提供可能的途径,为临床使用提供有利数据。[方法]冬凌草甲素作用BxPC-3细胞后,经瑞氏染色和Hoechst 33258荧光染色观察细胞形态,RT-PCR和实时荧光定量法(real time PCR)检测Cyclin D/Rb/p16信号通路基因的表达变化;甲基化专一性PCR试剂盒检测p16基因的甲基化。[结果]冬凌草甲素(32μg·mL-1)作用于BxPC-3细胞后,瑞氏染色可见细胞出现典型的凋亡小体,Hoechst33258荧光染色可见BxPC-3细胞出现特征性凋亡变化,冬凌草甲素(32μg·mL-1)作用BxPC-3细胞36 h时,CDK4的表达量达到最低,但p16的表达量达到最高;p16基因有甲基化。[结论]1、冬凌草甲素能诱导BxPC-3细胞形态改变。2、冬凌草甲素在一定程度下调了CDK4基因的表达,上调了p16基因的表达,不能改变p16基因的甲基化,可能通过影响Cyclin D/Rb/p16信号通路而抑制胰腺癌的生长周期。%Objective]To observe variety of morphological features, DNA band and expressions of Cyclin D/RB/p16 genes in BxPC-3 cel s treated with oridonin, investigate relationship between oridonin-induced apoptosis and Cyclin D/Rb/p16 signal pathway, which provided oridonin not only possible anti-tumor accesses but also favourable clinical data. [Methods]BxPC-3 cel s morphology was observed by Wright's staining, apoptosis was assayed by Hoechst 33258 fluorescence staining after treated with Oridonin in vitro, Cyclin D/Rb/P16 signal genes expression of BxPC-3 cel s were detected using real time PCR and a PCR kit specific of methylation for p16 gene methylation.[Results]Wright's staining showed characteristic apoptotic body in BxPC-3 cel s

  7. 冬凌草甲素对胰腺癌BxPC-3细胞Cyclin D/Rb/p16信号蛋白的影响研究%Study on Cyclin D/Rb/p16 Signal Pathway of BxPC-3 Cell Line Treated with Oridonin

    Institute of Scientific and Technical Information of China (English)

    沈雯; 许健; 孙金权; 牟一平; 吴晓莉

    2013-01-01

    Objective]To observe variety of morphological features, DNA band and expressions of Cyclin D/RB/p16 genes in BxPC-3 cel s treated with oridonin, investigate relationship between oridonin-induced apoptosis and Cyclin D/Rb/p16 signal pathway, which provided oridonin not only possible anti-tumor accesses but also favourable clinical data. [Methods]BxPC-3 cel s morphology was observed by Wright's staining, apoptosis was assayed by Hoechst 33258 fluorescence staining after treated with Oridonin in vitro, Cyclin D/Rb/P16 signal genes expression of BxPC-3 cel s were detected using real time PCR and a PCR kit specific of methylation for p16 gene methylation.[Results]Wright's staining showed characteristic apoptotic body in BxPC-3 cel s, Hoechst 33258 fluorescence staining showed characteristic change of apoptosis, the expression of CDK4 reduced to the minimum, and p16 gene reached the maximum; p16 gene presented methylation after treated with oridonin for 36h in BxPC-3 cel s. [Conclusion]1. Oridonin could induce BxPC-3 cel s into apoptosis. 2. Oridonin down-regulated CDK4, and up-regulated p16 and the methylation of p16 gene in BxPC-3 cel , but without effect on p16 gene methylation, which suggested that oridonin inhibited pancreatic cancer through Cyclin D/Rb/p16 signal pathway to a certain extent.%  [目的]通过观察冬凌草甲素对胰腺癌BxPC-3细胞形态和DNA变化的影响,研究其对Cyclin D/Rb/p16信号通路中基因表达的调节作用,分析冬凌草甲素对胰腺癌BxPC-3细胞的诱导与Cyclin D/Rb/p16信号通路之间的内在联系,为冬凌草甲素抗肿瘤提供可能的途径,为临床使用提供有利数据。[方法]冬凌草甲素作用BxPC-3细胞后,经瑞氏染色和Hoechst 33258荧光染色观察细胞形态,RT-PCR和实时荧光定量法(real time PCR)检测Cyclin D/Rb/p16信号通路基因的表达变化;甲基化专一性PCR试剂盒检测p16基因的甲基化。[结果]冬凌草甲素(32μg·mL-1)作用于Bx

  8. Using Binary Code Instrumentation in Computer Security

    Directory of Open Access Journals (Sweden)

    Marius POPA

    2013-01-01

    Full Text Available The paper approaches the low-level details of the code generated by compilers whose format permits outside actions. Binary code modifications are manually done when the internal format is known and understood, or automatically by certain tools developed to process the binary code. The binary code instrumentation goals may be various from security increasing and bug fixing to development of malicious software. The paper highlights the binary code instrumentation techniques by code injection to increase the security and reliability of a software application. Also, the paper offers examples for binary code formats understanding and how the binary code injection may be applied.

  9. The structure of contact binaries

    CERN Document Server

    Kaehler, H

    2003-01-01

    In radiative layers of rotating stars the luminosity carried by circulation currents through a surface of constant entropy (circulation luminosity) is shown to be positive. The corresponding decrease in the temperature gradient is important in the secondary of contact binaries. This result removes the deadlock in the theory of contact binaries. The resulting treatment of contact binaries is investigated, assuming thermal equilibrium. If the circulation luminosity is adjusted to give a prescribed temperature difference between the components, details turn out to be unimportant. The temperature difference is bound to be positive. The fractional extent of radiative regions is larger in the secondary than in the primary. In the course of evolution the period increases and the mass ratio decreases. A survey of unevolved and evolved contact configurations is presented. Observational tests are passed. In stable systems the degree of contact is small. Stable systems in the period-colour diagram, unevolved and evolved...

  10. Practical Binary Adaptive Block Coder

    CERN Document Server

    Reznik, Yuriy A

    2007-01-01

    This paper describes design of a low-complexity algorithm for adaptive encoding/ decoding of binary sequences produced by memoryless sources. The algorithm implements universal block codes constructed for a set of contexts identified by the numbers of non-zero bits in previous bits in a sequence. We derive a precise formula for asymptotic redundancy of such codes, which refines previous well-known estimate by Krichevsky and Trofimov, and provide experimental verification of this result. In our experimental study we also compare our implementation with existing binary adaptive encoders, such as JBIG's Q-coder, and MPEG AVC (ITU-T H.264)'s CABAC algorithms.

  11. Coalescing binaries and Doppler experiments

    OpenAIRE

    Vecchio, A.; Bertotti, B.; Iess, L.

    1997-01-01

    We discuss the sensitivity of the CASSINI experiments to gravitational waves emitted by the in-spiral of compact binaries. We show that the maximum distance reachable by the instrument is $\\sim 100$ Mpc. In particular, CASSINI can detect massive black hole binaries with chirp mass $\\simgt 10^6 \\Ms$ in the Virgo Cluster with signal-to-noise ratio between 5 and 30 and possible compact objects of mass $\\simgt 30 \\Ms$ orbiting the massive black hole that our Galactic Centre is likely to harbour.

  12. Rectangular Decomposition of Binary Images

    Czech Academy of Sciences Publication Activity Database

    Suk, Tomáš; Höschl, Cyril; Flusser, Jan

    Berlin : Springer, 2012 - (Blanc-Talon, J.; Popescu, D.; Philips, W.; Scheunders, P.), s. 213-224 ISBN 978-3-642-33139-8. - (Lecture Notes in Computer Science. 7517). [Advanced Concepts for Intelligent Vision Systems (Acivs 2012). Brno (CZ), 04.09.2012-07.09.2012] R&D Projects: GA ČR GAP103/11/1552 Institutional support: RVO:67985556 Keywords : binary image decomposition * generalized delta-method * distance transformation * quadtree * bipartite graph * image compression * fast convolution Subject RIV: IN - Informatics, Computer Science http://library.utia.cas.cz/separaty/2012/ZOI/suk-rectangular decomposition of binary images.pdf

  13. Kepler Eclipsing Binaries with Stellar Companions

    CERN Document Server

    Gies, D R; Guo, Z; Lester, K V; Orosz, J A; Peters, G J

    2015-01-01

    Many short-period binary stars have distant orbiting companions that have played a role in driving the binary components into close separation. Indirect detection of a tertiary star is possible by measuring apparent changes in eclipse times of eclipsing binaries as the binary orbits the common center of mass. Here we present an analysis of the eclipse timings of 41 eclipsing binaries observed throughout the NASA Kepler mission of long duration and precise photometry. This subset of binaries is characterized by relatively deep and frequent eclipses of both stellar components. We present preliminary orbital elements for seven probable triple stars among this sample, and we discuss apparent period changes in seven additional eclipsing binaries that may be related to motion about a tertiary in a long period orbit. The results will be used in ongoing investigations of the spectra and light curves of these binaries for further evidence of the presence of third stars.

  14. A Novel Colorimetric Sensing Material, Poly(γ-Glutamic acid)-graft-3, 4-Dihydro-3-(2'-ethyl hydroxyl)-6-Ethyl-1,3,2H-Benzoxazine (γ-PGA-graft-ethyl-Bx), for Iron (III) Ions

    International Nuclear Information System (INIS)

    A novel rapid ion colorimetric sensing material for iron (III) ions was developed from poly(γ-glutamic acid) and 3,4-dihydro-3-(2'-ethyl hydroxyl)-6-ethyl-1,3,2H-benzoxazine (ethyl-Bx). The benzoxazine as an ionophore segment was grafted into γ-PGA backbone via the esterification reaction, which is a simple and effective reaction. The structure of γ-PGA-graft-ethyl-Bx was characterized by using FT-IR and 1H-NMR. The most attainable degree of conversion was 25 %. The γ-PGA-graft-ethyl-Bx showed a highly selective and sensitive recognition toward iron (III), which was clearly observable with the naked eye. The iron (III) ions sensing property of γ-PGA-graft-ethyl-Bx was further examined by using photometric titration method. After the interaction between the γ-PGA-graft-ethyl-Bx and iron (III) ions was formed, the solution of the polymer in dimethyl sulfoxide was changed from clear and colorless to red color, resulting in the shift of the maximum wavelength from UV to visible range. (author)

  15. Frame theory for binary vector spaces

    OpenAIRE

    Bodmann, Bernhard G.; Le, My; Reza, Letty; Tobin, Matthew; Tomforde, Mark

    2009-01-01

    We develop the theory of frames and Parseval frames for finite-dimensional vector spaces over the binary numbers. This includes characterizations which are similar to frames and Parseval frames for real or complex Hilbert spaces, and the discussion of conceptual differences caused by the lack of a proper inner product on binary vector spaces. We also define switching equivalence for binary frames, and list all equivalence classes of binary Parseval frames in lowest dimensions, excluding cases...

  16. Using Binary Code Instrumentation in Computer Security

    OpenAIRE

    Marius POPA; Sergiu Marin CAPISIZU

    2013-01-01

    The paper approaches the low-level details of the code generated by compilers whose format permits outside actions. Binary code modifications are manually done when the internal format is known and understood, or automatically by certain tools developed to process the binary code. The binary code instrumentation goals may be various from security increasing and bug fixing to development of malicious software. The paper highlights the binary code instrumentation techniques by code injection to...

  17. Discs in misaligned binary systems

    Science.gov (United States)

    Rawiraswattana, Krisada; Hubber, David A.; Goodwin, Simon P.

    2016-08-01

    We perform SPH simulations to study precession and changes in alignment between the circumprimary disc and the binary orbit in misaligned binary systems. We find that the precession process can be described by the rigid-disc approximation, where the disc is considered as a rigid body interacting with the binary companion only gravitationally. Precession also causes change in alignment between the rotational axis of the disc and the spin axis of the primary star. This type of alignment is of great important for explaining the origin of spin-orbit misaligned planetary systems. However, we find that the rigid-disc approximation fails to describe changes in alignment between the disc and the binary orbit. This is because the alignment process is a consequence of interactions that involve the fluidity of the disc, such as the tidal interaction and the encounter interaction. Furthermore, simulation results show that there are not only alignment processes, which bring the components towards alignment, but also anti-alignment processes, which tend to misalign the components. The alignment process dominates in systems with misalignment angle near 90°, while the anti-alignment process dominates in systems with the misalignment angle near 0° or 180°. This means that highly misaligned systems will become more aligned but slightly misaligned systems will become more misaligned.

  18. A Galactic Binary Detection Pipeline

    Science.gov (United States)

    Littenberg, Tyson B.

    2011-01-01

    The Galaxy is suspected to contain hundreds of millions of binary white dwarf systems, a large fraction of which will have sufficiently small orbital period to emit gravitational radiation in band for space-based gravitational wave detectors such as the Laser Interferometer Space Antenna (LISA). LISA's main science goal is the detection of cosmological events (supermassive black hole mergers, etc.) however the gravitational signal from the galaxy will be the dominant contribution to the data - including instrumental noise over approximately two decades in frequency. The catalogue of detectable binary systems will serve as an unparalleled means of studying the Galaxy. Furthermore, to maximize the scientific return from the mission, the data must be "cleansed" of the galactic foreground. We will present an algorithm that can accurately resolve and subtract 2:: 10000 of these sources from simulated data supplied by the Mock LISA Data Challenge Task Force. Using the time evolution of the gravitational wave frequency, we will reconstruct the position of the recovered binaries and show how LISA will sample the entire compact binary population in the Galaxy.

  19. CFD Simulations of Binary Nucleation

    Czech Academy of Sciences Publication Activity Database

    Herrmann, E.; Brus, David; Hyvärinen, A-P.; Kulmala, M.

    Helsinki : -, 2010, P3U16. ISBN N. [International Aerosol Conference IAC 2010. Helsinki (FI), 29.08.2010-03.09.2010] Grant ostatní: FCR(FI) 1118615 Institutional research plan: CEZ:AV0Z40720504 Keywords : nucleation * binary * parameterization Subject RIV: CF - Physical ; Theoretical Chemistry www.iac2010.fi

  20. Eccentricity distribution of wide binaries

    CERN Document Server

    Tokovinin, Andrei

    2015-01-01

    A sample of 477 solar-type binaries within 67pc with projected separations larger than 50AU is studied by a new statistical method. Speed and direction of the relative motion are determined from the short observed arcs or known orbits, and their joint distribution is compared to the numerical simulations. By inverting the observed distribution with the help of simulations, we find that average eccentricity of wide binaries is 0.59+-0.02 and the eccentricity distribution can be modeled as f(e) ~= 1.2 e + 0.4. However, wide binaries containing inner subsystems, i.e. triple or higher-order multiples, have significantly smaller eccentricities with the average e = 0.52+-0.05 and the peak at e ~ 0.5. We find that the catalog of visual orbits is strongly biased against large eccentricities. A marginal evidence of eccentricity increasing with separation (or period) is found for this sample. Comparison with spectroscopic binaries proves the reality of the controversial period-eccentricity relation. The average eccentr...

  1. A Redundant Binary Algorithm for RSA

    Institute of Scientific and Technical Information of China (English)

    施荣华

    1996-01-01

    The normal form and modified normal form for binary redundant representation are defined.A redundant binary algorithm to compute modular exponentiation for very large integers is proposed.It is shown that the proposed algorithm requires the minimum number of basic operations(modular multiplications)among all possible binary redundant representations.

  2. Competitive learning for binary valued data

    OpenAIRE

    Leisch, Friedrich; Weingessel, Andreas; Dimitriadou, Evgenia

    1998-01-01

    We propose a new approach for using online competitive learning on binary data. The usual Euclidean distance is replaced by binary distance measures, which take possible asymmetries of binary data into account and therefore provide a "different point of view" for looking at the data. The method is demonstrated on two artificial examples and applied on tourist marketing research data. (author's abstract)

  3. Numerical Evaluation of Mode 1 Stress Intensity Factor as a Function of Material Orientation For BX-265 Foam Insulation Material

    Science.gov (United States)

    Knudsen, Erik; Arakere, Nagaraj K.

    2006-01-01

    Foam; a cellular material, is found all around us. Bone and cork are examples of biological cell materials. Many forms of man-made foam have found practical applications as insulating materials. NASA uses the BX-265 foam insulation material on the external tank (ET) for the Space Shuttle. This is a type of Spray-on Foam Insulation (SOFI), similar to the material used to insulate attics in residential construction. This foam material is a good insulator and is very lightweight, making it suitable for space applications. Breakup of segments of this foam insulation on the shuttle ET impacting the shuttle thermal protection tiles during liftoff is believed to have caused the space shuttle Columbia failure during re-entry. NASA engineers are very interested in understanding the processes that govern the breakup/fracture of this complex material from the shuttle ET. The foam is anisotropic in nature and the required stress and fracture mechanics analysis must include the effects of the direction dependence on material properties. Material testing at NASA MSFC has indicated that the foam can be modeled as a transversely isotropic material. As a first step toward understanding the fracture mechanics of this material, we present a general theoretical and numerical framework for computing stress intensity factors (SIFs), under mixed-mode loading conditions, taking into account the material anisotropy. We present mode I SIFs for middle tension - M(T) - test specimens, using 3D finite element stress analysis (ANSYS) and FRANC3D fracture analysis software, developed by the Cornel1 Fracture Group. Mode I SIF values are presented for a range of foam material orientations. Also, NASA has recorded the failure load for various M(T) specimens. For a linear analysis, the mode I SIF will scale with the far-field load. This allows us to numerically estimate the mode I fracture toughness for this material. The results represent a quantitative basis for evaluating the strength and

  4. A Multi-Wavelength Study of the 3B/X1.2 Flare Observed on 2003 October 26

    Institute of Scientific and Technical Information of China (English)

    Hui Li; Jian-Ping Li; Cheng Fang; Brigitte Schmieder; Arkadiusz Berlicki; Qiu-Sheng Du

    2005-01-01

    We report results from a multi-wavelength study of the 3B/X1.2 tworibbon disk flare (S15E44), which was well observed by both ground-based and space-borne instruments. Two pairs of conjugate kernels - K1 and K4, and K2and K3 - in the Hα images are identified. These kernels are linked by two different systems of EUV loops. K1 and K4 correspond to the two 17 GHz and 34 GHz microwave sources observed by the Nobeyama Radioheliograph (NoRH), while K2and K3 have no corresponding microwave sources. Optical spectroscopic observations suggest that all the four kernels are possible precipitating sites of non-thermal electrons. Thus the energy of electron deposited in K2 and K3 should be less than 100 keV. Two-dimensional distributions of the full widths at half maximum (FWHM) of the Hα profiles and the line-of-sight (LOS) velocities derived from the Ca Ⅱ 8542 (A) profiles indicate that the largest FWHM and LOS velocity tends to be located near the outer edges of Hα kernels, which is consistent with the scenario of current two-ribbon flare models and previous results. When non-thermal electron bombardment is present, the observed Hα and Ca Ⅱ 8542 A profiles are similar to previous observational and theoretical results, while the He Ⅰ 10830 (A) profiles are different from the theoretical ones. This puts some constraints on future theoretical calculation of the He Ⅰ 10830 (A) line.

  5. Focalyx Dx, Bx, Tx et Apps: A novel contemporary fusion paradigm for the management of prostate cancer.

    Science.gov (United States)

    Bianco, F J; Martínez-Salamanca, J I

    2016-07-01

    FocalyxTM conceived as a response to emerging evidence data across numerous cancer lesions that questions current standard treatment approaches that too often lead to detrimental quality of life yet delivering limited survival benefit, especially in-lieu of advances in imaging technology applicable to cancer patients. The Focalyx paradigm aims to control cancer with improvement in quality of life. We initially devised 5 milestones: 1- Consistently optimize Prostate MRI imaging using the novel published protocols adopted as guidelines by societies such as the European Society of Urology and Radiology; 2- Evaluate fusion platform software solutions that existed; 3- Determine best fusión platform for Focalyx on practicality, precision, and workflow premises; 4- Evaluate commercially available FDA approved ablative technologies to implement our treatment vision; 5- Design a treatment option that can be performed in the office setting under local anesthesia, which would not impact negatively QOL outcomes of Prostate Cancer patients and seamless constant nonintrusive practical patient-physician interaction by the Focalyx app that facilitates follow up and provides early warning signals shall any change in the disease dynamics emerge. Prostate cancer was identified as the pilot disease for Focalyx to deliver a "GPS" like solution for the prostate gland that destroys identifiable disease without adverse effects such as: cancer anxiety, urinary incontinence, loss of erections and ejaculation. Since September of 2013, over 300 men have been accrued in NCT02381990- clintrials.gov evaluating the feasibility of our solutions for imaging (FocalyxDx), Biopsy (FocalyxBx) and Treatment (FocalyxTx). In this review we detail the tools available to achieve the Focalyx paradigm for men with Prostate Cancer. PMID:27416639

  6. Cathepsin B/X is secreted by Echinometra lucunter sea urchin spines, a structure rich in granular cells and toxins

    Science.gov (United States)

    2013-01-01

    Background Echinometra lucunter is a common American sea urchin responsible for the majority of the marine accidents in Brazil. Although not lethal, these accidents are reported to be extremely painful. Recently, our group described the presence of toxins in its spines that contribute to the pathological reactions. Additionally, we have observed that the E. lucunter spines can regenerate when broken. In the present work we evaluated the enzymatic activities of sea urchin spine extracts in order to identify an enzyme that could contribute not only to the toxicity, but also participate in the spine growth and regeneration. Results The spine aqueous extract was tested for peptidase activity, with synthetic substrates, in the presence and absence of inhibitors and activators. For proper enzyme classification, the FRET-substrate cleavage pattern, pH-dependency activity and Western-blot analyses were performed. The spine extract was able to cleave Z-R-MCA and Abz-GIVRAK(Dnp)-OH following pre-incubation with DTT, and was inhibited by E-64. Furthermore, the double-peaked pH curve (5 and 7) and the cleavage site proportion (4:6, R↓A:A↓K) indicate the presence of both mono and dicarboxypeptidase activities. Moreover, in Western-blot analysis, the spine extract was positive for anti-cathepsin B antibody. Conclusions E. lucunter spines extracts presented a cysteine peptidase activity that was identified as cathepsin B/X that would participate in the remodeling and growth processes of the spine, as well as in the inflammatory response to the accident. PMID:24341625

  7. Perched-Water Evaluation for the Deep Vadose Zone Beneath the B, BX, and BY Tank Farms Area of the Hanford Site

    Energy Technology Data Exchange (ETDEWEB)

    Truex, Michael J.; Oostrom, Martinus; Carroll, KC; Chronister, Glen B.

    2013-06-28

    Perched-water conditions have been observed in the vadose zone above a fine-grained zone that is located a few meters above the water table within the B, BX, and BY Tank Farms area. The perched water contains elevated concentrations of uranium and technetium-99. This perched-water zone is important to consider in evaluating the future flux of contaminated water into the groundwater. The study described in this report was conducted to examine the perched-water conditions and quantitatively evaluate 1) factors that control perching behavior, 2) contaminant flux toward groundwater, and 3) associated groundwater impact.

  8. SURFACE GEOPHYSICAL EXPLORATION OF B & BX & BY TANK FARMS AT THE HANFORD SITE RESULTS OF BACKGROUND CHARACTERIZATION WITH MAGNETICS AND ELECTROMAGNETICS

    Energy Technology Data Exchange (ETDEWEB)

    MYERS DA

    2007-09-28

    This report documents the results of preliminary surface geophysical exploration activities performed between October and December 2006 at the B, BX, and BY tank farms (B Complex). The B Complex is located in the 200 East Area of the U. S. Department of Energy's Hanford Site in Washington State. The objective of the preliminary investigation was to collect background characterization information with magnetic gradiometry and electromagnetic induction to understand the spatial distribution of metallic objects that could potentially interfere with the results from high resolution resistivity survey. Results of the background characterization show there are several areas located around the site with large metallic subsurface debris or metallic infrastructure.

  9. Permutation Entropy for Random Binary Sequences

    Directory of Open Access Journals (Sweden)

    Lingfeng Liu

    2015-12-01

    Full Text Available In this paper, we generalize the permutation entropy (PE measure to binary sequences, which is based on Shannon’s entropy, and theoretically analyze this measure for random binary sequences. We deduce the theoretical value of PE for random binary sequences, which can be used to measure the randomness of binary sequences. We also reveal the relationship between this PE measure with other randomness measures, such as Shannon’s entropy and Lempel–Ziv complexity. The results show that PE is consistent with these two measures. Furthermore, we use PE as one of the randomness measures to evaluate the randomness of chaotic binary sequences.

  10. Remnants of compact binary mergers

    CERN Document Server

    Domainko, W

    2006-01-01

    We investigate the long-term evolution and observability of remnants originating from the merger of compact binary systems and discuss the differences to supernova remnants. Compact binary mergers expel much smaller amounts of mass at much higher velocities, as compared to supernovae, which will affect the dynamical evolution of their remnants. The ejecta of mergers consist of very neutron rich nuclei. Some of these neutron rich nuclei will produce observational signatures in form of gamma ray lines during their decay. The composition of the ejecta might even give interesting constraints about the internal structure of the neutron star. We further discuss the possibility that merger remnants appear as recently discovered 'dark accelerators' which are extended TeV sources which lack emission in other bands.

  11. Event Rates for Binary Inspiral

    CERN Document Server

    Kalogera, V

    2001-01-01

    Double compact objects (neutron stars and black holes) found in binaries with small orbital separations are known to spiral in and are expected to coalesce eventually because of the emission of gravitational waves. Such inspiral and merger events are thought to be primary sources for ground based gravitational-wave interferometric detectors (such as LIGO). Here, we present a brief review of estimates of coalescence rates and we examine the origin and relative importance of uncertainties associated with the rate estimates. For the case of double neutron star systems, we compare the most recent rate estimates to upper limits derived in a number of different ways. We also discuss the implications of the formation of close binaries with two non-recycled pulsars.

  12. Modified binary particle swam optimization

    Institute of Scientific and Technical Information of China (English)

    Sangwook Lee; Sangmoon Soak; Sanghoun Oh; Witold Pedrycz; Moongu Jeon

    2008-01-01

    This paper presents a modified binary particle swarm optimization(BPSO)which adopts concepts of the genotype-phenotype rep-resentation and the mutation operator of genetic algorithms.Its main feature is that the BPSO can be treated as a continuous PSO.The proposed BPSO algorithm is tested on various benchmark functions,and its performance is compared with that of the original BPSO.Experimental results show that the modified BPSO outperforms the original BPSO algorithm.

  13. Tides in asynchronous binary systems

    OpenAIRE

    Toledano, Oswaldo; Moreno, Edmundo; Koenigsberger, Gloria; Detmers, R.; Langer, Norbert

    2006-01-01

    Stellar oscillations are excited in non-synchronously rotating stars in binary systems due to the tidal forces. Tangential components of the tides can drive a shear flow which behaves as a differentially forced rotating structure in a stratified outer medium. In this paper we show that our single-layer approximation for the calculation of the forced oscillations yields results that are consistent with the predictions for the synchronization timescales in circular orbits. In addition, calibrat...

  14. Temperature affecting the magnetic properties of the Co79−xFe3Cr3Si15Bx amorphous alloy

    International Nuclear Information System (INIS)

    The paper studies the effect the temperature has on the magnetic properties of the Co79−xFe3Cr3Si15Bx amorphous alloy with different boron content. Magnetic saturation induction Bs and Curie temperature TC decrease as the boron content increases. Within the range of relatively high temperatures, magnetic saturation induction Bs = μ0Ms is related to the temperature by Bs(T) ∼ (TC − T)0.38. In the Co79−xFe3Cr3Si15Bx amorphous alloys with the Curie temperature of lower than 180 °C the initial permeability of 200,000 and the coercive force of 0.1 A/m were obtained. The high initial permeability of the amorphous alloy is attributed to the absence of the crystalline, magnetoelastic and induced magnetic anisotropy in this alloy. Low Curie temperature near which the permeability appreciably increases (Hopkinson effect) is another approach to the ideal magnetic softness

  15. High hardness BaCb-(BxOy/BN) composites with 3D mesh-like fine grain-boundary structure by reactive spark plasma sintering.

    Science.gov (United States)

    Vasylkiv, Oleg; Borodianska, Hanna; Badica, Petre; Grasso, Salvatore; Sakka, Yoshio; Tok, Alfred; Su, Liap Tat; Bosman, Michael; Ma, Jan

    2012-02-01

    Boron carbide B4C powders were subject to reactive spark plasma sintering (also known as field assisted sintering, pulsed current sintering or plasma assisted sintering) under nitrogen atmosphere. For an optimum hexagonal BN (h-BN) content estimated from X-ray diffraction measurements at approximately 0.4 wt%, the as-prepared BaCb-(BxOy/BN) ceramic shows values of Berkovich and Vickers hardness of 56.7 +/- 3.1 GPa and 39.3 +/- 7.6 GPa, respectively. These values are higher than for the vacuum SPS processed B4C pristine sample and the h-BN -mechanically-added samples. XRD and electronic microscopy data suggest that in the samples produced by reactive SPS in N2 atmosphere, and containing an estimated amount of 0.3-1.5% h-BN, the crystallite size of the boron carbide grains is decreasing with the increasing amount of N2, while for the newly formed lamellar h-BN the crystallite size is almost constant (approximately 30-50 nm). BN is located at the grain boundaries between the boron carbide grains and it is wrapped and intercalated by a thin layer of boron oxide. BxOy/BN forms a fine and continuous 3D mesh-like structure that is a possible reason for good mechanical properties. PMID:22629879

  16. Borehole Data Package for Well 299-E33-44 at Single-Shell Tank Waste Management Area B-BX-BY

    Energy Technology Data Exchange (ETDEWEB)

    DG Horton; SM Narbutovskih

    1999-03-23

    One new Resource Conservation and Recovery Act (RCRA) groundwater monitoring well was installed during September 1998 at the single-shell tank farm Waste Management Area (WMA) B-BX-BY. The well is 299-E33-44 and is located east of the BY single-shell tank farm. The well is a new upgradient monitoring well drilled in support of the groundwater assessment program at WMA B-BX-BY. This document is a compilation of information on the drilling and construction well development pump installation, and sediment testing and analyses applicable to well 299-E33-44. Appendix A contains copies of the geologist's log, the Well Construction Summary Report and Well Summary Sheet (as-built diagram); Appendix B contains results of Laboratory analyses completed on samples of sediment from the well and Appendix C contains geophysical logs. An aquifer test (slug test) was done in the well after well completion. Results from the aquifer test will be published elsewhere. Additional documentation concerning well construction is on file with Bechtel Hanford Inc., Richland, Washington.

  17. Galaxy Rotation and Rapid Supermassive Binary Coalescence

    Science.gov (United States)

    Holley-Bockelmann, Kelly; Khan, Fazeel Mahmood

    2015-09-01

    Galaxy mergers usher the supermassive black hole (SMBH) in each galaxy to the center of the potential, where they form an SMBH binary. The binary orbit shrinks by ejecting stars via three-body scattering, but ample work has shown that in spherical galaxy models, the binary separation stalls after ejecting all the stars in its loss cone—this is the well-known final parsec problem. However, it has been shown that SMBH binaries in non-spherical galactic nuclei harden at a nearly constant rate until reaching the gravitational wave regime. Here we use a suite of direct N-body simulations to follow SMBH binary evolution in both corotating and counterrotating flattened galaxy models. For N > 500 K, we find that the evolution of the SMBH binary is convergent and is independent of the particle number. Rotation in general increases the hardening rate of SMBH binaries even more effectively than galaxy geometry alone. SMBH binary hardening rates are similar for co- and counterrotating galaxies. In the corotating case, the center of mass of the SMBH binary settles into an orbit that is in corotation resonance with the background rotating model, and the coalescence time is roughly a few 100 Myr faster than a non-rotating flattened model. We find that counterrotation drives SMBHs to coalesce on a nearly radial orbit promptly after forming a hard binary. We discuss the implications for gravitational wave astronomy, hypervelocity star production, and the effect on the structure of the host galaxy.

  18. Visual Binaries in the Orion Nebula Cluster

    CERN Document Server

    Reipurth, Bo; Connelley, Michael S; Bally, John

    2007-01-01

    We have carried out a major survey for visual binaries towards the Orion Nebula Cluster using HST images obtained with an H-alpha filter. Among 781 likely ONC members more than 60" from theta-1 Ori C, we find 78 multiple systems (75 binaries and 3 triples), of which 55 are new discoveries, in the range from 0.1" to 1.5". About 9 binaries are likely line-of-sight associations. We find a binary fraction of 8.8%+-1.1% within the limited separation range from 67.5 to 675 AU. The field binary fraction in the same range is a factor 1.5 higher. Within the range 150 AU to 675 AU we find that T Tauri associations have a factor 2.2 more binaries than the ONC. The binary separation distribution function of the ONC shows unusual structure, with a sudden steep decrease in the number of binaries as the separation increases beyond 0.5", corresponding to 225 AU. We have measured the ratio of binaries wider than 0.5" to binaries closer than 0.5" as a function of distance from the Trapezium, and find that this ratio is signifi...

  19. Evolution of binary stars in multiple-population globular clusters - II. Compact binaries

    Science.gov (United States)

    Hong, Jongsuk; Vesperini, Enrico; Sollima, Antonio; McMillan, Stephen L. W.; D'Antona, Franca; D'Ercole, Annibale

    2016-04-01

    We present the results of a survey of N-body simulations aimed at exploring the evolution of compact binaries in multiple-population globular clusters. We show that as a consequence of the initial differences in the structural properties of the first-generation (FG) and the second-generation (SG) populations and the effects of dynamical processes on binary stars, the SG binary fraction decreases more rapidly than that of the FG population. The difference between the FG and SG binary fraction is qualitatively similar to but quantitatively smaller than that found for wider binaries in our previous investigations. The evolution of the radial variation of the binary fraction is driven by the interplay between binary segregation, ionization and ejection. Ionization and ejection counteract in part the effects of mass segregation but for compact binaries the effects of segregation dominate and the inner binary fraction increases during the cluster evolution. We explore the variation of the difference between the FG and the SG binary fraction with the distance from the cluster centre and its dependence on the binary binding energy and cluster structural parameters. The difference between the binary fraction in the FG and the SG populations found in our simulations is consistent with the results of observational studies finding a smaller binary fraction in the SG population.

  20. Orbital eccentricities in primordial black holes binaries

    OpenAIRE

    Cholis, Ilias; Kovetz, Ely D.; Ali-Haïmoud, Yacine; Bird, Simeon; Kamionkowski, Marc; Muñoz, Julian B.; Raccanelli, Alvise

    2016-01-01

    It was recently suggested that the merger of $\\sim30\\,M_\\odot$ primordial black holes (PBHs) may provide a significant number of events in gravitational-wave observatories over the next decade, if they make up an appreciable fraction of the dark matter. Here we show that measurement of the eccentricities of the inspiralling binary black holes can be used to distinguish these binaries from those produced by more traditional astrophysical mechanisms. These PBH binaries are formed on highly ecce...

  1. Asteroid Systems: Binaries, Triples, and Pairs

    CERN Document Server

    Margot, Jean-Luc; Taylor, Patrick; Carry, Benoît; Jacobson, Seth

    2015-01-01

    In the past decade, the number of known binary near-Earth asteroids has more than quadrupled and the number of known large main belt asteroids with satellites has doubled. Half a dozen triple asteroids have been discovered, and the previously unrecognized populations of asteroid pairs and small main belt binaries have been identified. The current observational evidence confirms that small (20 km) binaries with small satellites are most likely created during large collisions.

  2. Relativistic Gravity and Binary Radio Pulsars

    OpenAIRE

    Kaspi, V. M.

    1999-01-01

    Following a summary of the basic principles of pulsar timing, we present a review of recent results from timing observations of relativistic binary pulsars. In particular, we summarize the status of timing observations of the much celebrated original binary pulsar PSR B1913+16, draw attention to the recent confirmation of strong evidence for geodetic precession in this system, review the recent measurement of multiple post-Keplerian binary parameters for PSR B1534+12, and describe the Parkes ...

  3. Microlensing Signature of Binary Black Holes

    Science.gov (United States)

    Schnittman, Jeremy; Sahu, Kailash; Littenberg, Tyson

    2012-01-01

    We calculate the light curves of galactic bulge stars magnified via microlensing by stellar-mass binary black holes along the line-of-sight. We show the sensitivity to measuring various lens parameters for a range of survey cadences and photometric precision. Using public data from the OGLE collaboration, we identify two candidates for massive binary systems, and discuss implications for theories of star formation and binary evolution.

  4. Detection of unresolved binaries with multicolor photometry

    CERN Document Server

    Chulkov, D; Malkov, O; Sichevskij, S; Krussanova, N; Mironov, A; Zakharov, A; Kniazev, A

    2016-01-01

    The principal goal of this paper is to specify conditions of detection of unresolved binaries by multicolor photometry. We have developed a method for estimating the critical distance at which an unresolved binary of given mass and age can be detected. The method is applied to the photometric system of the planned Lyra-B spaceborne experiment. We have shown that some types of unresolved binary stars can be discovered and distinguished from single stars solely by means of photometric observations.

  5. Relativistic Gravity and Binary Radio Pulsars

    CERN Document Server

    Kaspi, V M

    1999-01-01

    Following a summary of the basic principles of pulsar timing, we present a review of recent results from timing observations of relativistic binary pulsars. In particular, we summarize the status of timing observations of the much celebrated original binary pulsar PSR B1913+16, draw attention to the recent confirmation of strong evidence for geodetic precession in this system, review the recent measurement of multiple post-Keplerian binary parameters for PSR B1534+12, and describe the Parkes Multibeam survey, a major survey of the Galactic Plane which promises to discover new relativistic binary pulsar systems.

  6. Speech perception of noise with binary gains

    DEFF Research Database (Denmark)

    Wang, DeLiang; Kjems, Ulrik; Pedersen, Michael Syskind;

    2008-01-01

    For a given mixture of speech and noise, an ideal binary time-frequency mask is constructed by comparing speech energy and noise energy within local time-frequency units. It is observed that listeners achieve nearly perfect speech recognition from gated noise with binary gains prescribed by the i...... by the ideal binary mask. Only 16 filter channels and a frame rate of 100 Hz are sufficient for high intelligibility. The results show that, despite a dramatic reduction of speech information, a pattern of binary gains provides an adequate basis for speech perception....

  7. The equations for binary density and the binary stream of particles of electro conducting magnetic liquids

    International Nuclear Information System (INIS)

    In work on the basis of a method of the kinetic equations it is output the differential equations for binary density and a binary stream of particles of electro conducting magnetic liquids. These equations are the nonuniform equations of parabolic type. The solution of these equations completely feature existential behaviour of binary density and a binary stream of particles of electro conducting magnetic liquids, i.e. process of a structural relaxation. (author)

  8. Massive Stars in Interactive Binaries

    Science.gov (United States)

    St.-Louis, Nicole; Moffat, Anthony F. J.

    Massive stars start their lives above a mass of ~8 time solar, finally exploding after a few million years as core-collapse or pair-production supernovae. Above ~15 solar masses, they also spend most of their lives driving especially strong, hot winds due to their extreme luminosities. All of these aspects dominate the ecology of the Universe, from element enrichment to stirring up and ionizing the interstellar medium. But when they occur in close pairs or groups separated by less than a parsec, the interaction of massive stars can lead to various exotic phenomena which would not be seen if there were no binaries. These depend on the actual separation, and going from wie to close including colliding winds (with non-thermal radio emission and Wolf-Rayet dust spirals), cluster dynamics, X-ray binaries, Roche-lobe overflow (with inverse mass-ratios and rapid spin up), collisions, merging, rejuventation and massive blue stragglers, black-hole formation, runaways and gamma-ray bursts. Also, one wonders whether the fact that a massive star is in a binary affects its parameters compared to its isolated equivalent. These proceedings deal with all of these phenomena, plus binary statistics and determination of general physical properties of massive stars, that would not be possible with their single cousins. The 77 articles published in these proceedings, all based on oral talks, vary from broad revies to the lates developments in the field. About a third of the time was spent in open discussion of all participants, both for ~5 minutes after each talk and 8 half-hour long general dialogues, all audio-recorded, transcribed and only moderately edited to yield a real flavour of the meeting. The candid information in these discussions is sometimes more revealing than the article(s) that preceded them and also provide entertaining reading. The book is suitable for researchers and graduate students interested in stellar astrophysics and in various physical processes involved when

  9. Young and Waltzing Binary Stars

    Science.gov (United States)

    2001-10-01

    ADONIS Observes Low-mass Eclipsing System in Orion Summary A series of very detailed images of a binary system of two young stars have been combined into a movie . In merely 3 days, the stars swing around each other. As seen from the earth, they pass in front of each other twice during a full revolution, producing eclipses during which their combined brightness diminishes . A careful analysis of the orbital motions has now made it possible to deduce the masses of the two dancing stars . Both turn out to be about as heavy as our Sun. But while the Sun is about 4500 million years old, these two stars are still in their infancy. They are located some 1500 light-years away in the Orion star-forming region and they probably formed just 10 million years ago . This is the first time such an accurate determination of the stellar masses could be achieved for a young binary system of low-mass stars . The new result provides an important piece of information for our current understanding of how young stars evolve. The observations were obtained by a team of astronomers from Italy and ESO [1] using the ADaptive Optics Near Infrared System (ADONIS) on the 3.6-m telescope at the ESO La Silla Observatory. PR Photo 29a/01 : The RXJ 0529.4+0041 system before primary eclipse PR Photo 29b/01 : The RXJ 0529.4+0041 system at mid-primary eclipse PR Photo 29c/01 : The RXJ 0529.4+0041 system after primary eclipse PR Photo 29d/01 : The RXJ 0529.4+0041 system before secondary eclipse PR Photo 29e/01 : The RXJ 0529.4+0041 system at mid-secondary eclipse PR Photo 29f/01 : The RXJ 0529.4+0041 system after secondary eclipse PR Video Clip 06/01 : Video of the RXJ 0529.4+0041 system Binary stars and stellar masses Since some time, astronomers have noted that most stars seem to form in binary or multiple systems. This is quite fortunate, as the study of binary stars is the only way in which it is possible to measure directly one of the most fundamental quantities of a star, its mass. The mass of a

  10. The structures of binary compounds

    CERN Document Server

    Hafner, J; Jensen, WB; Majewski, JA; Mathis, K; Villars, P; Vogl, P; de Boer, FR

    1990-01-01

    - Up-to-date compilation of the experimental data on the structures of binary compounds by Villars and colleagues. - Coloured structure maps which order the compounds into their respective structural domains and present for the first time the local co-ordination polyhedra for the 150 most frequently occurring structure types, pedagogically very helpful and useful in the search for new materials with a required crystal structure. - Crystal co-ordination formulas: a flexible notation for the interpretation of solid-state structures by chemist Bill Jensen. - Recent important advances in unders

  11. R144 : a very massive binary likely ejected from R136 through a binary-binary encounter

    CERN Document Server

    Oh, Seungkyung; Banerjee, Sambaran

    2013-01-01

    R144 is a recently confirmed very massive, spectroscopic binary which appears isolated from the core of the massive young star cluster R136. The dynamical ejection hypothesis as an origin for its location is claimed improbable by Sana et al. due to its binary nature and high mass. We demonstrate here by means of direct N-body calculations that a very massive binary system can be readily dynamically ejected from a R136-like cluster, through a close encounter with a very massive system. One out of four N-body cluster models produces a dynamically ejected very massive binary system with a mass comparable to R144. The system has a system mass of $\\approx$ 355 Msun and is located at 36.8 pc from the centre of its parent cluster, moving away from the cluster with a velocity of 57 km/s at 2 Myr as a result of a binary-binary interaction. This implies that R144 could have been ejected from R136 through a strong encounter with an other massive binary or single star. In addition, we discuss all massive binaries and sin...

  12. Millisecond Pulsars in Close Binaries

    CERN Document Server

    Tauris, Thomas M

    2015-01-01

    In this Habilitationsschrift (Habilitation thesis) I present my research carried out over the last four years at the Argelander Institute for Astronomy (AIfA) and the Max Planck Institute for Radio Astronomy (MPIfR). The thesis summarizes my main findings and has been written to fulfill the requirements for the Habilitation qualification at the University of Bonn. Although my work is mainly focused on the topic of millisecond pulsars (MSPs), there is a fairly broad spread of research areas ranging from the formation of neutron stars (NSs) in various supernova (SN) events, to their evolution, for example, via accretion processes in binary and triple systems, and finally to their possible destruction in merger events. The thesis is organized in the following manner: A general introduction to neutron stars and millisecond pulsars is given in Chapter 1. A selection of key papers published in 2011-2014 are presented in Chapters 2-10, ordered within five main research areas (ultra-stripped SNe in close binaries, ma...

  13. Polarization in binary microlensing events

    International Nuclear Information System (INIS)

    The light received by source stars in microlensing events may be significantly polarized if both an efficient photon-scattering mechanism is active in the source stellar atmosphere and a differential magnification is therein induced by the lensing system. The best candidate events for observing polarization are highly magnified events with source stars belonging to the class of cool, giant stars in which the stellar light is polarized by photon scattering on dust grains contained in their envelopes. The presence in the stellar atmosphere of an internal cavity devoid of dust produces polarization profiles with a two peaks structure. Hence, the time interval between them gives an important observable quantity directly related to the size of the internal cavity and to the model parameters of the lens system. We show that, during a microlensing event, the expected polarization variability can solve an ambiguity that arises in some cases, related to the binary or planetary lensing interpretation of the perturbations observed near the maximum of the event light-curve. We consider a specific event case for which the parameter values corresponding to the two solutions are given. Then, assuming a polarization model for the source star, we compute the two expected polarization profiles. The position of the two peaks appearing in the polarization curves and the characteristic time interval between them allow us to distinguish between the binary and planetary lens solutions. (paper)

  14. First-Principles Study of Electronic and Optical Properties of BxGa1 - xAs Alloy%BxGa1-xAs合金电子结构与光学性质的第一性原理计算

    Institute of Scientific and Technical Information of China (English)

    闫映策; 王彦龙; 马会芳

    2016-01-01

    First⁃principles calculations based on density functional theory are performed for zinc⁃blende BxGa1 - xAs alloy with a special quasirandom structure (SQS) approach in a 64⁃atom supercell. Structural, electronic and optical properties of BxGa1 - xAs alloy are comprehensively investigated under optimized geometry structures. It was found that calculated lattice constant slightly deviated from Vegards law and significant bond length relaxation is shown. Calculated bowing parameters of energy gap are small (2 57 eV - 5 01 eV) and are weakly composition⁃dependent. Finally, effects of boron composition on optical parameters including dielectric function, reflectivity, refractive index, absorption coefficient and energy loss function are analyzed in detail.%基于密度泛函理论的第一性原理和特殊准随机近似方法,建立64原子的超胞并且对结构进行几何优化.计算和讨论具有闪锌矿结构的三元合金 BxGa1- xAs 的结构参数、电子结构和光学性质.结果表明:BxGa1- xAs 的晶格常数与使用 Vegard 定理计算得到的值有微弱的偏离,键长存在明显的弛豫;计算得到的合金带隙弯曲参数变化较小(2.57 eV -5.01 eV)而且对组分变化的依赖很弱;最后分析硼的并入对 GaAs 光学参数包括介电函数、反射率、折射率、吸收系数和能量耗散函数的影响.

  15. Pulsating Components in Binary and Multiple Stellar Systems --- A Catalog of Oscillating Binaries

    OpenAIRE

    Zhou, A. -Y.

    2010-01-01

    We present an up-to-date catalog of pulsating binaries, i.e. the binary and multiple stellar systems containing pulsating components, along with a statistics on them. Compared to the earlier compilation by Soydugan et al.(2006a) of 25 delta Scuti-type `oscillating Algol-type eclipsing binaries' (oEA), the recent collection of 74 oEA by Liakos et al.(2012), and the collection of Cepheids in binaries by Szabados (2003a), the numbers and types of pulsating variables in binaries are now extended....

  16. The Evolution of Compact Binary Star Systems

    Directory of Open Access Journals (Sweden)

    Yungelson, Lev R.

    2006-12-01

    Full Text Available We review the formation and evolution of compact binary stars consisting of white dwarfs (WDs, neutron stars (NSs, and black holes (BHs. Binary NSs and BHs are thought to be the primary astrophysical sources of gravitational waves (GWs within the frequency band of ground-based detectors, while compact binaries of WDs are important sources of GWs at lower frequencies to be covered by space interferometers (LISA. Major uncertainties in the current understanding of properties of NSs and BHs most relevant to the GW studies are discussed, including the treatment of the natal kicks which compact stellar remnants acquire during the core collapse of massive stars and the common envelope phase of binary evolution. We discuss the coalescence rates of binary NSs and BHs and prospects for their detections, the formation and evolution of binary WDs and their observational manifestations. Special attention is given to AM CVn-stars -- compact binaries in which the Roche lobe is filled by another WD or a low-mass partially degenerate helium-star, as these stars are thought to be the best LISA verification binary GW sources.

  17. The Evolution of Compact Binary Star Systems

    Directory of Open Access Journals (Sweden)

    Konstantin A. Postnov

    2014-05-01

    Full Text Available We review the formation and evolution of compact binary stars consisting of white dwarfs (WDs, neutron stars (NSs, and black holes (BHs. Mergings of compact-star binaries are expected to be the most important sources for forthcoming gravitational-wave (GW astronomy. In the first part of the review, we discuss observational manifestations of close binaries with NS and/or BH components and their merger rate, crucial points in the formation and evolution of compact stars in binary systems, including the treatment of the natal kicks, which NSs and BHs acquire during the core collapse of massive stars and the common envelope phase of binary evolution, which are most relevant to the merging rates of NS-NS, NS-BH and BH-BH binaries. The second part of the review is devoted mainly to the formation and evolution of binary WDs and their observational manifestations, including their role as progenitors of cosmologically-important thermonuclear SN Ia. We also consider AM CVn-stars, which are thought to be the best verification binary GW sources for future low-frequency GW space interferometers.

  18. Eliciting Subjective Probabilities with Binary Lotteries

    DEFF Research Database (Denmark)

    Harrison, Glenn W.; Martínez-Correa, Jimmy; Swarthout, J. Todd

    We evaluate the binary lottery procedure for inducing risk neutral behavior in a subjective belief elicitation task. Harrison, Martínez-Correa and Swarthout [2013] found that the binary lottery procedure works robustly to induce risk neutrality when subjects are given one risk task defined over o...

  19. Pulsed Accretion onto Eccentric and Circular Binaries

    CERN Document Server

    Muñoz, Diego J

    2016-01-01

    We present numerical simulations of circumbinary accretion onto eccentric and circular binaries using the moving-mesh code AREPO. This is the first set of simulations to tackle the problem of binary accretion using a finite-volume scheme on a freely moving mesh, which allows for accurate measurements of accretion onto individual stars for arbitrary binary eccentricity. While accretion onto a circular binary shows bursts with period of ~5 times the binary period P_b,accretion onto an eccentric binary is predominantly modulated at the period ~1P_b. For an equal-mass circular binary, the accretion rates onto individual stars are quite similar to each other, following the same variable pattern in time. By contrast, for eccentric binaries, one of the stars can accrete at a rate 10-20 times larger than its companion. This "symmetry breaking" between the stars, however, alternates over timescales of order 200 P_b, and can be attributed to a slowly precessing, eccentric circumbinary disk. Over longer timescales, the ...

  20. ECCENTRIC EVOLUTION OF SUPERMASSIVE BLACK HOLE BINARIES

    International Nuclear Information System (INIS)

    In recent numerical simulations, it has been found that the eccentricity of supermassive black hole (SMBH)-intermediate black hole (IMBH) binaries grows toward unity through interactions with the stellar background. This increase of eccentricity reduces the merging timescale of the binary through the gravitational radiation to a value well below the Hubble time. It also gives a theoretical explanation of the existence of eccentric binaries such as that in OJ287. In self-consistent N-body simulations, this increase of eccentricity is always observed. On the other hand, the result of the scattering experiment between SMBH binaries and field stars indicated that the eccentricity dose not change significantly. This discrepancy leaves the high eccentricity of the SMBH binaries in N-body simulations unexplained. Here, we present a stellar-dynamical mechanism that drives the increase of the eccentricity of an SMBH binary with a large mass ratio. There are two key processes involved. The first one is the Kozai mechanism under a non-axisymmetric potential, which effectively randomizes the angular momenta of surrounding stars. The other is the selective ejection of stars with prograde orbits. Through these two mechanisms, field stars extract the orbital angular momentum of the SMBH binary. Our proposed mechanism causes the increase in the eccentricity of most of SMBH binaries, resulting in the rapid merger through gravitational wave radiation. Our result has given a definite solution to the 'last-parsec problem'.

  1. Microlensing Binaries with Candidate Brown Dwarf Companions

    DEFF Research Database (Denmark)

    Shin, I.-G; Han, C.; Gould, A.;

    2012-01-01

    Brown dwarfs are important objects because they may provide a missing link between stars and planets, two populations that have dramatically different formation histories. In this paper, we present the candidate binaries with brown dwarf companions that are found by analyzing binary microlensing ...

  2. Gravitational radiation, inspiraling binaries, and cosmology

    Science.gov (United States)

    Chernoff, David F.; Finn, Lee S.

    1993-01-01

    We show how to measure cosmological parameters using observations of inspiraling binary neutron star or black hole systems in one or more gravitational wave detectors. To illustrate, we focus on the case of fixed mass binary systems observed in a single Laser Interferometer Gravitational-wave Observatory (LIGO)-like detector. Using realistic detector noise estimates, we characterize the rate of detections as a function of a threshold SNR Rho(0), H0, and the binary 'chirp' mass. For Rho(0) = 8, H0 = 100 km/s/Mpc, and 1.4 solar mass neutron star binaries, the sample has a median redshift of 0.22. Under the same assumptions but independent of H0, a conservative rate density of coalescing binaries implies LIGO will observe about 50/yr binary inspiral events. The precision with which H0 and the deceleration parameter q0 may be determined depends on the number of observed inspirals. For fixed mass binary systems, about 100 observations with Rho(0) = 10 in the LIGO will give H0 to 10 percent in an Einstein-DeSitter cosmology, and 3000 will give q0 to 20 percent. For the conservative rate density of coalescing binaries, 100 detections with Rho(0) = 10 will require about 4 yrs.

  3. Gravitational waves from inspiralling binary black holes

    International Nuclear Information System (INIS)

    Binary black holes are the most promising candidate sources for the first generation of earth-based interferometric gravitational-wave detectors. We summarize and discuss the state-of-the-art analytical techniques developed during the last few years to better describe the late dynamical evolution of binary black holes of comparable masses

  4. Bayesian analysis of exoplanet and binary orbits

    CERN Document Server

    Schulze-Hartung, Tim; Henning, Thomas

    2012-01-01

    We introduce BASE (Bayesian astrometric and spectroscopic exoplanet detection and characterisation tool), a novel program for the combined or separate Bayesian analysis of astrometric and radial-velocity measurements of potential exoplanet hosts and binary stars. The capabilities of BASE are demonstrated using all publicly available data of the binary Mizar A.

  5. Intermediate valence in single crystals of (Lu1−xY bx)3Rh4Ge13 (0 ≤ x ≤ 1)

    International Nuclear Information System (INIS)

    Single crystals of (Lu1−xY bx)3Rh4Ge13 were characterized by magnetization, specific heat, and electrical resistivity measurements. Doping Yb into the non-magnetic Lu3Rh4Ge13 compound tunes this cubic system’s properties from a superconductor with disordered metal normal state (x < 0.05) to a Kondo for 0.05 ≤ x ≤0.2 and intermediate valence at the highest Yb concentrations. The evidence for intermediate Yb valence comes from a broad maximum in the magnetic susceptibility and X-ray photoelectron spectroscopy. Furthermore, the resistivity displays a local maximum at finite temperatures at intermediate compositions x, followed by apparent metallic behavior closest to the Yb end compound in the series

  6. 用f(1)、f(0)、f(-1)表示f(x)=ax2+bx+c解竞赛题

    Institute of Scientific and Technical Information of China (English)

    严启国; 陈纯亮

    2003-01-01

    @@ 设函数f(x)=ax2+bx+c(-1≤x≤1),则f(1)=a+b+c,f(0)=c,f(-1)=a-b+c,解得a=1/2f(1)+1/2f(-1)-f(0),b=1/2f(1)-1/2f(-1),c=f(0),从而有f(x)=[1/2f(1)+1/2f(-1)-f(0)]x2+[1/2f(1)-1/2f(-1)]x+f(0),利用这一表示形式可以解下列竞赛题.

  7. Planet Scattering Around Binaries: Ejections, Not Collisions

    CERN Document Server

    Smullen, Rachel A; Shannon, Andrew

    2016-01-01

    Transiting circumbinary planets discovered by Kepler provide unique insight into binary and planet formation. Several features of this new found population, for example the apparent pile-up of planets near the innermost stable orbit, may distinguish between formation theories. In this work, we determine how planet-planet scattering shapes planetary systems around binaries as compared to single stars. In particular, we look for signatures that arise due to differences in dynamical evolution in binary systems. We carry out a parameter study of N-body scattering simulations for four distinct planet populations around both binary and single stars. While binarity has little influence on the final system multiplicity or orbital distribution, the presence of a binary dramatically effects the means by which planets are lost from the system. Most circumbinary planets are lost due to ejections rather than planet-planet or planet-star collisions. The most massive planet in the system tends to control the evolution. Asid...

  8. Orbital dynamics of binary boson star systems

    International Nuclear Information System (INIS)

    We extend our previous studies of head-on collisions of boson stars by considering orbiting binary boson stars. We concentrate on equal-mass binaries and study the dynamical behavior of boson/boson and boson/antiboson pairs. We examine the gravitational wave output of these binaries and compare with other compact binaries. Such a comparison lets us probe the apparent simplicity observed in gravitational waves produced by black hole binary systems. In our system of interest however, there is an additional internal freedom which plays a significant role in the system's dynamics, namely, the phase of each star. Our evolutions show rather simple behavior at early times, but large differences occur at late times for the various initial configurations

  9. Logistic chaotic maps for binary numbers generations

    International Nuclear Information System (INIS)

    Two pseudorandom binary sequence generators, based on logistic chaotic maps intended for stream cipher applications, are proposed. The first is based on a single one-dimensional logistic map which exhibits random, noise-like properties at given certain parameter values, and the second is based on a combination of two logistic maps. The encryption step proposed in both algorithms consists of a simple bitwise XOR operation of the plaintext binary sequence with the keystream binary sequence to produce the ciphertext binary sequence. A threshold function is applied to convert the floating-point iterates into binary form. Experimental results show that the produced sequences possess high linear complexity and very good statistical properties. The systems are put forward for security evaluation by the cryptographic committees.

  10. Preparation and electrochemical properties of nanocrystalline LiBxMn2−xO4 cathode particles for Li-ion batteries by ultrasonic spray pyrolysis method

    International Nuclear Information System (INIS)

    Highlights: • B substituted spinel LiMn2O4 cathodes were prepared by spray pyrolysis method. • Effects of boron content to the spinel structure were investigated. • Formation of glassy phase expands the gap between charge–discharge potentials. • LiB0.3Mn1.7O4 sample exhibits 92 mAh g−1 discharge capacity at 0.5 C rate. • B–O bonding increases the structural stability against Li+ extraction/insertion. • Stabilized spinel structure by boron substitution shows good cycling performance. - Abstract: Nanocrystalline LiBxMn2−xO4 (x = 0.1–0.4) particles are prepared by ultrasonic spray pyrolysis using lithium nitrate, manganese nitrate and boric acid at 800 °C in an air atmosphere. The materials properties are characterized by X-ray diffraction, scanning electron microscopy, and atomic absorption spectroscopy. The electrochemical behaviors are investigated with cyclic voltammetry and galvanostatic techniques. The particle characterization studies show that nanocrystalline particles have spinel structure of submicron size with spherical morphology. All boron substituted lithium manganese oxide spinels show improved cycling performance. Among them, LiB0.3Mn1.7O4 particles exhibit 92 mAh g−1 discharge capacity and 82% capacity retention after 50 cycles at a 0.5 C rate. The higher degree of atomic ordering and the avoidance of the formation of a glass phase in LiBxMn2−xO4 materials are responsible for the better electrochemical performance

  11. Polarization in binary microlensing events

    CERN Document Server

    Ingrosso, G; Nucita, A A; Strafella, F; Novati, S Calchi; Jetzer, Ph; Liuzzi, G; Zakharov, A

    2013-01-01

    The light received by source stars in microlensing events may be significantly polarized if both an efficient photon scattering mechanism is active in the source stellar atmosphere and a differential magnification is therein induced by the lensing system. The best candidate events for observing polarization are highly magnified events with source stars belonging to the class of cool, giant stars {in which the stellar light is polarized by photon scattering on dust grains contained in their envelopes. The presence in the stellar atmosphere of an internal cavity devoid of dust produces polarization profiles with a two peaks structure. Hence, the time interval between them gives an important observable quantity directly related to the size of the internal cavity and to the model parameters of the lens system.} We show that {during a microlensing event} the expected polarization variability can solve an ambiguity, that arises in some cases, related to the binary or planetary lensing interpretation of the perturba...

  12. Binary Cepheids from optical interferometry

    CERN Document Server

    Gallenne, A; Mérand, A; Monnier, J D; Pietrzyński, J Breitfelder G; Gieren, W

    2013-01-01

    Classical Cepheid stars have been considered since more than a century as reliable tools to estimate distances in the universe thanks to their Period-Luminosity (P-L) relationship. Moreover, they are also powerful astrophysical laboratories, providing fundamental clues for studying the pulsation and evolution of intermediate-mass stars. When in binary systems, we can investigate the age and evolution of the Cepheid, estimate the mass and distance, and constrain theoretical models. However, most of the companions are located too close to the Cepheid (1-40 mas) to be spatially resolved with a 10-meter class telescope. The only way to spatially resolve such systems is to use long-baseline interferometry. Recently, we have started a unique and long-term interferometric program that aims at detecting and characterizing physical parameters of the Cepheid companions, with as main objectives the determination of accurate masses and geometric distances.

  13. Binary theory of electronic stopping

    CERN Document Server

    Sigmund, P

    2002-01-01

    Binary stopping theory has been developed to characterize the electronic stopping of swift heavy ions in matter. It is an extension of Bohr's classical theory of 1913 incorporating screening, higher-order-Z sub 1 and shell corrections, high-speed quantum and relativity corrections as well as projectile excitation and ionization. The main numerical input comes from optical properties. The computation of shell corrections involves orbital velocity distributions of target and projectile electrons. Calculated stopping parameters depend on ion charge. Equilibrium stopping forces may be computed by adoption of a suitable model for the equilibrium charge state. This paper summarizes the current status of the theory, in particular the sensitivity of its predictions to pertinent input. Charge-dependent stopping forces have been calculated for selected systems and compared to experimental results. Equilibrium stopping forces calculated for a wide variety of ion-target combinations are compared with experimental data fr...

  14. Binary mixtures of chiral gases

    CERN Document Server

    Presilla, Carlo

    2015-01-01

    A possible solution of the well known paradox of chiral molecules is based on the idea of spontaneous symmetry breaking. At low pressure the molecules are delocalized between the two minima of a given molecular potential while at higher pressure they become localized in one minimum due to the intermolecular dipole-dipole interactions. Evidence for such a phase transition is provided by measurements of the inversion spectrum of ammonia and deuterated ammonia at different pressures. In particular, at pressure greater than a critical value no inversion line is observed. These data are well accounted for by a model previously developed and recently extended to mixtures. In the present paper, we discuss the variation of the critical pressure in binary mixtures as a function of the fractions of the constituents.

  15. Gamma-ray binaries and related systems

    CERN Document Server

    Dubus, Guillaume

    2013-01-01

    After initial claims and a long hiatus, it is now established that several binary stars emit high (0.1-100 GeV) and very high energy (>100 GeV) gamma rays. A new class has emerged called 'gamma-ray binaries', since most of their radiated power is emitted beyond 1 MeV. Accreting X-ray binaries, novae and a colliding wind binary (eta Car) have also been detected - 'related systems' that confirm the ubiquity of particle acceleration in astrophysical sources. Do these systems have anything in common ? What drives their high-energy emission ? How do the processes involved compare to those in other sources of gamma rays: pulsars, active galactic nuclei, supernova remnants ? I review the wealth of observational and theoretical work that have followed these detections, with an emphasis on gamma-ray binaries. I present the current evidence that gamma-ray binaries are driven by rotation-powered pulsars. Binaries are laboratories giving access to different vantage points or physical conditions on a regular timescale as ...

  16. Interrupted Binary Mass Transfer in Star Clusters

    CERN Document Server

    Leigh, Nathan W C; Toonen, Silvia

    2016-01-01

    Binary mass transfer is at the forefront of some of the most exciting puzzles of modern astrophysics, including Type Ia supernovae, gamma-ray bursts, and the formation of most observed exotic stellar populations. Typically, the evolution is assumed to proceed in isolation, even in dense stellar environments such as star clusters. In this paper, we test the validity of this assumption via the analysis of a large grid of binary evolution models simulated with the SeBa code. For every binary, we calculate analytically the mean time until another single or binary star comes within the mean separation of the mass-transferring binary, and compare this time-scale to the mean time for stable mass transfer to occur. We then derive the probability for each respective binary to experience a direct dynamical interruption. The resulting probability distribution can be integrated to give an estimate for the fraction of binaries undergoing mass transfer that are expected to be disrupted as a function of the host cluster pro...

  17. Pd-Si binary bulk metallic glass

    Institute of Scientific and Technical Information of China (English)

    YAO KeFu; CHEN Na

    2008-01-01

    Pd80+xSi20-x (x=0, 1, and 2) binary metallic glasses with the diameter ranging from 7 to 8 mm were prepared by a combination of fluxing and water quenching or air cooling. Thermal analysis results show that with increasing Si content, the glass transition temperature Tg, the initial crystallization temperature Tx and the onset crystalliza-tion temperature Tp of Pd-Si binary glassy alloys increase. Moreover, the super-cooled liquid region reaches 61 K. It indicates that Pd-Si binary alloys possess large glass forming ability, which can be greatly improved by fluxing treatment.

  18. Pd-Si binary bulk metallic glass

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Pd80+xSi20-x (x=0,1,and 2) binary metallic glasses with the diameter ranging from 7 to 8 mm were prepared by a combination of fluxing and water quenching or air cooling. Thermal analysis results show that with increasing Si content,the glass transition temperature Tg,the initial crystallization temperature Tx and the onset crystalliza-tion temperature Tp of Pd-Si binary glassy alloys increase. Moreover,the super-cooled liquid region reaches 61 K. It indicates that Pd-Si binary alloys possess large glass forming ability,which can be greatly improved by fluxing treatment.

  19. Eliciting Subjective Probabilities with Binary Lotteries

    DEFF Research Database (Denmark)

    Harrison, Glenn W.; Martínez-Correa, Jimmy; Swarthout, J. Todd

    2014-01-01

    We evaluate a binary lottery procedure for inducing risk neutral behavior in a subjective belief elicitation task. Prior research has shown this procedure to robustly induce risk neutrality when subjects are given a single risk task defined over objective probabilities. Drawing a sample from the...... same subject population, we find evidence that the binary lottery procedure also induces linear utility in a subjective probability elicitation task using the Quadratic Scoring Rule. We also show that the binary lottery procedure can induce direct revelation of subjective probabilities in subjects with...

  20. Cassini states for black hole binaries

    OpenAIRE

    Correia, Alexandre C. M.

    2015-01-01

    Cassini states correspond to the equilibria of the spin axis of a body when its orbit is perturbed. They were initially described for planetary satellites, but the spin axes of black hole binaries also present this kind of equilibria. In previous works, Cassini states were reported as spin-orbit resonances, but actually the spin of black hole binaries is in circulation and there is no resonant motion. Here we provide a general description of the spin dynamics of black hole binary systems base...

  1. Fast algorithms for generating binary holograms

    CERN Document Server

    Stuart, Dustin; Kuhn, Axel

    2014-01-01

    We describe three algorithms for generating binary-valued holograms. Our methods are optimised for producing large arrays of tightly focussed optical tweezers for trapping particles. Binary-valued holograms allow us to use a digital mirror device (DMD) as the display element, which is much faster than other alternatives. We describe how our binary amplitude holograms can be used to correct for phase errors caused by optical aberrations. Furthermore, we compare the speed and accuracy of the algorithms for both periodic and arbitrary arrangements of traps, which allows one to choose the ideal scheme depending on the circumstances.

  2. CALCULATING THE HABITABLE ZONE OF BINARY STAR SYSTEMS. II. P-TYPE BINARIES

    International Nuclear Information System (INIS)

    We have developed a comprehensive methodology for calculating the circumbinary habitable zone (HZ) in planet-hosting P-type binary star systems. We present a general formalism for determining the contribution of each star of the binary to the total flux received at the top of the atmosphere of an Earth-like planet and use the Sun's HZ to calculate the inner and outer boundaries of the HZ around a binary star system. We apply our calculations to the Kepler's currently known circumbinary planetary systems and show the combined stellar flux that determines the boundaries of their HZs. We also show that the HZ in P-type systems is dynamic and, depending on the luminosity of the binary stars, their spectral types, and the binary eccentricity, its boundaries vary as the stars of the binary undergo their orbital motion. We present the details of our calculations and discuss the implications of the results

  3. CALCULATING THE HABITABLE ZONE OF BINARY STAR SYSTEMS. II. P-TYPE BINARIES

    Energy Technology Data Exchange (ETDEWEB)

    Haghighipour, Nader [Institute for Astronomy and NASA Astrobiology Institute, University of Hawaii-Manoa, Honolulu, HI 96822 (United States); Kaltenegger, Lisa [MPIA, Koenigstuhl 17, Heidelberg, D-69117 (Germany)

    2013-11-10

    We have developed a comprehensive methodology for calculating the circumbinary habitable zone (HZ) in planet-hosting P-type binary star systems. We present a general formalism for determining the contribution of each star of the binary to the total flux received at the top of the atmosphere of an Earth-like planet and use the Sun's HZ to calculate the inner and outer boundaries of the HZ around a binary star system. We apply our calculations to the Kepler's currently known circumbinary planetary systems and show the combined stellar flux that determines the boundaries of their HZs. We also show that the HZ in P-type systems is dynamic and, depending on the luminosity of the binary stars, their spectral types, and the binary eccentricity, its boundaries vary as the stars of the binary undergo their orbital motion. We present the details of our calculations and discuss the implications of the results.

  4. Compact Binaries in Star Clusters I - Black Hole Binaries Inside Globular Clusters

    OpenAIRE

    Downing, J. M. B.; Benacquista, M. J.; Giersz, M.; Spurzem, R.

    2009-01-01

    We study the compact binary population in star clusters, focusing on binaries containing black holes, using a self-consistent Monte Carlo treatment of dynamics and full stellar evolution. We find that the black holes experience strong mass segregation and become centrally concentrated. In the core the black holes interact strongly with each other and black hole-black hole binaries are formed very efficiently. The strong interactions, however, also destroy or eject the black hole-black hole bi...

  5. Properties of planets in binary systems. The role of binary separation

    OpenAIRE

    Desidera, S.; Barbieri, M.

    2006-01-01

    The statistical properties of planets in binaries were investigated. Any difference to planets orbiting single stars can shed light on the formation and evolution of planetary systems. As planets were found around components of binaries with very different separation and mass ratio, it is particularly important to study the characteristics of planets as a function of the effective gravitational influence of the companion. A compilation of planets in binary systems was made; a search for compa...

  6. Binaries in the Hipparcos data: Keep digging

    CERN Document Server

    Pourbaix, D; Jorissen, A

    2004-01-01

    Among the 120 000 objects in the Hipparcos catalogue, only 235 were fitted with an orbital model. Besides these 235 original astrometric binaries, most Hipparcos entries with a known spectroscopic orbit (extrasolar planet or stellar companion) have now been re-processed, as part of the on-going construction of the 9th Catalogue of Spectroscopic Binary Orbits (SB9, available at http://sb9.astro.ulb.ac.be). The pitfalls and successes of this re-processing are discussed in various contexts, like (i) orbital inclinations: the holy grail for extrasolar planets (ii) searching for binaries without a priori knowledge of their spectroscopic orbital elements, and application to barium stars (iii) why not all SB9 entries yield acceptable astrometric solutions? The lessons learned from this study are useful to devise the best possible binary-detection and orbit-determination algorithms for future astrometric missions like GAIA.

  7. A mesoscopic model for binary fluids

    CERN Document Server

    Echeverria, C; Alvarez-Llamoza, O; Orozco-Guillén, E E; Morales, M; Cosenza, M G

    2016-01-01

    We propose a model to study symmetric binary fluids, based in the mesoscopic molecular simulation technique known as multiparticle collision, where space and state variables are continuous while time is discrete. We include a repulsion rule to simulate segregation processes that does not require the calculation of the interaction forces between particles, thus allowing the description of binary fluids at a mesoscopic scale. The model is conceptually simple, computationally efficient, maintains Galilean invariance, and conserves the mass and the energy in the system at micro and macro scales; while momentum is conserved globally. For a wide range of temperatures and densities, the model yields results in good agreement with the known properties of binary fluids, such as density profile, width of the interface, phase separation and phase growth. We also apply the model to study binary fluids in crowded environments with consistent results.

  8. Red-giant stars in eccentric binaries

    Directory of Open Access Journals (Sweden)

    Beck P. G.

    2015-01-01

    Full Text Available The unparalleled photometric data obtained by NASA’s Kepler Space Telescope has led to improved understanding of red-giant stars and binary stars. We discuss the characterization of known eccentric system, containing a solar-like oscillating red-giant primary component. We also report several new binary systems that are candidates for hosting an oscillating companion. A powerful approach to study binary stars is to combine asteroseimic techniques with light curve fitting. Seismology allows us to deduce the properties of red giants. In addition, by modeling the ellipsoidal modulations we can constrain the parameters of the binary system. An valuable independent source are ground-bases, high-resolution spectrographs.

  9. Evolution of Binary Stars in Multiple-Population Globular Clusters - II. Compact Binaries

    CERN Document Server

    Hong, Jongsuk; Sollima, Antonio; McMillan, Stephen L W; D'Antona, Franca; D'Ercole, Annibale

    2016-01-01

    We present the results of a survey of N-body simulations aimed at exploring the evolution of compact binaries in multiple-population globular clusters.We show that as a consequence of the initial differences in the structural properties of the first-generation (FG) and the second-generation (SG) populations and the effects of dynamical processes on binary stars, the SG binary fraction decreases more rapidly than that of the FG population. The difference between the FG and SG binary fraction is qualitatively similar to but quantitatively smaller than that found for wider binaries in our previous investigations.The evolution of the radial variation of the binary fraction is driven by the interplay between binary segregation, ionization and ejection. Ionization and ejection counteract in part the effects of mass segregation but for compact binaries the effects of segregation dominate and the inner binary fraction increases during the cluster evolution. We explore the variation of the difference between the FG an...

  10. Tidal capture formation of Low Mass X-Ray Binaries from wide binaries in the field

    CERN Document Server

    Michaely, Erez

    2015-01-01

    We present a potentially efficient dynamical formation scenario for Low Mass X-ray Binaries (LMXBs) in the field, focusing on black-hole (BH) LMXBs. In this formation channel LMXBs are formed from wide binaries $(>1000$ AU) with a BH component and a stellar companion. The wide binary is perturbed by fly-by's of field stars and its orbit random-walks and changes over time. This diffusion process can drive the binary into a sufficiently eccentric orbit such that the binary components tidally interact at peri-center and the binary evolves to become a short period binary, which eventually evolves into an LMXB. The formation rate of LMXBs through this channel mostly depends on the number of such BH wide binaries progenitors, which in turn depends on the velocity kicks imparted to BHs (or NSs) at birth. We consider several models for the formation and survival of such wide binaries, and calculate the LMXB formation rates for each model. We find that models where BHs form through direct collapse with no/little natal...

  11. Binary is Good: A Binary Inference Framework for Primary User Separation in Cognitive Radio Networks

    CERN Document Server

    Nguyen, Huy; Han, Zhu

    2010-01-01

    Primary users (PU) separation concerns with the issues of distinguishing and characterizing primary users in cognitive radio (CR) networks. We argue the need for PU separation in the context of collaborative spectrum sensing and monitor selection. In this paper, we model the observations of monitors as boolean OR mixtures of underlying binary latency sources for PUs, and devise a novel binary inference algorithm for PU separation. Simulation results show that without prior knowledge regarding PUs' activities, the algorithm achieves high inference accuracy. An interesting implication of the proposed algorithm is the ability to effectively represent n independent binary sources via (correlated) binary vectors of logarithmic length.

  12. Dixie Valley Bottoming Binary Unit

    Energy Technology Data Exchange (ETDEWEB)

    McDonald, Dale [Terra-Gen Sierra Holdings, LLC, Reno, NV (United States)

    2014-12-21

    This binary plant is the first air cooled, high-output refrigeration based waste heat recovery cycle in the industry. Its working fluid is environmentally friendly and as such, the permits that would be required with a hydrocarbon based cycle are not necessary. The unit is largely modularized, meaning that the unit’s individual skids were assembled in another location and were shipped via truck to the plant site. The Air Cooled Condensers (ACC), equipment piping, and Balance of Plant (BOP) piping were constructed at site. This project further demonstrates the technical feasibility of using low temperature brine for geothermal power utilization. The development of the unit led to the realization of low temperature, high output, and environmentally friendly heat recovery systems through domestic research and engineering. The project generates additional renewable energy, resulting in cleaner air and reduced carbon dioxide emissions. Royalty and tax payments to governmental agencies will increase, resulting in reduced financial pressure on local entities. The major components of the unit were sourced from American companies, resulting in increased economic activity throughout the country.

  13. Structure of simple (binary) oxides

    International Nuclear Information System (INIS)

    Crystal structures of different simple and binary oxides of M3O, M2O, MO, MO2, MO4, MO3, M2O3, M3O4, M2O5, M2O7 composition as well as lowest cesium oxides (Cs7O, Cs4O, Cs11O3) are considered. Cs3O crystals are constructed out of the colomns of the Cs3O composition consisting of octahedrals OCs6 jointed through the opposite faces. This is the ZrI3 ''antistructure''. Cs2O has the CdCl2 antistructure. ZrO2, HfO2, CeO2, ThO2, UO2, NpO2, PuO2, AmO2, CmO2, PoO2 oxides have the structural type of fluorite of rutile - VO2, NbO2, TaO2, MoO2, ReO2 oxides, of wurtzite - BeO. The NbO oxide is unique, in its structure the oxygen and niobium atoms form four complanar bonds. A three-dimensional skeleton constructed out of the octahedral structural units Nb6 (Nb-Nb 2.98 A) is separated. ZrO2 is a polymorphous, at 1100 grad. the monoclinic modification transfers to tetragonal. M2O7 oxides are Re2O7, Tc2O7

  14. Detecting Eccentric Globular Cluster Binaries with LISA

    OpenAIRE

    Benacquista, M.

    2001-01-01

    The energy carried in the gravitational wave signal from an eccentric binary is spread across several harmonics of the orbital frequency. The inclusion of the harmonics in the analysis of the gravitational wave signal increases the signal-to-noise ratio of the detected signal for binaries whose fundamental frequency is below the galactic confusion-limited noise cut-off. This can allow for an improved angular resolution for sources whose orbital period is greater than 2000 s. Globular cluster ...

  15. Copula-based bivariate binary response models

    OpenAIRE

    Winkelmann, Rainer

    2009-01-01

    The bivariate probit model is frequently used for estimating the effect of an endogenous binary regressor on a binary outcome variable. This paper discusses simple modifications that maintain the probit assumption for the marginal distributions while introducing non-normal dependence among the two variables using copulas. Simulation results and evidence from two applications, one on the effect of insurance status on ambulatory expenditure and one on the effect of completing high school on sub...

  16. Binary compact object inspiral: Detection expectations

    Indian Academy of Sciences (India)

    Vassiliki Kalogera

    2004-10-01

    We review the current estimates of binary compact object inspiral rates in particular in view of the recently discovered highly relativistic binary pulsar J0737-3039. One of the robust results is that, because of this discovery, the rate estimates for binary neutron stars have increased by a factor of 6-7 independent of any uncertainties related to the pulsar population properties. This rate increase has dramatic implications for gravitational wave detectors. For initial LIGO, the most probable detection rates for double neutron star (DNS) inspirals is 1 event/(5{250) yr; at 95% confidence we obtain rates up to 1/1.5 yr. For advanced LIGO, the most probable rates are 20-1000 events/yr. These predictions, for the first time, bring the expectations for DNS detections by initial LIGO to the astrophysically relevant regime. We also use our models to predict that the large-scale Parkes multibeam pulsar survey with acceleration searches could detect an average of three to four binary pulsars similar to those known at present. In comparison, rate estimates for binaries with black holes are derived based on binary evolution calculation, and based on the optimistic ends of the ranges, remain an important candidate for inspiral detection in the next few years. We also consider another aspect of the detectability of binary inspiral: the effect of precession on the detection efficiency of astrophysically relevant binaries. Based on our current astrophysical expectations, large tilt angles are not favored. As a result the decrease in detection rate varies rather slowly with black hole spin magnitude and is within 20-30% of the maximum possible values.

  17. Planet Scattering Around Binaries: Ejections, Not Collisions

    OpenAIRE

    Smullen, Rachel A.; Kratter, Kaitlin M.; Shannon, Andrew

    2016-01-01

    Transiting circumbinary planets discovered by Kepler provide unique insight into binary and planet formation. Several features of this new found population, for example the apparent pile-up of planets near the innermost stable orbit, may distinguish between formation theories. In this work, we determine how planet-planet scattering shapes planetary systems around binaries as compared to single stars. In particular, we look for signatures that arise due to differences in dynamical evolution in...

  18. GAIA survey of galactic eclipsing binaries

    OpenAIRE

    Zwitter, Tomaz

    2002-01-01

    General importance and capabilities of observations of eclipsing binaries by the forthcoming ESA mission GAIA are discussed. Availability of spectroscopic observations and a large number of photometric bands on board will make it possible to reliably determine physical parameters for $\\sim 10^5$ binary stars. It is stressed that current methods of object by object analysis will have to be modified and included in an automatic analysis pipeline.

  19. Formation of Compact Binaries in Globular Clusters

    OpenAIRE

    Rappaport, Saul; Pfahl, Eric; Rasio, Fred; Podsiadlowski, Philipp

    2001-01-01

    We report here on two complementary population synthesis studies which relate directly to the formation and evolution of neutron star binaries in globular clusters. In the first, we compute the probability of retaining neutron stars in globular clusters, and quantitatively confirm the idea that the retention fraction for neutron stars born in binary systems is greatly enhanced over those born in isolated stars. However, the retention fraction may well be insufficient to explain the current po...

  20. Diffusion in ordered binary solid systems

    International Nuclear Information System (INIS)

    This thesis contains contributions to the field of diffusion in ordered binary solid systems. An extensive experimental investigation of the self diffusion in CoGa is presented. The results of these diffusion measurements strongly suggest that a substantial part of the atomic migration is caused by a new type of defect. A quantitative description of the atomic displacements via this defect is given. Finally computer simulations are presented of diffusion and ordering in binary solid systems. (Auth.)

  1. Binary nature of the Barium stars

    International Nuclear Information System (INIS)

    We present radial-velocity spectrometer observations that indicate that Ba II stars are binary systems. The secondary stars of these systems have low masses, consistent with their being degenerate objects which have lost mass onto their primaries in a previous stage of evolution. It is suggested that the Population II equivalents, the CH stars, may also be binary systems. This may be related to the fact that they are found only in globular clusters of the lowest central concentration

  2. On homogeneous nontransitive binary perfect code

    OpenAIRE

    Mogilnykh, I. Yu.; Solov'eva, F. I.

    2014-01-01

    Studying binary perfect codes we show the existence of homogeneous nontransitive codes. Thus, as far as perfect codes are concerned, the propelinear codes are strictly contained in transitive codes, wheresas homogeneous codes form a strict subclass of transitive codes. In the work we deduce a necessary and sufficient condition for transitivity of perfect binary codes of rank one more than that of Hamming code. The paper is in Russian.

  3. Texture classification by texton: statistical versus binary.

    Science.gov (United States)

    Guo, Zhenhua; Zhang, Zhongcheng; Li, Xiu; Li, Qin; You, Jane

    2014-01-01

    Using statistical textons for texture classification has shown great success recently. The maximal response 8 (Statistical_MR8), image patch (Statistical_Joint) and locally invariant fractal (Statistical_Fractal) are typical statistical texton algorithms and state-of-the-art texture classification methods. However, there are two limitations when using these methods. First, it needs a training stage to build a texton library, thus the recognition accuracy will be highly depended on the training samples; second, during feature extraction, local feature is assigned to a texton by searching for the nearest texton in the whole library, which is time consuming when the library size is big and the dimension of feature is high. To address the above two issues, in this paper, three binary texton counterpart methods were proposed, Binary_MR8, Binary_Joint, and Binary_Fractal. These methods do not require any training step but encode local feature into binary representation directly. The experimental results on the CUReT, UIUC and KTH-TIPS databases show that binary texton could get sound results with fast feature extraction, especially when the image size is not big and the quality of image is not poor. PMID:24520346

  4. Texture classification by texton: statistical versus binary.

    Directory of Open Access Journals (Sweden)

    Zhenhua Guo

    Full Text Available Using statistical textons for texture classification has shown great success recently. The maximal response 8 (Statistical_MR8, image patch (Statistical_Joint and locally invariant fractal (Statistical_Fractal are typical statistical texton algorithms and state-of-the-art texture classification methods. However, there are two limitations when using these methods. First, it needs a training stage to build a texton library, thus the recognition accuracy will be highly depended on the training samples; second, during feature extraction, local feature is assigned to a texton by searching for the nearest texton in the whole library, which is time consuming when the library size is big and the dimension of feature is high. To address the above two issues, in this paper, three binary texton counterpart methods were proposed, Binary_MR8, Binary_Joint, and Binary_Fractal. These methods do not require any training step but encode local feature into binary representation directly. The experimental results on the CUReT, UIUC and KTH-TIPS databases show that binary texton could get sound results with fast feature extraction, especially when the image size is not big and the quality of image is not poor.

  5. Direct Exoplanet Detection with Binary Differential Imaging

    CERN Document Server

    Rodigas, Timothy J; Mamajek, Eric E; Males, Jared R; Close, Laird M; Morzinski, Katie; Hinz, Philip M; Kaib, Nathan

    2015-01-01

    Binaries are typically excluded from direct imaging exoplanet surveys. However, the recent findings of Kepler and radial velocity programs show that planets can and do form in binary systems. Here, we suggest that visual binaries offer unique advantages for direct imaging. We show that Binary Differential Imaging (BDI), whereby two stars are imaged simultaneously at the same wavelength within the isoplanatic patch at high Strehl ratio, offers improved point spread function (PSF) subtraction that can result in increased sensitivity to planets close to each star. We demonstrate this by observing a young visual binary separated by 4\\asec ~with MagAO/Clio-2 at 3.9 \\microns, where the Strehl ratio is high, the isoplanatic patch is large, and giant planets are bright. Comparing BDI to angular differential imaging (ADI), we find that BDI's 5$\\sigma$ contrast is \\about 0.5 mags better than ADI's within \\about 1\\asec ~for the particular binary we observed. Because planets typically reside close to their host stars, BD...

  6. Spectroscopic Orbits for Kepler FOV Eclipsing Binaries

    Science.gov (United States)

    Matson, Rachel A.; Gies, Douglas R.; Williams, Stephen J.; Guo, Zhao

    2013-02-01

    We are currently involved in a four year program of precise eclipsing binary photometry with the NASA Kepler Observatory. Our goal is to search for variations in minimum light timing for intermediate mass eclipsing binaries. Such periodic variations will reveal the reflex motion caused by any distant, low mass object that orbits the close binary. it Kepler's unprecedented accuracy and continuous observations provide a unique opportunity to detect the low mass companions that are predicted to result from the angular momentum of the natal cloud. The goal of this proposal is to obtain blue spectra of short period (0.9-6d) eclipsing binaries, derive radial velocities, and produce a double-lined spectroscopic orbit (as well as estimates of the stellar effective temperatures, gravities, and metallicities). Combined with the it Kepler light curve, we will determine very accurate masses and radii for the members of the close binary, which will yield the mass-inclination product M_3 sin i for any companions detected by light travel time or other effects. An extended sample of eclipsing binaries with longer periods (up to 50d) is now being investigated to test whether the presence of a tertiary companion declines with increasing period. We propose to obtain a single spectrum at quadrature for the brightest 48 stars in this expanded sample to characterize the effective temperatures and total mass contained in these systems.

  7. Stability and Coalescence of Massive Twin Binaries

    CERN Document Server

    Hwang, Jason A; Rasio, Frederic A; Kalogera, Vassiliki

    2015-01-01

    Massive stars are usually found in binaries, and binaries with periods less than 10 days may have a preference for near equal component masses. In this paper we investigate the evolution of these binaries all the way to contact and the possibility that these systems can be progenitors of double neutron star binaries. The small orbital separations of observed double neutron star binaries suggest that the progenitor systems underwent a common envelope phase at least once during their evolution. Bethe & Brown (1998) proposed that massive binary twins will undergo a common envelope evolution while both components are ascending the red giant branch or asymptotic giant branch simultaneously, also known as double-core evolution. Using models generated from the stellar evolution code Evolve Zero Age Main Sequence, we determine the range of mass ratios resulting in both components simultaneously ascending the RGB or AGB as a function of the difference in birth times, t. We find that, even for a generous t=5 Myr, t...

  8. Spectroscopic subsystems in nearby wide binaries

    CERN Document Server

    Tokovinin, Andrei

    2015-01-01

    Radial velocity (RV) monitoring of solar-type visual binaries has been conducted at the CTIO/SMARTS 1.5-m telescope to study short-period systems. Data reduction is described, mean and individual RVs of 163 observed objects are given. New spectroscopic binaries are discovered or suspected in 17 objects, for some of them orbital periods could be determined. Subsystems are efficiently detected even in a single observation by double lines and/or by the RV difference between the components of visual binaries. The potential of this detection technique is quantified by simulation and used for statistical assessment of 96 wide binaries within 67pc. It is found that 43 binaries contain at least one subsystem and the occurrence of subsystems is equally probable in either primary or secondary components. The frequency of subsystems and their periods match the simple prescription proposed by the author (2014, AJ, 147, 87). The remaining 53 simple wide binaries with a median projected separation of 1300AU have the distri...

  9. Design and Implementation of BDB, the Binary Star Database

    Science.gov (United States)

    Kaygorodov, P.; Kovaleva, D.; Malkov, O.

    2013-02-01

    The Binary star DataBase (BDB, http://bdb.inasan.ru) is created to provide liasons between binary star catalogue data of various origin. Information on different observational types of binaries is obtained from heterogeneous sources of data - astronomical catalogues and surveys. The database allows a variety of query options useful for selected stars investigation purposes, for binary observations planning, and for construction and examination of binary datasets with certain characteristics.

  10. Exploring the Birth of Binary Stars

    Science.gov (United States)

    Kohler, Susanna

    2016-08-01

    More than half of all stars are thought to be in binary or multiple star systems. But how do these systems form? The misaligned spins of some binary protostars might provide a clue.Two Formation ModelsIts hard to tell how multiple-star systems form, since these systems are difficult to observe in their early stages. But based on numerical simulations, there are two proposed models for the formation of stellar binaries:Turbulent fragmentationTurbulence within a single core leads to multiple dense clumps. These clumps independently collapse to form stars that orbit each other.Disk fragmentationGravitational instabilities in a massive accretion disk cause the formation of a smaller, secondary disk within the first, resulting in two stars that orbit each other.Log column density for one of the authors simulated binary systems, just after the formation of two protostars. Diamonds indicate the protostar positions. [Adapted from Offner et al. 2016]Outflows as CluesHow can we differentiate between these formation mechanisms? Led by Stella Offner (University of Massachusetts), a team of scientists has suggested that the key isto examine the alignment of the stars protostellar outflows jets that are often emitted from the poles of young, newly forming stars.Naively, wed expect that disk fragmentation would produce binary stars with common angular momentum. As the stars spins would be aligned, they would therefore also launch protostellar jets that were aligned with each other. Turbulent fragmentation, on the other hand, would cause the stars to have independent angular momentum. This would lead to randomly oriented spins, so the protostellar jets would be misaligned.Snapshots from the authors simulations. Left panel of each pair: column density; green arrows giveprotostellar spin directions. Right panel: synthetic observations produced from the simulations; cyan arrows giveprotostellar outflow directions. [Offner et al. 2016]Simulations of FragmentationIn order to better

  11. New spectroscopic binary companions of giant stars and updated metallicity distribution for binary systems

    CERN Document Server

    Bluhm, P; Vanzi, L; Soto, M G; Vos, J; Wittenmyer, R A; Olivares, F; Drass, H; Mennickent, R E; Vuckovic, M; Rojo, P; Melo, C H F

    2016-01-01

    We report the discovery of 24 spectroscopic binary companions to giant stars. We fully constrain the orbital solution for 6 of these systems. We cannot unambiguously derive the orbital elements for the remaining stars because the phase coverage is incomplete. Of these stars, 6 present radial velocity trends that are compatible with long-period brown dwarf companions.The orbital solutions of the 24 binary systems indicate that these giant binary systems have a wide range in orbital periods, eccentricities, and companion masses. For the binaries with restricted orbital solutions, we find a range of orbital periods of between $\\sim$ 97-1600 days and eccentricities of between $\\sim$ 0.1-0.4. In addition, we studied the metallicity distribution of single and binary giant stars. We computed the metallicity of a total of 395 evolved stars, 59 of wich are in binary systems. We find a flat distribution for these binary stars and therefore conclude that stellar binary systems, and potentially brown dwarfs, have a diffe...

  12. Towards the field binary population: Influence of orbital decay on close binaries

    CERN Document Server

    Korntreff, Christina; Pfalzner, Susanne

    2012-01-01

    Surveys of the binary populations in the solar neighbourhood have shown that the periods of G- and M-type stars are log-normally distributed. However, observations of young binary populations suggest a log-uniform distribution. Clearly some process(es) change the period distribution over time. Most stars form in star clusters, in which two important dynamical processes occur: i) gas-induced orbital decay of embedded binary systems and ii) destruction of soft binaries in three-body interactions. The emphasis here is on orbital decay which has been largely neglected so far. Using a combination of Monte-Carlo and dynamical nbody modelling it is demonstrated here that the cluster dynamics destroys the number of wide binaries, but leaves short-period binaries basically undisturbed even for a initially log-uniform distribution. By contrast orbital decay significantly reduces the number and changes the properties of short-period binaries, but leaves wide binaries largely uneffected. Until now it was unclear whether ...

  13. Gravitational wave background from binary systems

    International Nuclear Information System (INIS)

    Basic aspects of the background of gravitational waves and its mathematical characterization are reviewed. The spectral energy density parameter Ω(f), commonly used as a quantifier of the background, is derived for an ensemble of many identical sources emitting at different times and locations. For such an ensemble, Ω(f) is generalized to account for the duration of the signals and of the observation, so that one can distinguish the resolvable and unresolvable parts of the background. The unresolvable part, often called confusion noise or stochastic background, is made by signals that cannot be either individually identified or subtracted out of the data. To account for the resolvability of the background, the overlap function is introduced. This function is a generalization of the duty cycle, which has been commonly used in the literature, in some cases leading to incorrect results. The spectra produced by binary systems (stellar binaries and massive black hole binaries) are presented over the frequencies of all existing and planned detectors. A semi-analytical formula for Ω(f) is derived in the case of stellar binaries (containing white dwarfs, neutron stars or stellar-mass black holes). Besides a realistic expectation of the level of background, upper and lower limits are given, to account for the uncertainties in some astrophysical parameters such as binary coalescence rates. One interesting result concerns all current and planned ground-based detectors (including the Einstein Telescope). In their frequency range, the background of binaries is resolvable and only sporadically present. In other words, there is no stochastic background of binaries for ground-based detectors.

  14. Birth of Massive Black Hole Binaries

    Energy Technology Data Exchange (ETDEWEB)

    Colpi, M.; /Milan Bicocca U.; Dotti, M.; /Insubria U., Como; Mayer, L.; /Zurich, ETH; Kazantzidis, S.; /KIPAC, Menlo Park

    2007-11-19

    If massive black holes (BHs) are ubiquitous in galaxies and galaxies experience multiple mergers during their cosmic assembly, then BH binaries should be common albeit temporary features of most galactic bulges. Observationally, the paucity of active BH pairs points toward binary lifetimes far shorter than the Hubble time, indicating rapid inspiral of the BHs down to the domain where gravitational waves lead to their coalescence. Here, we review a series of studies on the dynamics of massive BHs in gas-rich galaxy mergers that underscore the vital role played by a cool, gaseous component in promoting the rapid formation of the BH binary. The BH binary is found to reside at the center of a massive self-gravitating nuclear disc resulting from the collision of the two gaseous discs present in the mother galaxies. Hardening by gravitational torques against gas in this grand disc is found to continue down to sub-parsec scales. The eccentricity decreases with time to zero and when the binary is circular, accretion sets in around the two BHs. When this occurs, each BH is endowed with it own small-size ({approx}< 0.01 pc) accretion disc comprising a few percent of the BH mass. Double AGN activity is expected to occur on an estimated timescale of {approx}< 1 Myr. The double nuclear point-like sources that may appear have typical separation of {approx}< 10 pc, and are likely to be embedded in the still ongoing starburst. We note that a potential threat of binary stalling, in a gaseous environment, may come from radiation and/or mechanical energy injections by the BHs. Only short-lived or sub-Eddington accretion episodes can guarantee the persistence of a dense cool gas structure around the binary necessary for continuing BH inspiral.

  15. Massive gaseous discs around SMBH binaries: Binary decay and tidal disruptions

    Directory of Open Access Journals (Sweden)

    Brem P.

    2012-12-01

    Full Text Available We investigate the evolution of black hole binaries embedded within geometrically thin gas discs. Our results imply that such discs can produce black hole mergers for relatively low-mass binaries, and that a significant population of eccentric binaries might exist at separations of a few 0.01 pc. These binaries may be detectable due to the time-variable accretion on to the black holes. If the disc fragments, then the newly-born stars will continue driving the binary to its coalescence, although at a slower rate. Interestingly, our preliminary analysis shows that these stars will be disrupted at a rate of ∼10−4–2 · 10−5 events per year per system.

  16. Serial binary interval ratios improve rhythm reproduction

    Directory of Open Access Journals (Sweden)

    XiangWu

    2013-08-01

    Full Text Available Musical rhythm perception is a natural human ability that involves complex cognitive processes. Rhythm refers to the organization of events in time, and musical rhythms have an underlying hierarchical metrical structure. The metrical structure induces the feeling of a beat and the extent to which a rhythm induces the feeling of a beat is referred to as its metrical strength. Binary ratios are the most frequent interval ratio in musical rhythms. Rhythms with hierarchical binary ratios are better discriminated and reproduced than rhythms with hierarchical non-binary ratios. However, it remains unclear whether a superiority of serial binary over non-binary ratios in rhythm perception and reproduction exists. In addition, how different types of serial ratios influence the metrical strength of rhythms remains to be elucidated. The present study investigated serial binary vs. non-binary ratios in a reproduction task. Rhythms formed with exclusively binary (1:2:4:8, non-binary integer (1:3:5:6, and non-integer (1:2.3:5.3:6.4 ratios were examined within a constant meter. The results showed that the 1:2:4:8 rhythm type was more accurately reproduced than the 1:3:5:6 and 1:2.3:5.3:6.4 rhythm types, and the 1:2.3:5.3:6.4 rhythm type was more accurately reproduced than the 1:3:5:6 rhythm type. Further analyses showed that reproduction performance was better predicted by the distribution pattern of event occurrences within an inter-beat interval, than by the coincidence of events with beats, or the magnitude and complexity of interval ratios. Whereas rhythm theories and empirical data emphasize the role of the coincidence of events with beats in determining metrical strength and predicting rhythm performance, the present results suggest that rhythm processing may be better understood when the distribution pattern of event occurrences is taken into account. These results provide new insights into the mechanisms underlining musical rhythm perception.

  17. Characterization of Vadose Zone Sediment: Borehole 299-E33-46 Near B 110 in the B BX-BY Waste Management Area

    Energy Technology Data Exchange (ETDEWEB)

    Serne, R. Jeffrey; Bjornstad, Bruce N.; Gee, Glendon W.; Schaef, Herbert T.; Lanigan, David C.; mccain, r. G.; Lindenmeier, Clark W.; Orr, Robert D.; Legore, Virginia L.; Clayton, Ray E.; Lindberg, Michael J.; Kutynakov, I. V.; Baum, Steven R.; Geiszler, Keith N.; Valenta, Michelle M.; Vickerman, Tanya S.; Royack, Lisa J.

    2008-09-11

    This report was revised in September 2008 to remove acid-ectractable sodium data from Table 4.17. The sodium data was removed due to potential contamination introduced during the acid extraction process. The rest of the text remains unchanged from the original report issued in December 2002. The overall goal of the of the Tank Farm Vadose Zone Project, led by CH2M HILL Hanford Group, Inc., is to define risks from past and future single-shell tank farm activities. To meet this goal, CH2M HILL Hanford Group, Inc., asked scientists from Pacific Northwest National Laboratory to perform detailed analyses on vadose zone sediment from within the B-BX-BY Waste Management Area. This report is the third in a series of three reports to present the results of these analyses. Specifically, this report contains all the geologic, geochemical, and selected physical characterization data collected on vadose zone sediment recovered from a borehole installed approximately 4.5 m (15 ft) northeast of tank B- 110 (borehole 299-E33-46).

  18. Characterization of Vadose Zone Sediment: RCRA Borehole 299-E33-338 Located Near the B-BX-BY Waste Management Area

    Energy Technology Data Exchange (ETDEWEB)

    Lindenmeier, Clark W.; Serne, R. Jeffrey; Bjornstad, Bruce N.; Gee, Glendon W.; Schaef, Herbert T.; Lanigan, David C.; Lindberg, Michael J.; Clayton, Ray E.; Legore, Virginia L.; Kutnyakov, Igor V.; Baum, Steven R.; Geiszler, Keith N.; Brown, Christopher F.; Valenta, Michelle M.; Vickerman, Tanya S.; Royack, Lisa J.

    2008-09-11

    This report was revised in September 2008 to remove acid-extractable sodium data from Table 4.8. The sodium data was removed due to potential contamination introduced during the acid extraction process. The rest of the text remains unchanged from the original report issued in June 2003. The overall goals of the of the Tank Farm Vadose Zone Project, led by CH2M HILL Hanford Group, Inc., are: 1) to define risks from past and future single-shell tank farm activities, 2) to identify and evaluate the efficacy of interim measures, and 3) to aid via collection of geotechnical information and data, future decisions that must be made by the U.S. Department of Energy (DOE) regarding the near-term operations, future waste retrieval, and final closure activities for the single-shell tank waste management areas. For a more complete discussion of the goals of the Tank Farm Vadose Zone Project, see the overall work plan, Phase 1 RCRA Facility Investigation/Corrective Measures Study Work Plan for the Single-Shell Tank Waste Management Areas (DOE 1999). Specific details on the rationale for activities performed at the B-BX-BY tank farm waste management area are found in CH2M HILL (2000).

  19. Urey Prize Lecture: Binary Minor Planets

    Science.gov (United States)

    Margot, J. L.

    2004-11-01

    The discovery of binary systems in the near-Earth, main belt, and Kuiper belt populations provides an abundance of new data that expand our knowledge of the physics and chemistry of the solar system. Binary minor planets form as a result of collisional, tidal, and capture processes that are important to study as they play major roles in the formation and evolution of planetary systems. The frequency of occurrence of such processes directly reflects the dynamical environment in the various populations. Observations of binaries provide a powerful way to measure the bulk properties of small bodies, which in turn lead to inferences about their composition and internal structure. These data may offer a rare glimpse of what physical and chemical conditions prevailed when protoplanets formed, and what subsequent evolution took place. In the case of the Kuiper Belt, the study of a handful of binaries forces us to rethink how dense and how bright these bodies are, and to significantly revise our current mass estimates for the entire population. The number of known binary minor planets has increased dramatically over the past few years, with roughly ten new discoveries each year. I will attempt to summarize recent developments, with examples drawn from my observations with the Hubble, Palomar, Keck, Arecibo and Goldstone telescopes.

  20. Orbital eccentricities in primordial black holes binaries

    CERN Document Server

    Cholis, Ilias; Ali-Haïmoud, Yacine; Bird, Simeon; Kamionkowski, Marc; Muñoz, Julian B; Raccanelli, Alvise

    2016-01-01

    It was recently suggested that the merger of $\\sim30\\,M_\\odot$ primordial black holes (PBHs) may provide a significant number of events in gravitational-wave observatories over the next decade, if they make up an appreciable fraction of the dark matter. Here we show that measurement of the eccentricities of the inspiralling binary black holes can be used to distinguish these binaries from those produced by more traditional astrophysical mechanisms. These PBH binaries are formed on highly eccentric orbits and can then merge on timescales that in some cases are years or less, retaining some eccentricity in the last seconds before the merger. This is to be contrasted with massive-stellar-binary, globular-cluster, or other astrophysical origins for binary black holes (BBHs) in which the orbits have very effectively circularized by the time the BBH enters the observable LIGO window. Here we discuss the features of the gravitational-wave signals that indicate this eccentricity and forecast the sensitivity of LIGO a...

  1. Spherical hashing: binary code embedding with hyperspheres.

    Science.gov (United States)

    Heo, Jae-Pil; Lee, Youngwoon; He, Junfeng; Chang, Shih-Fu; Yoon, Sung-Eui

    2015-11-01

    Many binary code embedding schemes have been actively studied recently, since they can provide efficient similarity search, and compact data representations suitable for handling large scale image databases. Existing binary code embedding techniques encode high-dimensional data by using hyperplane-based hashing functions. In this paper we propose a novel hypersphere-based hashing function, spherical hashing, to map more spatially coherent data points into a binary code compared to hyperplane-based hashing functions. We also propose a new binary code distance function, spherical Hamming distance, tailored for our hypersphere-based binary coding scheme, and design an efficient iterative optimization process to achieve both balanced partitioning for each hash function and independence between hashing functions. Furthermore, we generalize spherical hashing to support various similarity measures defined by kernel functions. Our extensive experiments show that our spherical hashing technique significantly outperforms state-of-the-art techniques based on hyperplanes across various benchmarks with sizes ranging from one to 75 million of GIST, BoW and VLAD descriptors. The performance gains are consistent and large, up to 100 percent improvements over the second best method among tested methods. These results confirm the unique merits of using hyperspheres to encode proximity regions in high-dimensional spaces. Finally, our method is intuitive and easy to implement. PMID:26440269

  2. An interferometric view of binary stars

    CERN Document Server

    Boffin, Henri M J

    2016-01-01

    The study of binary stars is critical to apprehend many of the most interesting classes of stars. Moreover, quite often, the study of stars in binary systems is our only mean to constrain stellar properties, such as masses and radii. Unfortunately, a great fraction of the most interesting binaries are so compact that they can only be apprehended by high-resolution techniques, mostly by interferometry. I present some results highlighting the use of interferometry in the study of binary stars, from finding companions and deriving orbits, determining the mass and radius of stars, to studying mass transfer in symbiotic stars, and tackling luminous blue variables. In particular, I show how interferometric studies using the PIONIER instrument have allowed us to confirm a dichotomy within symbiotic stars, obtain masses of stars with a precision better than 1%, and help us find a new Eta Carinae-like system. I will also illustrate the benefits for the study of binary stars one would get from upgrading the VLT Interfe...

  3. Planet Scattering Around Binaries: Ejections, Not Collisions

    Science.gov (United States)

    Smullen, Rachel A.; Kratter, Kaitlin M.; Shannon, Andrew

    2016-06-01

    Transiting circumbinary planets discovered by Kepler provide unique insight into binary star and planet formation. Several features of this new found population, for example the apparent pile-up of planets near the innermost stable orbit, may distinguish between formation theories. In this work, we determine how planet-planet scattering shapes planetary systems around binaries as compared to single stars. In particular, we look for signatures that arise due to differences in dynamical evolution in binary systems. We carry out a parameter study of N-body scattering simulations for four distinct planet populations around both binary and single stars. While binarity has little influence on the final system multiplicity or orbital distribution, the presence of a binary dramatically effects the means by which planets are lost from the system. Most circumbinary planets are lost due to ejections rather than planet-planet or planet-star collisions. The most massive planet in the system tends to control the evolution. Systems similar to the only observed multi-planet circumbinary system, Kepler-47, can arise from much more tightly packed, unstable systems. Only extreme initial conditions introduce differences in the final planet populations. Thus, we suggest that any intrinsic differences in the populations are imprinted by formation.

  4. Investigating Dark Energy with Black Hole Binaries

    International Nuclear Information System (INIS)

    The accelerated expansion of the universe is ascribed to the existence of dark energy. Black holes accrete dark energy. The accretion induces a mass change proportional to the energy density and pressure of the background dark energy fluid. The time scale during which the mass of black holes changes considerably is long relative to the age of the universe, thus beyond detection possibilities. We propose to take advantage of the modified black hole masses for exploring the equation of state w[z] of dark energy, by investigating the evolution of supermassive black hole binaries on a dark energy background. Deriving the signatures of dark energy accretion on the evolution of binaries, we find that dark energy imprints on the emitted gravitational radiation and on the changes in the orbital radius of the binary can be within detection limits for certain supermassive black hole binaries. This talk describes how binaries can provide a useful tool in obtaining complementary information on the nature of dark energy.

  5. INTEGRAL & RXTE View of Gamma-ray Binaries

    OpenAIRE

    Jian LI; Torres, Diego F.; Zhang, Shu; WANG, JIANMIN

    2013-01-01

    Gamma-ray binaries are X-ray binaries with gamma-ray emissions. Their multi-wavelength emissions range from radio, optical, X-ray and to very high energy (TeV). X-ray emissions are crucial to understand the nature of gamma-ray binaries. INTEGRAL and RXTE have covered and monitored most of the gamma-ray binaries in hard and soft X-rays. Here we report the results of several gamma-ray binaries and possible gamma-ray binaries from INTEGRAL and RXTE.

  6. The Circulation Pattern in Simulated Contact Binaries

    Science.gov (United States)

    Motl, Patrick M.; Frank, J.; Tohline, J. E.

    2006-06-01

    We present a three-dimensional hydrodynamical simulation of an initially symmetric (equal mass) binary where both components are marginally in contact. The simulation evolves the binary through approximately 150 orbital periods and within the first 20 orbits, a global velocity field is established that carries material between both components. In the equatorial plane, the flow is along a figure eight pattern with streams of material sliding past one another in the neighborhood of the inner Lagrange point. For our chosen equation of state, mass transfer is ultimately unstable in this binary though the growth time is long compared to the orbital period. We are therefore able to observe that the circulation pattern, once established, is quite close to steady state. We explore the role that similar steady state flows may play in real contact systems.

  7. TIDAL NOVAE IN COMPACT BINARY WHITE DWARFS

    International Nuclear Information System (INIS)

    Compact binary white dwarfs (WDs) undergoing orbital decay due to gravitational radiation can experience significant tidal heating prior to merger. In these WDs, the dominant tidal effect involves the excitation of outgoing gravity waves in the inner stellar envelope and the dissipation of these waves in the outer envelope. As the binary orbit decays, the WDs are synchronized from outside in (with the envelope synchronized first, followed by the core). We examine the deposition of tidal heat in the envelope of a carbon-oxygen WD and study how such tidal heating affects the structure and evolution of the WD. We show that significant tidal heating can occur in the star's degenerate hydrogen layer. This layer heats up faster than it cools, triggering runaway nuclear fusion. Such 'tidal novae' may occur in all WD binaries containing a CO WD, at orbital periods between 5 minutes and 20 minutes, and precede the final merger by 105-106 years.

  8. Gravitational waves from spinning eccentric binaries

    CERN Document Server

    Csizmadia, Péter; Rácz, István; Vasúth, Mátyás

    2012-01-01

    This paper is to introduce a new software called CBwaves which provides a fast and accurate computational tool to determine the gravitational waveforms yielded by generic spinning binaries of neutron stars and/or black holes on eccentric orbits. This is done within the post-Newtonian (PN) framework by integrating the equations of motion and the spin precession equations while the radiation field is determined by a simultaneous evaluation of the analytic waveforms. In applying CBwaves various physically interesting scenarios have been investigated. In particular, we have studied the appropriateness of the adiabatic approximation, and justified that the energy balance relation is indeed insensitive to the specific form of the applied radiation reaction term. By studying eccentric binary systems it is demonstrated that circular template banks are very ineffective in identifying binaries even if they possess tiny residual orbital eccentricity. In addition, by investigating the validity of the energy balance relat...

  9. Binary Particle Model of Weak Interactions

    CERN Document Server

    Ndili, F N

    2011-01-01

    We introduce the new concept of binary particle as the basic matter unit that participates in weak interactions and not any one fermion singly. We state the quantum numbers of this binary particle, and show the concept leads us to a natural explanation of the standard model puzzle of the origin of flavor mixing and the CKM matrix. Certain other puzzles of the standard model such as the absence of flavor changing neutral currents (FCNC), are also explained naturally by the binary particle model. These puzzles are currently thought to be esoteric properties of electro weak interactions that have origins in physics beyond the standard model at some ultra high energy scales. We show that this is not necessarily the case.

  10. A binary spelling interface with random errors.

    Science.gov (United States)

    Perelmouter, J; Birbaumer, N

    2000-06-01

    An algorithm for design of a spelling interface based on a modified Huffman's algorithm is presented. This algorithm builds a full binary tree that allows to maximize an average probability to reach a leaf where a required character is located when a choice at each node is made with possible errors. A means to correct errors (a delete-function) and an optimization method to build this delete-function into the binary tree are also discussed. Such a spelling interface could be successfully applied to any menu-orientated alternative communication system when a user (typically, a patient with devastating neuromuscular handicap) is not able to express an intended single binary response, either through motor responses or by using of brain-computer interfaces, with an absolute reliability. PMID:10896195

  11. Hybrid Black-Hole Binary Initial Data

    Science.gov (United States)

    Mundim, Bruno C.; Kelly, Bernard J.; Nakano, Hiroyuki; Zlochower, Yosef; Campanelli, Manuela

    2010-01-01

    "Traditional black-hole binary puncture initial data is conformally flat. This unphysical assumption is coupled with a lack of radiation signature from the binary's past life. As a result, waveforms extracted from evolutions of this data display an abrupt jump. In Kelly et al. [Class. Quantum Grav. 27:114005 (2010)], a new binary black-hole initial data with radiation contents derived in the post-Newtonian (PN) calculations was adapted to puncture evolutions in numerical relativity. This data satisfies the constraint equations to the 2.5PN order, and contains a transverse-traceless "wavy" metric contribution, violating the standard assumption of conformal flatness. Although the evolution contained less spurious radiation, there were undesired features; the unphysical horizon mass loss and the large initial orbital eccentricity. Introducing a hybrid approach to the initial data evaluation, we significantly reduce these undesired features."

  12. Modeling Flows Around Merging Black Hole Binaries

    CERN Document Server

    van Meter, James R; Miller, M Coleman; Reynolds, Christopher S; Centrella, Joan M; Baker, John G; Boggs, William D; Kelly, Bernard J; McWilliams, Sean T

    2009-01-01

    Coalescing massive black hole binaries are produced by the mergers of galaxies. The final stages of the black hole coalescence produce strong gravitational radiation that can be detected by the space-borne LISA. In cases where the black hole merger takes place in the presence of gas and magnetic fields, various types of electromagnetic signals may also be produced. Modeling such electromagnetic counterparts of the final merger requires evolving the behavior of both gas and fields in the strong-field regions around the black holes. We have taken a step towards solving this problem by mapping the flow of pressureless matter in the dynamic, 3-D general relativistic spacetime around the merging black holes. We find qualitative differences in collision and outflow speeds, including a signature of the merger when the net angular momentum of the matter is low, between the results from single and binary black holes, and between nonrotating and rotating holes in binaries. If future magnetohydrodynamic results confirm ...

  13. Nonlinear Tides in Close Binary Systems

    CERN Document Server

    Weinberg, Nevin N; Quataert, Eliot; Burkart, Josh

    2011-01-01

    We study the excitation and damping of tides in close binary systems, accounting for the leading order nonlinear corrections to linear tidal theory. These nonlinear corrections include two distinct effects: three-mode nonlinear interactions and nonlinear excitation of modes by the time-varying gravitational potential of the companion. This paper presents the formalism for studying nonlinear tides and studies the nonlinear stability of the linear tidal flow. Although the formalism is applicable to binaries containing stars, planets, or compact objects, we focus on solar type stars with stellar or planetary companions. Our primary results include: (1) The linear tidal solution often used in studies of binary evolution is unstable over much of the parameter space in which it is employed. More specifically, resonantly excited gravity waves are unstable to parametric resonance for companion masses M' > 10-100 M_Earth at orbital periods P = 1-10 days. The nearly static equilibrium tide is, however, parametrically s...

  14. Gravitational wave background from binary systems

    CERN Document Server

    Rosado, Pablo A

    2011-01-01

    Basic aspects of the background of gravitational waves and its mathematical characterization are reviewed. The spectral energy density parameter $\\Omega(f)$, commonly used as a quantifier of the background, is derived for an ensemble of many identical sources emitting at different times and locations. For such an ensemble, $\\Omega(f)$ is generalized to account for the duration of the signals and of the observation, so that one can distinguish the resolvable and unresolvable parts of the background. The unresolvable part, often called confusion noise or stochastic background, is made by signals that cannot be either individually identified or subtracted out of the data. To account for the resolvability of the background, the overlap function is introduced. This function is a generalization of the duty cycle, which has been commonly used in the literature, in some cases leading to incorrect results. The spectra produced by binary systems (stellar binaries and massive black hole binaries) are presented over the ...

  15. Binary Code Disassembly for Reverse Engineering

    Directory of Open Access Journals (Sweden)

    Marius Popa

    2013-01-01

    Full Text Available The disassembly of binary file is used to restore the software application code in a readable and understandable format for humans. Further, the assembly code file can be used in reverse engineering processes to establish the logical flows of the computer program or its vulnerabilities in real-world running environment. The paper highlights the features of the binary executable files under the x86 architecture and portable format, presents issues of disassembly process of a machine code file and intermediate code, disassembly algorithms which can be applied to a correct and complete reconstruction of the source file written in assembly language, and techniques and tools used in binary code disassembly.

  16. Supermassive Black Hole Binaries as Galactic Blenders

    CERN Document Server

    Kandrup, H E; Terzic, B; Bohn, C L; Kandrup, Henry E.; Sideris, Ioannis V.; Terzic, Balsa; Bohn, Courtlandt L.

    2003-01-01

    This paper focuses on the dynamical implications of close supermassive black hole binaries both as an example of resonant phase mixing and as a potential explanation of inversions and other anomalous features observed in the luminosity profiles of some elliptical galaxies. The presence of a binary comprised of black holes executing nearly periodic orbits leads to the possibility of a broad resonant coupling between the black holes and various stars in the galaxy. This can result in efficient chaotic phase mixing and, in many cases, systematic increases in the energies of stars and their consequent transport towards larger radii. Allowing for the presence of a supermassive black hole binary with plausible parameter values near the center of a spherical, or nearly spherical, galaxy characterised initially by a Nuker density profile enables one to reproduce in considerable detail the central surface brightness distributions of such galaxies as NGC 3706.

  17. CALCULATING THE HABITABLE ZONE OF BINARY STAR SYSTEMS. I. S-TYPE BINARIES

    International Nuclear Information System (INIS)

    We have developed a comprehensive methodology for calculating the boundaries of the habitable zone (HZ) of planet-hosting S-type binary star systems. Our approach is general and takes into account the contribution of both stars to the location and extent of the binary HZ with different stellar spectral types. We have studied how the binary eccentricity and stellar energy distribution affect the extent of the HZ. Results indicate that in binaries where the combination of mass-ratio and orbital eccentricity allows planet formation around a star of the system to proceed successfully, the effect of a less luminous secondary on the location of the primary's HZ is generally negligible. However, when the secondary is more luminous, it can influence the extent of the HZ. We present the details of the derivations of our methodology and discuss its application to the binary HZ around the primary and secondary main-sequence stars of an FF, MM, and FM binary, as well as two known planet-hosting binaries α Cen AB and HD 196886

  18. CALCULATING THE HABITABLE ZONE OF BINARY STAR SYSTEMS. I. S-TYPE BINARIES

    Energy Technology Data Exchange (ETDEWEB)

    Kaltenegger, Lisa [MPIA, Koenigstuhl 17, D-69117 Heidelberg (Germany); Haghighipour, Nader, E-mail: kaltenegger@mpia.de [Institute for Astronomy and NASA Astrobiology Institute, University of Hawaii-Manoa, Honolulu, HI 96822 (United States)

    2013-11-10

    We have developed a comprehensive methodology for calculating the boundaries of the habitable zone (HZ) of planet-hosting S-type binary star systems. Our approach is general and takes into account the contribution of both stars to the location and extent of the binary HZ with different stellar spectral types. We have studied how the binary eccentricity and stellar energy distribution affect the extent of the HZ. Results indicate that in binaries where the combination of mass-ratio and orbital eccentricity allows planet formation around a star of the system to proceed successfully, the effect of a less luminous secondary on the location of the primary's HZ is generally negligible. However, when the secondary is more luminous, it can influence the extent of the HZ. We present the details of the derivations of our methodology and discuss its application to the binary HZ around the primary and secondary main-sequence stars of an FF, MM, and FM binary, as well as two known planet-hosting binaries α Cen AB and HD 196886.

  19. Binary black holes' effects on electromagnetic fields.

    Science.gov (United States)

    Palenzuela, Carlos; Anderson, Matthew; Lehner, Luis; Liebling, Steven L; Neilsen, David

    2009-08-21

    In addition to producing gravitational waves, the dynamics of a binary black hole system could induce emission of electromagnetic radiation by affecting the behavior of plasmas and electromagnetic fields in their vicinity. We here study how the electromagnetic fields are affected by a pair of orbiting black holes through the merger. In particular, we show how the binary's dynamics induce a variability in possible electromagnetically induced emissions as well as a possible enhancement of electromagnetic fields during the late-merge and merger epochs. These time dependent features will likely leave their imprint in processes generating detectable emissions and can be exploited in the detection of electromagnetic counterparts of gravitational waves. PMID:19792706

  20. Spin supplementary conditions for spinning compact binaries

    CERN Document Server

    Mikóczi, Balázs

    2016-01-01

    We consider the different spin supplementary conditions (SSC) for a spinning compact binary with the leading-order spin-orbit (SO) interaction. The Lagrangian of the binary system can be constructed but it is acceleration-dependent in two cases of SSC. We rewrite the generalized Hamiltonian formalism proposed by Ostrogradsky and compute the conservative quantities and the dissipative part of relative motion during the gravitational radiation of each SSCs. We give the orbital elements and observed quantities of the SO dynamics, for instance the energy and the orbital angular momentum losses and waveforms and discuss their SSC dependence.

  1. Quasi periodic oscillations in black hole binaries

    CERN Document Server

    Motta, S E

    2016-01-01

    Fast time variability is the most prominent characteristic of accreting systems and the presence of quasi periodic oscillations (QPOs) is a constant in all accreting systems, from cataclysmic variables to AGNs, passing through black hole and neutron star X-ray binaries and through the enigmatic ultra-luminous X-ray sources. In this paper I will briefly review the current knowledge of QPOs in black hole X-ray binaries, mainly focussing on their observed properties, but also mentioning the most important models that have been proposed to explain the origin of QPOs over the last decades.

  2. Photometric constraints on binary asteroid dynamics

    Science.gov (United States)

    Scheirich, Peter

    2015-08-01

    To date, about 50 binary NEAs, 20 Mars-crossing and 80 small MB asteroids are known. We observe also a population of about 200 unbound asteroid systems (asteroid pairs). I will review the photometric observational data we have for the best observed cases and compare them with theories of binary and paired asteroids evolution.The observed characteristics of asteroid systems suggest their formation by rotational fission of parent rubble-pile asteroids after being spun up by the YORP effect. The angular momentum content of binary asteroids is close to critical. The orientations of satellite orbits of observed binary systems are non-random; the orbital poles concentrate near the obliquities of 0 and 180 degrees, i.e., near the YORP asymptotic states.Recently, a significant excess of retrograde satellite orbits was detected, which is not yet explained characteristic.An evolution of binary system depend heavily on the BYORP effect. If BYORP is contractive, the primary and secondary could end in a tidal-BYORP equilibrium. Observations of mutual events between binary components in at least four apparitions are needed for BYORP to be revealed by detecting a quadratic drift in mean anomaly of the satellite. I will show the observational evidence of single-synchronous binary asteroid with tidally locked satellite (175706 1996 FG3), i.e, with the quadratic drift equal to zero, and binary asteroid with contracting orbit (88710 2001 SL9), with positive value of the quadratic drift (the solution for the quadratic drift is ambiguous so far, with possible values of 5 and 8 deg/yr2).The spin configuration of the satellite play a crucial role in the evolution of the system under the influence of the BYORP effect. I will show that the rotational lightcurves of the satellites show that most of them have small libration amplitudes (up to 20 deg.), with a few interesting exceptions.Acknowledgements: This work has been supported by the Grant Agency of the Czech Republic, Grant P209

  3. Binary Sparse Phase Retrieval via Simulated Annealing

    Directory of Open Access Journals (Sweden)

    Wei Peng

    2016-01-01

    Full Text Available This paper presents the Simulated Annealing Sparse PhAse Recovery (SASPAR algorithm for reconstructing sparse binary signals from their phaseless magnitudes of the Fourier transform. The greedy strategy version is also proposed for a comparison, which is a parameter-free algorithm. Sufficient numeric simulations indicate that our method is quite effective and suggest the binary model is robust. The SASPAR algorithm seems competitive to the existing methods for its efficiency and high recovery rate even with fewer Fourier measurements.

  4. Inducing Risk Neutral Preferences with Binary Lotteries

    DEFF Research Database (Denmark)

    Harrison, Glenn W.; Martínez-Correa, Jimmy; Swarthout, J. Todd

    2013-01-01

    We evaluate the binary lottery procedure for inducing risk neutral behavior. We strip the experimental implementation down to bare bones, taking care to avoid any potentially confounding assumptions about behavior having to be made. In particular, our evaluation does not rely on the assumed...... validity of any strategic equilibrium behavior, or even the customary independence axiom. We show that subjects sampled from our population are generally risk averse when lotteries are defined over monetary outcomes, and that the binary lottery procedure does indeed induce a statistically significant shift...... toward risk neutrality. This striking result generalizes to the case in which subjects make several lottery choices and one is selected for payment....

  5. Toroidal Horizons in Binary Black Hole Mergers

    OpenAIRE

    Bohn, Andy; Kidder, Lawrence E.; Teukolsky, Saul A.

    2016-01-01

    We find the first binary black hole event horizon with a toroidal topology. It had been predicted that generically the event horizons of merging black holes should briefly have a toroidal topology, but such a phase has never been seen prior to this work. In all previous binary black hole simulations, in the coordinate slicing used to evolve the black holes, the topology of the event horizon transitions directly from two spheres during the inspiral to a single sphere as the black holes merge. ...

  6. Binaries in the Hipparcos data: Keep digging

    OpenAIRE

    Pourbaix, D.; Jancart, S.; Jorissen, A.

    2004-01-01

    Among the 120 000 objects in the Hipparcos catalogue, only 235 were fitted with an orbital model. Besides these 235 original astrometric binaries, most Hipparcos entries with a known spectroscopic orbit (extrasolar planet or stellar companion) have now been re-processed, as part of the on-going construction of the 9th Catalogue of Spectroscopic Binary Orbits (SB9, available at http://sb9.astro.ulb.ac.be). The pitfalls and successes of this re-processing are discussed in various contexts, like...

  7. Apsidal motion in eclipsing binary GG Orionis

    Science.gov (United States)

    Yilan, E.; Bulut, I.

    2016-03-01

    The study of apsidal motion in binary stars with eccentric orbit is well known as an important source of information for the stellar internal structure as well as the possibility of verification of general relativity. In this study, the apsidal motion of the eccentric eclipsing binary GG Ori (P = 6.631 days, e = 0.22) has been analyzed using the times of minimum light taken from the literature and databases and the elements of apsidal motion have been computed. The method described by Giménez and García-Pelayo (1983) has been used for the apsidal motion analysis.

  8. Decomposition of Binary Signed-Graphic Matroids

    CERN Document Server

    Pitsoulis, Leonidas

    2010-01-01

    In this paper we employ Tutte's theory of bridges to derive a decomposition theorem for binary matroids arising from signed graphs. The proposed decomposition differs from previous decomposition results on matroids that have appeared in the literature in the sense that it is not based on $k$-sums, but rather on the operation of deletion of a cocircuit. Specifically, it is shown that certain minors resulting from the deletion of a cocircuit of a binary matroid will be graphic matroids apart from exactly one that will be signed-graphic, if and only if the matroid is signed-graphic.

  9. Quantitative spectroscopy of close binary stars

    CERN Document Server

    Pavlovski, K

    2011-01-01

    The method of spectral disentangling has now created the opportunity for studying the chemical composition in previously inaccessible components of binary and multiple stars. This in turn makes it possible to trace their chemical evolution, a vital aspect in understanding the evolution of stellar systems. We review different ways to reconstruct individual spectra from eclipsing and non-eclipsing systems, and then concentrate on some recent applications to detached binaries with high-mass and intermediate-mass stars, and Algol-type mass-transfer systems.

  10. Neutron-Star-Black-Hole Binaries Produced by Binary-Driven Hypernovae.

    Science.gov (United States)

    Fryer, Chris L; Oliveira, F G; Rueda, J A; Ruffini, R

    2015-12-01

    Binary-driven hypernovae (BdHNe) within the induced gravitational collapse paradigm have been introduced to explain energetic (E_{iso}≳10^{52}  erg), long gamma-ray bursts (GRBs) associated with type Ic supernovae (SNe). The progenitor is a tight binary composed of a carbon-oxygen (CO) core and a neutron-star (NS) companion, a subclass of the newly proposed "ultrastripped" binaries. The CO-NS short-period orbit causes the NS to accrete appreciable matter from the SN ejecta when the CO core collapses, ultimately causing it to collapse to a black hole (BH) and producing a GRB. These tight binaries evolve through the SN explosion very differently than compact binaries studied in population synthesis calculations. First, the hypercritical accretion onto the NS companion alters both the mass and the momentum of the binary. Second, because the explosion time scale is on par with the orbital period, the mass ejection cannot be assumed to be instantaneous. This dramatically affects the post-SN fate of the binary. Finally, the bow shock created as the accreting NS plows through the SN ejecta transfers angular momentum, braking the orbit. These systems remain bound even if a large fraction of the binary mass is lost in the explosion (well above the canonical 50% limit), and even large kicks are unlikely to unbind the system. Indeed, BdHNe produce a new family of NS-BH binaries unaccounted for in current population synthesis analyses and, although they may be rare, the fact that nearly 100% remain bound implies that they may play an important role in the compact merger rate, important for gravitational waves that, in turn, can produce a new class of ultrashort GRBs. PMID:26684106

  11. Retrograde binaries of massive black holes in circum-binary accretion discs

    OpenAIRE

    Amaro-Seoane, Pau; Maureira-Fredes, Cristián; Dotti, Massimo; Colpi, Monica

    2016-01-01

    We explore the hardening of a massive black hole binary embedded in a circum-binary gas disc when the binary and the gas are coplanar and the gas is counter-rotating. The secondary black hole, revolving in the direction opposite to the gas, experiences a drag from gas-dynamical friction and from direct accretion of part of it. Using two-dimensional (2D) hydrodynamical grid simulations we investigate the effect of changing the accretion prescriptions on the dynamics of the secondary black hole...

  12. A Survey Design for a Sensitive Binary Variable Correlated with Another Nonsensitive Binary Variable

    OpenAIRE

    Jun-Wu Yu; Guo-Liang Tian; Yang Lu

    2013-01-01

    Tian et al. (2007) introduced a so-called hidden sensitivity model for evaluating the association of two sensitive questions with binary outcomes. However, in practice, we sometimes need to assess the association between one sensitive binary variable (e.g., whether or not a drug user, the number of sex partner being ⩽1 or >1, and so on) and one nonsensitive binary variable (e.g., good or poor health status, with or without cervical cancer, and so on). To address this issue, by sufficiently ut...

  13. Adiabatic Mass Loss Model in Binary Stars

    Science.gov (United States)

    Ge, H. W.

    2012-07-01

    Rapid mass transfer process in the interacting binary systems is very complicated. It relates to two basic problems in the binary star evolution, i.e., the dynamically unstable Roche-lobe overflow and the common envelope evolution. Both of the problems are very important and difficult to be modeled. In this PhD thesis, we focus on the rapid mass loss process of the donor in interacting binary systems. The application to the criterion of dynamically unstable mass transfer and the common envelope evolution are also included. Our results based on the adiabatic mass loss model could be used to improve the binary evolution theory, the binary population synthetic method, and other related aspects. We build up the adiabatic mass loss model. In this model, two approximations are included. The first one is that the energy generation and heat flow through the stellar interior can be neglected, hence the restructuring is adiabatic. The second one is that he stellar interior remains in hydrostatic equilibrium. We model this response by constructing model sequences, beginning with a donor star filling its Roche lobe at an arbitrary point in its evolution, holding its specific entropy and composition profiles fixed. These approximations are validated by the comparison with the time-dependent binary mass transfer calculations and the polytropic model for low mass zero-age main-sequence stars. In the dynamical time scale mass transfer, the adiabatic response of the donor star drives it to expand beyond its Roche lobe, leading to runaway mass transfer and the formation of a common envelope with its companion star. For donor stars with surface convection zones of any significant depth, this runaway condition is encountered early in mass transfer, if at all; but for main sequence stars with radiative envelopes, it may be encountered after a prolonged phase of thermal time scale mass transfer, so-called delayed dynamical instability. We identify the critical binary mass ratio for the

  14. Evolution of Binary Stars in Multiple-Population Globular Clusters

    CERN Document Server

    Hong, Jongsuk; Sollima, Antonio; McMillan, Stephen L W; D'Antona, Franca; D'Ercole, Annibale

    2015-01-01

    The discovery of multiple stellar populations in globular clusters has implications for all the aspects of the study of these stellar systems. In this paper, by means of N-body simulations, we study the evolution of binary stars in multiple-population clusters and explore the implications of the initial differences in the spatial distribution of different stellar populations for the evolution and survival of their binary stars. Our simulations show that initial differences between the spatial distribution of first-generation (FG) and second-generation (SG) stars can leave a fingerprint in the current properties of the binary population. SG binaries are disrupted more efficiently than those of the FG population resulting in a global SG binary fraction smaller than that of the FG. As for surviving binaries, dynamical evolution produces a difference between the SG and the FG binary binding energy distribution with the SG population characterized by a larger fraction of high binding energy (more bound) binaries. ...

  15. Model-independent inference on compact-binary observations

    CERN Document Server

    Mandel, Ilya; Colonna, Andrea; Stevenson, Simon; Tiňo, Peter; Veitch, John

    2016-01-01

    The recent advanced LIGO detections of gravitational waves from merging binary black holes enhance the prospect of exploring binary evolution via gravitational-wave observations of a population of compact-object binaries. In the face of uncertainty about binary formation models, model-independent inference provides an appealing alternative to comparisons between observed and modelled populations. We describe a procedure for clustering in the multi-dimensional parameter space of observations that are subject to significant measurement errors. We apply this procedure to a mock data set of population-synthesis predictions for the masses of merging compact binaries convolved with realistic measurement uncertainties, and demonstrate that we can accurately distinguish subpopulations of binary neutron stars, binary black holes, and mixed black hole -- neutron star binaries.

  16. BINARY ASTEROID ENCOUNTERS WITH TERRESTRIAL PLANETS: TIMESCALES AND EFFECTS

    International Nuclear Information System (INIS)

    Many asteroids that make close encounters with terrestrial planets are in a binary configuration. Here, we calculate the relevant encounter timescales and investigate the effects of encounters on a binary's mutual orbit. We use a combination of analytical and numerical approaches with a wide range of initial conditions. Our test cases include generic binaries with close, moderate, and wide separations, as well as seven well-characterized near-Earth binaries. We find that close approaches (<10 Earth radii) occur for almost all binaries on 1-10 million year timescales. At such distances, our results suggest substantial modifications to a binary's semimajor axis, eccentricity, and inclination, which we quantify. Encounters within 30 Earth radii typically occur on sub-million year timescales and significantly affect the wider binaries. Important processes in the lives of near-Earth binaries, such as tidal and radiative evolution, can be altered or stopped by planetary encounters.

  17. Formation and evolution of X-ray binaries

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    We review recent progress in theoretical understanding of X-ray binaries,which has largely been driven by new observations.We select several topics including formation of compact low-mass X-ray binaries,the evolutionary connection between low-mass X-ray binaries and binary and millisecond radio pulsars,and ultraluminous X-ray sources,to illustrate the interplay between theories and observations.

  18. Binary Solid-Liquid Phase Equilibria

    Science.gov (United States)

    Ellison, Herbert R.

    1978-01-01

    Indicates some of the information that may be obtained from a binary solid-liquid phase equilibria experiment and a method to write a computer program that will plot an ideal phase diagram to which the experimental results may be compared. (Author/CP)

  19. The Environment of Binary Nuetron Star Mergers

    Science.gov (United States)

    Wiggins, Brandon

    2016-04-01

    In addition to detections by LIGO, binary neutron star mergers may be detected via luminous interaction with surrounding interstellar media. Upcoming observations including the VLASS survey may be able to detect such interactions and offer constraints on the binary neutron star merger rate. In this talk, I will present the results of cosmological simulations of a cluster of galaxies followed down to redshift 0. Our calculation includes star formation from which we infer a supernova and binary neutron star production rate. Using pre-existing models of neutron star binaries, we follow the positions of neutron star pairs in the cluster potential throughout cosmic time allowing us to identify regions in which neutron stars merge. We present statistics of many Monte Carlo instances of nuetron star pairs and trajectories allowing us to constrain the approximate fraction of neutron stars merging in dense gas. Our work has implications for R-process enrichment of galaxies in addition to predicting electromagnetic counterparts to gravitational wave detections of neutron star mergers.

  20. The Evolution of Relativistic Binary Progenitor Systems

    CERN Document Server

    Francischelli, G J; Brown, G E

    2001-01-01

    Relativistic binary pulsars, such as B1534+12 and B1913+16 are characterized by having close orbits with a binary separation of ~ 3 R_\\sun. The progenitor of such a system is a neutron star, helium star binary. The helium star, with a strong stellar wind, is able to spin up its compact companion via accretion. The neutron star's magnetic field is then lowered to observed values of about 10^{10} Gauss. As the pulsar lifetime is inversely proportional to its magnetic field, the possibility of observing such a system is, thus, enhanced by this type of evolution. We will show that a nascent (Crab-like) pulsar in such a system can, through accretion-braking torques (i.e. the "propeller effect") and wind-induced spin-up rates, reach equilibrium periods that are close to observed values. Such processes occur within the relatively short helium star lifetimes. Additionally, we find that the final outcome of such evolutionary scenarios depends strongly on initial parameters, particularly the initial binary separation a...

  1. The Binary Pulsar: Gravity Waves Exist.

    Science.gov (United States)

    Will, Clifford

    1987-01-01

    Reviews the history of pulsars generally and the 1974 discovery of the binary pulsar by Joe Taylor and Russell Hulse specifically. Details the data collection and analysis used by Taylor and Hulse. Uses this discussion as support for Albert Einstein's theory of gravitational waves. (CW)

  2. A Binary Teetering on the Edge

    Science.gov (United States)

    Motl, P. M.; D'Souza, M. C. R.; Tohline, J. E.; Frank, J.

    2005-05-01

    We present a fully three-dimensional hydrodynamical simulation of Roche lobe overflow in a binary near the stability boundary. This boundary separates evolutionary branches that correspond to either an accelerating mass transfer rate leading eventually to merger through tidal instability or to a decaying mass transfer rate as the orbit expands. The binary begins with a mass ratio of 0.4 (ratio of donor to accretor mass) and is initially assumed to be rotating synchronously. We treat the stellar components as simple polytropic fluids characterized by a polytropic index, n = 3/2. As the donor overflows its Roche lobe, the mass transfer rate initially accelerates before stabilizing and eventually dropping over a timescale of tens of orbits. We also note that for this particular binary, the accretion stream impacts on the surface of the donor rather than forming an accretion disk. This simulation allows us to measure the efficiency with which the accretion stream spins up the accretor in this "direct impact" scenario and the degree to which angular momentum is transfered back to the binary orbit via the tidal field.

  3. Pedestrian Detection Using Gradient Local Binary Patterns

    Science.gov (United States)

    Jiang, Ning; Xu, Jiu; Goto, Satoshi

    In recent years, local pattern based features have attracted increasing interest in object detection and recognition systems. Local Binary Pattern (LBP) feature is widely used in texture classification and face detection. But the original definition of LBP is not suitable for human detection. In this paper, we propose a novel feature named gradient local binary patterns (GLBP) for human detection. In this feature, original 256 local binary patterns are reduced to 56 patterns. These 56 patterns named uniform patterns are used for generating a 56-bin histogram. And gradient value of each pixel is set as the weight which is always same in LBP based features in histogram calculation to computing the values in 56 bins for histogram. Experiments are performed on INRIA dataset, which shows the proposal GLBP feature is discriminative than histogram of orientated gradient (HOG), Semantic Local Binary Patterns (S-LBP) and histogram of template (HOT). In our experiments, the window size is fixed. That means the performance can be improved by boosting methods. And the computation of GLBP feature is parallel, which make it easy for hardware acceleration. These factors make GLBP feature possible for real-time pedestrian detection.

  4. Binary translation using peephole translation rules

    Science.gov (United States)

    Bansal, Sorav; Aiken, Alex

    2010-05-04

    An efficient binary translator uses peephole translation rules to directly translate executable code from one instruction set to another. In a preferred embodiment, the translation rules are generated using superoptimization techniques that enable the translator to automatically learn translation rules for translating code from the source to target instruction set architecture.

  5. Flip-flopping binary black holes.

    Science.gov (United States)

    Lousto, Carlos O; Healy, James

    2015-04-10

    We study binary spinning black holes to display the long term individual spin dynamics. We perform a full numerical simulation starting at an initial proper separation of d≈25M between equal mass holes and evolve them down to merger for nearly 48 orbits, 3 precession cycles, and half of a flip-flop cycle. The simulation lasts for t=20 000M and displays a total change in the orientation of the spin of one of the black holes from an initial alignment with the orbital angular momentum to a complete antialignment after half of a flip-flop cycle. We compare this evolution with an integration of the 3.5 post-Newtonian equations of motion and spin evolution to show that this process continuously flip flops the spin during the lifetime of the binary until merger. We also provide lower order analytic expressions for the maximum flip-flop angle and frequency. We discuss the effects this dynamics may have on spin growth in accreting binaries and on the observational consequences for galactic and supermassive binary black holes. PMID:25910104

  6. Numerical simulations of compact object binaries

    OpenAIRE

    Pfeiffer, Harald P.

    2012-01-01

    Coalescing compact object binaries consisting of black holes and/or Neutron stars are a prime target for ground-based gravitational wave detectors. This article reviews the status of numerical simulations of these systems, with an emphasis on recent progress.

  7. PARTICLE SEGREGATION IN FLUIDIZED BINARY-MIXTURES

    NARCIS (Netherlands)

    HOFFMANN, AC; JANSSEN, LPBM

    1993-01-01

    The particle segregation in fluidised beds consisting of different types of binary mixtures is shown to be governed by the same particle transport processes. The segregation behaviour of both ''different-density mixtures'' and ''equal-density mixtures'', two types of system which until now largely h

  8. Planetary nebula progenitors that swallow binary systems

    CERN Document Server

    Soker, Noam

    2015-01-01

    I propose that some irregular `messy' planetary nebulae owe their morphologies to triple-stellar evolution where tight binary systems are tidally and frictionally destroyed inside the envelope of asymptotic giant branch (AGB) stars. The tight binary system might breakup with one star leaving the system. In an alternative evolution, one of the stars of the brook-up tight binary system falls toward the AGB envelope with low specific angular momentum, and drowns in the envelope. In a different type of destruction process the drag inside the AGB envelope causes the tight binary system to merge. This releases gravitational energy within the AGB envelope, leading to a very asymmetrical envelope ejection, with an irregular and `messy' planetary nebula as a descendant. The evolution of the triple-stellar system before destruction can be in a full common envelope evolution (CEE) or in a grazing envelope evolution (GEE). Both before and after destruction the system might lunch pairs of opposite jets. One pronounced sig...

  9. Locating Restricted Facilities on Binary Maps

    CERN Document Server

    Andreica, Mugurel Ionut; Andreica, Madalina Ecaterina

    2008-01-01

    In this paper we consider several facility location problems with applications to cost and social welfare optimization, when the area map is encoded as a binary (0,1) mxn matrix. We present algorithmic solutions for all the problems. Some cases are too particular to be used in practical situations, but they are at least a starting point for more generic solutions.

  10. Cassini states for black hole binaries

    Science.gov (United States)

    Correia, Alexandre C. M.

    2016-03-01

    Cassini states correspond to the equilibria of the spin axis of a body when its orbit is perturbed. They were initially described for planetary satellites, but the spin axes of black hole binaries also present this kind of equilibria. In previous works, Cassini states were reported as spin-orbit resonances, but actually the spin of black hole binaries is in circulation and there is no resonant motion. Here we provide a general description of the spin dynamics of black hole binary systems based on a Hamiltonian formalism. In absence of dissipation, the problem is integrable and it is easy to identify all possible trajectories for the spin for a given value of the total angular momentum. As the system collapses due to radiation reaction, the Cassini states are shifted to different positions, which modifies the dynamics around them. This is why the final spin distribution may differ from the initial one. Our method provides a simple way of predicting the distribution of the spin of black hole binaries at the end of the inspiral phase.

  11. Non-binary or genderqueer genders.

    Science.gov (United States)

    Richards, Christina; Bouman, Walter Pierre; Seal, Leighton; Barker, Meg John; Nieder, Timo O; T'Sjoen, Guy

    2016-01-01

    Some people have a gender which is neither male nor female and may identify as both male and female at one time, as different genders at different times, as no gender at all, or dispute the very idea of only two genders. The umbrella terms for such genders are 'genderqueer' or 'non-binary' genders. Such gender identities outside of the binary of female and male are increasingly being recognized in legal, medical and psychological systems and diagnostic classifications in line with the emerging presence and advocacy of these groups of people. Population-based studies show a small percentage--but a sizable proportion in terms of raw numbers--of people who identify as non-binary. While such genders have been extant historically and globally, they remain marginalized, and as such--while not being disorders or pathological in themselves--people with such genders remain at risk of victimization and of minority or marginalization stress as a result of discrimination. This paper therefore reviews the limited literature on this field and considers ways in which (mental) health professionals may assist the people with genderqueer and non-binary gender identities and/or expressions they may see in their practice. Treatment options and associated risks are discussed. PMID:26753630

  12. Eclipsing Binaries with the Kepler Mission

    Science.gov (United States)

    Prsa, Andrej; Kepler Eclipsing Binary Working Group

    2012-05-01

    Kepler has revolutionized the eclipsing binary field by providing us essentially uninterrupted data of unprecedented quality. Out of 160,000 targets, we detected over 2500 eclipsing binaries. These range in orbital periods from as short as 0.3 days, all the way to several years, and encompass stellar types across the H-R diagram. In this talk I will present the collaborative effort of the Kepler Eclipsing Binary Working Group to study and characterize these systems on a statistical level: their distribution in periods, galactic latitude, spectral type, fundamental stellar properties and multiplicity as evidenced by eclipse timing variations. I will further show the gems that have sprung from this sample, which were modeled and interpreted to reveal intrinsically pulsating components, runaway encounters with massive tertiaries, stellar objects that populate the lowest end of the main sequence and circumbinary planets. I will critically review and discuss the causes of data systematics and detrending, and introduce a novel algorithm to classify light curves into morphological types using Locally Linear Embedding. Finally, I will touch on the dark side of eclipsing binaries as the primary cause of false positives in extrasolar planet detections with Kepler.

  13. Spin frequency distributions of binary millisecond pulsars

    NARCIS (Netherlands)

    A. Papitto; D.F. Torres; N. Rea; T.M. Tauris

    2014-01-01

    Rotation-powered millisecond radio pulsars have been spun up to their present spin period by a 108−109 yr long X-ray-bright phase of accretion of matter and angular momentum in a low-to-intermediate mass binary system. Recently, the discovery of transitional pulsars that alternate cyclically between

  14. Short-timescale variability in cataclysmic binaries

    International Nuclear Information System (INIS)

    Rapid variability, including flickering and pulsations, has been detected in cataclysmic binaries at optical and x-ray frequencies. In the case of the novalike variable TT Arietis, simultaneous observations reveal that the x-ray and optical flickering activity is strongly correlated, while short period pulsations are observed that occur at the same frequencies in both wavelength bands

  15. Cassini states for black-hole binaries

    CERN Document Server

    Correia, Alexandre C M

    2016-01-01

    Cassini states correspond to equilibria of the spin axis of a celestial body when its orbit is perturbed. They were initially described for planetary satellites, but the spin axes of black-hole binaries also present this kind of equilibria. In previous works, Cassini states were reported as spin-orbit resonances, but actually the spin of black-hole binaries is in circulation and there is no resonant motion. Here we provide a general description of the spin dynamics of black-hole binary systems based on a Hamiltonian formalism. In absence of dissipation the problem is integrable and it is easy to identify all possible trajectories for the spin for a given value of the total angular momentum. As the system collapses due to radiation reaction, the Cassini states are shifted to different positions, which modifies the dynamics around them. This is why the final spin distribution may differ from the initial one. Our method provides a simple way of predicting the distribution of the spin of black-hole binaries at th...

  16. Supermassive Black Hole Binaries: The Search Continues

    CERN Document Server

    Bogdanovic, Tamara

    2014-01-01

    Gravitationally bound supermassive black hole binaries (SBHBs) are thought to be a natural product of galactic mergers and growth of the large scale structure in the universe. They however remain observationally elusive, thus raising a question about characteristic observational signatures associated with these systems. In this conference proceeding I discuss current theoretical understanding and latest advances and prospects in observational searches for SBHBs.

  17. Binary nucleation of water and sodium chloride

    Czech Academy of Sciences Publication Activity Database

    Němec, Tomáš; Maršík, František; Palmer, A.

    2006-01-01

    Roč. 124, č. 4 (2006), 0445091-0445096. ISSN 0021-9606 R&D Projects: GA ČR(CZ) GA101/05/2536 Institutional research plan: CEZ:AV0Z20760514 Keywords : binary nucleation * sodium chloride * water Subject RIV: BJ - Thermodynamics Impact factor: 3.166, year: 2006

  18. Generating quality tetrahedral meshes from binary volumes

    DEFF Research Database (Denmark)

    Hansen, Mads Fogtmann; Bærentzen, Jakob Andreas; Larsen, Rasmus

    2010-01-01

    use these measures to generate high quality meshes from signed distance maps. This paper also describes an approach for computing (smooth) signed distance maps from binary volumes as volumetric data in many cases originate from segmentation of objects from imaging techniques such as CT, MRI, etc. The...

  19. Binary pulsars as dark-matter probes

    CERN Document Server

    Pani, Paolo

    2015-01-01

    During the motion of a binary pulsar around the galactic center, the pulsar and its companion experience a wind of dark-matter particles that can affect the orbital motion through dynamical friction. We show that this effect produces a characteristic seasonal modulation of the orbit and causes a secular change of the orbital period whose magnitude can be well within the astonishing precision of various binary-pulsar observations. Our analysis is valid for binary systems with orbital period longer than a day. By comparing this effect with pulsar-timing measurements, it is possible to derive model-independent upper bounds on the dark-matter density at different distances $D$ from the galactic center. For example, the precision timing of J1713+0747 imposes $\\rho_{\\rm DM}\\lesssim 10^5\\,{\\rm GeV/cm}^3$ at $D\\approx7\\,{\\rm kpc}$. The detection of a binary pulsar at $D\\lesssim 10\\,{\\rm pc}$ could provide stringent constraints on dark-matter halo profiles and on growth models of the central black hole. The Square Kil...

  20. Testing the Binary Trigger Hypothesis in FUors

    CERN Document Server

    Green, Joel D; Rizzuto, Aaron C; Ireland, Michael J; Dupuy, Trent J; Mann, Andrew W; Kuruwita, Rajika

    2016-01-01

    We present observations of three FU Orionis objects (hereafter, FUors) with nonredundant aperture-mask interferometry (NRM) at 1.59 um and 2.12 um that probe for binary companions on the scale of the protoplanetary disk that feeds their accretion outbursts. We do not identify any companions to V1515 Cyg or HBC 722, but we do resolve a close binary companion to V1057 Cyg that is at the diffraction limit (rho = 58.3 +/- 1.4 mas or 30 +/- 5 AU) and currently much fainter than the outbursting star (delta(K') = 3.34 +/- 0.10 mag). Given the flux excess of the outbursting star, we estimate that the mass of the companion (M ~ 0.25 Msun) is similar to or slightly below that of the FUor itself, and therefore it resembles a typical T Tauri binary system. Our observations only achieve contrast limits of delta(K') ~ 4 mag, and hence we are only sensitive to companions that were near or above the pre-outburst luminosity of the FUors. It remains plausible that FUor outbursts could be tied to the presence of a close binary ...

  1. Constraining Binary Stellar Evolution With Pulsar Timing

    Science.gov (United States)

    Ferdman, Robert D.; Stairs, I. H.; Backer, D. C.; Burgay, M.; Camilo, F.; D'Amico, N.; Demorest, P.; Faulkner, A.; Hobbs, G.; Kramer, M.; Lorimer, D. R.; Lyne, A. G.; Manchester, R.; McLaughlin, M.; Nice, D. J.; Possenti, A.

    2006-06-01

    The Parkes Multibeam Pulsar Survey has yielded a significant number of very interesting binary and millisecond pulsars. Two of these objects are part of an ongoing timing study at the Green Bank Telescope (GBT). PSR J1756-2251 is a double-neutron star (DNS) binary system. It is similar to the original Hulse-Taylor binary pulsar system PSR B1913+16 in its orbital properties, thus providing another important opportunity to test the validity of General Relativity, as well as the evolutionary history of DNS systems through mass measurements. PSR J1802-2124 is part of the relatively new and unstudied "intermediate-mass" class of binary system, which typically have spin periods in the tens of milliseconds, and/or relatively massive (> 0.7 solar masses) white dwarf companions. With our GBT observations, we have detected the Shapiro delay in this system, allowing us to constrain the individual masses of the neutron star and white dwarf companion, and thus the mass-transfer history, in this unusual system.

  2. Performance of binary FSK data transmission systems

    Science.gov (United States)

    Batson, B. H.

    1973-01-01

    Matched-filter detection of binary signals is discussed in terms of the probability of bit error. The equations for the probability of error are derived for coherent phase shift keying, and coherent frequency shift keying (FSK). Suboptimum detection of FSK signals is also discussed for discriminators.

  3. BINARY WAVELET TRANSFORM FOR IMAGE REPRESENTATION

    Directory of Open Access Journals (Sweden)

    ASHOK.M

    2011-08-01

    Full Text Available The MRA (Multi resolution analysis for an image provides specific information localized in space or frequency domain .In this paper an efficient representation of the visual information is presented using Binary wavelet Transform for both color and gray level image. Analytical results shows that this method proves to be more efficient in representing the visual information than the earlier

  4. A semantic constraint on binary determiners

    OpenAIRE

    Zuber, Richard

    2009-01-01

    Abstract A type $${\\langle{1^2, 1}\\rangle}$$ quantifier F is symmetric iff F(X, X)(Y) = F(Y, Y)(X). It is shown that quantifiers denoted by irreducible binary determiners in natural languages are both conservative and symmetric and not only conservative.

  5. Orbits of Ten Visual Binary Stars

    Institute of Scientific and Technical Information of China (English)

    B.Novakovi(c)

    2007-01-01

    We present the orbits of ten visual binary stars:WDS 01015+6922.WDS 01424-0645,WDS 01461+6349,WDS 04374-0951,WDS 04478+5318,WDS 05255-0033,WDS 05491+6248,WDS 06404+4058,WDS 07479-1212,and WDS 18384+0850.We have also determined their masses,dynamical parallaxes and ephemerides.

  6. The Benchmark Eclipsing Binary V530 Ori

    DEFF Research Database (Denmark)

    Torres, Guillermo; Lacy, Claud H. Sandberg; Pavlovski, Kresimir;

    2015-01-01

    We report accurate measurements of the physical properties (mass, radius, temperature) of components of the G+M eclipsing binary V530 On. The M-type secondary shows a larger radius and a cooler temperature than predicted by standard stellar evolution models, as has been found for many other low-m...

  7. Cluster selection in binary nuclear models

    CERN Document Server

    Buck, B; Pérez, S M

    2000-01-01

    We present a simple prescription for selecting the cluster and core in a binary cluster-model description of a nucleus. The prescription reproduces the cluster-core combinations used in earlier successful applications of the model, predicts others, and extends the good agreement previously found with observed B(E2; 2 sup + -> 0 sup +) values of actinide nuclei. Refs. 31 (author)

  8. Merging Compact Binaries in Hierarchical Triple Systems: Resonant Excitation of Binary Eccentricity

    CERN Document Server

    Liu, Bin; Yuan, Ye-Fei

    2015-01-01

    The merging of compact binaries play an important role in astrophysical context. The gravitational waves takes the angular momentum off the merging binary, which makes the orbit of the inner binary shrink. In this work, we study the secular dynamics of merging binary with a small perturber in hierarchical triple systems. From our numerical calculations, we find that the triple system goes through a resonant state between the apsidal precession rates of two orbits during the orbital decay, and the eccentricity of the inner orbit is excited, as well as the corresponding gravita- tional wave frequency. Our numerical results could be understood under the linear approximation of small orbital eccentricities and coplanar configuration. Especially, the resonant condition and the excited eccentricity can be estimated analytically.

  9. Infalling clouds on to supermassive black hole binaries - II. Binary evolution and the final parsec problem

    CERN Document Server

    Goicovic, Felipe G; Cuadra, Jorge; Stasyszyn, Federico

    2016-01-01

    The formation of massive black hole binaries (MBHBs) is an unavoidable outcome of galaxy evolution via successive mergers. However, the mechanism that drives their orbital evolution from parsec separations down to the gravitational wave (GW) dominated regime is poorly understood and their final fate is still unclear. If such binaries are embedded in gas-rich and turbulent environments, as observed in remnants of galaxy mergers, the interaction with gas clumps (such as molecular clouds) may efficiently drive their orbital evolution. Using numerical simulations, we test this hypothesis by studying the dynamical evolution of an equal-mass, circular MBHB accreting infalling molecular clouds. We investigate different orbital configurations, modelling a total of 13 systems to explore different possible pericentre distances and relative inclinations of the cloud-binary encounter. We show that the evolution of the binary orbit is dominated by the exchange of angular momentum through gas accretion during the first sta...

  10. Radio evidence for binary super massive black holes

    Science.gov (United States)

    Ekers, R. D.

    2016-02-01

    I present examples of radio AGN with binary nuclei which provide the direct radio evidence for binary Super Massive Black Holes (SMBH) driving the AGN activity. There is also other evidence for distorted radio morphology and periodic variability which may indicate the presence of a second (inactive) SMBH. Finally I enumerate a number of possible radio tracers for the binary SMBH merger events.

  11. Kepler Eclipsing Binary Stars. VIII. Identification of False Positive Eclipsing Binaries and Re-extraction of New Light Curves

    CERN Document Server

    Abdul-Masih, Michael; Conroy, Kyle; Bloemen, Steven; Boyajian, Tabetha; Doyle, Laurance R; Johnston, Cole; Kostov, Veselin; Latham, David W; Matijevic, Gal; Shporer, Avi; Southworth, John

    2016-01-01

    The Kepler Mission has provided unprecedented, nearly continuous photometric data of $\\sim$200,000 objects in the $\\sim$105 deg$^{2}$ field of view from the beginning of science operations in May of 2009 until the loss of the second reaction wheel in May of 2013. The Kepler Eclipsing Binary Catalog contains information including but not limited to ephemerides, stellar parameters and analytical approximation fits for every known eclipsing binary system in the Kepler Field of View. Using Target Pixel level data collected from Kepler in conjunction with the Kepler Eclipsing Binary Catalog, we identify false positives among eclipsing binaries, i.e. targets that are not eclipsing binaries themselves, but are instead contaminated by eclipsing binary sources nearby on the sky and show eclipsing binary signatures in their light curves. We present methods for identifying these false positives and for extracting new light curves for the true source of the observed binary signal. For each source, we extract three separa...

  12. A decoding method of an n length binary BCH code through (n + 1n length binary cyclic code

    Directory of Open Access Journals (Sweden)

    TARIQ SHAH

    2013-09-01

    Full Text Available For a given binary BCH code Cn of length n = 2 s - 1 generated by a polynomial of degree r there is no binary BCH code of length (n + 1n generated by a generalized polynomial of degree 2r. However, it does exist a binary cyclic code C (n+1n of length (n + 1n such that the binary BCH code Cn is embedded in C (n+1n . Accordingly a high code rate is attained through a binary cyclic code C (n+1n for a binary BCH code Cn . Furthermore, an algorithm proposed facilitates in a decoding of a binary BCH code Cn through the decoding of a binary cyclic code C (n+1n , while the codes Cn and C (n+1n have the same minimum hamming distance.

  13. Binary Disk interaction II: Gap-Opening criteria for unequal mass binaries

    CERN Document Server

    del Valle, Luciano

    2013-01-01

    We study the interaction between an unequal mass binary with an isothermal circumbinary disk, motivated by the theoretical and observational evidence that after a major merger of gas-rich galaxies, a massive gaseous disk with a SMBH binary will be formed in the nuclear region. We focus on the gravitational torques that the binary exerts onto the disk and how these torques can drive the formation of a gap in the disk. This exchange of angular momentum between the binary and the disk is mainly driven by the gravitational interaction between the binary and a strong non-axisymmetric density perturbation that is produced in the disk, as response to the presence of the binary. Using SPH numerical simulations we tested two gap-opening criterion, one that assumes that the geometry of the density perturbation is an ellipsoid/thick-spirals and another that assumes a geometry of flat-spirals for the density perturbation. We find that the flat-spirals gap opening criterion successfully predicts which simulations will hav...

  14. Binaries migrating in a gaseous disk: Where are the Galactic center binaries?

    CERN Document Server

    Baruteau, C; Lin, D N C

    2010-01-01

    The massive stars in the Galactic center inner arcsecond share analogous properties with the so-called Hot Jupiters. Most of these young stars have highly eccentric orbits, and were probably not formed in-situ. It has been proposed that these stars acquired their current orbits from the tidal disruption of compact massive binaries scattered toward the proximity of the central supermassive black hole. Assuming a binary star formed in a thin gaseous disk beyond 0.1 pc from the central object, we investigate the relevance of disk-satellite interactions to harden the binding energy of the binary, and to drive its inward migration. A massive, equal-mass binary star is found to become more tightly wound as it migrates inwards toward the central black hole. The migration timescale is very similar to that of a single-star satellite of the same mass. The binary's hardening is caused by the formation of spiral tails lagging the stars inside the binary's Hill radius. We show that the hardening timescale is mostly determ...

  15. White-light Flares on Close Binaries Observed with Kepler

    Science.gov (United States)

    Gao, Qing; Xin, Yu; Liu, Ji-Feng; Zhang, Xiao-Bin; Gao, Shuang

    2016-06-01

    Based on Kepler data, we present the results of a search for white light flares on 1049 close binaries. We identify 234 flare binaries, of which 6818 flares are detected. We compare the flare-binary fraction in different binary morphologies (“detachedness”). The result shows that the fractions in over-contact and ellipsoidal binaries are approximately 10%–20% lower than those in detached and semi-detached systems. We calculate the binary flare activity level (AL) of all the flare binaries, and discuss its variations along the orbital period (P orb) and rotation period (P rot, calculated for only detached binaries). We find that the AL increases with decreasing P orb or P rot, up to the critical values at P orb ∼ 3 days or P rot ∼ 1.5 days, and thereafter the AL starts decreasing no matter how fast the stars rotate. We examine the flaring rate as a function of orbital phase in two eclipsing binaries on which a large number of flares are detected. It appears that there is no correlation between flaring rate and orbital phase in these two binaries. In contrast, when we examine the function with 203 flares on 20 non-eclipse ellipsoidal binaries, bimodal distribution of amplitude-weighted flare numbers shows up at orbital phases 0.25 and 0.75. Such variation could be larger than what is expected from the cross section modification.

  16. RGD偶联吉西他滨白蛋白纳米粒对胰腺癌细胞增殖抑制作用的研究%Study on inhibitory effects of RGD-conjugated gemcitabine-loaded albumin nanoparticles on the proliferation of BxPC-3 cells in vitro

    Institute of Scientific and Technical Information of China (English)

    吉顺荣; 吴闻哲; 王浩; 张波; 刘辰; 龙江; 虞先濬; 倪泉兴; 徐近

    2011-01-01

    Objective To explore the inhibitory effects of RGD-conjugated gemcitabine (GEM)-loaded albumin nanoparticles (ANP) on the proliferation of BxPC-3 cells in vitro. Methods Human pancreatic carcinoma BxPC-3 cells were cultured and then treated 5 different combinations of drugs (BSANP controls, RGD-BSANP, BSANP-GEM, GEM and RGD-BSANP-GEM) respectively. The inhibition rate of BxPC-3 cells was detected by MTT. Results The gemcitabine-loaded albumin nanoparticles produced higher inhibitory effects than gemcitabine alone. The RGD-conjugated gemcitabine-loaded albumin nanoparticles produced even higher anti-proliferation rate than those without RGD conjugation. Conclusions RGD peptides can increase the anti-proliferation rate of gemcitabine-loaded albumin nanoparticles on BxPC-3 cells in vitro.%目的:通过体外试验,探讨RGD偶联吉西他滨白蛋白纳米粒(RGD-BSANP-GEM)对胰腺癌细胞株BxPC-3的体外增殖的抑制作用.方法:以人胰腺癌细胞株BxPC-3为研究对象,分为5个给药组:BSANP对照组、RGD-BSANP组、BSANP-GEM组、GEM原药组、RGD-BSANP-GEM组.运用MTT法检测给药后24h、48 h和72 h的增殖抑制率.结果:BSANP-GEM组细胞抑制率高于GEM组(P<0.05),RGD-BSANP-GEM组细胞抑制率高于BSANP-GEM组.同时RGD-BSANP-GEM组对胰腺癌细胞株的抑制率与给药浓度和作用时间呈正相关.结论:体外RGD环肽能够增加BSANP-GEM对胰腺癌细胞的增殖抑制作用.

  17. Detectability of Gravitational Waves from High-Redshift Binaries.

    Science.gov (United States)

    Rosado, Pablo A; Lasky, Paul D; Thrane, Eric; Zhu, Xingjiang; Mandel, Ilya; Sesana, Alberto

    2016-03-11

    Recent nondetection of gravitational-wave backgrounds from pulsar timing arrays casts further uncertainty on the evolution of supermassive black hole binaries. We study the capabilities of current gravitational-wave observatories to detect individual binaries and demonstrate that, contrary to conventional wisdom, some are, in principle, detectable throughout the Universe. In particular, a binary with rest-frame mass ≳10^{10}M_{⊙} can be detected by current timing arrays at arbitrarily high redshifts. The same claim will apply for less massive binaries with more sensitive future arrays. As a consequence, future searches for nanohertz gravitational waves could be expanded to target evolving high-redshift binaries. We calculate the maximum distance at which binaries can be observed with pulsar timing arrays and other detectors, properly accounting for redshift and using realistic binary waveforms. PMID:27015470

  18. Twin Binaries: Studies of Stability, Mass Transfer, and Coalescence

    CERN Document Server

    Lombardi, James C; Dooley, Katherine L; Gearity, Kyle; Kalogera, Vassiliki; Rasio, Frederic A

    2010-01-01

    Motivated by suggestions that binaries with almost equal-mass components ("twins") play an important role in the formation of double neutron stars and may be rather abundant among binaries, we study the stability of synchronized close and contact binaries with identical components in circular orbits. In particular, we investigate the dependency of the innermost stable circular orbit on the core mass, and we study the coalescence of the binary that occurs at smaller separations. For twin binaries composed of convective main-sequence stars, subgiants, or giants with low mass cores (M_c ~0.15M), we find that stable contact configurations exist at all separations down to the Roche limit, when mass shedding through the outer Lagrangian points triggers a coalescence of the envelopes and leaves the cores orbiting in a central tight binary. We discuss the implications of our results to the formation of binary neutron stars.

  19. Template Mode Hierarchies for Binary Black Hole Mergers

    CERN Document Server

    Healy, James; Pekowsky, Larne; Shoemaker, Deirdre

    2013-01-01

    Matched filtering is a popular data analysis framework used to search for gravitational wave signals emitted by compact object binaries. The templates used in matched filtering searches are constructed predominantly from the quadrupolar mode because this mode is the energetically most dominant channel. However, for highly precessing binaries or binaries with moderately large mass ratios, significant power is also carried by higher-order modes. We investigate how the inclusion of higher modes in the templates increases the prospects for detecting gravitational waves. Specifically, we use numerical relativity waveforms from the late inspiral and coalescence of binary black holes to identify mode hierarchies that cover the sky of binary orientations. We show that the ordering in these hierarchies depends on the characteristics of the binary system and the mode strengths. Our study demonstrates that detecting moderately high precessing or unequal mass binaries requires the inclusion of higher modes in the templat...

  20. Performance analysis and binary working fluid selection of combined flash-binary geothermal cycle

    International Nuclear Information System (INIS)

    Performance of the combined flash-binary geothermal power cycle for geofluid temperatures between 150 and 250 °C is studied. A thermodynamic model is developed, and the suitable binary working fluids for different geofluid temperatures are identified from a list of thirty working fluid candidates, consisting environmental friendly refrigerants and hydrocarbons. The overall system exergy destruction and Vapor Expansion Ratio across the binary cycle turbine are selected as key performance indicators. The results show that for low-temperature heat sources using refrigerants as binary working fluids result in higher overall cycle efficiency and for medium and high-temperature resources, hydrocarbons are more suitable. For combined flash-binary cycle, secondary working fluids; R-152a, Butane and Cis-butane show the best performances at geofluid temperatures 150, 200 and 250 °C respectively. The overall second law efficiency is calculated as high as 0.48, 0.55 and 0.58 for geofluid temperatures equal 150, 200 and 250 °C respectively. The flash separator pressure found to has important effects on cycle operation and performance. Separator pressure dictates the work production share of steam and binary parts of the system. And there is an optimal separator pressure at which overall exergy destruction of the cycle achieves its minimum value. - Highlights: • Performance of the combined flash-binary geothermal cycle is investigated. • Thirty different fluids are screened to find the most suitable ORC working fluid. • Optimum cycle operation conditions presented for geofluids between 150 °C and 250 °C. • Refrigerants are more suitable for the ORC at geothermal sources temperature ≤200 °C. • Hydrocarbons are more suitable for the ORC at geothermal sources temperature >200 °C

  1. Phenomenological gravitational waveforms from spinning coalescing binaries

    CERN Document Server

    Sturani, R; Cadonati, L; Guidi, G M; Healy, J; Shoemaker, D; Vicere', A

    2010-01-01

    An accurate knowledge of the coalescing binary gravitational waveform is crucial for match filtering techniques, which are currently used in the observational searches performed by the LIGO-Virgo collaboration. Following an earlier paper by the same authors we expose the construction of analytical phenomenological waveforms describing the signal sourced by generically spinning binary systems. The gap between the initial inspiral part of the waveform, described by spin-Taylor approximants, and its final ring-down part, described by damped exponentials, is bridged by a phenomenological phase calibrated by comparison with the dominant spherical harmonic mode of a set of waveforms including both numerical and phenomenological waveforms of a different type. All waveforms considered describe equal mass systems with dimension-less spin magnitudes equal to 0.6. The noise-weighted overlap integral between numerical and phenomenological waveforms ranges between 0.93 and 0.98 for a wide span of mass values.

  2. Spin-Spin Coupling in Asteroidal Binaries

    Science.gov (United States)

    Batygin, Konstantin; Morbidelli, Alessandro

    2015-11-01

    Gravitationally bound binaries constitute a substantial fraction of the small body population of the solar system, and characterization of their rotational states is instrumental to understanding their formation and dynamical evolution. Unlike planets, numerous small bodies can maintain a perpetual aspheroidal shape, giving rise to a richer array of non-trivial gravitational dynamics. In this work, we explore the rotational evolution of triaxial satellites that orbit permanently deformed central objects, with specific emphasis on quadrupole-quadrupole interactions. Our analysis shows that in addition to conventional spin-orbit resonances, both prograde and retrograde spin-spin resonances naturally arise for closely orbiting, highly deformed bodies. Application of our results to the illustrative examples of (87) Sylvia and (216) Kleopatra multi-asteroid systems implies capture probabilities slightly below ~10% for leading-order spin-spin resonances. Cumulatively, our results suggest that spin-spin coupling may be consequential for highly elongated, tightly orbiting binary objects.

  3. BISC: binary subcomplexes in proteins database.

    Science.gov (United States)

    Juettemann, Thomas; Gerloff, Dietlind L

    2011-01-01

    Binary subcomplexes in proteins database (BISC) is a new protein-protein interaction (PPI) database linking up the two communities most active in their characterization: structural biology and functional genomics researchers. The BISC resource offers users (i) a structural perspective and related information about binary subcomplexes (i.e. physical direct interactions between proteins) that are either structurally characterized or modellable entries in the main functional genomics PPI databases BioGRID, IntAct and HPRD; (ii) selected web services to further investigate the validity of postulated PPI by inspection of their hypothetical modelled interfaces. Among other uses we envision that this resource can help identify possible false positive PPI in current database records. BISC is freely available at http://bisc.cse.ucsc.edu. PMID:21081561

  4. Error detection by binary sparse matrices

    International Nuclear Information System (INIS)

    Error detection is a crucial process in an information transmission protocol like TCP for attaining reliable communications over unreliable channels. The most important performance measure for an error detection scheme is its undetected error probability, which is the probability corresponding to the event such that an erroneous received word passes the detection test. The paper reviews the author's results on an analysis of the undetected error probability of ensembles of m x n binary matrices. The ensemble of binary sparse matrices called the Bernoulli ensemble whose members are considered as matrices generated from i.i.d. Bernoulli source is mainly discussed here. The error exponent of the average undetected error probability and closed form expressions for the variance of the undetected error probability will be presented.

  5. Hamiltonian Hydrodynamics and Irrotational Binary Inspiral

    CERN Document Server

    Markakis, Charalampos M

    2014-01-01

    Gravitational waves from neutron-star and black-hole binaries carry valuable information on their physical properties and probe physics inaccessible to the laboratory. Although development of black-hole gravitational-wave templates in the past decade has been revolutionary, the corresponding work for double neutron-star systems has lagged. Neutron stars can be well-modelled as simple barotropic fluids during the part of binary inspiral most relevant to gravitational wave astronomy, but the crucial geometric and mathematical consequences of this simplification have remained computationally unexploited. In particular, Carter and Lichnerowicz have described barotropic fluid motion via classical variational principles as conformally geodesic. Moreover, Kelvin's circulation theorem implies that initially irrotational flows remain irrotational. Applied to numerical relativity, these concepts lead to novel Hamiltonian or Hamilton-Jacobi schemes for evolving relativistic fluid flows. Hamiltonian methods can conserve ...

  6. Processes assessment in binary mixture plant

    Directory of Open Access Journals (Sweden)

    N. Shankar Ganesh, T. Srinivas

    2013-01-01

    Full Text Available Binary fluid system has an efficient system of heat recovery compared to a single fluid system due to a better temperature match between hot and cold fluids. There are many applications with binary fluid system i.e. Kalina power generation, vapor absorption refrigeration, combined power and cooling etc. Due to involvement of three properties (pressure, temperature and concentration in the processes evaluation, the solution is complicated compared to a pure substance. The current work simplifies this complex nature of solution and analyzes the basic processes to understand the processes behavior in power generation as well as cooling plants. Kalina power plant consists of regenerator, heat recovery vapor generator, condenser, mixture, separator, turbine, pump and throttling device. In addition to some of these components, the cooling plant consists of absorber which is similar in operation of condenser. The amount of vapor at the separator decreases with an increase in its pressure and temperature.

  7. Binary hidden Markov models and varieties

    CERN Document Server

    Critch, Andrew J

    2012-01-01

    The technological applications of hidden Markov models have been extremely diverse and successful, including natural language processing, gesture recognition, gene sequencing, and Kalman filtering of physical measurements. HMMs are highly non-linear statistical models, and just as linear models are amenable to linear algebraic techniques, non-linear models are amenable to commutative algebra and algebraic geometry. This paper examines closely those HMMs in which all the random variables, called nodes, are binary. Its main contributions are (1) minimal defining equations for the 4-node model, comprising 21 quadrics and 29 cubics, which were computed using Gr\\"obner bases in the cumulant coordinates of Sturmfels and Zwiernik, and (2) a birational parametrization for every binary HMM, with an explicit inverse for recovering the hidden parameters in terms of observables. The new model parameters in (2) are hence rationally identifiable in the sense of Sullivant, Garcia-Puente, and Spielvogel, and each model's Zar...

  8. Binary Minor Planets V9.0

    Science.gov (United States)

    Johnston, W. R.

    2016-07-01

    The data set lists orbital and physical properties for well-observed or suspected binary/multiple minor planets including the Pluto system, compiled from the published literature as inspired by Richardson and Walsh (2006) and similar reviews (Merline et al., 2003; Noll, 2006; Pravec et al., 2006; Pravec and Harris, 2007; Descamps and Marchis, 2008; Noll et al., 2008; Walsh, 2009). In total 297 companions in 282 systems are included. Data are presented in three tables: one for orbital and physical properties; one for companion designations, discovery information, and reference codes for data values; and one giving full references for each reference code. This data set is complete for binary/multiple components reported through 31 March 2016.

  9. Modulated Binary-Ternary Dual Semiconductor Heterostructures.

    Science.gov (United States)

    Prusty, Gyanaranjan; Guria, Amit K; Mondal, Indranil; Dutta, Anirban; Pal, Ujjwal; Pradhan, Narayan

    2016-02-18

    A generic modular synthetic strategy for the fabrication of a series of binary-ternary group II-VI and group I-III-VI coupled semiconductor nano-heterostructures is reported. Using Ag2 Se nanocrystals first as a catalyst and then as sacrificial seeds, four dual semiconductor heterostructures were designed with similar shapes: CdSe-AgInSe2 , CdSe-AgGaSe2 , ZnSe-AgInSe2 , and ZnSe-AgGaSe2 . Among these, dispersive type-II heterostructures are further explored for photocatalytic hydrogen evolution from water and these are observed to be superior catalysts than the binary or ternary semi-conductors. Details of the chemistry of this modular synthesis have been studied and the photophysical processes involved in catalysis are investigated. PMID:26800297

  10. Parallel Matrix Factorization for Binary Response

    CERN Document Server

    Khanna, Rajiv; Agarwal, Deepak; Chen, Beechung

    2012-01-01

    Predicting user affinity to items is an important problem in applications like content optimization, computational advertising, and many more. While bilinear random effect models (matrix factorization) provide state-of-the-art performance when minimizing RMSE through a Gaussian response model on explicit ratings data, applying it to imbalanced binary response data presents additional challenges that we carefully study in this paper. Data in many applications usually consist of users' implicit response that are often binary -- clicking an item or not; the goal is to predict click rates, which is often combined with other measures to calculate utilities to rank items at runtime of the recommender systems. Because of the implicit nature, such data are usually much larger than explicit rating data and often have an imbalanced distribution with a small fraction of click events, making accurate click rate prediction difficult. In this paper, we address two problems. First, we show previous techniques to estimate bi...

  11. Superconducting State Parameters of Binary Superconductors

    Directory of Open Access Journals (Sweden)

    Aditya M. Vora

    2012-05-01

    Full Text Available A well known pseudopotential is used to investigate the superconducting state parameters viz. electron-phonon coupling strength , Coulomb pseudopotential *, transition temperature ТС, isotope effect exponent  and effective interaction strength N0V for the AgxZn1 – x and AgxAl1 – x binary superconductors theoretically for the first time. We have incorporated here five different types of the local field correction functions to show the effect of exchange and correlation on the aforesaid properties. Very strong influence of the various exchange and correlation functions is concluded from the present study. The comparison with other such experimental values is encouraging, which confirms the applicability of the model potential in explaining the superconducting state parameters of binary mixture.

  12. Sequential binary decay of highly excited nuclei

    International Nuclear Information System (INIS)

    The decay of highly excited nuclei is described as a sequence of binary processes involving emission of fragments in their ground, excited-bound and unbound states. Primary together with secondary decay products lead to the final mass distributions. Asymmetric mass splittings involving nucleon emission up to symmetric binary ones are treated according to a generalized Weisskopf evaporation formalism. This procedure is implemented in the Monte-Carlo multi-step statistical model code MECO (Multisequential Evaporation COde). We examine the evolution of the calculated final mass distributions in the decay of a light compound nucleus, as the initial excitation energy increases towards the limits of complete dissociation. Comparisons are made with the predictions of the transition-stage theory, as well as a consistent Weisskopf treatment in which the decay process is described by rate equations for the generation of different fragment species. (author)

  13. Simulation of nuclei morphologies for binary alloy

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    We study the critical nuclei morphologies of a binary alloy by the string method. The dynamic equation of the string, connecting the metastable phase (liquid) and stable phase (solid), is governed by Helmholtz free energy for the binary alloy system at a given temperature. The stationary string through the critical nucleus (saddle point) is obtained if the relaxation time of the string is su?ciently large. The critical nucleus radius and energy barrier to nucleation of a pure alloy with isotropic interface energy in two and three dimensions are calculated, which are consistent with the classical nucleation theory. The critical nuclei morphologies are sensitive to the anisotropy strength of interface energy and interface thickness of alloy in two and three dimensions. The critical nucleus and energy barrier to nucleation become smaller if the anisotropy strength of the interface energy is increased, which means that it is much easier to form a stable nucleus if the anisotropy of the interface energy is considered.

  14. Binary Brayton cycle with two isothermal processes

    International Nuclear Information System (INIS)

    Highlights: • This paper presents binary Brayton cycle with two isothermal processes. • Different parameters affecting the cycle performance have been studied. • The present cycle is a promising cycle for future power generation. - Abstract: The literature introduced isothermal concept and binary Brayton cycle as two promising methods used to enhance the performance of the gas turbine. Consequently, this work presents a cycle based on the blending of the two methods. This cycle is composed of gas turbine topping cycle with isothermal combustion and air turbine bottoming cycle with isothermal heating. Different parameters affecting the cycle performance have been studied. Simulations demonstrate that the present cycle achieves drastic enhancement in performance. The cycle merits justify its potential utilization for future power generation

  15. Toroidal Horizons in Binary Black Hole Mergers

    CERN Document Server

    Bohn, Andy; Teukolsky, Saul A

    2016-01-01

    We find the first binary black hole event horizon with a toroidal topology. It had been predicted that generically the event horizons of merging black holes should briefly have a toroidal topology, but such a phase has never been seen prior to this work. In all previous binary black hole simulations, in the coordinate slicing used to evolve the black holes, the topology of the event horizon transitions directly from two spheres during the inspiral to a single sphere as the black holes merge. We present a coordinate transformation to a foliation of spacelike hypersurfaces that "cut a hole" through the event horizon surface, resulting in a toroidal event horizon. A torus could potentially provide a mechanism for violating topological censorship. However, these toroidal event horizons satisfy topological censorship by construction, because we can always trivially apply the inverse coordinate transformation to remove the topological feature.

  16. A Binary Representation of the Genetic Code

    CERN Document Server

    Nemzer, Louis R

    2016-01-01

    This article introduces a novel binary representation of the canonical genetic code, in which each of the four mRNA nucleotide bases is assigned a unique 2-bit identifier. These designations have a physiological meaning derived from the molecular structures of, and relationships between, the bases. In this scheme, the 64 possible triplet codons are each indexed by a 6-bit label. The order of the bits reflects the hierarchical organization manifested by the DNA replication/repair and tRNA translation systems. Transition and transversion mutations are naturally expressed as basic binary operations, and the severity of the different types is analyzed. Using a principal component analysis, it is shown that physicochemical properties of amino acids related to protein folding also correlate with particular bit positions of their respective labels. Thus, the likelihood for a particular point mutation to be conservative, and therefore less likely to cause a change in protein functionality, can be estimated.

  17. Binary Fingerprints at Fluctuation-Enhanced Sensing

    CERN Document Server

    Chang, Hung-Chih; King, Maria D; Kwan, Chiman

    2009-01-01

    We developed a simple way to generate binary patterns based on spectral slopes in different frequency ranges at fluctuation-enhanced sensing. Such patterns can be considered as binary "fingerprints" of odors. The method has experimentally been demonstrated with a commercial semiconducting metal oxide (Taguchi) sensor exposed to bacterial odors (Escherichia coli and Anthrax-surrogate Bacillus subtilis) and processing their stochastic signals. With a single Taguchi sensor, the situations of empty chamber, tryptic soy agar (TSA) medium, or TSA with bacteria could be distinguished with 100% reproducibility. The bacterium numbers were in the range of 25 thousands to 1 million. To illustrate the relevance for ultra-low power consumption, we show that this new type of signal processing and pattern recognition task can be implemented by a simple analog circuitry and a few logic gates with total power consumption in the microWatts range.

  18. Dynamics and Habitability in Binary Star Systems

    CERN Document Server

    Eggl, Siegfried; Pilat-Lohinger, Elke

    2014-01-01

    Determining planetary habitability is a complex matter, as the interplay between a planet's physical and atmospheric properties with stellar insolation has to be studied in a self consistent manner. Standardized atmospheric models for Earth-like planets exist and are commonly accepted as a reference for estimates of Habitable Zones. In order to define Habitable Zone boundaries, circular orbital configurations around main sequence stars are generally assumed. In gravitationally interacting multibody systems, such as double stars, however, planetary orbits are forcibly becoming non circular with time. Especially in binary star systems even relatively small changes in a planet's orbit can have a large impact on habitability. Hence, we argue that a minimum model for calculating Habitable Zones in binary star systems has to include dynamical interactions.

  19. Buffer Overflow Detection on Binary Code

    Institute of Scientific and Technical Information of China (English)

    ZHENG Yan-fei; LI Hui; CHEN Ke-fei

    2006-01-01

    Most solutions for detecting buffer overflow are based on source code. But the requirement for source code is not always practical especially for business software. A new approach was presented to detect statically the potential buffer overflow vulnerabilities in the binary code of software. The binary code was translated into assembly code without the lose of the information of string operation functions. The feature code abstract graph was constructed to generate more accurate constraint statements, and analyze the assembly code using the method of integer range constraint. After getting the elementary report on suspicious code where buffer overflows possibly happen, the control flow sensitive analysis using program dependence graph was done to decrease the rate of false positive. A prototype was implemented which demonstrates the feasibility and efficiency of the new approach.

  20. Construction of generalized binary Bent sequences

    Institute of Scientific and Technical Information of China (English)

    KE Pin-hui; CHANG Zu-ling; WEN Qiao-yan

    2006-01-01

    Bent functions in trace forms play an important role in the constructions of generalized binary Bent sequences.Trace representation of some degree two Bent functions are presented in this paper.A sufficient and necessary condition is derived to determine whether the sum of the combinations of Gold functions,tr1n(x2'+1),1≤I≤n-1,over finite fields F2n (n be even) in addition to another term tr1n/2(x2n/2+1) is a Bent function.Similar to the result presented by Khoo et al.,the condition can be verified by polynominal greatest common divisor (GCD) computation.A similar result also holds in the case Fpn (n be even,p be odd prime).Using the constructed Bent functions and Niho type Bent functions given by Dobbertin et al.,many new generalized binary Bent sequences are obtained.

  1. Kepler Eclipsing Binary Stars. V. Identification of 31 Eclipsing Binaries in the K2 Engineering Data-set

    CERN Document Server

    Conroy, Kyle E; Stassun, Keivan G; Bloemen, Steven; Parvizi, Mahmoud; Quarles, Billy; Boyajian, Tabetha; Barclay, Thomas; Shporer, Avi; Latham, David W; Abdul-Masih, Michael

    2014-01-01

    Over 2500 eclipsing binaries were identified and characterized from the ultra-precise photometric data provided by the Kepler space telescope. Kepler is now beginning its second mission, K2, which is proving to again provide ultra-precise photometry for a large sample of eclipsing binary stars. In the 1951 light curves covering 12 days in the K2 engineering data-set, we have identified and determined the ephemerides for 31 eclipsing binaries that demonstrate the capabilities for eclipsing binary science in the upcoming campaigns in K2. Of those, 20 are new discoveries. We describe both manual and automated approaches to harvesting the complete set of eclipsing binaries in the K2 data, provide identifications and details for the full set of eclipsing binaries present in the engineering data-set, and discuss the prospects for application of eclipsing binary searches in the K2 mission.

  2. Binary pulsar - a test for general relativity

    International Nuclear Information System (INIS)

    The binary system of PSR1913 + 16 contains the pulsar and an, as yet unknown, companion. If this star is a compact object too, then the data can be interpreted in terms of general relativistic effects. This leads to the conclusion that the decay of the orbit must be due to the emission of gravitational waves. The nature of the unseen companion is discussed in detail

  3. Gravitational waves from binary black holes

    Indian Academy of Sciences (India)

    Bala R Iyer

    2011-07-01

    It is almost a century since Einstein predicted the existence of gravitational waves as one of the consequences of his general theory of relativity. A brief historical overview including Chandrasekhar’s contribution to the subject is first presented. The current status of the experimental search for gravitational waves and the attendant theoretical insights into the two-body problem in general relativity arising from computations of gravitational waves from binary black holes are then broadly reviewed.

  4. Gravity Waves, Chaos, and Spinning Compact Binaries

    OpenAIRE

    Levin, Janna

    1999-01-01

    Spinning compact binaries are shown to be chaotic in the Post-Newtonian expansion of the two body system. Chaos by definition is the extreme sensitivity to initial conditions and a consequent inability to predict the outcome of the evolution. As a result, the spinning pair will have unpredictable gravitational waveforms during coalescence. This poses a challenge to future gravity wave observatories which rely on a match between the data and a theoretical template.

  5. Modeling Flows Around Merging Black Hole Binaries

    OpenAIRE

    van Meter, James R.; Wise, John H.; Miller, M. Coleman; Reynolds, Christopher S.; Centrella, Joan M.; Baker, John G.; Boggs, William D.; Kelly, Bernard J.; McWilliams, Sean T.

    2009-01-01

    Coalescing massive black hole binaries are produced by the mergers of galaxies. The final stages of the black hole coalescence produce strong gravitational radiation that can be detected by the space-borne LISA. In cases where the black hole merger takes place in the presence of gas and magnetic fields, various types of electromagnetic signals may also be produced. Modeling such electromagnetic counterparts of the final merger requires evolving the behavior of both gas and fields in the stron...

  6. Minimum degree and density of binary sequences

    DEFF Research Database (Denmark)

    Brandt, Stephan; Müttel, J.; Rautenbach, D.;

    2010-01-01

    For d,k∈N with k ≤ 2d, let g(d,k) denote the infimum density of binary sequences (x)∈{0,1} which satisfy the minimum degree condition σ(x+) ≥ k for all i∈Z with xi=1. We reduce the problem of computing g(d,k) to a combinatorial problem related to the generalized k-girth of a graph G which is...

  7. Reconciliation with Non-Binary Species Trees

    OpenAIRE

    Vernot, Benjamin; Stolzer, Maureen; Goldman, Aiton; Durand, Dannie

    2008-01-01

    Reconciliation extracts information from the topological incongruence between gene and species trees to infer duplications and losses in the history of a gene family. The inferred duplication-loss histories provide valuable information for a broad range of biological applications, including ortholog identification, estimating gene duplication times, and rooting and correcting gene trees. While reconciliation for binary trees is a tractable and well studied problem, there are no algorithms for...

  8. Binary dicots, a core of dicot games

    OpenAIRE

    Renault, Gabriel

    2014-01-01

    We study combinatorial games under mis\\`ere convention. Several sets of games have been considered earlier to better understand the behaviour of mis\\`ere games. We here connect several of these sets. In particular, we prove that comparison modulo binary dicot games is often the same as comparison modulo dicot games, and that equivalence modulo dicot games and modulo impartial games are the same when they are restricted to impartial games.

  9. Modified Sonine approximation for granular binary mixtures

    OpenAIRE

    Garzó, Vicente; Reyes, Francisco Vega; Montanero, José María

    2008-01-01

    We evaluate in this work the hydrodynamic transport coefficients of a granular binary mixture in $d$ dimensions. In order to eliminate the observed disagreement (for strong dissipation) between computer simulations and previously calculated theoretical transport coefficients for a monocomponent gas, we obtain explicit expressions of the seven Navier-Stokes transport coefficients with the use of a new Sonine approach in the Chapman-Enskog theory. Our new approach consists in replacing, where a...

  10. Mergers of Binary Neutron Star Systems

    Science.gov (United States)

    Motl, Patrick M.; Anderson, Matthew; Lehner, Luis; Liebling, Steven; Neilsen, David; Palenzuela, Carlos

    2016-04-01

    We present results from fully relativistic simulations of binary neutron star mergers varying the tabular equation of state used to approximate the degenerate material and the mass ratio. The simulations incorporate both magnetic fields and the effects of neutrino cooling. In particular, we examine the amount and properties of material ejected from the merger. We gratefully acknowledge the support of NASA through the Astrophysics Theory Program grant NNX13AH01G.

  11. Dynamics of phase separation of binary fluids

    Science.gov (United States)

    Ma, Wen-Jong; Maritan, Amos; Banavar, Jayanth R.; Koplik, Joel

    1992-01-01

    The results of molecular-dynamics studies of surface-tension-dominated spinodal decomposition of initially well-mixed binary fluids in the absence and presence of gravity are presented. The growth exponent for the domain size and the decay exponent of the potential energy of interaction between the two species with time are found to be 0.6 +/- 0.1, inconsistent with scaling arguments based on dimensional analysis.

  12. The Binary Choice Approach of Laffer Curve

    OpenAIRE

    Mihai Mutascu

    2012-01-01

    The paper analyzes empirically, based on “Laffer effects”, in Romania’s case, the relationship between tax revenues (dependent variable) and tax rates (independent variables). The analysis is based on the construction of a binary choice model (Linear Probit Model) and the data set is covering the period 1999 - 2009 (first trimester), with quarterly frequency. The main results show that the two “Laffer effects” have a different probability of existence. If the government knows which the maximu...

  13. Pressure effects in multiphase binary diffusion couples

    Science.gov (United States)

    Subramanyam, Dilip; Notis, Michael R.; Goldstein, Joseph I.

    1985-04-01

    A systematic study has been carried out of the effect of pressure upon growth kinetics of intermediate phases formed in diffusion couples in the binary systems Ni-Al, U-A1, and U-Cu. Even though applied pressures greater than 100 MPa and long times were investigated little or no pressure effect was observed, in disagreement with previous literature reports. The magnitude of observed pressure effects falls within that expected by closure of Kirkendall porosity.

  14. Relativistic apsidal motion in eccentric eclipsing binaries

    Czech Academy of Sciences Publication Activity Database

    Wolf, M.; Claret, L.; Kotková, Lenka; Kučáková, H.; Kocián, R.; Brát, L.; Svoboda, P.; Šmelcer, L.

    2010-01-01

    Roč. 509, January (2010), A18/1-A18/14. ISSN 0004-6361 Grant ostatní: GA ČR(CZ) GA205/04/2063; GA ČR(CZ) GA205/06/0217 Institutional research plan: CEZ:AV0Z10030501 Keywords : binaries eclipsing Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.410, year: 2010

  15. Binary magnetic structures in HoEr

    DEFF Research Database (Denmark)

    Howard, B.K.; Bohr, J.

    observed between 104 K and 47.5 K is a binary magnetic structure where the holmium and erbium moments belong to different modulated c-axis spirals. The intermediate-temperature phase between 47.5 K and 35 K is a simple basal plane spiral. Below 35 K, the measurements suggest a ferrimagnetic structure in...... which the holmium and erbium moments are indistinguishable and form a conical sprial with a half-cone angle of 20-degrees....

  16. Outbursts in ultracompact X-ray binaries

    CERN Document Server

    Hameury, J -M

    2016-01-01

    Very faint X-ray binaries appear to be transient in many cases with peak luminosities much fainter than that of usual soft X-ray transients, but their nature still remains elusive. We investigate the possibility that this transient behaviour is due to the same thermal/viscous instability which is responsible for outbursts of bright soft X-ray transients, occurring in ultracompact binaries for adequately low mass-transfer rates. More generally, we investigate the observational consequences of this instability when it occurs in ultracompact binaries. We use our code for modelling the thermal-viscous instability of the accretion disc, assumed here to be hydrogen poor. We also take into account the effects of disc X-ray irradiation, and consider the impact of the mass-transfer rate on the outburst brightness. We find that one can reproduce the observed properties of both the very faint and the brighter short transients (peak luminosity, duration, recurrence times), provided that the viscosity parameter in quiesce...

  17. A radio pulsing white dwarf binary star

    CERN Document Server

    Marsh, T R; Hümmerich, S; Hambsch, F -J; Bernhard, K; Lloyd, C; Breedt, E; Stanway, E R; Steeghs, D T; Parsons, S G; Toloza, O; Schreiber, M R; Jonker, P G; van Roestel, J; Kupfer, T; Pala, A F; Dhillon, V S; Hardy, L K; Littlefair, S P; Aungwerojwit, A; Arjyotha, S; Koester, D; Bochinski, J J; Haswell, C A; Frank, P; Wheatley, P J

    2016-01-01

    White dwarfs are compact stars, similar in size to Earth but ~200,000 times more massive. Isolated white dwarfs emit most of their power from ultraviolet to near-infrared wavelengths, but when in close orbits with less dense stars, white dwarfs can strip material from their companions, and the resulting mass transfer can generate atomic line and X-ray emission, as well as near- and mid-infrared radiation if the white dwarf is magnetic. However, even in binaries, white dwarfs are rarely detected at far-infrared or radio frequencies. Here we report the discovery of a white dwarf / cool star binary that emits from X-ray to radio wavelengths. The star, AR Scorpii (henceforth AR Sco), was classified in the early 1970s as a delta-Scuti star, a common variety of periodic variable star. Our observations reveal instead a 3.56 hr period close binary, pulsing in brightness on a period of 1.97 min. The pulses are so intense that AR Sco's optical flux can increase by a factor of four within 30 s, and they are detectable a...

  18. Spinodal decomposition of chemically reactive binary mixtures

    Science.gov (United States)

    Lamorgese, A.; Mauri, R.

    2016-08-01

    We simulate the influence of a reversible isomerization reaction on the phase segregation process occurring after spinodal decomposition of a deeply quenched regular binary mixture, restricting attention to systems wherein material transport occurs solely by diffusion. Our theoretical approach follows a diffuse-interface model of partially miscible binary mixtures wherein the coupling between reaction and diffusion is addressed within the frame of nonequilibrium thermodynamics, leading to a linear dependence of the reaction rate on the chemical affinity. Ultimately, the rate for an elementary reaction depends on the local part of the chemical potential difference since reaction is an inherently local phenomenon. Based on two-dimensional simulation results, we express the competition between segregation and reaction as a function of the Damköhler number. For a phase-separating mixture with components having different physical properties, a skewed phase diagram leads, at large times, to a system converging to a single-phase equilibrium state, corresponding to the absolute minimum of the Gibbs free energy. This conclusion continues to hold for the critical phase separation of an ideally perfectly symmetric binary mixture, where the choice of final equilibrium state at large times depends on the initial mean concentration being slightly larger or less than the critical concentration.

  19. A field guide to the binary stars

    Science.gov (United States)

    Trimble, V.

    1983-05-01

    Details and examples of the six phases of existence for a binary star system are described. The birth and pre-main-sequence contraction is generally obscured from observation by the presence of gas and dust clouds; it comprises 1/1000th of a system's lifetime. The main sequence, i.e., hydrogen burning, takes up to 90 pct of a star's lifetime, and has been detected in stars with masses ranging from 0.07-32 solar masses. In binary systems, the main sequence stars may or may not interact, or one companion may burn out before the other leaves the main sequence. The primary in a binary system expands to fill its Roche lobe before mass transfer begins, then continues on a Kelvin-Helmholtz time scale until the primary is smaller than the secondary, when transfer proceeds on a nuclear time scale. The depletion of hydrogen fuel or He ignition stops the mass transfer, leading to formation of a white dwarf, neutron star, or supernova that sends both the neutron star and the OB secondary off at high speeds. Back transfer can be initiated in a fifth phase and can produce black holes or dwarf novae, or supernovae. Finally, the system terminates when both stars are extinguished and fall into one another, which can also yield supernovae or black holes.

  20. On the binary expansions of algebraic numbers

    Energy Technology Data Exchange (ETDEWEB)

    Bailey, David H.; Borwein, Jonathan M.; Crandall, Richard E.; Pomerance, Carl

    2003-07-01

    Employing concepts from additive number theory, together with results on binary evaluations and partial series, we establish bounds on the density of 1's in the binary expansions of real algebraic numbers. A central result is that if a real y has algebraic degree D > 1, then the number {number_sign}(|y|, N) of 1-bits in the expansion of |y| through bit position N satisfies {number_sign}(|y|, N) > CN{sup 1/D} for a positive number C (depending on y) and sufficiently large N. This in itself establishes the transcendency of a class of reals {summation}{sub n{ge}0} 1/2{sup f(n)} where the integer-valued function f grows sufficiently fast; say, faster than any fixed power of n. By these methods we re-establish the transcendency of the Kempner--Mahler number {summation}{sub n{ge}0}1/2{sup 2{sup n}}, yet we can also handle numbers with a substantially denser occurrence of 1's. Though the number z = {summation}{sub n{ge}0}1/2{sup n{sup 2}} has too high a 1's density for application of our central result, we are able to invoke some rather intricate number-theoretical analysis and extended computations to reveal aspects of the binary structure of z{sup 2}.

  1. A Gray path on binary partitions

    CERN Document Server

    Colthurst, Thomas

    2009-01-01

    A binary partition of a positive integer $n$ is a partition of $n$ in which each part has size a power of two. In this note we first construct a Gray sequence on the set of binary partitions of $n$. This is an ordering of the set of binary partitions of each $n$ (or of all $n$) such that adjacent partitions differ by one of a small set of elementary transformations; here the allowed transformatios are replacing $2^k+2^k$ by $2^{k+1}$ or vice versa (or addition of a new +1). Next we give a purely local condition for finding the successor of any partition in this sequence; the rule is so simple that successive transitions can be performed in constant time. Finally we show how to compute directly the bijection between $k$ and the $k$th term in the sequence. This answers a question posed by Donald Knuth in section 7.2.1 of The Art of Computer Programming.

  2. Circumstellar disks around binary stars in Taurus

    International Nuclear Information System (INIS)

    We have conducted a survey of 17 wide (>100 AU) young binary systems in Taurus with the Atacama Large Millimeter Array (ALMA) at two wavelengths. The observations were designed to measure the masses of circumstellar disks in these systems as an aid to understanding the role of multiplicity in star and planet formation. The ALMA observations had sufficient resolution to localize emission within the binary system. Disk emission was detected around all primaries and 10 secondaries, with disk masses as low as 10–4 M ☉. We compare the properties of our sample to the population of known disks in Taurus and find that the disks from this binary sample match the scaling between stellar mass and millimeter flux of Fmm∝M∗1.5--2.0 to within the scatter found in previous studies. We also compare the properties of the primaries to those of the secondaries and find that the secondary/primary stellar and disk mass ratios are not correlated; in three systems, the circumsecondary disk is more massive than the circumprimary disk, counter to some theoretical predictions.

  3. Circumstellar disks around binary stars in Taurus

    Energy Technology Data Exchange (ETDEWEB)

    Akeson, R. L. [NASA Exoplanet Science Institute, IPAC/Caltech, Pasadena, CA 91125 (United States); Jensen, E. L. N. [Swarthmore College, Department of Physics and Astronomy, Swarthmore, PA 19081 (United States)

    2014-03-20

    We have conducted a survey of 17 wide (>100 AU) young binary systems in Taurus with the Atacama Large Millimeter Array (ALMA) at two wavelengths. The observations were designed to measure the masses of circumstellar disks in these systems as an aid to understanding the role of multiplicity in star and planet formation. The ALMA observations had sufficient resolution to localize emission within the binary system. Disk emission was detected around all primaries and 10 secondaries, with disk masses as low as 10{sup –4} M {sub ☉}. We compare the properties of our sample to the population of known disks in Taurus and find that the disks from this binary sample match the scaling between stellar mass and millimeter flux of F{sub mm}∝M{sub ∗}{sup 1.5--2.0} to within the scatter found in previous studies. We also compare the properties of the primaries to those of the secondaries and find that the secondary/primary stellar and disk mass ratios are not correlated; in three systems, the circumsecondary disk is more massive than the circumprimary disk, counter to some theoretical predictions.

  4. Binary progenitor models of type IIb supernovae

    CERN Document Server

    Claeys, J S W; Pols, O R; Eldridge, J J; Baes, M

    2011-01-01

    Massive stars that lose their hydrogen-rich envelope down to a few tenths of a solar mass explode as extended type IIb supernovae, an intriguing subtype that links the hydrogen-rich type II supernovae with the hydrogen-poor type Ib and Ic. The progenitors may be very massive single stars that lose their envelope due to their stellar wind, but mass stripping due to interaction with a companion star in a binary system is currently considered to be the dominant formation channel. We computed an extensive grid of binary models with the Eggleton binary evolution code. The predicted rate from our standard models, which assume conservative mass transfer, is about 6 times smaller than the current rate indicated by observations. It is larger but still comparable to the rate expected from single stars. To recover the observed rate we must generously allow for uncertainties and low accretion efficiencies in combination with limited angular momentum loss from the system. Motivated by the claims of detection and non-detec...

  5. Observational signatures of binary supermassive black holes

    International Nuclear Information System (INIS)

    Observations indicate that most massive galaxies contain a supermassive black hole, and theoretical studies suggest that when such galaxies have a major merger, the central black holes will form a binary and eventually coalesce. Here we discuss two spectral signatures of such binaries that may help distinguish them from ordinary active galactic nuclei. These signatures are expected when the mass ratio between the holes is not extreme and the system is fed by a circumbinary disk. One such signature is a notch in the thermal continuum that has been predicted by other authors; we point out that it should be accompanied by a spectral revival at shorter wavelengths and also discuss its dependence on binary properties such as mass, mass ratio, and separation. In particular, we note that the wavelength λ n at which the notch occurs depends on these three parameters in such a way as to make the number of systems displaying these notches ∝λn16/3; longer wavelength searches are therefore strongly favored. A second signature, first discussed here, is hard X-ray emission with a Wien-like spectrum at a characteristic temperature ∼100 keV produced by Compton cooling of the shock generated when streams from the circumbinary disk hit the accretion disks around the individual black holes. We investigate the observability of both signatures. The hard X-ray signal may be particularly valuable as it can provide an indicator of black hole merger a few decades in advance of the event.

  6. On the Neutron Star-Black Hole Binaries Produced by Binary-driven Hypernovae

    CERN Document Server

    Fryer, C L; Rueda, J A; Ruffini, R

    2015-01-01

    Binary-driven hypernovae (BdHNe) following the induced gravitational collapse (IGC) paradigm have been introduced to explain the concomitance of energetic long gamma-ray bursts (GRBs) with type Ic supernovae. The progenitor system is a tight binary system composed of a carbon-oxygen (CO) core and a neutron star (NS) companion. The supernova ejecta of the exploding CO core triggers a hypercritical accretion process onto the NS, which in a few seconds reach the NS critical mass, and gravitationally collapses to a black hole (BH) emitting a GRB. These tight binary systems evolve through the supernova explosion very differently than compact binary progenitors studied in population synthesis calculations. First, the hypercritical accretion onto the NS companion alters both the mass and momentum of the binary. Second, because the explosion timescale is on par with the orbital period, the mass ejection can not be assumed to be instantaneous. Finally, the bow shock created as the accreting NS plows through the supern...

  7. A Survey Design for a Sensitive Binary Variable Correlated with Another Nonsensitive Binary Variable

    Directory of Open Access Journals (Sweden)

    Jun-Wu Yu

    2013-01-01

    Full Text Available Tian et al. (2007 introduced a so-called hidden sensitivity model for evaluating the association of two sensitive questions with binary outcomes. However, in practice, we sometimes need to assess the association between one sensitive binary variable (e.g., whether or not a drug user, the number of sex partner being ⩽1 or >1, and so on and one nonsensitive binary variable (e.g., good or poor health status, with or without cervical cancer, and so on. To address this issue, by sufficiently utilizing the information contained in the non-sensitive binary variable, in this paper, we propose a new survey scheme, called combination questionnaire design/model, which consists of a main questionnaire and a supplemental questionnaire. The introduction of the supplemental questionnaire which is indeed a design of direct questioning can effectively reduce the noncompliance behavior since more respondents will not be faced with the sensitive question. Likelihood-based inferences including maximum likelihood estimates via the expectation-maximization algorithm, asymptotic confidence intervals, and bootstrap confidence intervals of parameters of interest are derived. A likelihood ratio test is provided to test the association between the two binary random variables. Bayesian inferences are also discussed. Simulation studies are performed, and a cervical cancer data set in Atlanta is used to illustrate the proposed methods.

  8. The formation of eccentric compact binary inspirals and the role of gravitational wave emission in binary-single stellar encounters

    Energy Technology Data Exchange (ETDEWEB)

    Samsing, Johan [Dark Cosmology Centre, Niels Bohr Institute, University of Copenhagen, Juliane Maries Vej 30, DK-2100 Copenhagen (Denmark); MacLeod, Morgan; Ramirez-Ruiz, Enrico [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States)

    2014-03-20

    The inspiral and merger of eccentric binaries leads to gravitational waveforms distinct from those generated by circularly merging binaries. Dynamical environments can assemble binaries with high eccentricity and peak frequencies within the LIGO band. In this paper, we study binary-single stellar scatterings occurring in dense stellar systems as a source of eccentrically inspiraling binaries. Many interactions between compact binaries and single objects are characterized by chaotic resonances in which the binary-single system undergoes many exchanges before reaching a final state. During these chaotic resonances, a pair of objects has a non-negligible probability of experiencing a very close passage. Significant orbital energy and angular momentum are carried away from the system by gravitational wave (GW) radiation in these close passages, and in some cases this implies an inspiral time shorter than the orbital period of the bound third body. We derive the cross section for such dynamical inspiral outcomes through analytical arguments and through numerical scattering experiments including GW losses. We show that the cross section for dynamical inspirals grows with increasing target binary semi-major axis a and that for equal-mass binaries it scales as a {sup 2/7}. Thus, we expect wide target binaries to predominantly contribute to the production of these relativistic outcomes. We estimate that eccentric inspirals account for approximately 1% of dynamically assembled non-eccentric merging binaries. While these events are rare, we show that binary-single scatterings are a more effective formation channel than single-single captures for the production of eccentrically inspiraling binaries, even given modest binary fractions.

  9. Synthesis and characterizations of water-based ferrofluids of substituted ferrites [Fe1-xBxFe2O4, B=Mn, Co (x=0-1)] for biomedical applications

    International Nuclear Information System (INIS)

    Nanomagnetic particles have great potential in the biomedical applications like MRI contrast enhancement, magnetic separation, targeting delivery and hyperthermia. In this paper, we have explored the possibility of biomedical applications of [Fe1-xBxFe2O4, B=Mn, Co] ferrite. Superparamagnetic particles of substituted ferrites [Fe1-xBxFe2O4, B=Mn, Co (x=0-1)] and their fatty acid coated water base ferrofluids have been successfully prepared by co-precipitation technique using NH4OH/TMAH (Tetramethylammonium hydroxide) as base. In vitro cytocompatibility study of different magnetic fluids was done using HeLa (human cervical carcinoma) cell lines. Co2+-substituted ferrite systems (e.g. CoFe2O4) is more toxic than Mn2+-substituted ferrite systems (e.g. MnFe2O4, Fe0.6Mn0.4Fe2O4). The later is as cytocompatible as Fe3O4. Thus, Fe1-xMnxFe2O4 could be useful in biomedical applications like MRI contrast agent and hyperthermia treatment of cancer

  10. Learning Compact Binary Face Descriptor for Face Recognition.

    Science.gov (United States)

    Lu, Jiwen; Liong, Venice Erin; Zhou, Xiuzhuang; Zhou, Jie

    2015-10-01

    Binary feature descriptors such as local binary patterns (LBP) and its variations have been widely used in many face recognition systems due to their excellent robustness and strong discriminative power. However, most existing binary face descriptors are hand-crafted, which require strong prior knowledge to engineer them by hand. In this paper, we propose a compact binary face descriptor (CBFD) feature learning method for face representation and recognition. Given each face image, we first extract pixel difference vectors (PDVs) in local patches by computing the difference between each pixel and its neighboring pixels. Then, we learn a feature mapping to project these pixel difference vectors into low-dimensional binary vectors in an unsupervised manner, where 1) the variance of all binary codes in the training set is maximized, 2) the loss between the original real-valued codes and the learned binary codes is minimized, and 3) binary codes evenly distribute at each learned bin, so that the redundancy information in PDVs is removed and compact binary codes are obtained. Lastly, we cluster and pool these binary codes into a histogram feature as the final representation for each face image. Moreover, we propose a coupled CBFD (C-CBFD) method by reducing the modality gap of heterogeneous faces at the feature level to make our method applicable to heterogeneous face recognition. Extensive experimental results on five widely used face datasets show that our methods outperform state-of-the-art face descriptors. PMID:26340256

  11. Merging binary black holes formed through chemically homogeneous evolution in short-period stellar binaries

    CERN Document Server

    Mandel, Ilya

    2016-01-01

    We explore a newly proposed channel to create binary black holes of stellar origin. This scenario applies to massive, tight binaries where mixing induced by rotation and tides transports the products of hydrogen burning throughout the stellar envelopes. This slowly enriches the entire star with helium, preventing the build-up of an internal chemical gradient. The stars remain compact as they evolve nearly chemically homogeneously, eventually forming two black holes, which, we estimate, typically merge 4 to 11 Gyr after formation. Like other proposed channels, this evolutionary pathway suffers from significant theoretical uncertainties, but could be constrained in the near future by data from advanced ground-based gravitational-wave detectors. We perform Monte Carlo simulations of the expected merger rate over cosmic time to explore the implications and uncertainties. Our default model for this channel yields a local binary black hole merger rate of about $10$ Gpc$^{-3}$ yr$^{-1}$ at redshift $z=0$, peaking at...

  12. A precontact binary and a shallow contact binary are in the same field

    Science.gov (United States)

    Liu, Liang; Qian, Shengbang; He, Jiajia; Liao, Wenping; Liu, Nianping

    2016-06-01

    The period changes of two close binaries, V1107 Cas and AX Cas, which are in the same field, were investigated. Their periods both show a long-term decrease. After further analysis, we found that the periods have their respective cyclic oscillations (T3 = 6.74 ± 0.24 yr for V1107 Cas and T3 = 13.8 ± 0.3 yr for AX Cas), which are possibly caused by a third body due to the light-time effect. We also obtained the complete VRcIc light curves for V1107 Cas and analyzed them with the 2010 version of the Wilson-Devinney code. The photometric results reveal that V1107 Cas is a W-type shallow contact (15.2%±1.8%) binary, with a mass-ratio of 1.797 ± 0.006. The period variation and photometric solution suggest that V1107 Cas is a newly formed contact binary system. Moreover, we estimated the fundamental parameters for V1107 Cas. They are: M1 = 0.39 ± 0.01 M⊙, M2 = 0.70 ± 0.03 M⊙, R1 = 0.52 ± 0.10 R⊙, R2 = 0.68 ± 0.12 R⊙, L1 = 0.178 ± 0.108 L⊙, and L2 = 0.196 ± 0.116 L⊙. Then, based on the coplane assumption, we deduced the masses of possible third bodies to be M3 = 0.091 ± 0.019 M⊙ for V1107 Cas and M3 = 0.325 ± 0.029 M⊙ for AX Cas. Finally, we inferred the evolutional stage of AX Cas, and believe that it is a precontact binary. Thus, the precontact binary AX Cas and the shallow contact binary V1107 Cas have adjoining evolutional stages.

  13. Properties of eclipsing binaries from all-sky surveys - I. Detached eclipsing binaries in ASAS, NSVS, and LINEAR

    Science.gov (United States)

    Lee ( ), Chien-Hsiu

    2015-11-01

    Eclipsing binaries provide a unique opportunity to measure fundamental properties of stars. With the advent of all-sky surveys, thousands of eclipsing binaries have been reported, yet their light curves are not fully exploited. The goal of this work is to make use of the eclipsing binary light curves delivered by all-sky surveys. We attempt to extract physical parameters of the binary systems from their light curves and colour. Inspired by the work of Devor et al., we use the Detached Eclipsing Binary Light curve fitter (DEBIL) and the Method for Eclipsing Component Identification (MECI) to derive basic properties of the binary systems reported by the All Sky Automated Survey, the Northern Sky Variability Survey, and the Lincoln Near Earth Asteroids Research. We derive the mass, fractional radius, and age for 783 binary systems. We report a subsample of eccentric systems and compare their properties to the tidal circularization theory. With MECI, we are able to estimate the distance of the eclipsing binary systems and use them to probe the structure of the Milky Way. Following the approach of Devor et al., we demonstrate that DEBIL and MECI are instrumental to investigate eclipsing binary light curves in the era of all-sky surveys, and provide estimates of stellar parameters of both binary components without spectroscopic information.

  14. Binary pairs of supermassive black holes - Formation in merging galaxies

    International Nuclear Information System (INIS)

    A process in which supermassive binary blackholes are formed in nuclei of supergiant galaxies due to galaxy mergers is examined. There is growing evidence that mergers of galaxies are common and that supermassive black holes in center of galaxies are also common. Consequently, it is expected that binary black holes should arise in connection with galaxy mergers. The merger process in a galaxy modeled after M87 is considered. The capture probability of a companion is derived as a function of its mass. Assuming a correlation between the galaxy mass and the blackholes mass, the expected mass ratio in binary black holes is calculated. The binary black holes formed in this process are long lived, surviving longer than the Hubble time unless they are perturbed by black holes from successive mergers. The properties of these binaries agree with Gaskell's (1988) observational work on quasars and its interpretation in terms of binary black holes. 39 refs

  15. Binary pulsar evolution: unveiled links and new species

    Science.gov (United States)

    Possenti, Andrea

    2013-03-01

    In the last years a series of blind and/or targeted pulsar searches led to almost triple the number of known binary pulsars in the galactic field with respect to a decade ago. The focus will be on few outliers, which are emerging from the average properties of the enlarged binary pulsar population. Some of them may represent the long sought missing links between two kinds of neutron star binaries, while others could represent the stereotype of new groups of binaries, resulting from an evolutionary path which is more exotic than those considered until recently. In particular, a new class of binaries, which can be dubbed Ultra Low Mass Binary Pulsars (ULMBPs), is emerging from recent data.

  16. Microlensing Binaries Discovered through High-magnification Channel

    DEFF Research Database (Denmark)

    Shin, I.-G.; Choi, J.-Y.; Park, S.-Y.;

    2012-01-01

    Microlensing can provide a useful tool to probe binary distributions down to low-mass limits of binary companions. In this paper, we analyze the light curves of eight binary-lensing events detected through the channel of high-magnification events during the seasons from 2007 to 2010. The perturba......Microlensing can provide a useful tool to probe binary distributions down to low-mass limits of binary companions. In this paper, we analyze the light curves of eight binary-lensing events detected through the channel of high-magnification events during the seasons from 2007 to 2010...... of the event OGLE-2008-BLG-510/MOA-2008-BLG-369 is q ~ 0.1, making the companion of the lens a strong brown dwarf candidate....

  17. Milankovitch Cycles of Terrestrial Planets in Binary Star Systems

    CERN Document Server

    Forgan, Duncan H

    2016-01-01

    The habitability of planets in binary star systems depends not only on the radiation environment created by the two stars, but also on the perturbations to planetary orbits and rotation produced by the gravitational field of the binary and neighbouring planets. Habitable planets in binaries may therefore experience significant perturbations in orbit and spin. The direct effects of orbital resonances and secular evolution on the climate of binary planets remain largely unconsidered. We present latitudinal energy balance modelling of exoplanet climates with direct coupling to an N Body integrator and an obliquity evolution model. This allows us to simultaneously investigate the thermal and dynamical evolution of planets orbiting binary stars, and discover gravito-climatic oscillations on dynamical and secular timescales. We investigate the Kepler-47 and Alpha Centauri systems as archetypes of P and S type binary systems respectively. In the first case, Earthlike planets would experience rapid Milankovitch cycle...

  18. Distinguishing Between Formation Channels for Binary Black Holes with LISA

    CERN Document Server

    Breivik, Katelyn; Larson, Shane L; Kalogera, Vassiliki; Rasio, Frederic A

    2016-01-01

    The recent detections of GW150914 and GW151226 imply an abundance of stellar-mass binary-black-hole mergers in the local universe. While ground-based gravitational-wave detectors are limited to observing the final moments before a binary merges, space-based detectors, such as the Laser Interferometer Space Antenna (LISA), can observe binaries at lower orbital frequencies where such systems may still encode information about their formation histories. In particular, the orbital eccentricity of binary black holes in the LISA frequency band can be used discriminate between binaries formed in isolation in galactic fields, and those formed in dense stellar environments such as globular clusters. In this letter, we explore the differences in orbital eccentricities of binary black hole populations as they evolve through the LISA frequency band. Overall we find that there are three distinct populations of orbital eccentricities discernible by LISA. We show that, depending on gravitational-wave frequency, anywhere fro...

  19. Nonlinear Dynamics, Lorenz Model and Formation of Binary Stars

    OpenAIRE

    Chang, Yi-Fang

    2008-01-01

    Based on the Lorenz model derived from the equations of hydrodynamics of nebula, we discuss the formation of binary stars by the qualitative analysis theory of nonlinear equation. Here the two wings in the Lorenz model form just the binary stars, whose Roche surface is result of evolution under certain condition. The nonlinear interaction plays a crucial role, and is necessary condition of the formation of binary stars and of multiple stars. While the linear equations form only a single star....

  20. On the formation of Be stars through binary interaction

    OpenAIRE

    Shao, Yong; Li, Xiang-Dong

    2014-01-01

    Be stars are rapidly rotating B type stars. The origin of their rapid rotation is not certain, but binary interaction remains to be a possibility. In this work we investigate the formation of Be stars resulting from mass transfer in binaries in the Galaxy. We calculate the binary evolution with both stars evolving simultaneously and consider different possible mass accretion histories for the accretor. From the calculated results we obtain the critical mass ratios $q_{\\rm cr}$ that determine ...

  1. Magnetic Interaction in Ultra-compact Binary Systems

    CERN Document Server

    Wu, Kinwah

    2009-01-01

    This article reviews the current works on ultra-compact double-degenerate binaries in the presence of magnetic interaction, in particular, unipolar induction. The orbital dynamics and evolution of compact white-dwarf pairs are discussed in detail. Models and predictions of electron cyclotron masers from unipolar-inductor compact binaries and unipolar-inductor white-dwarf planetary systems are presented. Einstein-Laub effects in compact binaries are briefly discussed.

  2. Magnetic interaction in ultra-compact binary systems

    Institute of Scientific and Technical Information of China (English)

    Kinwah WU

    2009-01-01

    This article reviews the current works on ultra-compact double-degenerate binaries in the presence of magnetic interaction, in particular, unipolar induction. The orbital dynamics and evolution of compact white-dwarf pairs are discussed in detail. Models and predictions of electron cyclotron masers from unipolar-inductor compact binaries and unipolar-inductor white-dwarf planetary systems are presented. Einstein-Laub effects in compact binaries are briefly discussed.

  3. Automatic classification of eclipsing binaries light curves using neural networks

    CERN Document Server

    Sarro, L M; Giménez, A

    2005-01-01

    In this work we present a system for the automatic classification of the light curves of eclipsing binaries. This system is based on a classification scheme that aims to separate eclipsing binary sistems according to their geometrical configuration in a modified version of the traditional classification scheme. The classification is performed by a Bayesian ensemble of neural networks trained with {\\em Hipparcos} data of seven different categories including eccentric binary systems and two types of pulsating light curve morphologies.

  4. How I Learned to Stop Worrying and Love Eclipsing Binaries

    OpenAIRE

    Moe, Maxwell

    2015-01-01

    Relatively massive B-type stars with closely orbiting stellar companions can evolve to produce Type Ia supernovae, X-ray binaries, millisecond pulsars, mergers of neutron stars, gamma ray bursts, and sources of gravitational waves. However, the formation mechanism, intrinsic frequency, and evolutionary processes of B-type binaries are poorly understood. As of 2012, the binary statistics of massive stars had not been measured at low metallicities, extreme mass ratios, or intermediate orbital ...

  5. NEW BINARY PARTICLE SWARM OPTIMIZATION WITH IMMUNITY-CLONAL ALGORITHM

    OpenAIRE

    Dina EL-Gammal; Amr Badr; Mostafa Abd El Azeim

    2013-01-01

    Particle Swarm Optimization used to solve a continuous problem and has been shown to perform well however, binary version still has some problems. In order to solve these problems a new technique called New Binary Particle Swarm Optimization using Immunity-Clonal Algorithm (NPSOCLA) is proposed This Algorithm proposes a new updating strategy to update the position vector in Binary Particle Swarm Optimization (BPSO), which further combined with Immunity-Clonal Algorithm to improve the optimiza...

  6. Information Measures: the Curious Case of the Binary Alphabet

    OpenAIRE

    Jiao, Jiantao; Courtade, Thomas; No, Albert; Venkat, Kartik; Weissman, Tsachy

    2014-01-01

    Four problems related to information divergence measures defined on finite alphabets are considered. In three of the cases we consider, we illustrate a contrast which arises between the binary-alphabet and larger-alphabet settings. This is surprising in some instances, since characterizations for the larger-alphabet settings do not generalize their binary-alphabet counterparts. Specifically, we show that $f$-divergences are not the unique decomposable divergences on binary alphabets that sati...

  7. Simple methods for evaluating and comparing binary experiments

    OpenAIRE

    Thomas A. Weber

    2010-01-01

    We consider a confidence parametrization of binary information sources in terms of appropriate likelihood ratios. This parametrization is used for Bayesian belief updates and for the equivalent comparison of binary experiments. In contrast to the standard parametrization of a binary information source in terms of its specificity and its sensitivity, one of the two confidence parameters is sufficient for a Bayesian belief update conditional on a signal realization. We introduce a confidence-au...

  8. Segregation phases in a vibrated binary granular layer

    OpenAIRE

    Reis, P. M.; Ehrhardt, G.; Mullin, T.

    2003-01-01

    We present the results of an experimental study of patterned segregation in a horizontally shaken shallow layer of a binary mixture of dry particles. As the compacity, $C$, of the mixture was increased, the evolution of three distinct phases was observed. We classify them as binary gas, segregation liquid and segregation crystal phases using macroscopic and microscopic measures. The binary gas to segregation liquid transition is consistent with a continuous phase transition and includes the c...

  9. Geographically Weighted Local Statistics Applied to Binary Data

    OpenAIRE

    Brunsdon, Chris; Fotheringham, Stewart; Charlton, Martin

    2002-01-01

    This paper considers the application of geographically weighting to summary statistics for binary data. We argue that geographical smoothing techniques that are applied to descriptive statistics for ratio and interval scale data may also be applied to descriptive statistics for binary categorical data. Here we outline how this may be done, focussing attention on the odds ratio statistic used for summarising the linkage between a pair of binary variables. An example of this is applied to data ...

  10. Asymptotic bound on binary self-orthogonal codes

    Institute of Scientific and Technical Information of China (English)

    DING Yang

    2009-01-01

    We present two constructions for binary self-orthogonal codes. It turns out that our constructions yield a constructive bound on binary self-orthogonal codes. In particular, when the in-formation rate R = 1/2, by our constructive lower bound, the relative minimum distance δ≈ 0.0595 (for GV bound, δ≈0.110). Moreover, we have proved that the binary self-orthogonal codes asymptotically achieve the Gilbert-Varshamov bound.

  11. Asymptotic bound on binary self-orthogonal codes

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    We present two constructions for binary self-orthogonal codes. It turns out that our constructions yield a constructive bound on binary self-orthogonal codes. In particular, when the in-formation rate R = 1/2, by our constructive lower bound, the relative minimum distance δ≈ 0.0595 (for GV bound, δ≈ 0.110). Moreover, we have proved that the binary self-orthogonal codes asymptotically achieve the Gilbert-Varshamov bound.

  12. Evolution of a ring around the Pluto-Charon binary

    OpenAIRE

    Bromley, B. C.; Kenyon, S J

    2015-01-01

    We consider the formation of satellites around the Pluto-Charon binary. An early collision between the two partners likely produced the binary and a narrow ring of debris, out of which arose the moons Styx, Nix, Kerberos and Hydra. How the satellites emerged from the compact ring is uncertain. Here we show that a particle ring spreads from physical collisions and collective gravitational scattering, similar to migration. Around a binary, these processes take place in the reference frames of "...

  13. Improving geothermal power plants with a binary cycle

    Science.gov (United States)

    Tomarov, G. V.; Shipkov, A. A.; Sorokina, E. V.

    2015-12-01

    The recent development of binary geothermal technology is analyzed. General trends in the introduction of low-temperature geothermal sources are summarized. The use of single-phase low-temperature geothermal fluids in binary power plants proves possible and expedient. The benefits of power plants with a binary cycle in comparison with traditional systems are shown. The selection of the working fluid is considered, and the influence of the fluid's physicochemical properties on the design of the binary power plant is discussed. The design of binary power plants is based on the chemical composition and energy potential of the geothermal fluids and on the landscape and climatic conditions at the intended location. Experience in developing a prototype 2.5 MW Russian binary power unit at Pauzhetka geothermal power plant (Kamchatka) is outlined. Most binary systems are designed individually for a specific location. Means of improving the technology and equipment at binary geothermal power plants are identified. One option is the development of modular systems based on several binary systems that employ the heat from the working fluid at different temperatures.

  14. DESTRUCTION OF BINARY MINOR PLANETS DURING NEPTUNE SCATTERING

    International Nuclear Information System (INIS)

    The existence of extremely wide binaries in the low-inclination component of the Kuiper Belt provides a unique handle on the dynamical history of this population. Some popular frameworks of the formation of the Kuiper Belt suggest that planetesimals were moved there from lower semimajor axis orbits by scattering encounters with Neptune. We test the effects such events would have on binary systems and find that wide binaries are efficiently destroyed by the kinds of scattering events required to create the Kuiper Belt with this mechanism. This indicates that a binary-bearing component of the cold Kuiper Belt was emplaced through a gentler mechanism or was formed in situ.

  15. ANNEXATION OF TWO KINDS OF SOLUTION IN BINARY METALLIC MELTS

    Institute of Scientific and Technical Information of China (English)

    J.Zhang

    2004-01-01

    After investigation on the thervnodynamic properties of a small number of binary metallic melts,the structural units of which cannot be wholly determined by the corresponding phase diagrams,it was found that they can be determined by the principle of annexation of two kinds of solutions in binary metallic melts.According to the principle of annexation,calculating models of mass action concentrations for several binary metallic melts have been formulated.The calculated results agree well with practice,showing that this principle is a reliable basis for determination of the structural units for some binary metallic melts.

  16. Binary GCD like Algorithms for Some Complex Quadratic Rings

    DEFF Research Database (Denmark)

    Agarwal, Saurabh; Frandsen, Gudmund Skovbjerg

    2004-01-01

    binary gcd like algorithms for the ring of integers in and , one now has binary gcd like algorithms for all complex quadratic Euclidean domains. The running time of our algorithms is O(n 2) in each ring. While there exists an O(n 2) algorithm for computing the gcd in quadratic number rings by Erich......On the lines of the binary gcd algorithm for rational integers, algorithms for computing the gcd are presented for the ring of integers in where . Thus a binary gcd like algorithm is presented for a unique factorization domain which is not Euclidean (case d=-19). Together with the earlier known...

  17. White-Light Flares on Close Binaries Observed with Kepler

    CERN Document Server

    Gao, Qing; Liu, Ji-Feng; Zhang, Xiao-Bin; Gao, Shuang

    2016-01-01

    Based on Kepler data, we present the results of a search for white-light flares on 1049 close binaries. We identify 234 flare binaries, on which 6818 flares are detected. We compare the flare-binary fraction in different binary morphologies ("detachedness"). The result shows that the fractions in over-contact and ellipsoidal binaries are approximately 10-20 percent lower than those in detached and semi-detached systems. We calculate the binary flares activity level (AL) of all the flare binaries, and discuss its variations along the orbital period (P_orb) and rotation period (P_rot, calculated for only detached binaries). We find that AL increases with decreasing P_orb or P_rot up to the critical values at P_orb near 3 days or P_rot near 1.5 days, thereafter, the AL starts decreasing no matter how fast the stars rotate. We examine the flaring rate as a function of orbital phase in 2 eclipsing binaries on which a large number of flares are detected. It appears that there is no correlation between flaring rate ...

  18. Electronic band structures of binary skutterudites

    International Nuclear Information System (INIS)

    The electronic properties of complex binary skutterudites, MX3 (M = Co, Rh, Ir; X = P, As, Sb) are explored, using various density functional theory (DFT) based theoretical approaches including Green's Function (GW) as well as regular and non-regular Tran Blaha modified Becke Jhonson (TB-mBJ) methods. The wide range of calculated bandgap values for each compound of this skutterudites family confirm that they are theoretically as challenging as their experimental studies. The computationally expensive GW method, which is generally assume to be efficient in the reproduction of the experimental bandgaps, is also not very successful in the calculation of bandgaps. In this article, the issue of the theoretical bandgaps of these compounds is resolved by reproducing the accurate experimental bandgaps, using the recently developed non-regular TB-mBJ approach, based on DFT. The effectiveness of this technique is due to the fact that a large volume of the binary skutterudite crystal is empty and hence quite large proportion of electrons lie outside of the atomic spheres, where unlike LDA and GGA which are poor in the treatment of these electrons, this technique properly treats these electrons and hence reproduces the clear electronic picture of these compounds. - Highlights: • Theoretical and experimental electronic band structures of binary skutterudites are reviewed. • The literature reveals that none of the existing theoretical results are consistent with the experiments. • GW, regular and non-regular TB-mBJ methods are used to reproduce the correct results. • The GW and regular TB-mBJ results are better than the available results in literature. • However, non-regular TB-mBJ reproduces the correct experimental band structures

  19. Electronic band structures of binary skutterudites

    Energy Technology Data Exchange (ETDEWEB)

    Khan, Banaras [Center for Computational Materials Science, University of Malakand, Chakdara (Pakistan); Department of Physics, University of Malakand, Chakdara (Pakistan); Aliabad, H.A. Rahnamaye [Department of Physics, Hakim Sabzevari University, Sabzevar (Iran, Islamic Republic of); Saifullah [Center for Computational Materials Science, University of Malakand, Chakdara (Pakistan); Department of Physics, University of Malakand, Chakdara (Pakistan); Jalali-Asadabadi, S. [Department of Physics, Faculty of Science, University of Isfahan (UI), 81744 Isfahan (Iran, Islamic Republic of); Khan, Imad [Center for Computational Materials Science, University of Malakand, Chakdara (Pakistan); Department of Physics, University of Malakand, Chakdara (Pakistan); Ahmad, Iftikhar, E-mail: ahma5532@gmail.com [Center for Computational Materials Science, University of Malakand, Chakdara (Pakistan); Department of Physics, University of Malakand, Chakdara (Pakistan)

    2015-10-25

    The electronic properties of complex binary skutterudites, MX{sub 3} (M = Co, Rh, Ir; X = P, As, Sb) are explored, using various density functional theory (DFT) based theoretical approaches including Green's Function (GW) as well as regular and non-regular Tran Blaha modified Becke Jhonson (TB-mBJ) methods. The wide range of calculated bandgap values for each compound of this skutterudites family confirm that they are theoretically as challenging as their experimental studies. The computationally expensive GW method, which is generally assume to be efficient in the reproduction of the experimental bandgaps, is also not very successful in the calculation of bandgaps. In this article, the issue of the theoretical bandgaps of these compounds is resolved by reproducing the accurate experimental bandgaps, using the recently developed non-regular TB-mBJ approach, based on DFT. The effectiveness of this technique is due to the fact that a large volume of the binary skutterudite crystal is empty and hence quite large proportion of electrons lie outside of the atomic spheres, where unlike LDA and GGA which are poor in the treatment of these electrons, this technique properly treats these electrons and hence reproduces the clear electronic picture of these compounds. - Highlights: • Theoretical and experimental electronic band structures of binary skutterudites are reviewed. • The literature reveals that none of the existing theoretical results are consistent with the experiments. • GW, regular and non-regular TB-mBJ methods are used to reproduce the correct results. • The GW and regular TB-mBJ results are better than the available results in literature. • However, non-regular TB-mBJ reproduces the correct experimental band structures.

  20. Observational signatures of binary supermassive black holes

    Energy Technology Data Exchange (ETDEWEB)

    Roedig, Constanze; Krolik, Julian H. [Department of Physics and Astronomy, Johns Hopkins University, Baltimore, MD 21218 (United States); Miller, M. Coleman [Department of Astronomy and Joint Space-Science Institute, University of Maryland, College Park, MD 20742 (United States)

    2014-04-20

    Observations indicate that most massive galaxies contain a supermassive black hole, and theoretical studies suggest that when such galaxies have a major merger, the central black holes will form a binary and eventually coalesce. Here we discuss two spectral signatures of such binaries that may help distinguish them from ordinary active galactic nuclei. These signatures are expected when the mass ratio between the holes is not extreme and the system is fed by a circumbinary disk. One such signature is a notch in the thermal continuum that has been predicted by other authors; we point out that it should be accompanied by a spectral revival at shorter wavelengths and also discuss its dependence on binary properties such as mass, mass ratio, and separation. In particular, we note that the wavelength λ {sub n} at which the notch occurs depends on these three parameters in such a way as to make the number of systems displaying these notches ∝λ{sub n}{sup 16/3}; longer wavelength searches are therefore strongly favored. A second signature, first discussed here, is hard X-ray emission with a Wien-like spectrum at a characteristic temperature ∼100 keV produced by Compton cooling of the shock generated when streams from the circumbinary disk hit the accretion disks around the individual black holes. We investigate the observability of both signatures. The hard X-ray signal may be particularly valuable as it can provide an indicator of black hole merger a few decades in advance of the event.

  1. Anonymizing Binary Tables is APX-hard

    CERN Document Server

    Bonizzoni, Paola; Dondi, Riccardo

    2007-01-01

    The problem of publishing personal data without giving up privacy is increasingly important. An interesting formalization is the $k$-anonymization, where all rows in a table are clustered in sets of at least $k$ records, and all the entries for which records in the same cluster have different values are suppressed. The problem has been shown to be NP-hard when the records values are over a ternary alphabet and $k=3$. In this paper we show that the problem is not only NP-hard, but also APX-hard, when the records values are over a binary alphabet and $k=3$.

  2. Astronomical Plate Archives and Binary Blazars Studies

    Czech Academy of Sciences Publication Activity Database

    Hudec, René

    2011-01-01

    Roč. 32, 1-2 (2011), s. 91-95. ISSN 0250-6335. [Conference on Multiwavelength Variability of Blazars. Guangzhou, 22,09,2010-24,09,2010] R&D Projects: GA ČR GA205/08/1207 Grant ostatní: GA ČR(CZ) GA102/09/0997; MŠMT(CZ) ME09027 Institutional research plan: CEZ:AV0Z10030501 Keywords : astronomical plates * plate archives archives * binary blazars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.400, year: 2011

  3. Statistical kinetic treatment of relativistic binary collisions.

    Science.gov (United States)

    Peano, F; Marti, M; Silva, L O; Coppa, G

    2009-02-01

    In particle-based algorithms, the effect of binary collisions is commonly described in a statistical way, using Monte Carlo techniques. It is shown that, in the relativistic regime, stringent constraints should be considered on the sampling of particle pairs for collision, which are critical to ensure physically meaningful results, and that nonrelativistic sampling criteria (e.g., uniform random pairing) yield qualitatively wrong results, including equilibrium distributions that differ from the theoretical Jüttner distribution. A general procedure for relativistically consistent algorithms is provided, and verified with three-dimensional Monte Carlo simulations, thus opening the way to the numerical exploration of the statistical properties of collisional relativistic systems. PMID:19391799

  4. 6384 Kervin: A Possible Hungaria Binary Asteroid

    Science.gov (United States)

    Warner, Brian D.; Aznar Macia, Amadeo

    2016-04-01

    Analysis of CCD photometric observations in late 2015 of the Hungaria asteroid 6384 Kervin indicates that it may be a binary asteroid with a primary lightcurve of P1 = 3.6194 ± 0.0001 h, A1 = 0.06 ± 0.01 mag. The secondary lightcurve parameters are P2 = 15.94 ± 0.01 h, A2 = 0.03 ± 0.01 mag. No mutual events (occultations or eclipses) were observed. However, other indicators give an estimated diameter ratio on the order of Ds/Dp ~ 0.3, possibly greater.

  5. Associative memory - An optimum binary neuron representation

    Science.gov (United States)

    Awwal, A. A.; Karim, M. A.; Liu, H. K.

    1989-01-01

    Convergence mechanism of vectors in the Hopfield's neural network is studied in terms of both weights (i.e., inner products) and Hamming distance. It is shown that Hamming distance should not always be used in determining the convergence of vectors. Instead, weights (which in turn depend on the neuron representation) are found to play a more dominant role in the convergence mechanism. Consequently, a new binary neuron representation for associative memory is proposed. With the new neuron representation, the associative memory responds unambiguously to the partial input in retrieving the stored information.

  6. X-ray binaries, part 1

    International Nuclear Information System (INIS)

    Optical observations of X-ray binaries and their interpretation are described. A number of early-type stars which are identified as companions of X-ray sources are photometrically and spectroscopically observed. The spectra were obtained with the coude spectrograph attached to the 1.5 m telescope of the European Southern Observatory, La Silla, Chile. Registrations of the spectra were made with the Faul-Coradi microphotometer of the Observatory at Utrecht. To study radial velocity variations, the positions of the spectral lines were measured with the Grant comparator of the University of Groningen

  7. Model for magnetic-nonmagnetic binary alloys

    Energy Technology Data Exchange (ETDEWEB)

    Razafimandimby, H. [Departement de Physique, Universite de Toliara, 601 Toliara (Madagascar); Randrianasoloharisoa, D. [LPMR, Universite d' Antananarivo (Madagascar); Rakotomahevitra, A. [Departement des Sciences Exactes, Universite de Mahajanga, BP 155 (Madagascar); Parlebas, J.C. [IPCMS, UMR 7504 CNRS-Universite Louis Pasteur, 23 rue du Loess, BP 43, 67034 Strasbourg (France)

    2007-10-15

    An extension of a mean-field approximation (MFA) developed within standard basis operators (SBO) is used to study magnetism in magnetic-nonmagnetic binary alloys. The Curie temperature is calculated from the free energy within the framework of the present approach. The calculated results are in fair agreement with the theoretical results of other research groups for the same problem but utilizing other methods. Finally, the case of NiPt alloys is briefly examined as an example test for the comparison with experiment. (copyright 2007 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  8. Is the Coma cluster binary dominated?

    International Nuclear Information System (INIS)

    It is investigated whether the model of an expanding cluster dominated by a massive binary galaxy, first suggested by Valtonen and Byrd (1979), is consistent with optical data on the surface density and velocity dispersion of the Coma cluster. The evolution of this model is simulated for a wide variety of initial conditions. It is found that galaxy counts in the model can be made to agree with observation, but that the observed velocity dispersion profile cannot be reproduced. A number of other arguments suggest that the central galaxies in Coma cannot be as massive as required by the model. This model is not a viable representation of the Coma cluster. 25 refs

  9. Double riches: asteroseismology in eclipsing binaries

    CERN Document Server

    Southworth, John

    2015-01-01

    The study of eclipsing binaries is our primary source of measured properties of normal stars, achieved through analysis of light and radial velocity curves of eclipsing systems. The study of oscillations and pulsations is increasingly vital for determining the properties of single stars, and investigating the physical phenomena active in their interiors. Combining the two methods holds the promise of establishing stringent tests of stellar evolutionary theory, and of calibrating model-dependent asteroseismology with empirically measured stellar properties. I review recent advances and outline future work.

  10. NONLINEAR TIDES IN CLOSE BINARY SYSTEMS

    International Nuclear Information System (INIS)

    We study the excitation and damping of tides in close binary systems, accounting for the leading-order nonlinear corrections to linear tidal theory. These nonlinear corrections include two distinct physical effects: three-mode nonlinear interactions, i.e., the redistribution of energy among stellar modes of oscillation, and nonlinear excitation of stellar normal modes by the time-varying gravitational potential of the companion. This paper, the first in a series, presents the formalism for studying nonlinear tides and studies the nonlinear stability of the linear tidal flow. Although the formalism we present is applicable to binaries containing stars, planets, and/or compact objects, we focus on non-rotating solar-type stars with stellar or planetary companions. Our primary results include the following: (1) The linear tidal solution almost universally used in studies of binary evolution is unstable over much of the parameter space in which it is employed. More specifically, resonantly excited internal gravity waves in solar-type stars are nonlinearly unstable to parametric resonance for companion masses M' ∼> 10-100 M⊕ at orbital periods P ≈ 1-10 days. The nearly static 'equilibrium' tidal distortion is, however, stable to parametric resonance except for solar binaries with P ∼3[P/10 days] for a solar-type star) and drives them as a single coherent unit with growth rates that are a factor of ≈N faster than the standard three-wave parametric instability. These are local instabilities viewed through the lens of global analysis; the coherent global growth rate follows local rates in the regions where the shear is strongest. In solar-type stars, the dynamical tide is unstable to this collective version of the parametric instability for even sub-Jupiter companion masses with P ∼< a month. (4) Independent of the parametric instability, the dynamical and equilibrium tides excite a wide range of stellar p-modes and g-modes by nonlinear inhomogeneous forcing

  11. Nonlinear Tides in Close Binary Systems

    Science.gov (United States)

    Weinberg, Nevin N.; Arras, Phil; Quataert, Eliot; Burkart, Josh

    2012-06-01

    We study the excitation and damping of tides in close binary systems, accounting for the leading-order nonlinear corrections to linear tidal theory. These nonlinear corrections include two distinct physical effects: three-mode nonlinear interactions, i.e., the redistribution of energy among stellar modes of oscillation, and nonlinear excitation of stellar normal modes by the time-varying gravitational potential of the companion. This paper, the first in a series, presents the formalism for studying nonlinear tides and studies the nonlinear stability of the linear tidal flow. Although the formalism we present is applicable to binaries containing stars, planets, and/or compact objects, we focus on non-rotating solar-type stars with stellar or planetary companions. Our primary results include the following: (1) The linear tidal solution almost universally used in studies of binary evolution is unstable over much of the parameter space in which it is employed. More specifically, resonantly excited internal gravity waves in solar-type stars are nonlinearly unstable to parametric resonance for companion masses M' >~ 10-100 M ⊕ at orbital periods P ≈ 1-10 days. The nearly static "equilibrium" tidal distortion is, however, stable to parametric resonance except for solar binaries with P companion masses larger than a few Jupiter masses, the dynamical tide causes short length scale waves to grow so rapidly that they must be treated as traveling waves, rather than standing waves. (3) We show that the global three-wave treatment of parametric instability typically used in the astrophysics literature does not yield the fastest-growing daughter modes or instability threshold in many cases. We find a form of parametric instability in which a single parent wave excites a very large number of daughter waves (N ≈ 103[P/10 days] for a solar-type star) and drives them as a single coherent unit with growth rates that are a factor of ≈N faster than the standard three

  12. Computer Vision Using Local Binary Patterns

    CERN Document Server

    Pietikainen, Matti; Zhao, Guoying; Ahonen, Timo

    2011-01-01

    The recent emergence of Local Binary Patterns (LBP) has led to significant progress in applying texture methods to various computer vision problems and applications. The focus of this research has broadened from 2D textures to 3D textures and spatiotemporal (dynamic) textures. Also, where texture was once utilized for applications such as remote sensing, industrial inspection and biomedical image analysis, the introduction of LBP-based approaches have provided outstanding results in problems relating to face and activity analysis, with future scope for face and facial expression recognition, b

  13. Stretchable Binary Fresnel Lens for Focus Tuning.

    Science.gov (United States)

    Li, Xueming; Wei, Lei; Poelma, René H; Vollebregt, Sten; Wei, Jia; Urbach, Hendrik Paul; Sarro, Pasqualina M; Zhang, Guo Qi

    2016-01-01

    This paper presents a tuneable binary amplitude Fresnel lens produced by wafer-level microfabrication. The Fresnel lens is fabricated by encapsulating lithographically defined vertically aligned carbon nanotube (CNT) bundles inside a polydimethyl-siloxane (PDMS) layer. The composite lens material combines the excellent optical absorption properties of the CNT with the transparency and stretchability of the PDMS. By stretching the elastomeric composite in radial direction, the lens focal length is tuned. Good focusing response is demonstrated and a large focus change (≥24%) was achieved by stretching lenses up to 11.4%. PMID:27139747

  14. Physical Structure of Four Symbiotic Binaries

    Science.gov (United States)

    Kenyon, Scott J. (Principal Investigator)

    1997-01-01

    Disk accretion powers many astronomical objects, including pre-main sequence stars, interacting binary systems, and active galactic nuclei. Unfortunately, models developed to explain the behavior of disks and their surroundings - boundary layers, jets, and winds - lack much predictive power, because the physical mechanism driving disk evolution - the viscosity - is not understood. Observations of many types of accreting systems are needed to constrain the basic physics of disks and provide input for improved models. Symbiotic stars are an attractive laboratory for studying physical phenomena associated with disk accretion. These long period binaries (P(sub orb) approx. 2-3 yr) contain an evolved red giant star, a hot companion, and an ionized nebula. The secondary star usually is a white dwarf accreting material from the wind of its red giant companion. A good example of this type of symbiotic is BF Cygni: our analysis shows that disk accretion powers the nuclear burning shell of the hot white dwarf and also manages to eject material perpendicular to the orbital plane (Mikolajewska, Kenyon, and Mikolajewski 1989). The hot components in other symbiotic binaries appear powered by tidal overflow from a very evolved red giant companion. We recently completed a study of CI Cygni and demonstrated that the accreting secondary is a solar-type main sequence star, rather than a white dwarf (Kenyon et aL 1991). This project continued our study of symbiotic binary systems. Our general plan was to combine archival ultraviolet and optical spectrophotometry with high quality optical radial velocity observations to determine the variation of line and continuum sources as functions of orbital phase. We were very successful in generating orbital solutions and phasing UV+optical spectra for five systems: AG Dra, V443 Her, RW Hya, AG Peg, and AX Per. Summaries of our main results for these systems appear below. A second goal of our project was to consider general models for the

  15. Binary magnetic structures in HoEr

    DEFF Research Database (Denmark)

    Howard, B.K.; Bohr, J.

    1991-01-01

    The magnetic structure of a single crystal of the rare earth random alloy Ho50% Er50% has been investigated by elastic neutron diffraction measurements in the temperature range 120-10 K. Three distinct magnetic phases are identified below the Neel temperature of 104 K. The high-temperature phase...... observed between 104 K and 47.5 K is a binary magnetic structure where the holmium and erbium moments belong to different modulated c-axis spirals. The intermediate-temperature phase between 47.5 K and 35 K is a simple basal plane spiral. Below 35 K, the measurements suggest a ferrimagnetic structure in...

  16. Binary quadratic forms an algorithmic approach

    CERN Document Server

    Buchmann, Johannes

    2007-01-01

    The book deals with algorithmic problems related to binary quadratic forms, such as finding the representations of an integer by a form with integer coefficients, finding the minimum of a form with real coefficients and deciding equivalence of two forms. In order to solve those problems, the book introduces the reader to important areas of number theory such as diophantine equations, reduction theory of quadratic forms, geometry of numbers and algebraic number theory. The book explains applications to cryptography. It requires only basic mathematical knowledge.

  17. Binary Colloidal Alloy Test-5: Phase Separation

    Science.gov (United States)

    Lynch, Matthew; Weitz, David A.; Lu, Peter J.

    2008-01-01

    The Binary Colloidal Alloy Test - 5: Phase Separation (BCAT-5-PhaseSep) experiment will photograph initially randomized colloidal samples onboard the ISS to determine their resulting structure over time. This allows the scientists to capture the kinetics (evolution) of their samples, as well as the final equilibrium state of each sample. BCAT-5-PhaseSep studies collapse (phase separation rates that impact product shelf-life); in microgravity the physics of collapse is not masked by being reduced to a simple top and bottom phase as it is on Earth.

  18. Multiple Human Tracking Using Binary Infrared Sensors

    Directory of Open Access Journals (Sweden)

    Toshiaki Miyazaki

    2015-06-01

    Full Text Available To create a context-aware environment, human locations and movement paths must be considered. In this paper, we propose an algorithm that tracks human movement paths using only binary sensed data obtained by infrared (IR sensors attached to the ceiling of a room. Our algorithm can estimate multiple human movement paths without a priori knowledge of the number of humans in the room. By repeating predictions and estimations of human positions and links from the previous human positions to the estimated ones at each time period, human movement paths can be estimated. Simulation-based evaluation results show that our algorithm can dynamically trace human movement paths.

  19. On Totally Reducible Binary Forms: I

    Indian Academy of Sciences (India)

    C Hooley

    2001-08-01

    Let () be the number of positive numbers up to a large limit that are expressible in essentially more than one way by a binary form that is a product of > 2 distinct linear factors with integral coefficients. We prove that $$(n) = O\\left(n^{2/l-_l+\\epsilon}\\right),$$ where \\begin{equation*}_l=\\begin{cases}1/l^2, \\quad\\text{if}\\quad l=3,\\\\ (l-2)/l^2(l-1), \\quad\\text{if}\\quad l>3,\\end{cases}\\end{equation*} thus demonstrating in particular that it is exceptional for a number represented by to have essentially more than one representation.

  20. Binary Nucleation of Water and Sodium Chloride

    Energy Technology Data Exchange (ETDEWEB)

    Nemec, Thomas [Institute of Thermomechanics ASCR, Prague, Czech Republic; Marsik, Frantisek [Institute of Thermomechanics ASCR, Prague, Czech Republic; Palmer, Donald [ORNL

    2005-01-01

    Nucleation processes in the binary water-sodium chloride system are investigated in the sense of the classical nucleation theory (CNT). The CNT is modified to be able to handle the electrolytic nature of the system and is employed to investigate the acceleration of the nucleation process due to the presence of sodium chloride in the steam. This phenomenon, frequently observed in the Wilson zone of steam turbines, is called early condensation. Therefore, the nucleation rates of the water-sodium chloride mixture are of key importance in the power cycle industry.

  1. HD 161306: a radiatively interacting Be binary?

    Czech Academy of Sciences Publication Activity Database

    Koubský, Pavel; Kotková, Lenka; Kraus, Michaela; Yang, S.; Šlechta, Miroslav; Harmanec, P.; Wolf, M.; Votruba, Viktor; Kubát, Jiří; Kubátová, Brankica; Niemczura, E.; Škoda, Petr

    2014-01-01

    Roč. 567, July (2014), A57/1-A57/4. ISSN 0004-6361 R&D Projects: GA ČR(CZ) GA14-21373S; GA MŠk LG14026 Grant ostatní: ESA(XE) ESA-PECS project no. 98058; GA ČR(CZ) GAP209/10/0715 Institutional support: RVO:67985815 Keywords : binaries: spectroscopic * stars: emission-line * Be: stars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.378, year: 2014

  2. The Gaia Mission, Binary Stars and Exoplanets

    CERN Document Server

    Eyer, Laurent; Holl, Berry; North, Pierre; Zucker, Shay; Evans, Dafydd W; Pourbaix, Dimitri; Hodgkin, Simon T; Thuillot, William; Mowlavi, Nami; Carry, Benoit

    2015-01-01

    On the 19th of December 2013, the Gaia spacecraft was successfully launched by a Soyuz rocket from French Guiana and started its amazing journey to map and characterise one billion celestial objects with its one billion pixel camera. In this presentation, we briefly review the general aims of the mission and describe what has happened since launch, including the Ecliptic Pole scanning mode. We also focus especially on binary stars, starting with some basic observational aspects, and then turning to the remarkable harvest that Gaia is expected to yield for these objects.

  3. Iterative Method for Generating Correlated Binary Sequences

    CERN Document Server

    Usatenko, O V; Apostolov, S S; Makarov, N M; Krokhin, A A

    2014-01-01

    We propose a new efficient iterative method for generating random correlated binary sequences with prescribed correlation function. The method is based on consecutive linear modulations of initially uncorrelated sequence into a correlated one. Each step of modulation increases the correlations until the desired level has been reached. Robustness and efficiency for the proposed algorithm are tested by generating sequences with inverse power-law correlations. The substantial increase in the strength of correlation in the iterative method with respect to the single-step filtering generation is shown for all studied correlation functions. Our results can be used for design of disordered superlattices, waveguides, and surfaces with selective transport properties.

  4. UV Emission line shifts of symbiotic binaries

    OpenAIRE

    Friedjung, M.; Mikolajewska, J.; Zajczyk, A.; Eriksson, M.

    2010-01-01

    Relative and absolute emission line shifts have been previously found for symbiotic binaries, but their cause was not clear. This work aims to better understand the emission line shifts. Positions of strong emission lines were measured on archival UV spectra of Z And, AG Dra, RW Hya, SY Mus and AX Per and relative shifts between the lines of different ions compared. Profiles of lines of RW Hya and Z And were also examined. The reality of the relative shift between resonance and intercombinati...

  5. Retrograde binaries of massive black holes in circum-binary accretion discs

    CERN Document Server

    Amaro-Seoane, Pau; Dotti, Massimo; Colpi, Monica

    2016-01-01

    We explore the hardening of a massive black hole binary embedded in a circum-binary gas disc when the binary and the gas are coplanar and the gas is counter-rotating. The secondary black hole, revolving in the direction opposite to the gas, experiences a drag from gas-dynamical friction and from direct accretion of part of it. Using two-dimensional (2D) hydrodynamical grid simulations we investigate the effect of changing the accretion prescriptions on the dynamics of the secondary black hole which in turn affect the binary hardening and eccentricity evolution. We find that realistic accretion prescriptions lead to results that differ from those inferred assuming accretion of all the gas within the Roche Lobe of the secondary black hole. Different accretion prescriptions result in different disc's surface densities which alter the black hole's dynamics back. Full 3D SPH realizations of a number of representative cases, run over a shorter interval of time, validate the general trends observed in the less compu...

  6. Merging binary black holes formed through chemically homogeneous evolution in short-period stellar binaries

    Science.gov (United States)

    Mandel, Ilya; de Mink, Selma E.

    2016-05-01

    We explore a newly proposed channel to create binary black holes of stellar origin. This scenario applies to massive, tight binaries where mixing induced by rotation and tides transports the products of hydrogen burning throughout the stellar envelopes. This slowly enriches the entire star with helium, preventing the build-up of an internal chemical gradient. The stars remain compact as they evolve nearly chemically homogeneously, eventually forming two black holes, which we estimate typically merge 4-11 Gyr after formation. Like other proposed channels, this evolutionary pathway suffers from significant theoretical uncertainties, but could be constrained in the near future by data from advanced ground-based gravitational-wave detectors. We perform Monte Carlo simulations of the expected merger rate over cosmic time to explore the implications and uncertainties. Our default model for this channel yields a local binary black hole merger rate of about 10 Gpc-3 yr-1 at redshift z = 0, peaking at twice this rate at z = 0.5. This means that this channel is competitive, in terms of expected rates, with the conventional formation scenarios that involve a common-envelope phase during isolated binary evolution or dynamical interaction in a dense cluster. The events from this channel may be distinguished by the preference for nearly equal-mass components and high masses, with typical total masses between 50 and 110 M⊙. Unlike the conventional isolated binary evolution scenario that involves shrinkage of the orbit during a common-envelope phase, short time delays are unlikely for this channel, implying that we do not expect mergers at high redshift.

  7. Kepler Eclipsing Binary Stars. VIII. Identification of False Positive Eclipsing Binaries and Re-extraction of New Light Curves

    Science.gov (United States)

    Abdul-Masih, Michael; Prša, Andrej; Conroy, Kyle; Bloemen, Steven; Boyajian, Tabetha; Doyle, Laurance R.; Johnston, Cole; Kostov, Veselin; Latham, David W.; Matijevič, Gal; Shporer, Avi; Southworth, John

    2016-04-01

    The Kepler mission has provided unprecedented, nearly continuous photometric data of ∼200,000 objects in the ∼105 deg2 field of view (FOV) from the beginning of science operations in May of 2009 until the loss of the second reaction wheel in May of 2013. The Kepler Eclipsing Binary Catalog contains information including but not limited to ephemerides, stellar parameters, and analytical approximation fits for every known eclipsing binary system in the Kepler FOV. Using target pixel level data collected from Kepler in conjunction with the Kepler Eclipsing Binary Catalog, we identify false positives among eclipsing binaries, i.e., targets that are not eclipsing binaries themselves, but are instead contaminated by eclipsing binary sources nearby on the sky and show eclipsing binary signatures in their light curves. We present methods for identifying these false positives and for extracting new light curves for the true source of the observed binary signal. For each source, we extract three separate light curves for each quarter of available data by optimizing the signal-to-noise ratio, the relative percent eclipse depth, and the flux eclipse depth. We present 289 new eclipsing binaries in the Kepler FOV that were not targets for observation, and these have been added to the catalog. An online version of this catalog with downloadable content and visualization tools is maintained at http://keplerEBs.villanova.edu.

  8. A Compact Supermassive Binary Black Hole System

    CERN Document Server

    Rodríguez, C; Zavala, R T; Peck, A B; Pollack, L K; Romani, R W

    2006-01-01

    We report on the discovery of a supermassive binary black hole system in the radio galaxy 0402+379, with a projected separation between the two black holes of just 7.3 pc. This is the closest black hole pair yet found by more than two orders of magnitude. These results are based upon recent multi-frequency observations using the Very Long Baseline Array (VLBA) which reveal two compact, variable, flat-spectrum, active nuclei within the elliptical host galaxy of 0402+379. Multi-epoch observations from the VLBA also provide constraints on the total mass and dynamics of the system. Low spectral resolution spectroscopy using the Hobby-Eberly Telescope indicates two velocity systems with a combined mass of the two black holes of ~1.5 x 10^8 solar masses. The two nuclei appear stationary while the jets emanating from the weaker of the two nuclei appear to move out and terminate in bright hot spots. The discovery of this system has implications for the number of close binary black holes that might be sources of gravi...

  9. Observations of accretion discs in interacting binaries

    Science.gov (United States)

    Honey, William Bruce

    Cataclysmic and X-ray binaries (CV and LMXB) are considered, and new observations of both types of source are considered. Chapter 1 gives an introduction to the subject and presents a study of the evolution and period relationships of these objects. Chapter 2 studies the superoutburst of a system. The observational data presented in the Chapter are used to place constraints on the geometry of the system, and also upon the theoretical models examined; only eccentric disc models are found to be acceptable. A tidally dominated eccentric accretion disc is considered, and good agreement between the observations and a tidally distorted disc simulation is achieved. In Chapter 3, a search for the superhump phenomenon is conducted. No such superhump behavior was found. These observations support the ideas first raised in Chapter 2 of the importance of tidal behavior in dwarf novae. Chapter 4 reviews observations of black hole candidates, and lists the generally expected 'fingerprint' thought to be associated with black holes in binary systems. Chapter 5 reports on observations of the LMXB GX339-4 and the discovery of the period for the system. Constraints on the system parameters are given and a model is presented that is compatible with the observations. Chapter 6 reviews the work done and considers other important observational evidence that is to be found in the literature and is pertinent to the work in this thesis.

  10. Multilevel Cross-Dependent Binary Longitudinal Data

    KAUST Repository

    Serban, Nicoleta

    2013-10-16

    We provide insights into new methodology for the analysis of multilevel binary data observed longitudinally, when the repeated longitudinal measurements are correlated. The proposed model is logistic functional regression conditioned on three latent processes describing the within- and between-variability, and describing the cross-dependence of the repeated longitudinal measurements. We estimate the model components without employing mixed-effects modeling but assuming an approximation to the logistic link function. The primary objectives of this article are to highlight the challenges in the estimation of the model components, to compare two approximations to the logistic regression function, linear and exponential, and to discuss their advantages and limitations. The linear approximation is computationally efficient whereas the exponential approximation applies for rare events functional data. Our methods are inspired by and applied to a scientific experiment on spectral backscatter from long range infrared light detection and ranging (LIDAR) data. The models are general and relevant to many new binary functional data sets, with or without dependence between repeated functional measurements.

  11. Gravitational redshift from a binary system

    Energy Technology Data Exchange (ETDEWEB)

    Steklain, Andre [Universidade Tecnologica Federal do Parana (UTFPR), PR (Brazil)

    2011-07-01

    Full text: In this work we study the gravitational redshift of a binary system in general relativity. We employ a mixed metric obtained from the matching of a 1PN metric with two perturbed Schwarzschild metrics, based on previous works [Alvi, Phys. Rev. D, 61, 124013 (2000)]. This metric is well known, and has been considered for several applications [Steklain et al, Phys. Lett. A, 373, 188, (2009)]. We consider a massless observer in a timelike geodesic of this metric measuring the redshift of the system. The observer concentrates the redshift measurements in one of the massive bodies and is influenced by the mass of the second body. We find that there is a substantial contribution of the second mass in some cases. We compare with experimental data obtained for real binary systems of white dwarfs [Vennes et al, Astroph. J., L37 (1991)]. We also discuss these results for more massive systems, and make some predictions for very massive systems, like black holes, although it extrapolates the limit of the 1PN approximation used. Is well known that the major contribution of the observed redshift is from the universe expansion, but these results indicate that the influence of the gravitational redshift may be underestimated at some systems. (author)

  12. Tertiary companions to close spectroscopic binaries

    CERN Document Server

    Tokovinin, A; Thomas, S; Udry, S

    2006-01-01

    We have surveyed a sample of 165 solar-type spectroscopic binaries (SB) with periods from 1 to 30 days for higher-order multiplicity. 62 targets have been observed with the NACO adaptive optics system and 13 new physical tertiary companions were detected. Another 12 new wide companions (5 still tentative) were retrieved from the 2MASS sky survey. Our binaries belong to 161 stellar systems; of these 64 are triple, 11 quadruple and 7 quintuple. After correction for incomplete detection, the fraction of SBs with additional companions is 63% +- 5%. We find that this fraction is a strong function of the SB period P, reaching 96% for P12d. Period distributions of SBs with and without tertiaries are significantly different, but their mass ratio distributions are identical. New statistical data on the multiplicity of close SBs indicate that their periods and mass ratios were established very early, but periods of SBs within triples were further shortened by angular momentum exchange with companions.

  13. Transient High Mass X-ray Binaries

    CERN Document Server

    Paul, Biswajit

    2011-01-01

    High Mass X-ray Binaries (HMXBs) are interesting objects that provide a wide range of observational probes to the nature of the two stellar components, accretion process, stellar wind and orbital parameters of the systems. A large fraction of the transient HMXBs are found to be Be/X-ray binaries in which the companion Be star with its circumstellar disk governs the outburst. These outbursts are understood to be due to the sudden enhanced mass accretion to the neutron star and is likely to be associated with changes in the circumstellar disk of the companion. In the recent years, another class of transient HMXBs have been found which have supergiant companions and show shorter bursts. X-ray, infrared and optical observations of these objects provide vital information regarding these systems. Here we review some key observational properties of the transient HMXBs and also discuss some important recent developments from studies of this class of sources. The X-ray properties of these objects are discussed in some...

  14. Thirty New Low-Mass Spectroscopic Binaries

    CERN Document Server

    Shkolnik, Evgenya L; Liu, Michael C; Reid, I Neill; Cameron, Andrew C

    2010-01-01

    As part of our search for young M dwarfs within 25 pc, we acquired high-resolution spectra of 185 low-mass stars compiled by the NStars project that have strong X-ray emission. By cross-correlating these spectra with radial velocity standard stars, we are sensitive to finding multi-lined spectroscopic binaries. We find a low-mass spectroscopic binary fraction of 16% consisting of 27 SB2s, 2 SB3s and 1 SB4, increasing the number of known low-mass SBs by 50% and proving that strong X-ray emission is an extremely efficient way to find M-dwarf SBs. WASP photometry of 23 of these systems revealed two low-mass EBs, bringing the count of known M dwarf EBs to 15. BD -22 5866, the SB4, is fully described in Shkolnik et al. 2008 and CCDM J04404+3127 B consists of a two mid-M stars orbiting each other every 2.048 days. WASP also provided rotation periods for 12 systems, and in the cases where the synchronization time scales are short, we used P_rot to determine the true orbital parameters. For those with no P_rot, we us...

  15. Speakers' choice of frame in binary choice

    Directory of Open Access Journals (Sweden)

    Marc van Buiten

    2009-02-01

    Full Text Available A distinction is proposed between extit{recommending for} preferred choice options and extit{recommending against} non-preferred choice options. In binary choice, both recommendation modes are logically, though not psychologically, equivalent. We report empirical evidence showing that speakers recommending for preferred options predominantly select positive frames, which are less common when speakers recommend against non-preferred options. In addition, option attractiveness is shown to affect speakers' choice of frame, and adoption of recommendation mode. The results are interpreted in terms of three compatibility effects, (i extit{recommendation mode---valence framing compatibility}: speakers' preference for positive framing is enhanced under extit{recommending for} and diminished under extit{recommending against} instructions, (ii extit{option attractiveness---valence framing compatibility}: speakers' preference for positive framing is more pronounced for attractive than for unattractive options, and (iii extit{recommendation mode---option attractiveness compatibility}: speakers are more likely to adopt a extit{recommending for} approach for attractive than for unattractive binary choice pairs.

  16. Ordering in binary transition metal alloys

    Energy Technology Data Exchange (ETDEWEB)

    Rusakov, G. [Institute for Metal Physics UB RAS, 18 Kovalevskoj St., 620990 Ekaterinburg (Russian Federation); Ural State Technical University - UPI, 19 Mira St., 620002 Ekaterinburg (Russian Federation); Son, L., E-mail: ldson@yandex.ru [Ural State Pedagogical University, 26 Cosmonavtov Ave, 620017 Ekaterinburg (Russian Federation); Efimova, E. [Institute for Metal Physics UB RAS, 18 Kovalevskoj St., 620990 Ekaterinburg (Russian Federation); Ural State Technical University - UPI, 19 Mira St., 620002 Ekaterinburg (Russian Federation); Dubinin, N. [Institute for Metallurgy UB RAS, 101 Amundsen St., 620016 Ekaterinburg (Russian Federation); Ural State Technical University - UPI, 19 Mira St., 620002 Ekaterinburg (Russian Federation)

    2012-03-20

    We present the phenomenological thermodynamic modeling of binary alloys which demonstrate solubility of the components at high temperatures, and form intermediate phase near equiatomic composition at lower ones (the so-called sigma-phase). Besides, the regular solution miscibility gap takes place also. The nonequilibrium thermodynamic potential is written out as a sum of the free energy of regular solution and polynomial term of scalar order parameter {phi}, which describes the {sigma}-phase ordering. There are four parameters in the model: the energy of regular solution mixing, the energy of {sigma}-phase formation at zero temperature, and the widths of temperature and concentration intervals of {sigma}-phase existence in the alloy with frozen-in random distribution of components. Up to now, both phase transitions which take place in a number of transition metals binary alloys (the {sigma}-phase formation and miscibility in the regular solution) have been treated separately. In present work, the standard technique of phase diagram calculation allows us to analyze all possible phase diagrams which may arise in the alloy.

  17. Convergence Speed of Binary Interval Consensus

    CERN Document Server

    Draief, Moez

    2012-01-01

    We consider the convergence time for solving the binary consensus problem using the interval consensus algorithm proposed by B\\' en\\' ezit, Thiran and Vetterli (2009). In the binary consensus problem, each node initially holds one of two states and the goal for each node is to correctly decide which one of these two states was initially held by a majority of nodes. We derive an upper bound on the expected convergence time that holds for arbitrary connected graphs, which is based on the location of eigenvalues of some contact rate matrices. We instantiate our bound for particular networks of interest, including complete graphs, paths, cycles, star-shaped networks, and Erd\\" os-R\\' enyi random graphs; for these graphs, we compare our bound with alternative computations. We find that for all these examples our bound is tight, yielding the exact order with respect to the number of nodes. We pinpoint the fact that the expected convergence time critically depends on the voting margin defined as the difference betwe...

  18. Modeling and analysis of advanced binary cycles

    Energy Technology Data Exchange (ETDEWEB)

    Gawlik, K.

    1997-12-31

    A computer model (Cycle Analysis Simulation Tool, CAST) and a methodology have been developed to perform value analysis for small, low- to moderate-temperature binary geothermal power plants. The value analysis method allows for incremental changes in the levelized electricity cost (LEC) to be determined between a baseline plant and a modified plant. Thermodynamic cycle analyses and component sizing are carried out in the model followed by economic analysis which provides LEC results. The emphasis of the present work is on evaluating the effect of mixed working fluids instead of pure fluids on the LEC of a geothermal binary plant that uses a simple Organic Rankine Cycle. Four resources were studied spanning the range of 265{degrees}F to 375{degrees}F. A variety of isobutane and propane based mixtures, in addition to pure fluids, were used as working fluids. This study shows that the use of propane mixtures at a 265{degrees}F resource can reduce the LEC by 24% when compared to a base case value that utilizes commercial isobutane as its working fluid. The cost savings drop to 6% for a 375{degrees}F resource, where an isobutane mixture is favored. Supercritical cycles were found to have the lowest cost at all resources.

  19. The binary-rich cluster Abell 2244

    International Nuclear Information System (INIS)

    A structural, luminosity, and velocity study of the cluster Abell 2244 is presented. A2244 was selected for study from the list of Struble and Rood because of its unusually binary-rich population in an evolved cD-type cluster environment, a contradiction in terms of cluster collapse scenarios versus the formation and survival of bound pairs. In comparison with the Coma cluster, A2244 is a slightly poorer version with a suspected deficiency in the number of cluster members in the core. This evidence, combined with the high-velocity dispersion of the cluster, suggests that a low-velocity population of galaxies has been consumed by the central cD galaxy. The central cD galaxy has a single low-velocity companion deep in its envelope and cross sections of its surface-brightness profile suggest that it is in transition from a depressed central surface-brightness object to a high central concentration system, a point of contention in merger models. All but two of the binary galaxies were found to be projections with other cluster members or stars and, thus, are not in conflict with the advanced dynamical age of the cluster. 35 refs

  20. The Electromagnetic Signals of Compact Binary Mergers

    CERN Document Server

    Piran, T; Rosswog, S

    2012-01-01

    Compact binary mergers are prime sources of gravitational waves (GWs), targeted by current and next generation detectors. The question "what is the observable electromagnetic (EM) signature of a compact binary merger?" is an intriguing one with crucial consequences to the quest for gravitational waves. We present a large set of numerical simulations that focus on the electromagnetic signals that emerge from the dynamically ejected sub-relativistic material. These outflows produce on a time scale of a day macronovae - short-lived optical/UV signals powered by radioactive decay. In addition, the outflow interaction with the surrounding matter inevitably leads to a long-lasting radio emission. We calculate the expected radio signals from these outflows on time scales longer than a year, when the sub-relativistic ejecta dominate the emission. We discuss their detectability in 1.4 GHz and 150 MHz and compare it with an updated estimate of the detectability of short GRBs' orphan afterglows. We find that mergers wit...