PTF11mnb: First analog of supernova 2005bf. Long-rising, double-peaked supernova Ic from a massive progenitor

Science.gov (United States)

Taddia, F.; Sollerman, J.; Fremling, C.; Karamehmetoglu, E.; Quimby, R. M.; Gal-Yam, A.; Yaron, O.; Kasliwal, M. M.; Kulkarni, S. R.; Nugent, P. E.; Smadja, G.; Tao, C.

2018-01-01

Aims: We study PTF11mnb, a He-poor supernova (SN) whose light curves resemble those of SN 2005bf, a peculiar double-peaked stripped-envelope (SE) SN, until the declining phase after the main peak. We investigate the mechanism powering its light curve and the nature of its progenitor star. Methods: Optical photometry and spectroscopy of PTF11mnb are presented. We compared light curves, colors and spectral properties to those of SN 2005bf and normal SE SNe. We built a bolometric light curve and modeled this light curve with the SuperNova Explosion Code (SNEC) hydrodynamical code explosion of a MESA progenitor star and semi-analytic models. Results: The light curve of PTF11mnb turns out to be similar to that of SN 2005bf until 50 d when the main (secondary) peaks occur at -18.5 mag. The early peak occurs at 20 d and is about 1.0 mag fainter. After the main peak, the decline rate of PTF11mnb is remarkably slower than what was observed in SN 2005bf, and it traces well the 56Co decay rate. The spectra of PTF11mnb reveal a SN Ic and have no traces of He unlike in the case of SN Ib 2005bf, although they have velocities comparable to those of SN 2005bf. The whole evolution of the bolometric light curve is well reproduced by the explosion of a massive (Mej = 7.8 M⊙), He-poor star characterized by a double-peaked 56Ni distribution, a total 56Ni mass of 0.59 M⊙, and an explosion energy of 2.2 × 1051 erg. Alternatively, a normal SN Ib/c explosion (M(56Ni) = 0.11 M⊙, EK = 0.2 × 1051 erg, Mej = 1 M⊙) can power the first peak while a magnetar, with a magnetic field characterized by B = 5.0 × 1014 G, and a rotation period of P = 18.1 ms, provides energy for the main peak. The early g-band light curve can be fit with a shock-breakout cooling tail or an extended envelope model from which a radius of at least 30 R⊙ is obtained. Conclusions: We presented a scenario where PTF11mnb was the explosion of a massive, He-poor star, characterized by a double-peaked 56Ni

Topological BF field theory description of topological insulators

International Nuclear Information System (INIS)

Cho, Gil Young; Moore, Joel E.

2011-01-01

Research highlights: → We show that a BF theory is the effective theory of 2D and 3D topological insulators. → The non-gauge-invariance of the bulk theory yields surface terms for a bosonized Dirac fermion. → The 'axion' term in electromagnetism is correctly obtained from gapped surfaces. → Generalizations to possible fractional phases are discussed in closing. - Abstract: Topological phases of matter are described universally by topological field theories in the same way that symmetry-breaking phases of matter are described by Landau-Ginzburg field theories. We propose that topological insulators in two and three dimensions are described by a version of abelian BF theory. For the two-dimensional topological insulator or quantum spin Hall state, this description is essentially equivalent to a pair of Chern-Simons theories, consistent with the realization of this phase as paired integer quantum Hall effect states. The BF description can be motivated from the local excitations produced when a π flux is threaded through this state. For the three-dimensional topological insulator, the BF description is less obvious but quite versatile: it contains a gapless surface Dirac fermion when time-reversal-symmetry is preserved and yields 'axion electrodynamics', i.e., an electromagnetic E . B term, when time-reversal symmetry is broken and the surfaces are gapped. Just as changing the coefficients and charges of 2D Chern-Simons theory allows one to obtain fractional quantum Hall states starting from integer states, BF theory could also describe (at a macroscopic level) fractional 3D topological insulators with fractional statistics of point-like and line-like objects.

An additional memory effect in mass spectrometry for BF3

International Nuclear Information System (INIS)

Hoshino, Kiichi; Satooka, Sakae

1978-01-01

It is considered that the memory effect appears in a metallic gas inlet of a mass spectrometer for measurement with samples of BF 3 is classified into two kinds, one is essential memory effect which is caused by an action between the surface of metal and BF 3 , and the other is additional memory effect which is caused by viscous liquid produced by reaction among water, BF 3 and metals. The additional memory effect is caused by stain on the inner surface of the gas inlet. Air is introduced into the sample bottle joint at each time for change of sample bottle. Moisture in the air is adsorbed on inner surfaces of the joint and piping made of metal, and combined with BF 3 which is introduced, and then viscous compound is produced by dissolution of the metal into the compound made from H 2 O and BF 3 . The vapour pressure of the viscous compound is not sufficient low, and so the compound propagates from the sample bottle joint to the whole of the gas inlet at each time of opening and closing of valves of the gas inlet. The coated film of the viscous compound with adsorption and release of Bf 3 is a cause of the additional memory effect. If the stain of the inner surface of the gas inlet grows up, the additional memory effect becomes more intense compared with the essential memory effect, and the measured values are not converged. To remove the additional memory effect, it is desirable to introduce the sample BF 3 after the moisture intruded into the piping by the exchange of sample bottles is removed sufficiently by introduction of F 2 or ClF 3 . (auth.)

Young's modulus of BF wood material by longitudinal vibration

International Nuclear Information System (INIS)

Phadke, Sushil; Shrivastava, Bhakt Darshan; Mishra, Ashutosh; Dagaonkar, N

2014-01-01

All engineered structures are designed and built with consideration of resisting the same fundamental forces of tension, compression, shear, bending and torsion. Structural design is a balance of these internal and external forces. So, it is interesting to calculate the Young's moduli of Borassus Flabellifier BF wood are quite important from the application point of view. The ultrasonic waves are closely related with the elastic and inelastic properties of the materials. In the present study, we measured longitudinal wave ultrasonic velocities in BF wood material by longitudinal vibration method. After measuring ultrasonic velocity in BF wood material, we calculated Young's modulus of Borassus Flabellifier BF wood material. We used ultrasonic interferometer for measuring longitudinal wave ultrasonic velocity in BF wood material made by Mittal Enterprises, New Delhi, India in our laboratory. Borassus Flabellifier BF wood material was collected from Dhar district of Madhya Pradesh, India.

Fe4 cluster and a buckled macrocycle complex from the reduction of [(dmgBF2)2Fe(L)2] (L = MeCN, (t)Bu(i)NC).

Science.gov (United States)

Rose, Michael J; Winkler, Jay R; Gray, Harry B

2012-02-20

We report the syntheses, X-ray structures, and reductive electrochemistry of the Fe(II) complexes [(dmgBF(2))(2)Fe(MeCN)(2)] (1; dmg = dimethylglyoxime, MeCN = acetonitrile) and [(dmgBF(2))Fe((t)Bu(i)NC)(2)] (2; (t)Bu(i)NC = tert-butylisocyanide). The reaction of 1 with Na/Hg amalgam led to isolation and the X-ray structure of [(dmgBF(2))(2)Fe(glyIm)] (3; glyIm = glyimine), wherein the (dmgBF(2))(2) macrocyclic frame is bent to accommodate the binding of a bidentate apical ligand. We also report the X-ray structure of a rare mixed-valence Fe(4) cluster with supporting dmg-type ligands. In the structure of [(dmg(2)BF(2))(3)Fe(3)((1)/(2)dmg)(3)Fe(O)(6)] (4), the (dmgBF(2))(2) macrocycle has been cleaved, eliminating BF(2) groups. Density functional theory calculations and electron paramagnetic resonance data are in accordance with a central Fe(III) ion surrounded by three formally Fe(II)dmg(2)BF(2) units.

From lattice BF gauge theory to area-angle Regge calculus

International Nuclear Information System (INIS)

Bonzom, Valentin

2009-01-01

We consider Riemannian 4D BF lattice gauge theory, on a triangulation of spacetime. Introducing the simplicity constraints which turn BF theory into simplicial gravity, some geometric quantities of Regge calculus, areas, and 3D and 4D dihedral angles, are identified. The parallel transport conditions are taken care of to ensure a consistent gluing of simplices. We show that these gluing relations, together with the simplicity constraints, contain the constraints of area-angle Regge calculus in a simple way, via the group structure of the underlying BF gauge theory. This provides a precise road from constrained BF theory to area-angle Regge calculus. Doing so, a framework combining variables of lattice BF theory and Regge calculus is built. The action takes a form a la Regge and includes the contribution of the Immirzi parameter. In the absence of simplicity constraints, the standard spin foam model for BF theory is recovered. Insertions of local observables are investigated, leading to Casimir insertions for areas and reproducing for 3D angles known results obtained through angle operators on spin networks. The present formulation is argued to be suitable for deriving spin foam models from discrete path integrals and to unravel their geometric content.

Assessment of the turbine trip transient in Cofrentes NPP with TRAC-BF1

International Nuclear Information System (INIS)

Castrillo, F.; Gomez, A.; Gallego, I.

1993-06-01

This report presents the results of the assessment of TRAC-BF1 (G1-J1) code with the model of C. N. Cofrentes for simulation of the transient originated by the manual trip of the main turbine. C. N. Cofrentes is a General Electric designed BWR/6 plant, with a nominal core thermal power of 2894 Mwt, in commercial operation since 1985, owned and operated by Hidroelectrica Espanola, S. A. The plant incorporates all the characteristics of BWR/6 reactors, with two turbine driven FW pumps. As a result of this assessment a model of C. N. Cofrentes has been developed for TRAC-BF1 that fairly reproduces operational transient behavior of the plant. A special purpose code was generated to obtain reactivity coefficients, as required by TRAC-BF1, from the 3D simulator

The entropic boundary law in BF theory

Science.gov (United States)

Livine, Etera R.; Terno, Daniel R.

2009-01-01

We compute the entropy of a closed bounded region of space for pure 3d Riemannian gravity formulated as a topological BF theory for the gauge group SU(2) and show its holographic behavior. More precisely, we consider a fixed graph embedded in space and study the flat connection spin network state without and with particle-like topological defects. We regularize and compute exactly the entanglement for a bipartite splitting of the graph and show it scales at leading order with the number of vertices on the boundary (or equivalently with the number of loops crossing the boundary). More generally these results apply to BF theory with any compact gauge group in any space-time dimension.

The Quantum Description of BF Model in Superspace

Directory of Open Access Journals (Sweden)

Manoj Kumar Dwivedi

2018-01-01

Full Text Available We consider the BRST symmetric four-dimensional BF theory, a topological theory, containing antisymmetric tensor fields in Landau gauge and extend the BRST symmetry by introducing a shift symmetry to it. Within this formulation, the antighost fields corresponding to shift symmetry coincide with antifields of standard field/antifield formulation. Furthermore, we provide a superspace description for the BF model possessing extended BRST and extended anti-BRST transformations.

New polymers containing BF2-benzoylacetonate groups. Synthesis, luminescence, excimer and exciplex formation

International Nuclear Information System (INIS)

Fedorenko, Elena V.; Mirochnik, Anatolii G.; Beloliptsev, Anton Yu.

2017-01-01

In the present study, a new synthetic method for the functionalization of polystyrene (PS) and (styrene-methyl methacrylate) copolymer has been developed. Using the new method, polymers containing BF 2 -benzoylacetonate groups have been obtained through double acylation by acetic anhydride with boron trifluoride. Luminescence of the produced polymers in solutions and films has been studied. Quantum yields of polymer solution luminescence are significantly higher than those of the low-molecular-weight analog – boron difluoride benzoylacetonate. For the polymer, in which styrene fragments are separated by methyl methacrylate groups, at low concentrations of the polymer in solution one observes the monomer luminescence of BF 2 -benzoylacetonate groups, while at high concentrations – the excimer luminescence. In case of PS-based polymers, in which BF 2 -benzoylacetonate groups and phenyl rings are not separated, in diluted solutions one observes the fluorescence of the intramolecular exciplexes, while at the concentration increase – the luminescence of intermolecular exciplexes. The ability of excimer formation is responsible for the increased photostability of the produced polymers. - Highlights: •Polymers containing BF 2 -benzoylacetonate groups have been synthesized. •Luminescence of the produced polymers in solutions and films has been studied. •Formation of excimers and exciplexes in solution has been revealed. •Formation of excimers in films increases their photostability.

The interaction between Xe and F in Si (1 0 0) pre-amorphised with 20 keV Xe and implanted with low energy BF{sub 2}

Energy Technology Data Exchange (ETDEWEB)

Werner, M. [Joule Physics Laboratory, Institute of Materials Research, University of Salford, Salford M54WT (United Kingdom)]. E-mail: m.werner@pgr.salford.ac.uk; Berg, J.A. van den [Joule Physics Laboratory, Institute of Materials Research, University of Salford, Salford M54WT (United Kingdom); Armour, D.G. [Joule Physics Laboratory, Institute of Materials Research, University of Salford, Salford M54WT (United Kingdom); Carter, G. [Joule Physics Laboratory, Institute of Materials Research, University of Salford, Salford M54WT (United Kingdom); Feudel, T. [AMD Saxony LLC and Co. KG, Wilschdorfer Landstrasse, 101 D-01109 Dresden (Italy); Herden, M. [AMD Saxony LLC and Co. KG, Wilschdorfer Landstrasse, 101 D-01109 Dresden (Italy); Bersani, M. [ITC IRST, 38050 Povo, Trento (Italy); Giubertoni, D. [ITC IRST, 38050 Povo, Trento (Italy); Bailey, P. [CCLRC Daresbury Laboratory, Daresbury WA44A (United Kingdom); Noakes, T.C.Q. [CCLRC Daresbury Laboratory, Daresbury WA44A (United Kingdom)

2004-12-15

The pre-amorphisation of Si by Xe{sup +} ions, before source/drain and extension implants, is an attractive alternative to Ge{sup +} or Si{sup +}, as it produces sharper amorphous/crystalline interfaces. Si (1 0 0) samples pre-amorphised with 20 keV Xe{sup +} to a nominal dose of 2E14 cm{sup -2} were implanted with 1 and 3 keV BF{sub 2} {sup +} to doses of 7E14 cm{sup -2}. Samples were annealed at temperatures ranging from 600 to 1130 deg. C and investigated by medium energy ion scattering (MEIS) and secondary ion mass spectrometry (SIMS). Following annealing, it was observed that implanted Xe has interacted with F originating from the BF{sub 2} {sup +} implant. MEIS studies showed that for all annealing conditions, approximately half of the Xe accumulated at depths of 7 nm for the 1 keV and at 13 nm for the 3 keV BF{sub 2} {sup +} implant. This equates to the end of range of B and F within the amorphous Si. SIMS showed that in the pre-amorphised samples, approximately 10% of the F migrates into the bulk and is trapped at the same depth in a {approx}1:1 ratio to Xe. A small fraction of the implanted B is also trapped. The effect is interpreted in terms of the formation of a defect structure within the amorphised Si, leading to F stabilised Xe bubble or XeF compound formation.

Dissipation of pyraclostrobin and its metabolite BF-500-3 in maize under field conditions.

Science.gov (United States)

You, Xiangwei; Liu, Congyun; Liu, Fengmao; Liu, Yanping; Dong, Jiannan

2012-06-01

The dissipation and residue of pyraclostrobin and its metabolite BF-500-3 in maize under field conditions were investigated. A sensitive, simple and fast method for simultaneous determination of pyraclostrobin and BF-500-3 in maize matrix was established by high performance liquid chromatography-tandem mass spectrometry (HPLC-MS/MS). The average recoveries of pyraclostrobin and BF-500-3 were found in the range of 83.6-104.9% with relative standard deviations (RSDs) of 2.3-10.0%. The results showed that pyraclostrobin dissipated quickly in maize plant with half-lives of 1.6-1.7 days. Its metabolite BF-500-3 showed a tendency of rapid increasing initially and decreasing afterwards. At harvest time, the terminal residues of pyraclostrobin were below the maximum residue limit (MRL) set by USA and Canada in maize grain when measured 7 days after the final application, which suggested that the use of this fungicide was safe for humans. The results could provide guidance to safe and reasonable use of pyraclostrobin in agriculture. Copyright © 2012 Elsevier Inc. All rights reserved.

Bundesamt fuer Strahlenschutz (BfS). Annual report 1991

International Nuclear Information System (INIS)

1992-08-01

The progress report submitted by Bundesamt fuer Strahlenschutz reveals that this federal radiation protection agency is not only entrusted with the fulfillment of the federal administrative tasks imposed by law but engages in applications-oriented research regarding the operational, metrological and health-related aspects of radiation protection, regarding nuclear safety and radioactive waste management. In addition, BfS takes care of public-relations tasks. The reports submitted by the BfS departments are completed by summaries of the main research results. (DG) [de

Hexadecyltrimethylammonium bromide (CTA-Br) and 1-butyl-3-methylimidazolium tetrafluoroborate (bmim-BF4) in aqueous solution: An ephemeral binary system.

Science.gov (United States)

Comelles, Francesc; Ribosa, Isabel; Gonzalez, Juan José; Garcia, M Teresa

2017-03-15

Mixtures of the cationic surfactant hexadecyltrimethylammonium bromide (CTA-Br) and the ionic liquid 1-butyl-3-methylimidazolium tetrafluoroborate (bmim-BF 4 ) in aqueous solutions are expected to behave as typical binary cationic surfactant system taking into account the surface activity displayed by the ionic liquid, instead of considering the IL as a water cosolvent. Surface tension and conductivity measurements have been conducted as a function of the total concentration of the mixtures at different surfactant mole fraction (α CTA-Br ) to investigate the surface active properties. Turbidity immediately appearing when the compounds are mixed in water suggests the spontaneous formation of the low soluble compound hexadecyltrimethylammonium tetrafluoroborate (CTA-BF 4 ), together with the salt formed by the respective counterions bmim + and Br - in solution. For α CTA-Br ≠0.5, furthermore of the mentioned compounds, the spare bmim-BF 4 (for α CTA-Br Br (for α CTA-Br >0.5), are also present in the aqueous solution. Systems containing excess of bmim-BF 4 show a low critical aggregate concentration (cac), but an unexpected high surface tension at cac (γ cac ≈53-56mN/m), as pure CTA-BF 4 . For systems containing excess of CTA-Br, cac increases but γ cac decreases up to 36mN/m. Mixtures of pure CTA-BF 4 and bmim-BF 4 or CTA-Br behave as typical binary surfactant systems. Copyright © 2016 Elsevier Inc. All rights reserved.

Surface morphologies of excimer-laser annealed BF2+ implanted Si diodes

International Nuclear Information System (INIS)

Burtsev, A.; Schut, H.; Nanver, L.K.; Veen, A. van; Slabbekoorn, J.; Scholtes, T.L.M.

2004-01-01

Laser-induced surface roughness and damage formation in ultra-shallow n + -p and p + -n junctions, formed by low energy (5 keV) As + and BF 2 + implantations in Si, respectively, with a dose of 1 x 10 15 cm -2 have been investigated by atomic force microscopy (AFM) and Positron Annihilation Doppler Broadening (PADB) technique. The Si surface roughness is found to increase with laser energy density, and reaches a value of 3.5 nm after excimer-laser annealing (ELA) at 1100 mJ/cm 2 . However, anomalous behavior is witnessed for BF 2 + -implanted Si sample at 800 mJ/cm 2 , at which energy very high surface protrusions up to 9 nm high are observed. By PADB this behavior is correlated to extensive deep microcavity formation in the Si whereby the volatile F 2 fraction can accumulate and evaporate/out-diffuse, leading to Si surface roughening. The consequences for the diode characteristics and contact resistivity are examined

BF-30 effectively inhibits ciprofloxacin-resistant bacteria in vitro and in a rat model of vaginosis.

Science.gov (United States)

Wang, Jing; Li, Bing; Li, Yang; Dou, Jie; Hao, Qingru; Tian, Yuwei; Wang, Hui; Zhou, Changlin

2014-07-01

Bacterial infections are becoming increasingly difficult to treat due to the increasing number of multidrug-resistant strains. Cathelicidin-BF (BF-30) is a cathelicidin-like antimicrobial peptide and exhibits broad antimicrobial activity against bacteria. In the present study, the antibacterial activity of BF-30 against ciprofloxacin-resistant Escherichia coli and Staphylococcus aureus was examined, and the protective effects of this peptide against these bacteria in rats with bacterial vaginosis were identified for the first time. The data showed that BF-30 had effective antimicrobial activities against ciprofloxacin-resistant E. coli and S. aureus. The minimal inhibitory concentrations for both bacterial strains were 16 μg/ml, and the minimal bactericidal concentrations were 64 and 128 μg/ml, respectively. A time course experiment showed that the CFU counts rapidly decreased after BF-30 treatment, and the bacteria were nearly eliminated within 4 h. BF-30 could reduce the fold change (CFU/ml) in local colonization by drug-resistant E. coli and S. aureus to 0.01 at a dose of 0.8 mg/kg/day in the rats' vaginal secretions. In addition, BF-30 induced membrane permeabilization and bound to the genomic DNA, interrupting protein synthesis. Taken together, our data demonstrate that BF-30 has potential therapeutic value for the prevention and treatment of bacterial vaginosis.

Electrochemical fabrication of TiO2 nanoparticles/[BMIM]BF4 ionic liquid hybrid film electrode and its application in determination of p-acetaminophen

International Nuclear Information System (INIS)

Wang, Bin; Li, Yuan; Qin, Xianjing; Zhan, Guoqing; Ma, Ming; Li, Chunya

2012-01-01

A water soluble ionic liquid, 1‐butyl‐3‐methylimidazolium tetrafluoroborate ([BMIM]BF 4 ), was incorporated into TiO 2 nanoparticles to fabricate a hybrid film modified glassy carbon electrode (nano‐TiO 2 /[BMIM]BF 4 /GCE) through electrochemical deposition in a tetrabutyltitanate sol solution containing [BMIM]BF 4 . The obtained nano‐TiO 2 /[BMIM]BF 4 /GCEs were characterized scanning electronic microscopy (SEM) and X‐ray photoelectron spectroscopy (XPS). Electrochemical behaviors of p‐acetaminophen at the nano‐TiO 2 /[BMIM]BF 4 /GCEs were thoroughly investigated. Compared to the redox reaction of p‐acetaminophen using an unmodified electrode under the same conditions, a new reduction peak was observed clearly at 0.26 V with the modified electrode. In addition, the peak potential for the oxidation of p‐acetaminophen was found to shift negatively about 90 mV and the current response increased significantly. These changes indicate that the nano‐TiO 2 /[BMIM]BF 4 hybrid film can improve the redox reactions of p‐acetaminophen in aqueous medium. Under optimum conditions, a linear relationship was obtained for the p‐acetaminophen solutions with concentration in the range from 5.0 × 10 −8 to 5.0 × 10 −5 M. The estimated detection limit was 1.0 × 10 −8 M (S/N = 3). The newly developed method was applied for the determination of p-acetaminophen in urine samples. - Highlights: ► Nano-TiO 2 /[BMIM]BF 4 hybrid film electrode was fabricated with electrodeposition. ► Voltammetric behavior of p-acetaminophen at the obtained electrode was investigated. ► The hybrid film electrode shows good electrocatalytic response to p-acetaminophen. ► p-acetaminophen in urine samples was successfully determined.

Enhanced Iron and Selenium Uptake in Plants by Volatile Emissions of Bacillus amyloliquefaciens (BF06

Directory of Open Access Journals (Sweden)

Jianfei Wang

2017-01-01

Full Text Available Volatile organic compounds (VOCs released by plant growth-promoting rhizobacteria (PGPR are involved in promoting growth and triggering systemic resistance (ISR in plants. Importantly, the release of VOCs by some PGPR strains confers improved plant uptake of nutrient elements from the soil. However, the underlying mechanisms of VOCs-regulated nutrient acquisition remain elusive. In this study, VOCs were extracted and identified from Bacillus amyloliquefaciens (strain BF06 using gas chromatography–mass spectrometry (GC–MS. BF06 VOCs exposure significantly promoted the growth and photosynthesis of Arabidopsis plants. To explore how microbial VOCs stimulate growth in plants, gene expression profiles of Arabidopsis seedlings exposed to BF06 VOCs were examined using transcriptomic analyses. In screening differentially expressed genes (DEGs, most upregulated DEGs were found to be related to amino acid transport, iron (Fe uptake and homeostasis, and sulfate transport. Furthermore, BF06 VOCs significantly enhanced Fe absorption in plants under Fe-limited conditions. However, when nitric oxide (NO synthesis was inhibited, BF06 VOCs exposure could not substantially augment Fe acquisition in plants under alkaline stress, indicating that VOCs-mediated plant uptake of Fe was required for induction of root NO accumulation. In addition, BF06 VOCs exposure led to a marked increase in some genes encoding for sulfate transporters, and further increased Se accumulation in plants. Intriguingly, BF06 VOCs exposure failed to increase Se uptake in sultr1;2 mutants, which may indicate that high-level transcription of these sulfate transporters induced by BF06 VOCs was essential for enhancing Se absorption by plants. Taken together, our results demonstrated the potential of VOCs released by this strain BF06 to increase Fe and Se uptake in plants.

BF2 complex of fluorinated dipyrrolyldiketone: a new class of efficient receptor for acetate anions.

Science.gov (United States)

Maeda, Hiromitsu; Ito, Yoshihiro

2006-10-02

The beta-fluorinated derivative (2b) of the 1,3-dipyrrolyl-1,3-propanedione BF2 complex has been prepared from 3,4-difluoropyrrole and malonyl chloride, followed by treatment with BF3.OEt2. Despite the simple, acyclic, and neutral structure, 2b exhibits efficient 1:1 binding for anions in CH2Cl2 using the bridging CH and pyrrole NH as interaction sites. The binding constant (Ka) of 2b for acetate (CH3CO(2-)), associating more effectively than anions such as F-, Cl-, Br-, H2PO(4-), and HSO(4-), is estimated to be 9.6 x 10(5) M(-1), approximately 9 times larger than that of the beta-H derivative 2a (1.1 x 10(5) M(-1)). The UV-vis and fluorescence spectral changes of 2b elucidate the effective recognition of an amino acid, such as phenylalanine, in the anionic form; this is also supported by CD spectral changes with mirror images by L- and D-isomers. Furthermore, in the solid state, BF2 complex 2b provides Cl- -bridged supramolecular networks and, in sharp contrast, deprotonated "anionic" self-assembled structures by F- binding.

Characterization of BF4− in terms of its effect on water by the 1-propanol probing methodology

DEFF Research Database (Denmark)

Morita, Takeshi; Ayako, Nitta; Nishikawa, Keilo

2014-01-01

One of the most common constituent anions for room temperature ionic liquids (RTILs), BF4−, was characterized in terms of its effect on H2O using the so-called 1-propanol (1P) probing methodology developed by us earlier [PCCP, 15(2013) 14548-14565]. The results indicated that BF4− is quantitatively...

1H, 19F and 11B nuclear magnetic resonance characterization of BF3:amine catalysts used in the cure of C fiber-epoxy prepregs

International Nuclear Information System (INIS)

Happe, J.A.; Morgan, R.J.; Walkup, C.M.

1983-12-01

The chemical composition of commercial BF 3 :amine complexes are variable and contain BF 4 - and BF 3 (OH) - salts together with other unidentified highly reactive species. The BF 3 :amine complexes, which are susceptible to hydrolysis, also partially convert to the BF 4 - salt (i.e. BF 4 - NH 3 + C 2 H 5 ) upon heating. This salt formation is accelerated in dimethyl sulfoxide solution and in the presence of the epoxides that are present in commercial prepregs. Commercial C fiber-epoxy prepregs are shown to contain either BF 3 :NH 2 C 2 H 5 or BF 3 :NHC 5 H 10 species together with their BF 4 - salts and a variety of boron-fluorine or carbon-fluorine prepreg species. Considerable variation in the relative quantities of BF 3 :amine to its BF 4 - salt was observed from prepreg lot to lot, which will cause variable viscosity-time-temperature prepreg cure profiles. It is concluded that the chemically stable and mobile BF 4 - salt is the pre-dominant catalytic species, acting as a cationic catalyst for the prepreg cure reactions. During the early stages of cure the BF 3 :amine catalyst converts to the BF 4 - salt in the presence of epoxides, whereas the BF 3 -prepreg species are susceptible to catalytic deactivation and immobilization

In vivo detection of prion amyloid plaques using [11C]BF-227 PET

International Nuclear Information System (INIS)

Okamura, Nobuyuki; Yanai, Kazuhiko; Shiga, Yusei; Itoyama, Yasuhito; Furumoto, Shozo; Tashiro, Manabu; Tsuboi, Yoshio; Furukawa, Katsutoshi; Arai, Hiroyuki; Iwata, Ren; Kudo, Yukitsuka; Doh-ura, Katsumi

2010-01-01

In vivo detection of pathological prion protein (PrP) in the brain is potentially useful for the diagnosis of transmissible spongiform encephalopathies (TSEs). However, there are no non-invasive ante-mortem means for detection of pathological PrP deposition in the brain. The purpose of this study is to evaluate the amyloid imaging tracer BF-227 with positron emission tomography (PET) for the non-invasive detection of PrP amyloid in the brain. The binding ability of BF-227 to PrP amyloid was investigated using autoradiography and fluorescence microscopy. Five patients with TSEs, including three patients with Gerstmann-Straeussler-Scheinker disease (GSS) and two patients with sporadic Creutzfeldt-Jakob disease (CJD), underwent [ 11 C]BF-227 PET scans. Results were compared with data from 10 normal controls and 17 patients with Alzheimer's disease (AD). The regional to pons standardized uptake value ratio was calculated as an index of BF-227 retention. Binding of BF-227 to PrP plaques was confirmed using brain samples from autopsy-confirmed GSS cases. In clinical PET study, significantly higher retention of BF-227 was detected in the cerebellum, thalamus and lateral temporal cortex of GSS patients compared to that in the corresponding tissues of normal controls. GSS patients also showed higher retention of BF-227 in the cerebellum, thalamus and medial temporal cortex compared to AD patients. In contrast, the two CJD patients showed no obvious retention of BF-227 in the brain. Although [ 11 C]BF-227 is a non-specific imaging marker of cerebral amyloidosis, it is useful for in vivo detection of PrP plaques in the human brain in GSS, based on the regional distribution of the tracer. PET amyloid imaging might provide a means for both early diagnosis and non-invasive disease monitoring of certain forms of TSEs. (orig.)

New polymers containing BF{sub 2}-benzoylacetonate groups. Synthesis, luminescence, excimer and exciplex formation

Energy Technology Data Exchange (ETDEWEB)

Fedorenko, Elena V., E-mail: gev@ich.dvo.ru [Institute of Chemistry, Far Eastern Branch of the Russian Academy of Sciences, 159, Prosp. 100 letiya Vladivostoka, Vladivostok 690022 (Russian Federation); Mirochnik, Anatolii G.; Beloliptsev, Anton Yu. [Institute of Chemistry, Far Eastern Branch of the Russian Academy of Sciences, 159, Prosp. 100 letiya Vladivostoka, Vladivostok 690022 (Russian Federation)

2017-05-15

In the present study, a new synthetic method for the functionalization of polystyrene (PS) and (styrene-methyl methacrylate) copolymer has been developed. Using the new method, polymers containing BF{sub 2}-benzoylacetonate groups have been obtained through double acylation by acetic anhydride with boron trifluoride. Luminescence of the produced polymers in solutions and films has been studied. Quantum yields of polymer solution luminescence are significantly higher than those of the low-molecular-weight analog – boron difluoride benzoylacetonate. For the polymer, in which styrene fragments are separated by methyl methacrylate groups, at low concentrations of the polymer in solution one observes the monomer luminescence of BF{sub 2}-benzoylacetonate groups, while at high concentrations – the excimer luminescence. In case of PS-based polymers, in which BF{sub 2}-benzoylacetonate groups and phenyl rings are not separated, in diluted solutions one observes the fluorescence of the intramolecular exciplexes, while at the concentration increase – the luminescence of intermolecular exciplexes. The ability of excimer formation is responsible for the increased photostability of the produced polymers. - Highlights: •Polymers containing BF{sub 2}-benzoylacetonate groups have been synthesized. •Luminescence of the produced polymers in solutions and films has been studied. •Formation of excimers and exciplexes in solution has been revealed. •Formation of excimers in films increases their photostability.

Tumor cell-released TLR4 ligands stimulate Gr-1+CD11b+F4/80+ cells to induce apoptosis of activated T cells.

Science.gov (United States)

Liu, Yan-Yan; Sun, Ling-Cong; Wei, Jing-Jing; Li, Dong; Yuan, Ye; Yan, Bin; Liang, Zhi-Hui; Zhu, Hui-Fen; Xu, Yong; Li, Bo; Song, Chuan-Wang; Liao, Sheng-Jun; Lei, Zhang; Zhang, Gui-Mei; Feng, Zuo-Hua

2010-09-01

Gr-1(+)CD11b(+)F4/80(+) cells play important roles in tumor development and have a negative effect on tumor immunotherapy. So far, the mechanisms underlying the regulation of their immunosuppressive phenotype by classical and alternative macrophage activation stimuli are not well elucidated. In this study, we found that molecules from necrotic tumor cells (NTC-Ms) stimulated Gr-1(+)CD11b(+)F4/80(+) cells to induce apoptosis of activated T cells but not nonstimulated T cells. The apoptosis-inducing capacity was determined by higher expression levels of arginase I and IL-10 relative to those of NO synthase 2 and IL-12 in Gr-1(+)CD11b(+)F4/80(+) cells, which were induced by NTC-Ms through TLR4 signaling. The apoptosis-inducing capacity of NTC-Ms-stimulated Gr-1(+)CD11b(+)F4/80(+) cells could be enhanced by IL-10. IFN-gamma may reduce the apoptosis-inducing capacity of Gr-1(+)CD11b(+)F4/80(+) cells only if their response to IFN-gamma was not attenuated. However, the potential of Gr-1(+)CD11b(+)F4/80(+) cells to express IL-12 in response to IFN-gamma could be attenuated by tumor, partially due to the existence of active STAT3 in Gr-1(+)CD11b(+)F4/80(+) cells and NTC-Ms from tumor. In this situation, IFN-gamma could not effectively reduce the apoptosis-inducing capacity of Gr-1(+)CD11b(+)F4/80(+) cells. Tumor immunotherapy with 4-1BBL/soluble programmed death-1 may significantly reduce, but not abolish the apoptosis-inducing capacity of Gr-1(+)CD11b(+)F4/80(+) cells in local microenvironment. Blockade of TLR4 signaling could further reduce the apoptosis-inducing capacity of Gr-1(+)CD11b(+)F4/80(+) cells and enhance the suppressive effect of 4-1BBL/soluble form of programmed death-1 on tumor growth. These findings indicate the relationship of distinct signaling pathways with apoptosis-inducing capacity of Gr-1(+)CD11b(+)F4/80(+) cells and emphasize the importance of blocking TLR4 signaling to prevent the induction of T cell apoptosis by Gr-1(+)CD11b(+)F4/80(+) cells.

Bundesamt fuer Strahlenschutz (BfS). Annual report 2011; Bundesamt fuer Strahlenschutz (BfS). Jahresbericht 2011

Energy Technology Data Exchange (ETDEWEB)

Ebermann, Lutz (comp.)

2012-07-01

The annual report 2011 of the Bundesamt fuer Strahlenschutz (BfS) includes the following main articles: Fukushima and the consequences, new power lines across Germany and the management of radioactive wastes in Germany. Further topics of the BfS were reasonable exposure to sun and skin cancer prevention, individual health assessment of lung cancer with low-dose CT, occupational radiation exposure in medicine, radiation protection at setting up digital radio of security authorities and organizations, importance of laboratory ring experiments for incorporation monitoring, defence against nuclear hazards: cooperation and exercises in 2011, new developments with regard to radioactivity in drinking water, reportable events in nuclear facilities in 2011, decommissioning of a permanently shut down NPP. The environmental research program of the Federal Environmental ministry - research for strengthening nuclear safety and radiation protection: German uranium miners biobank: consequences of uranium mining and radiological impacts, German miners cohort study, health effects of strong magnetic fields of NMR imaging, radiation exposure due to nuclear medical examinations, national survey on the radio-cesium contamination of wild boars.

Assessing toxic effects of [Omim]Cl and [Omim]BF4 in zebrafish adults using a biomarker approach.

Science.gov (United States)

Liu, Tong; Guo, Yingying; Wang, Jinhua; Wang, Jun; Zhu, Lusheng; Zhang, Jun; Zhang, Cheng

2016-04-01

In the present study, the toxic effects of 1-octyl-3-methylimidazolium chloride ([Omim]Cl) and 1-octyl-3-methylimidazolium tetrafluoroborate ([Omim]BF4) on the zebrafish livers were studied at 0, 5, 10, 20, and 40 mg L(-1) on the 7th and 14th days. In addition, the concentrations of [Omim]Cl and [Omim]BF4 in the test water, the acute toxicity of the two ionic liquids (ILs), and the influence of anions on the toxicity of the ILs were evaluated. The acute toxicity test results showed 50 % lethal concentration (LC50) values of 152.3 ± 12.1 mg L(-1) for [Omim]Cl and 144.0 ± 11.4 mg L(-1) for [Omim]BF4. At the lowest concentration investigated (5 mg L(-1)), [Omim]Cl and [Omim]BF4 did not significantly affect zebrafish during the exposure period. However, the toxic effects of these substances were enhanced as dosing concentrations and exposure times were increased. Levels of reactive oxygen species (ROS) were significantly enhanced on the 7th day after 20 mg L(-1) and on the 14th day after 10 mg L(-1) of either substance was applied, resulting in oxidative damage, such as lipid peroxidation and DNA damage. The experimental results also indicated little effect of the anions on the toxicity of ILs and consistent toxic effects of [Omim]Cl and [Omim]BF4. Graphical Abstract The graphical abstract for the present study after exposure to [Omim]Cl and [Omim]BF4. The letter R represents the anions Cl(-) and BF4 (.)

A Kallosh theorem for BF-type topological field theory

International Nuclear Information System (INIS)

Birmingham, D.; Gibbs, R.; Mokhtari, S.

1991-01-01

A Kallosh theorem is established for the case of BF-type theories in three dimensions, including a coupling to Chern-Simons theory. The phase contribution to the one-loop off-shell effective action is computed for a two-parameter family of local covariant gauges. It is shown that the phase is independent of these parameters, and thus equals the 'no Vilkovisky-DeWitt' gauge result. The field space metric dependence of a corresponding calculation for generalized BF theory is briefly discussed. (orig.)

A Kallosh theorem for BF-type topological field theory

Energy Technology Data Exchange (ETDEWEB)

Birmingham, D. (Theory Div., CERN, Geneva (Switzerland)); Gibbs, R.; Mokhtari, S. (Physics Dept., Louisiana Tech. Univ., Ruston, LA (United States))

1991-12-12

A Kallosh theorem is established for the case of BF-type theories in three dimensions, including a coupling to Chern-Simons theory. The phase contribution to the one-loop off-shell effective action is computed for a two-parameter family of local covariant gauges. It is shown that the phase is independent of these parameters, and thus equals the 'no Vilkovisky-DeWitt' gauge result. The field space metric dependence of a corresponding calculation for generalized BF theory is briefly discussed. (orig.).

In vivo detection of prion amyloid plaques using [{sup 11}C]BF-227 PET

Energy Technology Data Exchange (ETDEWEB)

Okamura, Nobuyuki; Yanai, Kazuhiko [Tohoku University School of Medicine, Department of Pharmacology, Sendai (Japan); Shiga, Yusei; Itoyama, Yasuhito [Tohoku University School of Medicine, Department of Neurology, Sendai (Japan); Furumoto, Shozo [Tohoku University School of Medicine, Department of Pharmacology, Sendai (Japan); Tohoku University, Division of Radiopharmaceutical Chemistry, Cyclotron and Radioisotope Center, Sendai (Japan); Tashiro, Manabu [Tohoku University, Division of Cyclotron Nuclear Medicine, Cyclotron and Radioisotope Center, Sendai (Japan); Tsuboi, Yoshio [Fukuoka University School of Medicine, Department of Neurology, Fukuoka (Japan); Furukawa, Katsutoshi; Arai, Hiroyuki [Institute of Development, Aging, and Cancer, Tohoku University, Department of Geriatrics and Gerontology, Division of Brain Sciences, Sendai (Japan); Iwata, Ren [Tohoku University, Division of Radiopharmaceutical Chemistry, Cyclotron and Radioisotope Center, Sendai (Japan); Kudo, Yukitsuka [Tohoku University, Innovation of New Biomedical Engineering Center, Sendai (Japan); Doh-ura, Katsumi [Tohoku University School of Medicine, Department of Prion Research, 2-1 Seiryo-machi, Aoba-ku, Sendai (Japan)

2010-05-15

In vivo detection of pathological prion protein (PrP) in the brain is potentially useful for the diagnosis of transmissible spongiform encephalopathies (TSEs). However, there are no non-invasive ante-mortem means for detection of pathological PrP deposition in the brain. The purpose of this study is to evaluate the amyloid imaging tracer BF-227 with positron emission tomography (PET) for the non-invasive detection of PrP amyloid in the brain. The binding ability of BF-227 to PrP amyloid was investigated using autoradiography and fluorescence microscopy. Five patients with TSEs, including three patients with Gerstmann-Straeussler-Scheinker disease (GSS) and two patients with sporadic Creutzfeldt-Jakob disease (CJD), underwent [{sup 11}C]BF-227 PET scans. Results were compared with data from 10 normal controls and 17 patients with Alzheimer's disease (AD). The regional to pons standardized uptake value ratio was calculated as an index of BF-227 retention. Binding of BF-227 to PrP plaques was confirmed using brain samples from autopsy-confirmed GSS cases. In clinical PET study, significantly higher retention of BF-227 was detected in the cerebellum, thalamus and lateral temporal cortex of GSS patients compared to that in the corresponding tissues of normal controls. GSS patients also showed higher retention of BF-227 in the cerebellum, thalamus and medial temporal cortex compared to AD patients. In contrast, the two CJD patients showed no obvious retention of BF-227 in the brain. Although [{sup 11}C]BF-227 is a non-specific imaging marker of cerebral amyloidosis, it is useful for in vivo detection of PrP plaques in the human brain in GSS, based on the regional distribution of the tracer. PET amyloid imaging might provide a means for both early diagnosis and non-invasive disease monitoring of certain forms of TSEs. (orig.)

BF*F allotype of the alternative pathway of complement: A marker of protection against the development of antiphospholipid antibodies in patients with systemic lupus erythematosus.

Science.gov (United States)

Picceli, V F; Skare, T L; Nisihara, R M; Nass, F R; Messias-Reason, I T; Utiyama, S R R

2016-04-01

B factor (BF) from the alternative complement pathway seems to participate in the pathophysiology of systemic lupus erythematosus (SLE) and antiphospholipid syndrome (APS). To study the allotypic variability of BF in SLE and their associations with clinical and autoantibodies profile. BF allotypes were determined by high-voltage agarose gel electrophoresis, under constant cooling, followed by immunofixation with anti-human BF antibody, in 188 SLE patients and 103 controls. Clinical and serological data were obtained from medical examination and records. No significant differences of BF variants between patients and controls were found, neither in relation to epidemiologic or clinical manifestations. Associations of phenotype BF SS07 and allotype BF*S07 were found with anticardiolipin IgM (aCl-IgM) antibodies (p = 0.014 and p = 0.009 respectively), but not with aCl-IgG, lupus anticoagulant (LA), anti β2GPI or clinical APS. A significant decrease in BF*F allotype (p = 0.043) and BF SF phenotype (p = 0.018) was detected in patients with anti-phospholipid antibodies as a whole (aCl-IgG, aCl-IgM, LA and anti β2GPI). There is a link between phenotype BF SS07 and allotype BF*S07 with aCl-IgM in SLE patients; BF*F allotype could be considered a marker of protection against the development of antiphospholipid antibodies in these patients. © The Author(s) 2015.

Comparison between a conventional membrane bioreactor (C-MBR and a biofilm membrane bioreactor (BF-MBR for domestic wastewater treatment

Directory of Open Access Journals (Sweden)

E. L. Subtil

2014-09-01

Full Text Available In this paper, the influence of biofilm carriers in a MBR on the performance of organic matter and nitrogen removal and the influence on membrane fouling were evaluated. The configurations studied included a Conventional Membrane Bioreactor (C-MBR and a Biofilm Membrane Bioreactor (BF-MBR operated in parallel, both fed with domestic wastewater. Regarding organic matter removal, no statistically significant differences were observed between C-MBR and BF-MBR, producing an effluent with a Soluble COD concentration of 27 ± 9.0 mgO2/L and 26 ±1.0 mgO2/L and BOD concentration of 6.0 ± 2.5 mgO2/L and 6.2 ± 2.1 mgO2/L, respectively. On the other hand, the BF-MBR produced a permeate with lower ammonia and total nitrogen concentrations, which resulted in a removal efficiency of 98% and 73%, respectively. It was also observed that the fouling rate was about 35% higher in the C-MBR than that for the BF-MBR, which also presented a reduction of total membrane resistance, about 29%, and increased operational cycle length around 7 days, compared to C-MBR.

Topological higher gauge theory: From BF to BFCG theory

International Nuclear Information System (INIS)

Girelli, F.; Pfeiffer, H.; Popescu, E. M.

2008-01-01

We study generalizations of three- and four-dimensional BF theories in the context of higher gauge theory. First, we construct topological higher gauge theories as discrete state sum models and explain how they are related to the state sums of Yetter, Mackaay, and Porter. Under certain conditions, we can present their corresponding continuum counterparts in terms of classical Lagrangians. We then explain that two of these models are already familiar from the literature: the ΣΦEA model of three-dimensional gravity coupled to topological matter and also a four-dimensional model of BF theory coupled to topological matter

The effective action in (2+1)-dimensional gravity and generalized BF topological field theory

Energy Technology Data Exchange (ETDEWEB)

Birmingham, D. (Theory Div., CERN, Geneva (Switzerland)); Gibbs, R.; Mokhtari, S. (Physics Dept., Louisiana Tech Univ., Ruston, LA (United States))

1991-07-11

The one-loop off-shell effective action is studied for the case of generalized BF theories in three dimensions, including, for example, (2 + 1)-dimensional gravity with a cosmological constant. The phase contribution to the effective action, originating from the {eta}-function of a particular first order operator, is calculated using a momentum space technique. It is found that the {eta}-function is proportional to the classical action. (orig.).

The effective action in (2+1)-dimensional gravity and generalized BF topological field theory

International Nuclear Information System (INIS)

Birmingham, D.; Gibbs, R.; Mokhtari, S.

1991-01-01

The one-loop off-shell effective action is studied for the case of generalized BF theories in three dimensions, including, for example, (2 + 1)-dimensional gravity with a cosmological constant. The phase contribution to the effective action, originating from the η-function of a particular first order operator, is calculated using a momentum space technique. It is found that the η-function is proportional to the classical action. (orig.)

Janus field theories from non-linear BF theories for multiple M2-branes

International Nuclear Information System (INIS)

Ryang, Shijong

2009-01-01

We integrate the nonpropagating B μ gauge field for the non-linear BF Lagrangian describing N M2-branes which includes terms with even number of the totally antisymmetric tensor M IJK in arXiv:0808.2473 and for the two-types of non-linear BF Lagrangians which include terms with odd number of M IJK as well in arXiv:0809:0985. For the former Lagrangian we derive directly the DBI-type Lagrangian expressed by the SU(N) dynamical A μ gauge field with a spacetime dependent coupling constant, while for the low-energy expansions of the latter Lagrangians the B μ integration is iteratively performed. The derived Janus field theory Lagrangians are compared.

Oxygen evolution from BF3/MnO4-.

Science.gov (United States)

Yiu, Shek-Man; Man, Wai-Lun; Wang, Xin; Lam, William W Y; Ng, Siu-Mui; Kwong, Hoi-Ki; Lau, Kai-Chung; Lau, Tai-Chu

2011-04-14

MnO(4)(-) is activated by BF(3) to undergo intramolecular coupling of two oxo ligands to generate O(2). DFT calculations suggest that there should be a spin intercrossing between the singlet and triplet potential energy surfaces on going from the active intermediate [MnO(2)(OBF(3))(2)](-) to the O···O coupling transition state.

Rate Coefficients for the Reactions of BF with O and O2.

Science.gov (United States)

1981-12-21

2 indicate that indi- vidual molecular orbitals of BF are quite asymmetric so that the small overall dipole moment could be misleading. Nevertheless...radiation effects on materials, lu- brication and surface phenomena, thersionic " emision . photosensitive materials and detectors, atomic frequency standards

Highly precise (liquid + liquid) equilibrium and heat capacity measurements near the critical point for [Bmim][BF4] + 1H, 1H, 2H, 2H perfluoroctanol

International Nuclear Information System (INIS)

Pérez-Sánchez, G.; Troncoso, J.; Losada-Pérez, P.; Méndez-Castro, P.; Romaní, L.

2013-01-01

Highlights: • Highly precise liquid–liquid curves for [Bmim][BF 4 ] + perfluoroctanol are reported. • Critical behavior of heat capacity for the same system was also characterized. • In contrast to previous results, no coulombic/solvophobic crossover for coexistence curve diameter was found. • The system criticality shows characteristics both solvophobic and coulombic. -- Abstract: Liquid + liquid equilibrium of the system [Bmim][BF 4 ] + 1H, 1H, 2H, 2H perfluoroctanol using a highly precise methodology based on refractive index measurements was experimentally determined. In addition, isobaric heat capacity near the critical point was obtained. The performance of the new refractive index set-up was successfully checked against the coexistence curve of the system dimethyl carbonate + decane, since highly accurate data are available in the literature. The choice of [Bmim][BF 4 ] + 1H, 1H, 2H, 2H perfluoroctanol was motivated by a previous experimental work, whose results suggest that this system could present characteristics of both solvophobic and coulombic behavior, which are the two categories to which an ionic system can belong. Although this was previously observed for other ionic systems, this mixture presented a very striking feature: the diameter of the coexistence curve seemed to change its criticality in the studied temperature range, from solvophobic far away to coulombic close to the critical point. The results of this work reveal that, in fact, [Bmim][BF 4 ] + 1H, 1H, 2H, 2H perfluoroctanol presents characteristics of both solvophobic and coulombic criticality, but no evidence of the observed crossover over the experimental temperature range has been found

Improvement of neutron kinetics module in TRAC-BF1code: one-dimensional nodal collocation method

Energy Technology Data Exchange (ETDEWEB)

Jambrina, Ana; Barrachina, Teresa; Miro, Rafael; Verdu, Gumersindo, E-mail: ajambrina@iqn.upv.es, E-mail: tbarrachina@iqn.upv.es, E-mail: rmiro@iqn.upv.es, E-mail: gverdu@iqn.upv.es [Universidade Politecnica de Valencia (UPV), Valencia (Spain); Soler, Amparo, E-mail: asoler@iberdrola.es [SEA Propulsion S.L., Madrid (Spain); Concejal, Alberto, E-mail: acbe@iberdrola.es [Iberdrola Ingenieria y Construcion S.A.U., Madrid (Spain)

2013-07-01

The TRAC-BF1 one-dimensional kinetic model is a formulation of the neutron diffusion equation in the two energy groups' approximation, based on the analytical nodal method (ANM). The advantage compared with a zero-dimensional kinetic model is that the axial power profile may vary with time due to thermal-hydraulic parameter changes and/or actions of the control systems but at has the disadvantages that in unusual situations it fails to converge. The nodal collocation method developed for the neutron diffusion equation and applied to the kinetics resolution of TRAC-BF1 thermal-hydraulics, is an adaptation of the traditional collocation methods for the discretization of partial differential equations, based on the development of the solution as a linear combination of analytical functions. It has chosen to use a nodal collocation method based on a development of Legendre polynomials of neutron fluxes in each cell. The qualification is carried out by the analysis of the turbine trip transient from the NEA benchmark in Peach Bottom NPP using both the original 1D kinetics implemented in TRAC-BF1 and the 1D nodal collocation method. (author)

M1 distributions for {sup 163}Dy and {sup 157}Gd in the SU{sup BF}{sub sdg}(3) and SU{sup BF}{sub sd}(3) x 1g limits of pn-sdgIBFM

Energy Technology Data Exchange (ETDEWEB)

Devi, Y.D. [Saha Inst. of Nuclear Physics, Calcutta (India); Kota, V.K.B. [Physical Research Laboratory, Ahmedabad 380 009 (India)

1996-04-01

The SU{sup BF}{sub sdg}(3) limit of pn-sdgIBFM, which was developed earlier, is applied with success in analyzing the recently observed M1 data in the {sup 163}Dy nucleus. As new experiments are being planned for {sup 157}Gd nucleus and that {sup 156}Gd is known to be a good SU{sub sd}(3) x 1g nucleus, in the second part of the paper a formalism for M1 distributions in the SU{sup BF}{sub sd}(3) x 1g limit is developed. In both these analytically solvable limiting situations, predictions are made for M1 distributions in the {sup 157}Gd nucleus. (orig.).

Performance Test of BF3 Neutron Detection System

Energy Technology Data Exchange (ETDEWEB)

Choi, Yu Sun; Shin, Ho Cheol [KHNP-CRI, Daejeon (Korea, Republic of); Cho, Jin Bok; Oh, Sae Hyun; Ryou, Seok Jean [USERS, Daejeon (Korea, Republic of)

2015-10-15

The neutron detecting system of First-of-a-kind plant such an APR1400 at Shin Kori should have been verified in the condition of low operating temperature and pressure of the primary coolant system before receiving the operation license. Auxiliary Ex-core Neutron Flux Monitoring System (AENFMS) is supposed to be installed using BF3 neutron detector in Shin Kori plant. The performance test of AENFMS was conducted to measure neutron sensitivity, moderation ratio and count rate in the same condition with Ex-core Neutron Flux Monitoring System (ENFMS) of APR1400 to verify its detection characteristics in compliance with the functional requirement. Performance test has been conducted for AENFMS of APR1400 to verify BF3 neutron sensitivity, moderation ration of PE, expecting neutron signal count rate from AENFMS, possible extending cable length from detector to pre-amplifier. As a result of measurement, the neutron sensitivity of 34.246±0.168(95%CI)cps/nv, moderation ratio of 11.343±0.039(95%CI) and AENFMS expecting count rate related to ENFMS of 17.8 times are acceptable in compliance with functional requirement, respectively.

Crystal structure and characterization of the novel NH+⋯N hydrogen bonded polar crystal [NH2(CH2)4NH][BF4

Science.gov (United States)

Wojtaś, M.; Gaģor, A.; Czupiński, O.; Medycki, W.; Jakubas, R.

2012-03-01

Dielectric properties and phase transitions of the piperazinium tetrafluoroborate ([NH2(CH2)4NH][BF4], abbreviated as PFB) crystal are related to the one-dimensional arrangement of the cations linked by the bistable NH+⋯N hydrogen bonds and molecular motions of the [BF4]- units. The crystal structure of [NH2(CH2)4NH][BF4] is monoclinic at room temperature with the polar space group Pn. The polar/acentric properties of the room temperature phase IV have been confirmed by the piezoelectric and pyroelectric measurements. DSC measurements show that the compound undergoes three first-order structural phase transitions: at 421/411 K (heating/cooling), at 386/372 K and at 364/349 K. 1H and 19F NMR measurements indicate the reorientational motions of [BF4]- anions and piperazinium(+) cations as well as the proton motion in the hydrogen-bonded chains of piperazine along the [001] direction. Over the phase I the isotropic reorientational motions or even self-diffusion of the cations and anions are expected. The conductivity measurements in the vicinity of the II-I PT indicate a superionic phase over the phase I.

The reaction of Cs{sub 2}[Tc(NO)F{sub 5}] with BF{sub 3} in acetonitrile. Formation and structure of [{Tc(NO)(CH_3CN)_4}{sub 2}(μ-F)](BF{sub 4}){sub 3}

Energy Technology Data Exchange (ETDEWEB)

Balasekaran, Samundeeswari Mariappan [Institute of Chemistry and Biochemistry, Freie Universitaet Berlin (Germany); Department of Chemistry, University of Nevada, Las Vegas, NV (United States); Hagenbach, Adelheid; Spandl, Johann; Abram, Ulrich [Institute of Chemistry and Biochemistry, Freie Universitaet Berlin (Germany)

2017-10-04

The deep blue, paramagnetic Cs{sub 2}[Tc{sup II}(NO)F{sub 5}] is formed during reactions of pertechnetate, acetohydroxamic acid, and CsF in aqueous HF. A reaction of Cs{sub 2}[Tc(NO)F{sub 5}] with BF{sub 3}.MeOH in acetonitrile gives yellow blocks of the fluorido-bridged dimer [{Tc"I(NO)(CH_3CN)_4}{sub 2}F](BF{sub 4}){sub 3}. The compound is stable as solid and in acetonitrile solutions. The complex cation contains a bent μ-F{sup -} ligand and two linear nitrosyl groups. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

[Cu(I)(bpp)]BF4: the first extended coordination network prepared solvothermally in an ionic liquid solvent.

Science.gov (United States)

Jin, Kun; Huang, Xiaoying; Pan, Long; Li, Jing; Appel, Aaron; Wherland, Scot; Pang, Long

2002-12-07

Use of an ionic liquid [bmim][BF4] (bmim = 1-butyl-3-methylimidazolium) as solvent has resulted in the first extended coordination structure, the two-dimensional network [Cu(bpp)]BF4 [bpp = 1,3-bis(4-pyridyl)propane], produced via a solvothermal route.

Crystal structure and characterization of the novel NH+⋯N hydrogen bonded polar crystal [NH2(CH2)4NH][BF4

International Nuclear Information System (INIS)

Wojtaś, M.; Gagor, A.; Czupiński, O.; Medycki, W.; Jakubas, R.

2012-01-01

Dielectric properties and phase transitions of the piperazinium tetrafluoroborate ([NH 2 (CH 2 ) 4 NH][BF 4 ], abbreviated as PFB) crystal are related to the one-dimensional arrangement of the cations linked by the bistable NH + ⋯N hydrogen bonds and molecular motions of the [BF 4 ] − units. The crystal structure of [NH 2 (CH 2 ) 4 NH][BF 4 ] is monoclinic at room temperature with the polar space group Pn. The polar/acentric properties of the room temperature phase IV have been confirmed by the piezoelectric and pyroelectric measurements. DSC measurements show that the compound undergoes three first-order structural phase transitions: at 421/411 K (heating/cooling), at 386/372 K and at 364/349 K. 1 H and 19 F NMR measurements indicate the reorientational motions of [BF 4 ] − anions and piperazinium(+) cations as well as the proton motion in the hydrogen-bonded chains of piperazine along the [001] direction. Over the phase I the isotropic reorientational motions or even self-diffusion of the cations and anions are expected. The conductivity measurements in the vicinity of the II–I PT indicate a superionic phase over the phase I. - Graphical abstract: It must be emphasized that the titled compound represents the first organic–inorganic simple salt containing the single-protonated piperazinium cation which was studied by means of the wide variety of experimental techniques. A survey of Cambridge Structural Database (CSD version 5.32 (November 2010) and updates (May 2011)) for structure containing the piperazinium cations yields 248 compounds with the doubly protonated piperazinium(2+) cations and only eight compounds with the singly protonated piperazinium(+) cations. Among these structures only one is the hybrid organic–inorganic material. This is piperazinium nitrate characterized structurally. The crystal packing of [NH 2 (CH 2 ) 4 NH][BF 4 ], phase IV. The dashed lines stand for the hydrogen bonds. The hydrogen bonds to BF4 groups are not included for

BF integrase genes of HIV-1 circulating in São Paulo, Brazil, with a recurrent recombination region.

Directory of Open Access Journals (Sweden)

Atila Iamarino

Full Text Available Although some studies have shown diversity in HIV integrase (IN genes, none has focused particularly on the gene evolving in epidemics in the context of recombination. The IN gene in 157 HIV-1 integrase inhibitor-naïve patients from the São Paulo State, Brazil, were sequenced tallying 128 of subtype B (23 of which were found in non-B genomes, 17 of subtype F (8 of which were found in recombinant genomes, 11 integrases were BF recombinants, and 1 from subtype C. Crucially, we found that 4 BF recombinant viruses shared a recurrent recombination breakpoint region between positions 4900 and 4924 (relative to the HXB2 that includes 2 gRNA loops, where the RT may stutter. Since these recombinants had independent phylogenetic origin, we argue that these results suggest a possible recombination hotspot not observed so far in BF CRF in particular, or in any other HIV-1 CRF in general. Additionally, 40% of the drug-naïve and 45% of the drug-treated patients had at least 1 raltegravir (RAL or elvitegravir (EVG resistance-associated amino acid change, but no major resistance mutations were found, in line with other studies. Importantly, V151I was the most common minor resistance mutation among B, F, and BF IN genes. Most codon sites of the IN genes had higher rates of synonymous substitutions (dS indicative of a strong negative selection. Nevertheless, several codon sites mainly in the subtype B were found under positive selection. Consequently, we observed a higher genetic diversity in the B portions of the mosaics, possibly due to the more recent introduction of subtype F on top of an ongoing subtype B epidemics and a fast spread of subtype F alleles among the B population.

Equivalent and Alternative Forms for BF Gravity with Immirzi Parameter

Directory of Open Access Journals (Sweden)

Merced Montesinos

2011-11-01

Full Text Available A detailed analysis of the BF formulation for general relativity given by Capovilla, Montesinos, Prieto, and Rojas is performed. The action principle of this formulation is written in an equivalent form by doing a transformation of the fields of which the action depends functionally on. The transformed action principle involves two BF terms and the two Lorentz invariants that appear in the original action principle generically. As an application of this formalism, the action principle used by Engle, Pereira, and Rovelli in their spin foam model for gravity is recovered and the coupling of the cosmological constant in such a formulation is obtained.

Quantitative kinetic analysis of PET amyloid imaging agents [11C]BF227 and [18F]FACT in human brain

International Nuclear Information System (INIS)

Shidahara, Miho; Watabe, Hiroshi; Tashiro, Manabu; Okamura, Nobuyuki; Furumoto, Shozo; Watanuki, Shoichi; Furukawa, Katsutoshi; Arakawa, Yuma; Funaki, Yoshihito; Iwata, Ren; Gonda, Kohsuke; Kudo, Yukitsuka; Arai, Hiroyuki; Ishiwata, Kiichi; Yanai, Kazuhiko

2015-01-01

Introduction: The purpose of this study was to compare two amyloid imaging agents, [ 11 C]BF227 and [ 18 F]FACT (derivative from [ 11 C]BF227) through quantitative pharmacokinetics analysis in human brain. Methods: Positron emission tomography studies were performed on six elderly healthy control (HC) subjects and seven probable Alzheimer’s disease (AD) patients with [ 11 C]BF227 and 10 HC subjects and 10 probable AD patients with [ 18 F]FACT. Data from nine regions of interest were analyzed by several approaches, namely non-linear least-squared fitting methods with arterial input functions (one-tissue compartment model(1TCM), two-tissue compartment model (2TCM)), Logan plot, and linearized methods with reference region (Reference Logan plot (RefLogan), MRTM0, MRTM2). We also evaluated SUV and SUVR for both tracers. The parameters estimated by several approaches were compared between two tracers for detectability of differences between HC and AD patients. Results: For [ 11 C]BF227, there were no significant difference of V T (2TCM, 1TCM) and SUV in all regions (Student t-test; p < 0.05) and significant differences in the DVRs (Logan, RefLogan, and MRTM2) and SUVRs in six neocortical regions (p < 0.05) between the HC and AD groups. For [ 18 F]FACT, significant differences in DVRs (RefLogan, MRTM0, and MRTM2) were observed in more than four neocortical regions between the HC and AD groups (p < 0.05), and the significant differences were found in SUVRs for two neocortical regions (inferior frontal coretex and lateral temporal coretex). Our results showed that both tracers can clearly distinguish between HC and AD groups although the pharmacokinetics and distribution patterns in brain for two tracers were substantially different. Conclusion: This study revealed that although the PET amyloid imaging agents [ 11 C]BF227 and [ 18 F]FACT have similar chemical and biological properties, they have different pharmacokinetics, and caution must be paid for usage of the

Performance enhancement of Ge-on-Insulator tunneling FETs with source junctions formed by low-energy BF2 ion implantation

Science.gov (United States)

Katoh, Takumi; Matsumura, Ryo; Takaguchi, Ryotaro; Takenaka, Mitsuru; Takagi, Shinichi

2018-04-01

To clarify the process of formation of source regions of high-performance Ge n-channel tunneling field-effect transistors (TFETs), p+-n junctions formed by low-energy ion implantation (I/I) of BF2 atoms are characterized. Here, the formation of p+-n junctions with steep B profiles and low junction leakage is a key issue. The steepness of 5.7 nm/dec in profiles of B implanted into Ge is obtained for BF2 I/I at 3 keV with a dose of 4 × 1014 cm-2. Ge-on-insulator (GOI) n-TFETs with the source tunnel junctions formed by low-energy B and BF2 I/I are fabricated on GOI substrates and the device operation is confirmed. Although the performance at room temperature is significantly degraded by the source junction leakage current, an I on/I off ratio of 105 and the minimum sub-threshold swing (S.S.) of 130 mV/dec are obtained at 10 K. It is found that GOI n-TFETs with steeper B profiles formed by BF2 I/I have led to higher on current and a lower sub-threshold slope, demonstrating the effectiveness of steep B profiles in enhancing the GOI TFET performance.

Photomagnetic studies on spin-crossover solid solutions containing two different metal complexes, [Fe(1-bpp)(2)](x)[M(terpy)2](1-x)[BF4]2 (M = Ru or Co).

Science.gov (United States)

Chastanet, Guillaume; Tovee, Clare A; Hyett, Geoffrey; Halcrow, Malcolm A; Létard, Jean-François

2012-04-28

The photomagnetic properties of two series of spin-crossover solid solutions, [Fe(1-bpp)(2)](x)[Ru(terpy)(2)](1-x)(BF(4))(2) and [Fe(1-bpp)(2)](x)[Co(terpy)(2)](1-x)(BF(4))(2) (1-bpp = 2,6-bis[pyrazol-1-yl]pyridine), have been investigated. For all the materials, the evolution of the T(LIESST) value, the high-spin → low-spin relaxation parameters and the LITH loops were thoroughly studied. Interestingly in the Fe:Co series, along the photo-excitation, cobalt ions are concomitantly converted from low-spin to high-spin states with the iron centres, and also fully relax after light excitation. This journal is © The Royal Society of Chemistry 2012

Study of thermal spin crossover in [Fe(II)(isoxazole)(6)](BF4)(2) with Mossbauer spectroscopy

NARCIS (Netherlands)

Bhattacharjee, A.; van Koningsbruggen, P. J.; Hibbs, W.; Miller, Joel S.; Guetlich, P.

2007-01-01

Fe-57 Mossbauer spectroscopy of the mononuclear [Fe( II)( isoxazole)(6)]( BF4)(2) compound has been studied to reveal the thermal spin crossover of Fe( II) between low- spin ( S = 0) and high- spin ( S = 2) states. A temperature-dependent spin transition curve has been constructed with the least-

Turbine trip transient analysis in peach bottom NPP with TRAC-BF1 code and Simtab-1D methodology

International Nuclear Information System (INIS)

Barrachina, T.; Miro, R.; Verdu, G.; Collazo, I.; Gonzalez, P.; Concejal, A.; Ortego, P.; Melara, J.

2010-01-01

In TRAC-BF1 nuclear cross-sections are specified in the input deck in as a polynomial expansion. Therefore, it is necessary to obtain the coefficients of this polynomial function. One of the methods proposed in the literature is the KINPAR methodology. This methodology uses the results from different perturbations of the original state to obtain the coefficients of the polynominal expansion. The simulations are performed using the SIMULATE3 code. In this work, a new methodology to obtain the cross-sections set in 1D is presented. The first step consists of the application of the SIMTAB methodology, developed in UPV, to obtain the 3D cross-sections sets from CASMO4/SIMULATE3. These 3D cross-sections sets are collapsed to 1D, using as a weighting factor the 3D thermal and rapid neutron fluxes obtained from SIMULATE3. The 1D cross-sections obtained are in the same format as the 3D sets, hence, it has been necessary to modify the TRAC-BF1 code in order to be able to read and interpolate between these tabulated 1D cross-sections. With this new methodology it is not necessary to perform simulations of different perturbations of the original state, and also the variation range of the moderator density can be higher than using the former KINPAR methodology. This is important for simulating severe accidents in which the variables vary in a wide range. This new methodology is applied to the simulation of the turbine trip transient Benchmark in Peach Bottom NPP using the TRAC-BF1 code. The results of the transient simulation in TRAC-BF1 using the KINPAR methodology and the new methodology, SIMTAB-1D, are compared. (author)

Mixing thermodynamic properties of 1-butyl-4-methylpyridinium tetrafluoroborate [b4mpy][BF{sub 4}] with water and with an alkan-1ol (methanol to pentanol)

Energy Technology Data Exchange (ETDEWEB)

Ortega, J. [Laboratorio de Termodinamica y Fisicoquimica de Fluidos, Parque Cientifico-Tecnologico, Campus Universitario de Tafira, Universidad de Las Palmas de Gran Canaria, 35071-Las Palmas de Gran Canaria, Canary Islands (Spain)], E-mail: jortega@dip.ulpgc.es; Vreekamp, R.; Penco, E.; Marrero, E. [Laboratorio de Termodinamica y Fisicoquimica de Fluidos, Parque Cientifico-Tecnologico, Campus Universitario de Tafira, Universidad de Las Palmas de Gran Canaria, 35071-Las Palmas de Gran Canaria, Canary Islands (Spain)

2008-07-15

This article presents a study of the behaviour in solution of 1-butyl-4-methylpyridinium tetrafluoroborate [b4mpy][BF{sub 4}] in water and in the first five alkanols of the series methanol to pentan-1-ol. The excess enthalpies, H{sub m}{sup E} and volumes, V{sub m}{sup E} were determined at the temperatures (298.15 and 318.15) K. At these temperatures, the [b4mpy][BF{sub 4}] was completely miscible in water, methanol, and ethanol, but only partially miscible in the other alkanols. A solubility study was carried out and the (liquid + liquid) equilibria of the ([b4mpy][BF{sub 4}] + alkanol) systems were experimentally determined, evaluating zones of complete miscibility and determining the UCST in each case. The mixtures with water gave positive values of H{sub m}{sup E} and V{sub m}{sup E}, being also positive the changes of these quantities with temperature. The mixtures with alkanols gave values of H{sub m}{sup E}>0 and V{sub m}{sup E}<0, and for these binary mixtures (dH{sub m}{sup E}/dT){sub p}>0 and (dV{sub m}{sup E}/dT){sub p}<0. For all cases, results were interpreted and compared with data obtained in mixtures with another isomer [b3mpy][BF{sub 4}]. Excess properties were correlated with a suitable equation and the area and volume parameters were calculated for [b4mpy][BF{sub 4}].

Recrystallization of implanted amorphous silicon layers. I. Electrical properties of silicon implanted with BF+2 or Si++B+

International Nuclear Information System (INIS)

Tsai, M.Y.; Streetman, B.G.

1979-01-01

Electrical properties of recrystallized amorphous silicon layers, formed by BF + 2 implants or Si + +B + implants, have been studied by differential resistivity and Hall-effect measurements. Electrical carrier distribution profiles show that boron atoms inside the amorphized Si layers can be fully activated during recrystallization at 550 0 C. The mobility is also recovered. However, the tail of the B distribution, located inside a damaged region near the original amorphous-crystalline interface, remains inactive. This inactive tail has been observed for all samples implanted with BF + 2 . Only in a thicker amorphous layer, formed for example by Si + predamage implants, can the entire B profile be activated. The etch rate of amorphous silicon in HF and the effect of fluorine on the recrystallization rate are also reported

Green synthesis of 2,3,4,9-tetrahydro-1H-carbazoles/ 2,3-dimethylindoles catalyzed by [bmim (BF 4] ionic liquid in methanol

Directory of Open Access Journals (Sweden)

Tamatakallu O. Shrungesh Kumar

2013-03-01

Full Text Available 1-butyl-3-methylimidazolium tetrafluoroborate [bmim (BF 4] ionic liquid has been used as catalyst for the synthesis of tetrahydrocarbazoles and 2, 3-dimethylindoles with excellent yields in a shorter reaction time. The results show that the [bmim (BF 4] ionic liquid is very efficient in the Fischer indole synthesis due to its operational simplicity, high yields, dual catalyst-solvent properties and reused for five consecutive reactions without significant loss of catalytic efficiency. The applicability of the methodology for large-scale reaction highlights its potentiality for industrial scale synthesis. The main advantage of this procedure is that the products could be obtained in pure form after filtration and evaporation of MeOH solvent.

Separation of toluene from n-heptane by liquid–liquid extraction using binary mixtures of [bpy][BF4] and [4bmpy][Tf2N] ionic liquids as solvent

International Nuclear Information System (INIS)

García, Silvia; Larriba, Marcos; García, Julián; Torrecilla, José S.; Rodríguez, Francisco

2012-01-01

Highlights: ► Binary mixtures of ionic liquids as extraction solvents of aromatics. ► [4bmpy][Tf 2 N] shows higher capacity but lower selectivity than sulfolane. ► [bpy][BF 4 ] shows lower capacity but higher selectivity than sulfolane. ► Mixed {[4bmpy][Tf 2 N] + [bpy][BF 4 ]} improves both extractive properties. - Abstract: The use of binary mixture of ionic liquids N-butylpyridinium tetrafluoroborate ([bpy][BF 4 ]), and 1-butyl-4-methylpyridinium bis(trifluoromethylsulfonyl)imide ([4bmpy][Tf 2 N]) in the liquid–liquid extraction of toluene from n-heptane has been investigated at 313.2 K and atmospheric pressure. The experimental capacity of extraction and selectivity for this binary mixture has proved to be intermediate to those corresponding to the pure ionic liquids, and they can be predicted using a logarithmic–linear model of solubility. Furthermore, the results showed that the use of binary mixture of {[bpy][BF 4 ] + [4bmpy][Tf 2 N]} at a mole solvent composition around 0.7 for [bpy][BF 4 ] improves both the capacity of extraction of toluene and the selectivity with respect to those of sulfolane, the organic solvent taken as a benchmark. Thus, this mixed ionic liquid could be likely to be used in the extraction of aromatic from aliphatic in replacement to sulfolane.

BF2.649 [1-{3-[3-(4-Chlorophenyl)propoxy]propyl}piperidine, hydrochloride], a nonimidazole inverse agonist/antagonist at the human histamine H3 receptor: Preclinical pharmacology.

Science.gov (United States)

Ligneau, X; Perrin, D; Landais, L; Camelin, J-C; Calmels, T P G; Berrebi-Bertrand, I; Lecomte, J-M; Parmentier, R; Anaclet, C; Lin, J-S; Bertaina-Anglade, V; la Rochelle, C Drieu; d'Aniello, F; Rouleau, A; Gbahou, F; Arrang, J-M; Ganellin, C R; Stark, H; Schunack, W; Schwartz, J-C

2007-01-01

Histamine H3 receptor inverse agonists are known to enhance the activity of histaminergic neurons in brain and thereby promote vigilance and cognition. 1-{3-[3-(4-Chlorophenyl)propoxy]propyl}piperidine, hydrochloride (BF2.649) is a novel, potent, and selective nonimidazole inverse agonist at the recombinant human H3 receptor. On the stimulation of guanosine 5'-O-(3-[35S]thio)triphosphate binding to this receptor, BF2.649 behaved as a competitive antagonist with a Ki value of 0.16 nM and as an inverse agonist with an EC50 value of 1.5 nM and an intrinsic activity approximately 50% higher than that of ciproxifan. Its in vitro potency was approximately 6 times lower at the rodent receptor. In mice, the oral bioavailability coefficient, i.e., the ratio of plasma areas under the curve after oral and i.v. administrations, respectively, was 84%. BF2.649 dose dependently enhanced tele-methylhistamine levels in mouse brain, an index of histaminergic neuron activity, with an ED50 value of 1.6 mg/kg p.o., a response that persisted after repeated administrations for 17 days. In rats, the drug enhanced dopamine and acetylcholine levels in microdialysates of the prefrontal cortex. In cats, it markedly enhanced wakefulness at the expense of sleep states and also enhanced fast cortical rhythms of the electroencephalogram, known to be associated with improved vigilance. On the two-trial object recognition test in mice, a promnesiant effect was shown regarding either scopolamine-induced or natural forgetting. These preclinical data suggest that BF2.649 is a valuable drug candidate to be developed in wakefulness or memory deficits and other cognitive disorders.

Different strain relaxation mechanisms in strained Si/Si sub 1 sub - sub x Ge sub x /Si heterostructures by high dose B sup + and BF sub 2 sup + doping

CERN Document Server

Chen, C C; Zhang, S L; Zhu, D Z; Vantomme, A

2002-01-01

Strained Si/Si sub 0 sub . sub 8 Ge sub 0 sub . sub 2 /Si heterostructures are implanted at room temperature with 7.5 keV B sup + and 33 keV BF sub 2 sup + ions to a high dose of 2x10 sup 1 sup 5 ions/cm sup 2 , respectively. The samples are subsequently subjected to three-step anneals (spacer anneal, oxidation anneal and rapid thermal anneal), which are used to simulate a real fabrication process of SiGe-based MOSFET devices. The damage induced by implantation and its recovery are characterized by 2 MeV sup 4 He sup + RBS/channeling spectrometry. A damage layer on the surface is induced by B sup + implantation, but BF sup + sub 2 ion implantation amorphizes the surface of Si/Si sub 0 sub . sub 8 Ge sub 0 sub . sub 2 /Si heterostructure. Channeling angular scans along the axial direction demonstrate that the strain stored in the SiGe layer could be nearly completely retained for the B sup + implanted and subsequently annealed sample. However, the strain in the BF sub 2 sup + implanted/annealed SiGe layer has...

An R-matrix study of electron induced processes in BF3 plasma

Science.gov (United States)

Gupta, Dhanoj; Chakrabarti, Kalyan; Yoon, Jung-Sik; Song, Mi-Young

2017-12-01

An R-matrix formalism is used to study electron collision with the BF3 molecule using Quantemol-N, a computational system for electron molecule collisions which uses the molecular R-matrix method. Several target models are tested for BF3 in its equilibrium geometry, and the results are presented for the best model. Scattering calculations are then performed to yield resonance parameters, elastic, differential, excitation, and momentum transfer cross sections. The results for all the cross sections are compared with the experimental and theoretical data, and a good agreement is obtained. The resonances have been detected at 3.79 and 13.58 eV, with the ionization threshold being 15.7 eV. We have also estimated the absolute dissociative electron attachment (DEA) cross section for the F- ion production from BF3, which is a maiden attempt. The peak of the DEA is at around 13.5 eV, which is well supported by the resonance detected at 13.58 eV. The cross sections reported here find a variety of applications in the plasma technology.

Effect of bone marrow-derived CD11b(+)F4/80 (+) immature dendritic cells on the balance between pro-inflammatory and anti-inflammatory cytokines in DBA/1 mice with collagen-induced arthritis.

Science.gov (United States)

Fu, Jingjing; Zhang, Lingling; Song, Shanshan; Sheng, Kangliang; Li, Ying; Li, Peipei; Song, Shasha; Wang, Qingtong; Chu, Jianhong; Wei, Wei

2014-05-01

To explore the effect of bone marrow-derived CD11b(+)F4/80(+) immature dendritic cells (BM CD11b(+)F4/80(+)iDC) on the balance between pro-inflammatory and anti-inflammatory cytokines in DBA/1 mice with collagen-induced arthritis (CIA). BM CD11b(+)F4/80(+)iDC were induced with rmGM-CSF and rmIL-4, and were identified by the expressions of toll-like receptor 2 (TLR-2), indoleamine 2,3-deoxygenase (IDO), interleukin (IL)-10, transforming growth factor (TGF)-β1 and mixed leukocyte reaction (MLR). CIA was established in DBA/1 mice by immunization with type II collagen. CIA mice were injected intravenously with BM CD11b(+)F4/80(+)iDC three times after immunization. The effect of BM CD11b(+)F4/80(+)iDC on CIA was evaluated by the arthritis index, joint histopathology, body weight, thymus index, thymocytes proliferation, IL-1β, tumor necrosis factor (TNF)-α, IL-17, IL-10 and TGF-β1 levels. BM CD11b(+)F4/80(+)iDC induced with rmGM-CSF and rmIL-4 expressed high levels of TLR-2, IDO, IL-10 and TGF-β1. Infusion of BM CD11b(+)F4/80(+)iDC in CIA mice significantly reduced the arthritis index and pathological scores of joints, recovered the weight, decreased the thymus index and inhibited thymocyte proliferation. Levels of IL-1β, TNF-α and IL-17 were decreased in BM CD11b(+)F4/80(+)iDC-treated mice. BM CD11b(+)F4/80(+)iDC can be induced successfully with rmGM-CSF and rmIL-4. BM CD11b(+)F4/80(+)iDC treatment can ameliorate the development and severity of CIA by regulating the balance between pro-inflammatory cytokines and anti-inflammatory cytokines.

Pressure-induced change in the Raman spectra of ionic liquid [DEME][BF4]-H2O mixtures

International Nuclear Information System (INIS)

Imai, Y; Abe, H; Goto, T; Miyashita, T; Yoshimura, Y

2010-01-01

We have measured Raman spectral changes of N,N,diethyl-N-methyl-N-(2-methoxyethyl) ammonium tetrafluoroborate, [DEME][BF 4 ]-H 2 O mixtures under high pressure. All the Raman spectra of mixtures of water concentrations below 50.0 mol% H 2 O changed at around 1 GPa at room temperature. The spectrum at high pressure is completely different from that obtained by cooling the sample at a normal pressure.

Thermally Tunable Dual Emission of the d8–d8 Dimer [Pt2(μ-P2O5(BF2)2)4]4–

Czech Academy of Sciences Publication Activity Database

Hofbeck, T.; Lam, Y.; Ch.; Kalbáč, Martin; Záliš, Stanislav; Vlček, Antonín; Yersin, H.

2016-01-01

Roč. 55, č. 5 (2016), s. 2441-2449 ISSN 0020-1669 R&D Projects: GA MŠk LH13015; GA MŠk LD14129; GA MŠk LL1301 Grant - others:COST(XE) cm1202 Institutional support: RVO:61388955 Keywords : High-resolution fluorescence * phosphorescence spectra * [Pt2(μ-P2O5(BF2)2)4]4− (Pt(pop-BF2)) Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.857, year: 2016

Comparison of the local binding motifs in the imidazolium-based ionic liquids [EMIM][BF{sub 4}] and [EMMIM][BF{sub 4}] through cryogenic ion vibrational predissociation spectroscopy: Unraveling the roles of anharmonicity and intermolecular interactions

Energy Technology Data Exchange (ETDEWEB)

Fournier, Joseph A.; Wolke, Conrad T.; Johnson, Christopher J.; Johnson, Mark A., E-mail: mark.johnson@yale.edu, E-mail: mccoy@chemistry.ohio-state.edu [Sterling Chemistry Laboratory, Yale University, New Haven, Connecticut 06520 (United States); McCoy, Anne B., E-mail: mark.johnson@yale.edu, E-mail: mccoy@chemistry.ohio-state.edu [Department of Chemistry and Biochemistry, The Ohio State University, Columbus, Ohio 43210 (United States)

2015-02-14

We clarify the role of the critical imidazolium C{sub (2)}H position (the central C between N atoms in the heterocycle) in the assembly motif of the [EMIM][BF{sub 4}] ionic liquid by analyzing the vibrational spectra of the bare EMIM{sup +} ion as well as that of the cationic [EMIM]{sub 2}[BF{sub 4}]{sup +} (EMIM{sup +} = 1-ethyl-3-methylimidazolium, C{sub 6}H{sub 11}N{sub 2}{sup +}) cluster. Vibrational spectra of the cold, mass-selected ions are obtained using cryogenic ion vibrational predissociation of weakly bound D{sub 2} molecules formed in a 10 K ion trap. The C{sub (2)}H behavior is isolated by following the evolution of key vibrational features when the C{sub (2)} hydrogen, the proposed binding location of the anion to the imidazolium ring, is replaced by either deuterium or a methyl group (i.e., in the EMMIM{sup +} analogue). Strong features in the ring CH stretching region of the bare ion are traced to Fermi resonances with overtones of lower frequency modes. Upon incorporation into the EMIM{sup +} ⋅ ⋅ ⋅ BF{sub 4}{sup −} ⋅ ⋅ ⋅ EMIM{sup +} ternary complex, the C{sub (2)}H oscillator strength is dramatically increased, accounting for the much more complicated patterns derived from the EMIM{sup +} ring CH stretches in the light isotopomer, which are strongly suppressed in the deuterated analogue. Further changes in the spectra that occur when the C{sub (2)}H is replaced by a methyl group are consistent with BF{sub 4}{sup −} attachment directly to the imidazolium ring in an arrangement that maximizes the electrostatic interaction between the molecular ions.

Membrane fouling mechanism of biofilm-membrane bioreactor (BF-MBR): Pore blocking model and membrane cleaning.

Science.gov (United States)

Zheng, Yi; Zhang, Wenxiang; Tang, Bing; Ding, Jie; Zheng, Yi; Zhang, Zhien

2018-02-01

Biofilm membrane bioreactor (BF-MBR) is considered as an important wastewater treatment technology that incorporates advantages of both biofilm and MBR process, as well as can alleviate membrane fouling, with respect to the conventional activated sludge MBR. But, to be efficient, it necessitates the establishment of proper methods for the assessment of membrane fouling. Four Hermia membrane blocking models were adopted to quantify and evaluate the membrane fouling of BF-MBR. The experiments were conducted with various operational conditions, including membrane types, agitation speeds and transmembrane pressure (TMP). Good agreement between cake formation model and experimental data was found, confirming the validity of the Hermia models for assessing the membrane fouling of BF-MBR and that cake layer deposits on membrane. Moreover, the influences of membrane types, agitation speeds and transmembrane pressure on the Hermia pore blocking coefficient of cake layer were investigated. In addition, the permeability recovery after membrane cleaning at various operational conditions was studied. This work confirms that, unlike conventional activated sludge MBR, BF-MBR possesses a low degree of membrane fouling and a higher membrane permeability recovery after cleaning. Copyright © 2017 Elsevier Ltd. All rights reserved.

TRACE and TRAC-BF1 benchmark against Leibstadt plant data during the event inadvertent opening of relief valves

Energy Technology Data Exchange (ETDEWEB)

Sekhri, A.; Baumann, P. [KernkraftwerkLeibstadt AG, 5325 Leibstadt (Switzerland); Wicaksono, D. [Swiss Federal Inst. of Technology Zurich ETH, 8092 Zurich (Switzerland); Miro, R.; Barrachina, T.; Verdu, G. [Inst. for Industrial, Radiophysical and Environmental Safety ISIRYM, Universitat Politecnica de Valencia UPV, Cami de Vera s/n, 46021 Valencia (Spain)

2012-07-01

In framework of introducing TRACE code to transient analyses system codes for Leibstadt Power Plant (KKL), a conversion process of existing TRAC-BF1 model to TRACE has been started within KKL. In the first step, TRACE thermal-hydraulic model for KKL has been developed based on existing TRAC-BF1 model. In order to assess the code models a simulation of plant transient event is required. In this matter simulations of inadvertent opening of 8 relief valves event have been performed. The event occurs at KKL during normal operation, and it started when 8 relief valves open resulting in depressurization of the Reactor Pressure Vessel (RPV). The reactor was shutdown safely by SCRAM at low level. The high pressure core spray (HPCS) and the reactor core isolation cooling (RCIC) have been started manually in order to compensate the level drop. The remaining water in the feedwater (FW) lines flashes due to saturation conditions originated from RPV depressurization and refills the reactor downcomer. The plant boundary conditions have been used in the simulations and the FW flow rate has been adjusted for better prediction. The simulations reproduce the plant data with good agreement. It can be concluded that the TRAC-BF1 existing model has been used successfully to develop the TRACE model and the results of the calculations have shown good agreement with plant recorded data. Beside the modeling assessment, the TRACE and TRAC-BF1 capabilities to reproduce plant physical behavior during the transient have shown satisfactory results. The first step of developing KKL model for TRACE has been successfully achieved and this model is further developed in order to simulate more complex plant behavior such as Turbine Trip. (authors)

TRACE and TRAC-BF1 benchmark against Leibstadt plant data during the event inadvertent opening of relief valves

International Nuclear Information System (INIS)

Sekhri, A.; Baumann, P.; Wicaksono, D.; Miro, R.; Barrachina, T.; Verdu, G.

2012-01-01

In framework of introducing TRACE code to transient analyses system codes for Leibstadt Power Plant (KKL), a conversion process of existing TRAC-BF1 model to TRACE has been started within KKL. In the first step, TRACE thermal-hydraulic model for KKL has been developed based on existing TRAC-BF1 model. In order to assess the code models a simulation of plant transient event is required. In this matter simulations of inadvertent opening of 8 relief valves event have been performed. The event occurs at KKL during normal operation, and it started when 8 relief valves open resulting in depressurization of the Reactor Pressure Vessel (RPV). The reactor was shutdown safely by SCRAM at low level. The high pressure core spray (HPCS) and the reactor core isolation cooling (RCIC) have been started manually in order to compensate the level drop. The remaining water in the feedwater (FW) lines flashes due to saturation conditions originated from RPV depressurization and refills the reactor downcomer. The plant boundary conditions have been used in the simulations and the FW flow rate has been adjusted for better prediction. The simulations reproduce the plant data with good agreement. It can be concluded that the TRAC-BF1 existing model has been used successfully to develop the TRACE model and the results of the calculations have shown good agreement with plant recorded data. Beside the modeling assessment, the TRACE and TRAC-BF1 capabilities to reproduce plant physical behavior during the transient have shown satisfactory results. The first step of developing KKL model for TRACE has been successfully achieved and this model is further developed in order to simulate more complex plant behavior such as Turbine Trip. (authors)

U-Healthcare Center Service in Busan City, South Korea: An Empirical Analysis and the Results of 1 Year of Service.

Science.gov (United States)

Bravo Santisteban, Ramiro D; Youm, Sekyoung; Park, Seung-Hun

2015-10-01

Studies have demonstrated that technological innovation is vital for prosperous economies, and greater technological innovation leads to improved public health indicators. The South Korean government has implemented policies to provide city services using information communication technologies, and ubiquitous healthcare (u-healthcare) wellness is one of these. This article presents the effects of using a u-healthcare center model that proves self-healthcare monitoring can work for the general population. The u-healthcare center has provided service to the public since April 2013. It is equipped with medical devices that evaluate physiological parameters such as weight, body mass index (BMI), blood pressure (BP), pulse rate (PR), and body fat (BF). This article focuses on the analysis of BMI, BP, PR, and BF parameters. Health test results from 12,766 voluntary patients of the u-healthcare center were analyzed during a 1-year period. The four health parameters from each of the four seasons were analyzed and compared, showing statistically significant seasonal differences. A Duncan's post hoc analysis showed that BMI did not differ between spring and summer, whereas BP differed throughout all seasons. Participation of females was higher compared with males, and men's average BMI was statistically higher than that of the women. Some additional significant findings for all participants were as follows: 48.8% scored normal in BMI, 31.7% scored normal-controlled in BP, 90.7% scored normal in PR, and 24.8% scored normal in BF. A survey showed that 96.4% found the u-healthcare center to be generally helpful, and 95.7% responded that they would recommend it. Implementation of u-healthcare projects provides a new public service toward evaluating health parameters, providing historical health information access, promoting self-monitoring, and motivating users to be more aware of their own health status.

Volumetric and viscosity properties of 1-butyl-3-methylimidazolium tetrafluoroborate ionic liquid in methanol%[Bmim]BF4离子液体在甲醇中的体积和黏度性质

Institute of Scientific and Technical Information of China (English)

李诗琴; 周贤丰; 许映杰

2013-01-01

在298.15 K和常压下,测定了1-丁基-3-甲基咪唑四氟硼酸([Bmim] BF4)离子液体+甲醇体系的密度和黏度.由密度计算了体系的表观摩尔体积,并采用Redlich-Mayer方程关联了体系的表观摩尔体积与组成的关系,得到了[Bmim]BF4在甲醇中的标准偏摩尔体积.由Jones-Dole方程对体系的黏度随组成的变化进行了拟合,获得了[Bmim] BF4在甲醇中的黏度B系数.结果表明:[Bmim] BF4+甲醇体系的表观摩尔体积和黏度均随[Bmim] BF4浓度的增加而增加,[Bmim] BF4在甲醇中的标准偏摩尔体积和黏度B系数分别为155.72×10-6m3/mol和0.282 9.%Densities and viscosities of l-butyl-3-methylimi-dazolium tetrafluoroborate ionic liquid ( [ Bmim ] BF4 ) with methanol were measured at 298. 15 K and atmospheric pressure. Apparent molar volumes, Vf of the above-mentioned mixture were determined from the experimental densities. Standard partial molar volume , Vo/f of [ Bmim] BF4 in methanol was estimated by the Redlich-Mayer equation. The achieved viscosities were used to calculate the viscosity B-coefficient of [ Bmim ] BF4 in methanol through Jones-Dole equation. The results indicate that the apparent molar volumes and viscosities increase with increasing of ionic liquid concentration. Standard partial molar volume and viscosity B-coefficient of [Bmim] BF4 in methanol is 155.72 ?10-6 m3 穖ol-1 and 0.282 9,respectively.

The BfR publishes workshop report based on the expert meeting on endocrine disruptors

OpenAIRE

German Federal Institute for Risk Assessment

2016-01-01

On the occasion of an expert meeting organised by the Federal Institute for Risk Assessment (BfR) held in Berlin on 11 and 12 April 2016, a consensus was reached on the identification of endocrine disruptors. The BfR has now published the workshop report from the conference. It contains, among other things, the consensus paper agreed by all participants. The report is published at http://www.bfr.bund.de/cm/349/scientific-principles-for-the-identification-of-endocrine-disrupting-chemicals-a-co...

Higgsless superconductivity from topological defects in compact BF terms

Directory of Open Access Journals (Sweden)

M. Cristina Diamantini

2015-02-01

Full Text Available We present a new Higgsless model of superconductivity, inspired from anyon superconductivity but P- and T-invariant and generalisable to any dimension. While the original anyon superconductivity mechanism was based on incompressible quantum Hall fluids as average field states, our mechanism involves topological insulators as average field states. In D space dimensions it involves a (D−1-form fictitious pseudovector gauge field which originates from the condensation of topological defects in compact low-energy effective BF theories. In the average field approximation, the corresponding uniform emergent charge creates a gap for the (D−2-dimensional branes via the Magnus force, the dual of the Lorentz force. One particular combination of intrinsic and emergent charge fluctuations that leaves the total charge distribution invariant constitutes an isolated gapless mode leading to superfluidity. The remaining massive modes organise themselves into a D-dimensional charged, massive vector. There is no massive Higgs scalar as there is no local order parameter. When electromagnetism is switched on, the photon acquires mass by the topological BF mechanism. Although the charge of the gapless mode (2 and the topological order (4 are the same as those of the standard Higgs model, the two models of superconductivity are clearly different since the origins of the gap, reflected in the high-energy sectors are totally different. In 2D this type of superconductivity is explicitly realised as global superconductivity in Josephson junction arrays. In 3D this model predicts a possible phase transition from topological insulators to Higgsless superconductors.

On chirality transfer in electron donor-acceptor complexes. A prediction for the sulfinimine···BF3 system.

Science.gov (United States)

Rode, Joanna E; Dobrowolski, Jan Cz

2012-01-01

Stabilization energies of the electron donor-acceptor sulfinimine···BF(3) complexes calculated at either the B3LYP/aug-cc-pVTZ or the MP2/aug-cc-pVTZ level do not allow to judge, whether the N- or O-atom in sulfinimine is stronger electron-donor to BF(3) . The problem seems to be solvable because chirality transfer phenomenon between chiral sulfinimine and achiral BF(3) is expected to be vibrational circular dichroism (VCD) active. Moreover, the bands associated with the achiral BF(3) molecule are predicted to be the most intense in the entire spectrum. However, the VCD band robustness analyses show that most of the chirality transfer modes of BF(3) are unreliable. Conversely, variation of VCD intensity with change of intermolecular distance, angle, and selected dihedrals between the complex partners shows that to establish the robustness of chirality transfer mode. It is also necessary to determine the influence of the potential energy surface (PES) shape on the VCD intensity. At the moment, there is still no universal criterion for the chirality transfer mode robustness and the conclusions formulated based on one system cannot be directly transferred even to a quite similar one. However, it is certain that more attention should be focused on relation of PES shape and the VCD mode robustness problem. Copyright © 2011 Wiley Periodicals, Inc.

Bauhinia forficata lectin (BfL) induces cell death and inhibits integrin-mediated adhesion on MCF7 human breast cancer cells.

Science.gov (United States)

Silva, Mariana C C; de Paula, Cláudia A A; Ferreira, Joana G; Paredes-Gamero, Edgar J; Vaz, Angela M S F; Sampaio, Misako U; Correia, Maria Tereza S; Oliva, Maria Luiza V

2014-07-01

Plant lectins have attracted great interest in cancer studies due to their antitumor activities. These proteins or glycoproteins specifically and reversibly bind to different types of carbohydrates or glycoproteins. Breast cancer, which presents altered glycosylation of cell surface glycoproteins, is one of the most frequent malignant diseases in women. In this work, we describe the effect of the lectin Bauhinia forficata lectin (BfL), which was purified from B. forficata Link subsp. forficata seeds, on the MCF7 human breast cancer cellular line, investigating the mechanisms involved in its antiproliferative activity. MCF7 cells were treated with BfL. Viability and adhesion alterations were evaluated using flow cytometry and western blotting. BfL inhibited the viability of the MCF7 cell line but was ineffective on MDA-MB-231 and MCF 10A cells. It inhibits MCF7 adhesion on laminin, collagen I and fibronectin, decreases α1, α6 and β1 integrin subunit expression, and increases α5 subunit expression. BfL triggers necrosis and secondary necrosis, with caspase-9 inhibition. It also causes deoxyribonucleic acid (DNA) fragmentation, which leads to cell cycle arrest in the G2/M phase and a decrease in the expression of the regulatory proteins pRb and p21. BfL shows selective cytotoxic effect and adhesion inhibition on MCF7 breast cancer cells. Cell death induction and inhibition of cell adhesion may contribute to understanding the action of lectins in breast cancer. Copyright © 2014 Elsevier B.V. All rights reserved.

A modified method of 3D-SSP analysis for amyloid PET imaging using [¹¹C]BF-227.

Science.gov (United States)

Kaneta, Tomohiro; Okamura, Nobuyuki; Minoshima, Satoshi; Furukawa, Katsutoshi; Tashiro, Manabu; Furumoto, Shozo; Iwata, Ren; Fukuda, Hiroshi; Takahashi, Shoki; Yanai, Kazuhiko; Kudo, Yukitsuka; Arai, Hiroyuki

2011-12-01

Three-dimensional stereotactic surface projection (3D-SSP) analyses have been widely used in dementia imaging studies. However, 3D-SSP sometimes shows paradoxical results on amyloid positron emission tomography (PET) analyses. This is thought to be caused by errors in anatomical standardization (AS) based on an (18)F-fluorodeoxyglucose (FDG) template. We developed a new method of 3D-SSP analysis for amyloid PET imaging, and used it to analyze (11)C-labeled 2-(2-[2-dimethylaminothiazol-5-yl]ethenyl)-6-(2-[fluoro]ethoxy)benzoxazole (BF-227) PET images of subjects with mild cognitive impairment (MCI) and Alzheimer's disease (AD). The subjects were 20 with MCI, 19 patients with AD, and 17 healthy controls. Twelve subjects with MCI were followed up for 3 years or more, and conversion to AD was seen in 6 cases. All subjects underwent PET with both FDG and BF-227. For AS and 3D-SSP analyses of PET data, Neurostat (University of Washington, WA, USA) was used. Method 1 involves AS for BF-227 images using an FDG template. In this study, we developed a new method (Method 2) for AS: First, an FDG image was subjected to AS using an FDG template. Then, the BF-227 image of the same patient was registered to the FDG image, and AS was performed using the transformation parameters calculated for AS of the corresponding FDG images. Regional values were normalized by the average value obtained at the cerebellum and values were calculated for the frontal, parietal, temporal, and occipital lobes. For statistical comparison of the 3 groups, we applied one-way analysis of variance followed by the Bonferroni post hoc test. For statistical comparison between converters and non-converters, the t test was applied. Statistical significance was defined as p SSP analysis of amyloid PET imaging possible. This new method of 3D-SSP analysis for BF-227 PET could prove useful for detecting differences between normal groups and AD and MCI groups, and between converters and non-converters.

BF3/nano-γ-Al2O3 Promoted Knoevenagel Condensation at Room Temperature

Directory of Open Access Journals (Sweden)

B. F. Mirjalili

2015-10-01

Full Text Available The Knoevenagel condensation of aromatic aldehydes with barbituric acid, dimedone and malononitrile occurred in the presence of BF3/nano-γ-Al2O3 at room temperature in ethanol. This catalyst is characterized by powder X-ray diffraction (XRD, fourier transform infrared spectroscopy (FT-IR, thermal gravimetric analysis (TGA, field emission scanning electron microscopy (FESEM and energy-dispersive X-ray spectroscopy (EDS.

Superacid Catalyzed Depolymerization and Conversion of Coals. Final Technical Report. [HF:BF{sub 2}/H{sub 2}

Science.gov (United States)

Olah, G.

1980-01-01

We were interested in applying superacid catalyzed cleavage-depolymerization and ionic hydrogenation low temperature conversion of coal to liquid hydrocarbon, as well as obtaining information about the reactions involved and the structure of intermediates of the coal liquefaction process. In order to show the feasibility of our proposed research we have carried out preliminary investigation in these areas. Preceding our work there was no practical application of a superacid system to coal liquefaction. We carried out an extensive study of the potential of the HF:BF{sub 3}/H{sub 2} system for coal hydroliquefaction. Under varying conditions of reactant ratio, reaction time and temperature, we were able to obtain over 95% pyridine extractible product by treating coal in HF:BF{sub 3}:H{sub 2} system at approx. 100 degrees C for 4 hours. The coal to acid ratio was 1:5 and FB{sub 3} at 900 psi and H{sub 2} at 500 psi were used. These are extremely encouraging results in that the conditions used are drastically milder than those used in any known process, such as Exxon donor solvent and related processes. The cyclohexane extractibility of the treated coal was as high as 27% and the yield of liquid distillate at 400 degrees C/5 x 10{sup -3}/sup torr/ was approx. 30%. The infrared spectrum of product coal, extracts and distillates were distinctly different from the starting coal and show a significant increase in the amount of saturates. The {sup 1}H NMR spectrum of cyclohexane extract of the treated coal shows essentially all aliphatic photons. The spectra of other treated coal extracts show increased amounts and types of aliphatic protons as well as significant amounts of protons bound to unsaturated sites. This again indicates that the HF-BF{sub 3} system is depolymerizing the coal to small fragments which are soluble in non-polar solvents.

Cartan's equations define a topological field theory of the BF type

International Nuclear Information System (INIS)

Cuesta, Vladimir; Montesinos, Merced

2007-01-01

Cartan's first and second structure equations together with first and second Bianchi identities can be interpreted as equations of motion for the tetrad, the connection and a set of two-form fields T I and R J I . From this viewpoint, these equations define by themselves a field theory. Restricting the analysis to four-dimensional spacetimes (keeping gravity in mind), it is possible to give an action principle of the BF type from which these equations of motion are obtained. The action turns out to be equivalent to a linear combination of the Nieh-Yan, Pontrjagin, and Euler classes, and so the field theory defined by the action is topological. Once Einstein's equations are added, the resulting theory is general relativity. Therefore, the current results show that the relationship between general relativity and topological field theories of the BF type is also present in the first-order formalism for general relativity

Behaviour of BF{sub 3} counters after in-pile irradiation; Comportement de compteurs a BF{sub 3} apres irradiation dans un reacteur

Energy Technology Data Exchange (ETDEWEB)

Verdant, R [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1967-07-01

The behaviour of a proportional BF{sub 3}LCT 14 NE 31 counter with aluminium cathode has been studied after irradiation from 10{sup 5} to 10{sup 6} n.cm{sup -2} in the swimming-pool reactor Triton. The pulse spectrum was only slightly modified by two successive irradiations at 10{sup 15} n.cm{sup -2}, and 1 hour after the end of the irradiation the decrease in sensitivity reached 10 to 20 per cent. One hour after irradiation at 10{sup 16} n.cm{sup -2} this decrease was 20 per cent but the pulse spectrum was affected. The advantages of an aluminium cathode with respect to a standard counter using a copper cathode and irradiated under the same conditions are given. Beforehand, it had been established that the limit for use of an aluminium-cathode counter in the presence of {gamma} radiation is about 200 R.h{sup -1}. (author) [French] Le comportement d'un compteur proportionnel a BF-3LCT 14 NE 31, a cathode d'aluminium, a ete etudie apres des irradiations de 10{sup 5} a 10{sup 6} n.cm{sup -2} dans la pile-piscine TRITON. Deux irradiations successives de 10{sup 15} n.cm{sup -2} ont peu modifie le spectre des impulsions et 1 heure apres la fin de l'exposition la perte de sensibilite etait de 10 a 20 pour cent. Une heure apres une irradiation de 10{sup 16} n.cm{sup -2}, cette perte etait de 20 pour cent mais le spectre d'impulsions etait perturbe. L'avantage d'une cathode en aluminium est mis en evidence par comparaison avec un compteur standard a cathode de cuivre irradie dans les memes conditions. En preliminaire, on avait etabli que la limite d'utilisation d'un compteur a cathode d'aluminium en presence de rayonnements {gamma} etait de l'ordre de 200 R.h{sup -1}. (auteur)

Bone marrow CD11b(+)F4/80(+) dendritic cells ameliorate collagen-induced arthritis through modulating the balance between Treg and Th17.

Science.gov (United States)

Zhang, Lingling; Fu, Jingjing; Sheng, Kangliang; Li, Ying; Song, Shanshan; Li, Peipei; Song, Shasha; Wang, Qingtong; Chen, Jingyu; Yu, Jianhua; Wei, Wei

2015-03-01

Tolerogenic dendritic cells (DCs) are well-known to show an immunosuppressive function. In this study we determine the therapeutic effects and potential mechanisms of transferred bone marrow (BM) CD11b(+)F4/80(+) DCs on collagen-induced arthritis (CIA) in mice. Murine BM CD11b(+)F4/80(+) DCs were generated under the stimulation of GM-CSF and IL-4, and the function of BM CD11b(+) F4/80(+) DCs was identified by measuring the levels of IL-10, TGF-beta and indoleamine 2,3-dioxygenase (IDO). BM CD11b(+)F4/80(+) DCs were transferred to CIA mice by intravenous injections. The histopathology of joint and spleen were evaluated. T lymphocyte proliferation, Treg and Th17 subsets were analyzed. The expressions of Foxp3, Helios and RORγt in T lymphocytes co-cultured with BM CD11b(+)F4/80(+) DCs were measured in vitro. We found that BM CD11b(+)F4/80(+) DCs induced by GM-CSF and IL-4 could express high levels of IL-10, TGF-beta and IDO. BM CD11b(+)F4/80(+) DCs significantly reduced the pathologic scores in joints and spleens, which correlated significantly with the reduced T lymphocyte proliferation and Th17 cell number, and with the increased Tregs number. In vitro, OVA-pulsed BM CD11b(+)F4/80(+) DCs promoted Treg cell expansion, enhanced IL-10 and CTLA-4 protein expression, augmented Foxp3 and Helios mRNA expression, and inhibited RORγt and IL-17 mRNA expression. Taken together, BM CD11b(+)F4/80(+) DCs are able to ameliorate the development and severity of CIA, at least partly by inducing Foxp3(+) Treg cell expansion and suppressing Th17 function. The BM CD11b(+)F4/80(+) DCs might have a promising immunotherapeutic potential for autoimmune arthritis. Copyright © 2015 Elsevier B.V. All rights reserved.

Implementation and assessment of improved models and options in TRAC-BF1

International Nuclear Information System (INIS)

Analytis, G.Th.

1996-07-01

A summary of modifications and options introduced in TRAC-BF1 is presented and it is shown that the predicting capabilities of the modified version of the core are greatly improved. These changes include the introduction of a different heat transfer package during reflooding, the implementation of a simple single-phase limit procedure for forcing the two phases to acquire the same velocity if one phase disappears, a close assessment of the annular flow interfacial shear correlation, implementation of a simple radiation model which seems to alleviate some numerical-oscillations problems induced by the existing highly complex model. Furthermore, different options were introduced and tested like upwinding some terms of the momentum equations (which seems to solve a number of problems reported in the past), the second upwind scheme for the convective terms of the phasic momentum equations and the implementation and assessment of a completely different annular flow interfacial shear correlation. The modified TRAC-BF1 is assessed against some bottom-flooding separate-effect experiments, a 'benchmark' top flooding simulation as well as against the TLTA test Nr. 6423. In the process of this task, the different options are assessed and discussed and is shown that the predictions of the modified code are physically sound and close to the measurements, while almost all the predicted variables are free of unphysical spurious oscillations. The modifications introduced solve a number of problems associated with the frozen version of the code and result in a version which can be confidently used for LB-LOCA analyses. (author) 19 figs., 16 refs

BF3·Et2O promoted conjugate addition of ethanethiol to electron-deficient alkynes

Institute of Scientific and Technical Information of China (English)

Qing Fa Zhou; Xue Ping Chu; Shen Zhao; Tao Lu; Wei Fang Tang

2012-01-01

An effective method for the synthesis of vinyl thioethers through the conjugate addition of ethanethiol to electron-deficient alkynes promoted by BF3·Et2O has been developed.Electron-deficient internal alkynes react with ethanethiol in this system to yield mainly Z-isomer of vinyl thioether adducts,while electron-deficient terminal alkynes afford mainly E-isomer of vinyl thioether adducts.

Diffusion modelling of low-energy ion-implanted BF{sub 2} in crystalline silicon: Study of fluorine vacancy effect on boron diffusion

Energy Technology Data Exchange (ETDEWEB)

Marcon, J. [Laboratoire Electronique Microtechnologie et Instrumentation (LEMI), University of Rouen, 76821 Mont Saint Aignan (France)], E-mail: Jerome.Marcon@univ-rouen.fr; Merabet, A. [Laboratoire de Physique et Mecanique des Materiaux Metalliques, Departement d' O.M.P., Faculte des Sciences de l' Ingenieur, Universite de Setif, 19000 Setif (Algeria)

2008-12-05

We have investigated and modelled the diffusion of boron implanted into crystalline silicon in the form of boron difluoride BF{sub 2}{sup +}. We have used published data for BF{sub 2}{sup +} implanted with an energy of 2.2 keV in crystalline silicon. Fluorine effects are considered by using vacancy-fluorine pairs which are responsible for the suppression of boron diffusion in crystalline silicon. Following Uematsu's works, the simulations satisfactory reproduce the SIMS experimental profiles in the 800-1000 deg. C temperature range. The boron diffusion model in silicon of Uematsu has been improved taking into account the last experimental data.

Thermodynamic study of binary mixture of x1[C6mim][BF4] + x21-propanol: Measurements and molecular modeling

International Nuclear Information System (INIS)

Kermanpour, F.; Sharifi, T.

2012-01-01

Highlights: ► Densities and viscosities for binary mixture of {x 1 [C 6 mim][BF 4 ] + x 2 1-propanol} were measured at different temperatures. ► The excess molar functions were calculated from the obtained experimental data. ► These data were correlated with the Redlich–Kister equation and PFP model to obtain the coefficients and standard deviations. - Abstract: Densities, ρ, and viscosities, η, of pure 1-hexyl-3-methylimidazoliumtetrafluoro borate ([C 6 mim][BF 4 ]) and 1-propanol, and their binary mixture {x 1 [C 6 mim][BF 4 ] + x 2 1-propanol} were measured at atmospheric pressure and in the temperature range of 293.15–333.15 K. The excess molar volumes, V m E , thermal expansion coefficients, α, and their excess values, α E , isothermal coefficient of excess molar enthalpy, (∂H m E /∂p) T,x and excess viscosities, η E , were calculated from the experimental values of densities and viscosities. The excess molar volumes of the binary mixture are negative over the entire mole fraction range and increase with increasing temperature. Excess viscosities are negative over the entire mole fraction range of the mixture and decrease with increasing temperature. The obtained excess molar volumes and excess viscosities were correlated with the Redlich–Kister equation. The experimental results have also been used to examine the applicability of Prigogine–Flory–Patterson (PFP) theory in predicting the excess molar volume of the binary mixture. It is indicated that agreement between excess molar volumes calculated via PFP theory and the experimental results is good in all temperatures.

Systemic Responses of Multidrug-Resistant Pseudomonas aeruginosa and Acinetobacter baumannii Following Exposure to the Antimicrobial Peptide Cathelicidin-BF Imply Multiple Intracellular Targets

Directory of Open Access Journals (Sweden)

Cunbao Liu

2017-11-01

Full Text Available Cathelicidin-BF, derived from the banded krait (Bungarus fasciatus, is a typically cationic, amphiphilic and α-helical antimicrobial peptide (AMP with 30 amino acids that exerts powerful effects on multidrug-resistant (MDR clinical isolates, including Pseudomonas aeruginosa, Acinetobacter baumannii, and Klebsiella pneumoniae, but whether it targets plasma membranes or intracellular targets to kill bacteria is still controversial. In the present study, we demonstrated that the disruption of bacterial membranes with high concentrations of cathelicidin-BF was the cause of bacterial death, as with conventional antibiotics at high concentrations. At lower concentrations, cathelicidin-BF did not cause bacterial plasma membrane disruption, but it was able to cross the membrane and aggregate at the nucleoid regions. Functional proteins of the transcription processes of P. aeruginosa and A. baumannii were affected by sublethal doses of cathelicidin-BF, as demonstrated by comparative proteomics using isobaric tags for relative and absolute quantification and subsequent gene ontology (GO analysis. Analysis using the Kyoto Encyclopedia of Genes and Genomes showed that cathelicidin-BF mainly interferes with metabolic pathways related to amino acid synthesis, metabolism of cofactors and vitamins, metabolism of purine and energy supply, and other processes. Although specific targets of cathelicidin-BF must still be validated, our study offers strong evidence that cathelicidin-BF may act upon intracellular targets to kill superbugs, which may be helpful for further efforts to discover novel antibiotics to fight against them.

The BF formalism for QCD and quark confinement

International Nuclear Information System (INIS)

Fucito, F.; Zeni, M.

1997-01-01

Using the BF version of pure Yang-Mills, it is possible to find a covariant representation of the 't Hooft magnetic flux operator. In this framework, 't Hooft's pioneering work on confinement finds an explicit realization in the continuum. Employing the Abelian projection gauge we compute the expectation value of the magnetic variable and find the expected perimeter law. We also check the area law behavior for the Wilson loop average and compute the string tension which turns out to be of the right order of magnitude. (orig.)

Synthesis and characterization of ionic liquid (EMImBF{sub 4})/Li{sup +} - chitosan membranes for ion battery

Energy Technology Data Exchange (ETDEWEB)

Pasaribu, Marvin H., E-mail: marvin-shady88@yahoo.com; Arcana, I Made, E-mail: arcana@chem.itb.ac.id; Wahyuningrum, Deana, E-mail: deana@chem.itb.ac.id [Department of Chemistry, Faculty of Mathematics and Natural Sciences, InstitutTeknologi Bandung, Jl. Ganesha No. 10, Bandung 40132 (Indonesia)

2015-09-30

Lithium ion battery has been currently developed and produced because it has a longer life time, high energycapacity, and the efficient use of lithium ion battery that is suitable for storing electrical energy. However, this battery has some drawbacks such as use liquid electrolytes that are prone to leakage and flammability during the battery charging process in high temperature. In this study, an ionic liquid 1-ethyl-3-methylimidazolium tetrafluoroborate (EMImBF4) containing Li{sup +} ions was synthesized and combined with chitosan polymer host as a polymer electrolyte membrane for lithium-ion batteries to solve this problems. This ionic liquid was obtained from the anion metathesis reaction between EMImBr and LiBF4 salt, while EMImBr was synthesized from the reaction between 1-methylimidazole and ethyl bromide utilizing Microwave Assisted Organic Synthesis (MAOS) method. The ionic liquid obtained was characterized by microstructure analysis with using NMR and FTIR spectroscopy. The polymer electrolyte membrane was characterized by analysis functional groups (FTIR), ionic conductivity (EIS), and surface morphology (SEM). The analysis results of ion conductivity by the EIS method showed the increase the ionic conductivity value of membranes from 1.30 × 10{sup −2} S cm{sup −1} for chitosan to 1.30 × 10{sup −2} S cm{sup −1} for chitosan with EMImBF4/Li{sup +}, and this result was supported by analysis the surface morphology (SEM)

Synthesis of new low band gap dyes with BF{sub 2}-azopyrrole complex and their use for dye-sensitized solar cells

Energy Technology Data Exchange (ETDEWEB)

Mikroyannidis, John A. [Chemical Technology Laboratory, Department of Chemistry, University of Patras, GR-26500 Patras (Greece); Roy, M.S. [Defence Laboratory, Jodhpur (Raj.) (India); Sharma, G.D. [Physics Department, Molecular Electronic and Optoelectronic Device Laboratory, JNV University, Jodhpur (Raj.) 342005 (India); Jaipur Engineering College, Kukas, Jaipur (Raj.) (India)

2010-08-15

The diazonium salt derived from 4-aminobenzoic acid, 4-aminophenol or 2-aminophenol reacted with half equivalent of pyrrole to afford symmetrical 2,5-bisazopyrroles. They reacted subsequently with boron trifluoride in the presence of triethylamine to afford the corresponding BF{sub 2}-azopyrrole complexes D1, D2 and D3 respectively. They were soluble and stable in nonprotic solvents such as chloroform, dichloromethane and tetrahydrofuran but unstable in protic solvents such as ethanol. Their absorption spectra were broad with optical band gap of 1.49-1.70 eV. Among these dyes D2 displayed the broader absorption spectrum with low band gap E{sub g}{sup opt} of 1.49 eV. We have utilized these complexes as photosensitizers for quasi solid state dye-sensitized solar cells (DSSCs) and achieved power conversion efficiency in the range of 4.0-6.0%. We have also found that the co-adsorption of citric acid hindered the formation of dye aggregates and might improve the electron injection efficiency leading to an enhancement in short circuit photocurrent. This work suggests that metal-free dyes based on BF{sub 2}-azopyrrole complex are promising candidates for improvement of the DSSC performance. (author)

Crystal structure and characterization of the novel NH{sup +} Midline-Horizontal-Ellipsis N hydrogen bonded polar crystal [NH{sub 2}(CH{sub 2}){sub 4}NH][BF{sub 4}

Energy Technology Data Exchange (ETDEWEB)

Wojtas, M., E-mail: maciej.wojtas@chem.uni.wroc.pl [Faculty of Chemistry, University of Wroclaw, Joliot-Curie 14, 50-383 Wroclaw (Poland); Gagor, A. [W. Trzebiatowski Institute of Low Temperature and Structure Research, Polish Academy of Science, PO Box 1410, 50-950 Wroclaw (Poland); Czupinski, O. [Faculty of Chemistry, University of Wroclaw, Joliot-Curie 14, 50-383 Wroclaw (Poland); Medycki, W. [Institute of Molecular Physics, Polish Academy of Science, Smoluchowskiego 17, 60-179 Poznan (Poland); Jakubas, R. [Faculty of Chemistry, University of Wroclaw, Joliot-Curie 14, 50-383 Wroclaw (Poland)

2012-03-15

Dielectric properties and phase transitions of the piperazinium tetrafluoroborate ([NH{sub 2}(CH{sub 2}){sub 4}NH][BF{sub 4}], abbreviated as PFB) crystal are related to the one-dimensional arrangement of the cations linked by the bistable NH{sup +} Midline-Horizontal-Ellipsis N hydrogen bonds and molecular motions of the [BF{sub 4}]{sup -} units. The crystal structure of [NH{sub 2}(CH{sub 2}){sub 4}NH][BF{sub 4}] is monoclinic at room temperature with the polar space group Pn. The polar/acentric properties of the room temperature phase IV have been confirmed by the piezoelectric and pyroelectric measurements. DSC measurements show that the compound undergoes three first-order structural phase transitions: at 421/411 K (heating/cooling), at 386/372 K and at 364/349 K. {sup 1}H and {sup 19}F NMR measurements indicate the reorientational motions of [BF{sub 4}]{sup -} anions and piperazinium(+) cations as well as the proton motion in the hydrogen-bonded chains of piperazine along the [001] direction. Over the phase I the isotropic reorientational motions or even self-diffusion of the cations and anions are expected. The conductivity measurements in the vicinity of the II-I PT indicate a superionic phase over the phase I. - Graphical abstract: It must be emphasized that the titled compound represents the first organic-inorganic simple salt containing the single-protonated piperazinium cation which was studied by means of the wide variety of experimental techniques. A survey of Cambridge Structural Database (CSD version 5.32 (November 2010) and updates (May 2011)) for structure containing the piperazinium cations yields 248 compounds with the doubly protonated piperazinium(2+) cations and only eight compounds with the singly protonated piperazinium(+) cations. Among these structures only one is the hybrid organic-inorganic material. This is piperazinium nitrate characterized structurally. The crystal packing of [NH{sub 2}(CH{sub 2}){sub 4}NH][BF{sub 4}], phase IV. The

FTIR Spectroscopic and DC Ionic conductivity Studies of PVDF-HFP: LiBF4: EC Plasticized Polymer Electrolyte Membrane

Science.gov (United States)

Sangeetha, M.; Mallikarjun, A.; Jaipal Reddy, M.; Siva Kumar, J.

2017-08-01

In the present paper; the FTIR and Temperature dependent DC Ionic conductivity studies of polymer (80 Wt% PVDF-HFP) with inorganic lithium tetra fluoroborate salt (20 Wt% LiBF4) as ionic charge carrier and plasticized with various weight ratios of Ethylene carbonate plasticizer (10 Wt% to 70 Wt% EC) as gel polymer electrolytes. Solution casting method is used for the preparation of plasticized polymer-salt electrolyte films. FTIR analysis shows the good complexation between PVDF-HFP: LiBF4 and the presence of functional groups in the plasticized polymer-salt electrolyte membrane. Also the analysis and results show that the highest DC ionic conductivity of 1.66 × 10-3 SCm -1 was found at 373 K for a particular concentration of 80 Wt% PVDF-HFP: 20 Wt% LiBF4: 40 Wt% EC porous gel type polymer-salt plasticized porous membrane. Increase of temperature results expansion and segmental motion of polymer chain that generates free volume in turn promotes hopping of the lithium ions satisfying Vogel-Tammann-Fulcher equation.

Dicty_cDB: Contig-U11911-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 15738 ) EST1224699 MTY Medicago truncatula cDNA clone MTY... 46 0.077 2 ( BF643524 ) NF021F09EC1F1079 Elicited cell culture Medic...6 0.079 2 ( BF647644 ) NF078B01EC1F1011 Elicited cell culture Medicago t... 46 0....ited cell culture Medicago t... 46 0.086 2 ( BQ136068 ) NF032G12EC1F1099 Elicited cell culture Medic...tyostelium discoideum cDNA clone:ddc53b21, 3' ... 188 2e-47 2 ( CK249786 ) EST733423 potato callus cDNA library..., normalized ... 46 4e-04 3 ( CK249616 ) EST733253 potato callus cDNA library

Priorities, activities and objectives of the BMU/BfS concept for ''Human Factor'' (HF) topics

International Nuclear Information System (INIS)

Hennig, R.; Kociok, B.

1994-01-01

Representation of the SR 2039/1-7 research project of the BMU/BfS, with a short definition of its objectives. The man-machine or man-organization-interface in nuclear power plant operation is dealt with. (DG) [de

Formation of oxygen-related defects enhanced by fluorine in BF{sub 2}{sup +}-implanted Si studied by a monoenergetic positron beam

Energy Technology Data Exchange (ETDEWEB)

Uedono, Akira; Moriya, Tsuyoshi; Tanigawa, Shoichiro [Tsukuba Univ., Ibaraki (Japan). Inst. of Materials Science; Kawano, Takao; Nagai, Ryo; Umeda, Kazunori

1995-12-01

Defects in 25-keV BF{sub 2}{sup +}- or As{sup +}-implanted Si specimens were probed by a monoenergetic positron beam. For the As{sup +}-implanted specimen, the depth profile of defects was obtained from measurements of Doppler broadening profiles as a function of incident positron energy. The major species of the defects was identified as divacancies. For ion-implanted specimens after annealing treatment, oxygen-related defects were found to be formed. For the BF{sub 2}{sup +}-implanted specimen before annealing treatment, such defects were formed in the subsurface region, where oxygen atoms were implanted by recoil from oxide films. This was attributed to enhanced formation of oxygen-related defects by the presence of F atoms. (author)

Kinetic and spectroscopic studies of cytochrome b-563 in isolated cytochrome b/f complex and in thylakoid membranes

Energy Technology Data Exchange (ETDEWEB)

Hind, G.; Clark, R.D.; Houchins, J.P.

1983-01-01

Extensive studies, performed principally by Hauska, Hurt and collaborators, have shown that a cytochrome (cyt) b/f complex isolated from photosynthetic membranes of spinach or Anabaena catalyzes electron transport from plastoquinol (PQH/sub 2/) to plastocyanin or algal cyt c-552. The complex from spinach thylakoids generated a membrane potential when reconstituted into liposomes, and although the electrogenic mechanism remains unknown, a key role for cyt b-563 is widely accepted. Electrogenesis by a Q-cycle mechanism requires a plastoquinone (PQ) reductase to be associated with the stromal side of the thylakoid b/f complex though this activity has yet to be demonstrated. It seemed possible that more gentle isolation of the complex might yield a form containing additional polypeptides, perhaps including a PQ reductase or a component involved in returning electrons from reduced ferredoxin to the complex in cyclic electron flow. Optimization of the isolation of cyt b/f complex for Hybrid 424 spinach from a growth room was also required. The procedure we devised is compared to the protocol of Hurt and Hauska (1982). 13 references.

Negative charge induced degradation of PMOSFETs with BF2-implanted p+-poly gate

International Nuclear Information System (INIS)

Lu, C.Y.; Sung, J.M.

1989-01-01

A new degradation phenomenon on thin gate oxide PMOS-FETs with BF 2 implanted p + -poly gate has been demonstrated and investigated. The cause of this type of degradation is a combination of the boron penetration through the gate oxide and charge trap generation due to the presence of fluorine in the gate oxide and some other processing-induced effects. The negative charge-induced degradation other than enhanced boron diffusion has been studied in detail here. The impact of this process-sensitive p + -poly gate structure on deep submicron CMOS process integration has been discussed. (author)

Tests of BF3 counters with getter

International Nuclear Information System (INIS)

Comte, R.; Dauphin, G.

1968-01-01

BF 3 counters with addition of a getter have been developed to improve operation characteristics of these detectors in presence of strong gamma flows. The getter is made of an active coal deposit on the cathode. As noticed by other studies, the degradation of these counters is related to the exposure to strong neutron flows and to gamma radiations. The authors report tests performed on these counters with a brief presentation of the counters, and a presentation of the test installation. A threshold curve and an amplitude spectrum are obtained, and counting is performed for a fixed threshold before and after the exposure of detectors to variable doses of γ radiation. The results after a first 2 hour long irradiation, a 230 hour long second irradiation, and a third irradiation under high voltage (2100 V) are discussed. Thermal tests are then performed and commented

Comparison of proteomics profiles of Campylobacter jejuni strain Bf under microaerobic and aerobic conditions

Directory of Open Access Journals (Sweden)

Ramila Christiane Rodrigues

2016-10-01

Full Text Available Campylobacter jejuni accounts for one of the leading causes of foodborne bacterial enteritis in humans. Despite being considered an obligate microaerobic microorganism, C. jejuni is regularly exposed to oxidative stress. However, its adaptive strategies to survive the atmospheric oxygen level during transmission to humans remain unclear. Recently, the atypical clinical C. jejuni Bf strain was shown by its unexpected ability to grow under ambient atmosphere. Here, we aimed to understand better the biological mechanisms underlying its atypical aerotolerance trait using two-dimensional protein electrophoresis, gene expression and enzymatic activities. Forty-seven proteins were identified with a significantly different abundance between cultivation under microaerobic and aerobic conditions. The over-expressed proteins in aerobiosis belonged mainly to the oxidative stress response, modulation of the main enzymes of the tricarboxylic acid cycle, iron uptake and regulation and amino acid uptake when compared to microaerobic conditions. The higher abundance of proteins related to oxidative stress was correlated to dramatically higher transcript levels of the corresponding encoding genes in aerobic conditions compared to microaerobic conditions. In addition, a higher catalase-equivalent activity in strain Bf was observed. Despite the restricted catabolic capacities of C. jejuni, this study reveals that strain Bf is equipped to withstand oxidative stress. This ability could contribute to emergence and persistence of particular strains of C. jejuni throughout food processing or macrophage attack during human infection.

Hybrid biofilm-membrane bioreactor (Bf-MBR) for minimization of bulk liquid-phase organic substances and its positive effect on membrane permeability.

Science.gov (United States)

Sun, F Y; Li, P; Li, J; Li, H J; Ou, Q M; Sun, T T; Dong, Z J

2015-12-01

Four biofilm membrane bioreactors (Bf-MBRs) with various fixed carrier volumes (C:M) were operated in parallel to investigate the effect of attached-growth mode biomass involvement to the change of liquid-phase organics characteristics and membrane permeability, by comparing with conventional MBR. The experiments displayed that C:M and co-existence of biofilm with suspended solids in Bf-MBRs resulted in slight difference in pollutants removal effectiveness, and in rather distinct biomass properties and bacterial activities. The membrane permeability and specific resistance of bulk suspension of Bf-MBRs related closely with the liquid-phase organic substance, including soluble microbial products (SMP) and biopolymer cluster (BPC). Compared with conventional MBR, Bf-MBR with proper C:M had a low total biomass content and food-chain, where biofilm formation and its dominance affected liquid-phase organics, especially through reducing their content and minimizing strongly and weakly hydrophobic components with small molecular weight, and thus to mitigate membrane fouling significantly. Copyright © 2015 Elsevier Ltd. All rights reserved.

Electrodes for the hydrogen through water electrolysis using BMI.BF{sub 4} as electrolyte; Eletrodos para a producao de hidrogenio via eletrolise da agua utilizando BMI.BF{sub 4} como eletrolito

Energy Technology Data Exchange (ETDEWEB)

Botton, Janine Padilha; Martini, Emilse M.A.; Souza, Michele Oberson de; Souza, Roberto Fernando de [Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil). Inst. de Quimica. Lab. de Eletroquimica e Catalise]. E-mail: janine@iq.ufrgs.br; Loget, Gabriel [Universite de Rennes 1, Rennes (France). Lab. de Eletroquimica Molecular e Macromolecular. UMR CNRS 6510

2008-07-01

The hydrogen production by water electrolysis was tested with different electrocatalysts (nickel, iron alloys containing nickel, chromium and manganese, and molybdenum) in the ionic liquid electrolyte, 1-butyl-3-methylimidazolium tetrafluoroborate (BMI.BF{sub 4}), 10 vol.% in water. The hydrogen evolution reaction (HER) worked at room temperature with a platinum quasi-reference electrode (PtQRE) applying a -1.7 V potential. The experimental conditions used were determined in previous work and such parameters of operation were confirmed with the electrocatalysts employed in this work. A Hoffman cell apparatus was used to perform the water electrolysis. The current density values, j, obtained were between 3.0 mA cm{sup -2} and 77.5 mA cm{sup -2}. The system efficiency was very high for all electrocatalysts tested, between 97.0% and 99.2%. The molybdenum (Mo) electrode was better than others showing the highest current density value in HER. This behavior has been explained by the lower value of activation energy for the electrolysis reaction when Mo is employed comparing with Pt electrode. The energy activation of the HER using platinum (Pt) as electrocatalyst in an aqueous solution of BMI.BF{sub 4} 10 vol.% was 23.40 kJ mol{sup -1}, whereas with electrode of Mo in the same conditions , was 9.22 kJ mol{sup -1}. In an alkaline aqueous electrolyte (usual medium for such reaction), Mo is less efficient than Pt explaining the lack of published citation using pure Mo as cathode for the HER. The excellent results obtained with a Mo electrode employing ionic liquid as electrolyte show that the hydrogen production can be carried out with cheap electrode material at room temperature, which makes this method economically attractive. (author)

Two-dimensional topological field theories coupled to four-dimensional BF theory

International Nuclear Information System (INIS)

Montesinos, Merced; Perez, Alejandro

2008-01-01

Four-dimensional BF theory admits a natural coupling to extended sources supported on two-dimensional surfaces or string world sheets. Solutions of the theory are in one to one correspondence with solutions of Einstein equations with distributional matter (cosmic strings). We study new (topological field) theories that can be constructed by adding extra degrees of freedom to the two-dimensional world sheet. We show how two-dimensional Yang-Mills degrees of freedom can be added on the world sheet, producing in this way, an interactive (topological) theory of Yang-Mills fields with BF fields in four dimensions. We also show how a world sheet tetrad can be naturally added. As in the previous case the set of solutions of these theories are contained in the set of solutions of Einstein's equations if one allows distributional matter supported on two-dimensional surfaces. These theories are argued to be exactly quantizable. In the context of quantum gravity, one important motivation to study these models is to explore the possibility of constructing a background-independent quantum field theory where local degrees of freedom at low energies arise from global topological (world sheet) degrees of freedom at the fundamental level

The kinematical Hilbert space of loop quantum gravity from BF theories

International Nuclear Information System (INIS)

Cianfrani, Francesco

2011-01-01

In this work, it is demonstrated how the kinematical Hilbert space of loop quantum gravity (LQG) can be inferred from the configuration space of BF theories via the imposition of the Hamiltonian constraints. In particular, it is outlined how the projection to the representations associated with Ashtekar-Barbero connections provides the correct procedure to implement second-class constraints and the corresponding nontrivial induced symplectic structure. Then, the reduction to SU(2) invariant intertwiners is analyzed and the properties of LQG states under Lorentz transformations are discussed.

Nuclear inelastic scattering and density functional theory studies of a one-dimensional spin crossover [Fe(1,2,4-triazole)2(1,2,4-triazolato)](BF4) molecular chain.

Science.gov (United States)

Jenni, Kevin; Scherthan, Lena; Faus, Isabelle; Marx, Jennifer; Strohm, Cornelius; Herlitschke, Marcus; Wille, Hans-Christian; Würtz, Peter; Schünemann, Volker; Wolny, Juliusz A

2017-07-26

Nuclear inelastic scattering (NIS) experiments have been performed in order to study the vibrational dynamics of the low- and high-spin states of the polynuclear 1D spin crossover compound [Fe(1,2,4-triazole) 2 (1,2,4-triazolato)](BF 4 ) (1). Density functional theory (DFT) calculations using the functional B3LYP* and the basis set CEP-31G for heptameric and nonameric models of the compound yielded the normal vibrations and electronic energies for high-spin and low-spin isomers of three models differing in the distribution of anionic trz - ligands and BF 4 - anions. On the basis of the obtained energies a structural model with a centrosymmetric Fe(trzH) 4 (trz - ) 2 coordination core of the mononuclear unit of the chain is proposed. The obtained distribution of the BF 4 - counteranions in the proposed structure is similar to that obtained on the basis of X-ray powder diffraction studies by Grossjean et al. (Eur. J. Inorg. Chem., 2013, 796). The NIS data of the system diluted to 10% Fe(ii) content in a 90% Zn(ii) matrix (compound (2)) show a characteristic change of the spectral pattern of the low-spin centres, compared to the low-spin phase of the parent Fe(ii) complex (1). DFT calculations reveal that this is caused by a change of the structure of the neighbours of the low-spin centres. The spectral pattern of the high-spin centres in (2) is within a good approximation identical to that of the high-spin Fe(ii) isomer of (1). The inspection of the molecular orbitals of the monomeric model systems of [Fe(trzH) 4 (trz - ) 2 ] and [Fe(trzH) 6 ], together with calculations of spin transition energies, point towards the importance of an electrostatic effect caused by the negatively charged ligands. This results in the stabilisation of the low-spin state of the complex containing the anionic ligand and shortening of the Fe-N(trz - ) compared to the Fe-N(trzH) bond in high-spin, but not in low-spin [Fe(trzH) 4 (trz - ) 2 ].

Highly efficient extraction and oxidative desulfurization system using Na7H2LaW10O36⋅32 H2O in [bmim]BF4 at room temperature.

Science.gov (United States)

Xu, Junhua; Zhao, Shen; Chen, Wei; Wang, Miao; Song, Yu-Fei

2012-04-10

Highly efficient, deep desulfurization of model oil containing dibenzothiophene (DBT), benzothiophene (BT), or 4,6-dimethyldibenzothiophene (4,6-DMDBT) has been achieved under mild conditions by using an extraction and catalytic oxidative desulfurization system (ECODS) in which a lanthanide-containing polyoxometalate Na(7)H(2)LnW(10)O(36)⋅32 H(2)O (LnW(10); Ln = Eu, La) acts as catalyst, [bmim]BF(4) (bmim = 1-butyl-3-methylimidazolium) as extractant, and H(2)O(2) as oxidant. Sulfur removal follows the order DBT>4,6-DMDBT>BT at 30 °C. DBT can be completely oxidized to the corresponding sulfone in 25 min under mild conditions, and the LaW(10)/[bmim]BF(4) system could be recycled for ten times with only slight decrease in activity. Thus, LaW(10) in [bmim]BF(4) is one of the most efficient systems for desulfurization using ionic liquids as extractant reported so far. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Incident reporting to BfArM - regulatory framework, results and challenges.

Science.gov (United States)

Seidel, Robin; Stößlein, Ekkehard; Lauer, Wolfgang

2016-04-01

Medical devices are manifold and one of the most innovative fields of technology. As technologies advance, former limits cease to exist and complex devices become reality. Medical devices represent a very dynamic field with high economic relevance. The manufacturer of a medical device is obliged to minimize product-related risks as well as to demonstrate compliance with the so-called "essential requirements" regarding safety and performance before placing the device on the market. Any critical incident in relation to the application of a medical device has to be reported to the competent authority for risk assessment, which in Germany is either the Federal Institute for Drugs and Medical Devices (BfArM) or the Paul Ehrlich Institute (PEI) depending on the type of device. In this article, the German regulatory framework for medical devices and the resulting tasks for BfArM are described as well as the topics of its recently installed research and development group on prospective risk identification and application safety for medical devices. Results of failure mode and root cause analyses of incident data are presented as well as further data on cases with the result "root-cause analysis not possible". Finally an outlook is given on future challenges regarding risk assessment for medical devices.

Characteristics of ZnO nanostructures produced with [DMIm]BF{sub 4} using ultrasonic radiation

Energy Technology Data Exchange (ETDEWEB)

Rahman, I. B. Abdul; Ayob, M. T. M.; Ishak, I. S.; Mohd Lawi, R. L.; Isahak, W. N. R. W.; Hamid, M. H. N. Abd; Othman, N. K.; Radiman, S. [School of Applied Physics, Faculty of Science and Technology (FST), Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor Darul Ehsan (Malaysia); School of Chemistry and Food Technology, Faculty of Science and Technology (FST), Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor Darul Ehsan (Malaysia); School of Applied Physics, Faculty of Science and Technology (FST), Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor Darul Ehsan (Malaysia)

2012-11-27

Great interests in metallic oxides have emerged because of the promising properties of these materials for various applications such as solar cells and sensors. ZnO nanostructures with different morphologies were successfully synthesized from Zn(CH{sub 3}COO){sub 2} Bullet 2H{sub 2}O, NaOH and room temperature ionic liquid (RTIL) 1-decyl-3-methylimidazolium tetrafluoroborate, [DMIm][BF{sub 4}] with ultrasound irradiation. Parameters such as the effect of sonication time (30, 60 and 90 minutes) and Zn(Ac){sub 2} precursor to [DMIm][BF{sub 4}] ratios of 3:5, 5:5 and 5:3 were investigated. X-ray diffraction patterns revealed that the ZnO nanocrystals were hexagonal zincite crystalline in structure. The band gap energies (E{sub g}) were estimated to be 3.35-3.55 eV from the UV-Visible spectrum. The solution with the highest ratio of Zn was analysed with photoluminescence spectroscopy, which exhibited peaks at 362, 403, 468 and 539 nm, at room temperature. The micrographs of field emission scanning electron microscopy and transmission electron microscopy showed that the synthesis products were spherical (30-60 nm), spindle ({approx}10 Multiplication-Sign 70 nm for width Multiplication-Sign length) and whisker-like (100-200 nm), with their dimensions decreasing systematically with increased sonication time. Chemical compositions were approximated at 1:1 for Zn and O, estimated by electron dispersive x-ray spectrum.

Boron diffusion in Ge+ premorphized and BF2 implanted Si(001)

International Nuclear Information System (INIS)

Zou, L.F.; Acosta-Ortiz, S.E.; Zou, L.X.; Regalado, L.E.; Sun, D.Z.; Wang, Z.G.

1998-01-01

The annealing behavior of Si implanted with Ge and then BF 2 has been characterized by double crystal X-ray diffraction (DCXRD) and secondary ion mass spectroscopy (SIMS). The results show that annealing at 600 Centigrade for 60 minutes can only remove a little damage induced by implantation and nearly no redistribution of Ge and B atoms has occurred during the annealing. The initial crystallinity of Si is fully recovered after annealing at 950 Centigrade for 60 minutes and accompanied by Ge diffusion. Very shallow boron junction depth has been formed. When annealing temperature rises to 1050 Centigrade, B diffusion enhances, which leads to a deep diffusion and good distribution of B atoms into the Si substrate. The X-ray diffraction (004) rocking curves from the samples annealed at 1050 Centigrade for 60 minutes display two Si Ge peaks, which may be related to the B concentration profiles. (Author)

Spin-crossover in [Fe(3-bpp)2][BF4]2 in different solvents--a dramatic stabilisation of the low-spin state in water.

Science.gov (United States)

Barrett, Simon A; Kilner, Colin A; Halcrow, Malcolm A

2011-12-07

The temperature of spin-crossover in [Fe(3-bpp)(2)][BF(4)](2) (3-bpp = 2,6-di{pyrazol-3-yl}pyridine) tends to increase in associating solvents. In particular, T(½) shifts to 60-70 K higher temperature in water compared to organic solvents.

Dicty_cDB: Contig-U10229-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 9_231( CP000909 |pid:none) Chloroflexus aurantiacus J-10-fl... 39 0.54 EU016654_19( EU016654 |pid:none) Uncultured marine mic...405735 ) T7 end of clone AU0AA006A10 of library AU0AA from... 42 6e-18 5 ( CX531734 ) s13dNF81G04MJ024_257410 Methyl Jasmonate-Elic...e-18 5 ( BG585361 ) EST487125 MHAM Medicago truncatula/Glomus versifo... 78 1e-17 3 ( BF649659 ) NF083E04EC1F1033 Elicited cell cultu... 2e-16 2 ( BF650114 ) NF088A08EC1F1055 Elicited cell culture Medicago t... 78 2e-... CP000745 |pid:none) Methanococcus maripaludis C7, c... 151 1e-66 AM114193_1839( AM114193 |pid:none) Uncultured methanogenic

BF3.SiO2: an efficient catalyst for the synthesis of azo dyes at room temperature

Directory of Open Access Journals (Sweden)

Bi Bi Fatemeh Mirjalili

2012-07-01

Full Text Available A rapid one-pot method has been developed for the synthesis of azo dyes via ‎sequential diazotization–diazo coupling of aromatic amines with coupling agents at room ‎temperature in the presence of BF3.SiO2 as acidic catalyst. The obtained aryl diazonium salts bearing silica supported boron tri-flouride counter ion‎ was sufficiently stable to be kept at room ‎temperature in the dry state.‎

Empirical parameters for solvent acidity, basicity, dipolarity, and polarizability of the ionic liquids [BMIM][BF4] and [BMIM][PF6].

Science.gov (United States)

del Valle, J C; García Blanco, F; Catalán, J

2015-04-02

The empirical solvent scales for polarizability (SP), dipolarity (SdP), acidity (SA), and basicity (SB) have been successfully used to interpret the solvatochromism of compounds dissolved in organic solvents and their solvent mixtures. Providing that the published solvatochromic parameters for the ionic liquids 1-(1-butyl)-3-methylimidazolium tetrafluoroborate, [BMIM][BF4] and 1-(1-butyl)-3-methylimidazolium hexafluorophosphate, [BMIM][PF6], are excessively widespread, their SP, SdP, SA, and SB values are measured herein at temperatures from 293 to 353 K. Four key points are emphasized herein: (i) the origin of the solvatochromic solvent scales--the gas phase, that is the absence of any medium perturbation--; (ii) the separation of the polarizability and dipolarity effects; (iii) the simplification of the probing process in order to obtain the solvatochromic parameters; and (iv) the SP, SdP, SA, and SB solvent scales can probe the polarizability, dipolarity, acidity, and basicity of ionic liquids as well as of organic solvents and water-organic solvent mixtures. From the multiparameter approach using the four pure solvent scales one can draw the conclusion that (a) the solvent influence of [BMIM][BF4] parallels that of formamide at 293 K, both of them miscible with water; (b) [BMIM][PF6] shows a set of solvatochromic parameters similar to that of chloroacetonitrile, both of them water insoluble; and (c) that the corresponding solvent acidity and basicity of the ionic liquids can be explained to a great extent from the cation species by comparing the empirical parameters of [BMIM](+) with those of the solvent 1-methylimidazole. The insolubility of [BMIM][PF6] in water as compared to [BMIM][BF4] is tentatively connected to some extent to the larger molar volume of the anion [PF6](-), and to the difference in basicity of [PF6](-) and [BF4](-).

What Powers the 2006 Outburst of the Symbiotic Star BF Cygni?

Directory of Open Access Journals (Sweden)

A. Skopal

2015-02-01

Full Text Available BF Cygni is a classical symbiotic binary. Its optical light curve occasionally shows outbursts of the Z And-type, whose nature is not well understood. During the 2006 August, BF Cyg underwent the recent outburst, and continues its active phase to the present. The aim of this contribution is to determine the fundamental parameters of the hot component in the binary during the active phase. For this purpose we used a high- and low-resolution optical spectroscopy and the multicolour UBV RCIC photometry. Our photometric monitoring revealed that a high level of the star’s brightness lasts for unusually long time of > 7 years. A sharp violet-shifted absorption component and broad emission wings in the Hα profile developed during the whole active phase. From 2009, our spectra revealed a bipolar ejection from the white dwarf (WD. Modelling the spectral energy distribution (SED of the low-resolution spectra showed simultaneous presence of a warm (< 10 000 K disk-like pseudophotosphere and a strong nebular component of radiation (emission measure of ~1061 cm−3. The luminosity of the hot active object was estimated to > 5−8×103 Lʘ. Such high luminosity, sustained for the time of years, can be understood as a result of an enhanced transient accretion rate throughout a large disk, leading also to formation of collimated ejection from the WD.

Study on Digital Pulse Shape Discrimination System in BF{sub 3} Detector

Energy Technology Data Exchange (ETDEWEB)

Kim, Jinhyeong; Kim, J. H.; Choi, H. D. [Seoul National Univ., Seoul (Korea, Republic of)

2013-10-15

In this study, we develop the digital PSD system and discriminate the background signal of BF{sub 3}. Spectrum shapes are different according to the t{sub start} setting method, and it is favorable to set it as the certain ratio of maximum height. In future, it will be performed to vary t{sub start} point to optimize the pulse discrimination. To quantify the performance, Figure Of Merit (FOM) will be determined. For the nuclear non-proliferation and safeguards, an accurate and reliable measurement of nuclear material is essential. The nuclear material emits neutron and γ-ray, simultaneously. For the accurate detection of the nuclear material, neutron should be discriminated from γ-ray or background radiation. In previous study, N. S. Jung developed pulse shape analysis method based on NIM and CAMAC system. However, applications of other discrimination methods based on different detection modules or changing parameters are time-and-money consuming procedures in analogue systems. Today, the performance of digitizers is improved and it replaces some radiation measurement systems which require simple and portable equipment. Digital Pulse Shape Discrimination (PSD) method by using a digital oscilloscope is developed and applied to a neutron detection system by using BF{sub 3} detector in this study.

IL-12 and GM-CSF in DNA/MVA immunizations against HIV-1 CRF12_BF Nef induced T-cell responses with an enhanced magnitude, breadth and quality.

Directory of Open Access Journals (Sweden)

Ana María Rodríguez

Full Text Available In Argentina, the HIV epidemic is characterized by the co-circulation of subtype B and BF recombinant viral variants. Nef is an HIV protein highly variable among subtypes, making it a good tool to study the impact of HIV variability in the vaccine design setting. We have previously reported a specific cellular response against NefBF with low cross-reactivity to NefB in mice. The aim of this work was to analyze whether the co-administration of IL-12 and GM-CSF, using DNA and MVA vaccine vectors, could improve the final cellular response induced. Mice received three DNA priming doses of a plasmid that express NefBF plus DNAs expressing IL-12 and/or GM-CSF. Afterwards, all the groups were boosted with a MVAnefBF dose. The highest increase in the magnitude of the NefBF response, compared to that induced in the control was found in the IL-12 group. Importantly, a response with higher breadth was detected in groups which received IL-12 or GM-CSF, evidenced as an increased frequency of recognition of homologous (BF and heterologous (B Nef peptides, as well as a higher number of other Nef peptide pools representing different viral subtypes. However, these improvements were lost when both DNA cytokines were simultaneously administered, as the response was focused against the immunodominant peptide with a detrimental response towards subdominant epitopes. The pattern of cytokines secreted and the specific-T-cell proliferative capacity were improved in IL-12 and IL-12+GM-CSF groups. Importantly IL-12 generated a significant higher T-cell avidity against a B heterologous peptide.This study indicates that the incorporation of DNA expressing IL-12 in DNA/MVA schemes produced the best results in terms of improvements of T-cell-response key properties such as breadth, cross-reactivity and quality (avidity and pattern of cytokines secreted. These relevant results contribute to the design of strategies aimed to induce T-cell responses against HIV antigens with

Stereoisomerization of the P(OCH2CH2)3N+BF4– radical: a single-crystal e.s.r. study

NARCIS (Netherlands)

Hamerlinck, J.H.H.; Schipper, P.; Buck, H.M.

1981-01-01

The [graphic omitted]+BF4– radical with the unpaired electron in an apical position of the trigonal-bipyramidal (TBP) structure is generated by X-irradiation via an intermediate TBP structure in which the unpaired electron is located in an equatorial position.

Effect of the structure of imidazolium cations in [BF4](-)-type ionic liquids on direct electrochemistry and electrocatalysis of horseradish peroxidase in Nafion films.

Science.gov (United States)

Lu, Lu; Huang, Xirong; Qu, Yinbo

2011-10-01

The direct electrochemistry and bioelectrocatalysis of horseradish peroxidase (HRP) in Nafion films at glassy carbon electrode (GCE) was investigated in three [BF(4)](-)-type room-temperature ionic liquids (ILs) to understand the structural effect of imidazolium cations. The three ILs are 1-ethyl-3-methylimidazolium tetrafluoroborate ([Emim][BF(4)]), 1-butyl-3-methylimidazolium tetrafluoroborate ([Bmim][BF(4)]) and 1-hexyl-3-methylimidazolium tetrafluoroborate ([Hmim][BF(4)]). A small amount of water in the three ILs is indispensable for maintaining the electrochemical activity of HRP in Nafion films, and the optimum water contents decrease with the increase of alkyl chain length on imidazole ring. Analysis shows that the optimum water contents are primarily determined by the hydrophilicity of ILs used. In contrast to aqueous medium, ILs media facilitate the direct electron transfer of HRP, and the electrochemical parameters obtained in different ILs are obviously related to the nature of ILs. The direct electron transfer between HRP and GCE is a surface-confined quasi-reversible single electron transfer process. The apparent heterogeneous electron transfer rate constant decreases gradually with the increase of alkyl chain length on imidazole ring, but the changing extent is relatively small. The electrocatalytic reduction current of H(2)O(2) at the present electrode decreases obviously with the increase of alkyl chain length, and the mass transfer of H(2)O(2) via diffusion in ILs should be responsible for the change. In addition, the modified electrode has good stability and reproducibility; the ability to tolerate high levels of F(-) has been greatly enhanced due to the use of Nafion film. When an appropriate mediator is included in the sensing layer, a sensitive nonaqueous biosensor could be fabricated. Copyright © 2011 Elsevier B.V. All rights reserved.

BfR removes anthraquinone from its list of recommendations for food packaging

OpenAIRE

German Federal Institute for Risk Assessment

2013-01-01

The substance anthraquinone is used in the production of paper and cardboard, including food packaging. Anthraquinone contained in the packaging can contaminate food. The Federal Institute for Risk Assessment (BfR) took the publication of an expert opinion of the European Food Safety Agency (EFSA) published in 2012 as an opportunity to reassess the use of anthraquinone in the manufacture of paper intended for food contact. In its opinion on anthraquinone as an active pesticide ingredient,...

Investigation of electric conductivity, viscosity and density of LiBF4-1,3-dioxolane system in homogeneity region

International Nuclear Information System (INIS)

Plakhotnik, V.N.; Tovmash, N.F.; Mishustin, A.N.; Dam'e, V.N.

1987-01-01

Solutions of lithium tetrafluoborate in 1,3-dioxolane (DOL) in temperature range and concentrations limiting the homogeneity region from the side of salt crystallization and formation of polymer structures from -30 deg to +25 deg and from 10 -6 to 1.4 mol/l. are investigated using methods of conductometry, densimetry, viscosimetry and by measuring time of spinlattice 7 Li nuclei relaxation. The dissociation constant of LiBF 4 in DOL (pK D =4.9±0.2 at 25 deg) is determined. Comparison with systems based on 1,2-dimethoxyethane and tetrahydrofurane studied earlier is carried out. Suppositions concerning considerable contribution of ion molecular structures with participation of salt ions and solvent molecules to electric conductivity are stated, and it agrees with the data on measurements of velocities of spin-lattice relaxation of 7 Li nuclei

Vascular-targeted photodynamic therapy with BF2-chelated Tetraaryl-Azadipyrromethene agents: a multi-modality molecular imaging approach to therapeutic assessment.

LENUS (Irish Health Repository)

Byrne, A T

2009-11-03

Photodynamic therapy (PDT) is a treatment modality for a range of diseases including cancer. The BF(2)-chelated tetraaryl-azadipyrromethenes (ADPMs) are an emerging class of non-porphyrin PDT agent, which have previously shown excellent photochemical and photophysical properties for therapeutic application. Herein, in vivo efficacy and mechanism of action studies have been completed for the lead agent, ADMP06.

On the nature of the symbiotic star BF Cygni

International Nuclear Information System (INIS)

Mikolajewska, J.; Mikolajewski, M.; Kenyon, S.J.

1989-01-01

Optical and ultraviolet spectroscopy of the symbiotic binary BF Cyg obtained during 1979-1988 is discussed. This system consists of a low-mass M5 giant filling about 50 percent of its tidal volume and a hot, luminous compact object similar to the central star of a planetary nebula. The binary is embedded in an asymmetric nebula which includes a small, high-density region and an extended region of lower density. The larger nebula is formed by a slow wind ejected by the cool component and ionized by the hot star, while the more compact nebula is material expelled by the hot component in the form of a bipolar wind. The analysis indicates that disk accretion is essential to maintain the nuclear burning shell of the hot star. 84 refs

Krypton-85 Monitoring at BfS in Germany and Technical Solutions for Safeguards

International Nuclear Information System (INIS)

Schlosser, C.; Klingberg, F.

2015-01-01

The radioactive noble gas isotope krypton-85 with a half-life of 10.76 years is produced by nuclear fission. The main source of krypton-85 in the atmosphere are releases from reprocessing plants for nuclear fuel in the Northern Hemisphere. This volatile isotope is not retained in such plants and thus a very good indicator for the processing of irradiated nuclear fuel. This includes reprocessing for military purposes. Additionally, Kr-85 could be used as tracer for the validation of Atmospheric Transport Models. The German Federal Office for Radiation Protection (BfS) operates a noble gas laboratory and a global network which continuously monitors the krypton-85 activity concentrations in ground level air since the 1970s. The atmospheric activity concentration has continuously been increasing since the installation of reprocessing plants for nuclear fuels in the early 1950s until 2003. In the first decades it came mostly from military applications and later from civil reprocessing. Since 2003 the atmospheric krypton-85 background level in the Northern Hemisphere is nearly constant with a value of around 1.5 Bq/m 3 in Central Europe. The baseline is superimposed by spikes as a result from discharges of two European reprocessing plants of nuclear fuel, Sellafield and La Hague. The laboratory of the BfS and the techniques used will be presented. Long time series will be discussed and the use of ATM for source location demonstrated. (author)

Dicty_cDB: Contig-U12726-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ( DU826786 ) FLAS_CR30-2002_05F11.T7M FLAS_CR30-2002 unculture... 46 0.41 1 ( AL404104 ) T3 end of clone AT0AA013B12 of library...mid clone: MOF-010N15, gen... 46 0.41 1 ( CT559968 ) A BAC library has been constructed from cultivar ... 46...1 ( BG450438 ) NF015E06DT1F1051 Drought Medicago truncatula cDNA... 50 0.027 1 ( BF649099 ) NF055E07EC1F1053 Elicited cell culture... Medicago t... 50 0.027 1 ( BF644378 ) NF061A10EC1F1072 Elicited cell culture Medicago...M0435G20F Mouse 10kb plasmid UUGC1M library Mus ... 48 0.10 1 ( AL405948 ) T7 end of clone AU0AA007C03 of library

Dicty_cDB: Contig-U05633-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ) PUHQF14TD ZM_0.6_1.0_KB Zea mays genomic clone ZM... 46 1.9 1 ( EC770709 ) EST 7205 Guarana fruits cDNA library Paullinia cu...o... 44 7.7 1 ( BM027318 ) GIT0000656 Root-induced cDNA library from Glomus ... 44 7.7 1 ( BJ427410 ) Dic...ble cien cDNA librar... 50 0.12 1 ( EW965375 ) BRHL_03_O01_T7 Headlice composite library... DN564657 ) 90838967 Sea Urchin primary mesenchyme cell cDNA ... 46 1.9 1 ( CN845958 ) PG07006A08 Ginseng cDNA library from MeJA tre... BF648097 ) NF044C02EC1F1017 Elicited cell culture Medicago t... 44 7.7 1 ( BF646377 ) NF071B12EC1F1096 Elicited cell culture Medic

Investigation of electric conductivity, viscosity and density of LiBF/sub 4/-1,3-dioxolane system in homogeneity region

Energy Technology Data Exchange (ETDEWEB)

Plakhotnik, V N; Tovmash, N F; Mishustin, A N; Dam' e, V N

1987-01-01

Solutions of lithium tetrafluoborate in 1,3-dioxolane (DOL) in temperature range and concentrations limiting the homogeneity region from the side of salt crystallization and formation of polymer structures from -30 deg to +25 deg and from 10/sup -6/ to 1.4 mol/l. are investigated using methods of conductometry, densimetry, viscosimetry and by measuring time of spinlattice /sup 7/Li nuclei relaxation. The dissociation constant of LiBF/sub 4/ in DOL (pK/sub D/=4.9+-0.2 at 25 deg) is determined. Comparison with systems based on 1,2-dimethoxyethane and tetrahydrofurane studied earlier is carried out. Suppositions concerning considerable contribution of ion molecular structures with participation of salt ions and solvent molecules to electric conductivity are stated, and it agrees with the data on measurements of velocities of spin-lattice relaxation of /sup 7/Li nuclei.

Molecular cloning and nucleotide sequence of CYP6BF1 from the diamondback moth, Plutella xylostella

Science.gov (United States)

Li, Hongshan; Dai, Huaguo; Wei, Hui

2005-01-01

A novel cDNA clong encoding a cytochrome P450 was screened from the insecticide-susceptible strain of Plutella xylostella (L.) (Lepidoptera:Yponomeutidae). The nucleotide sequence of the clone, designated CYP6BF1, was determined. This is the first full-length sequence of the CYP6 family from Plutella xylostella (L.). The cDNA is 1661bp in length and contains an open reading frame from base pairs 26 to 1570, encoding a protein of 514 amino acid residues. It is similar to the other insect P450s in gene family 6, including CYP6AE1 from Depressaria pastinacella, (46%). The GenBank accession number is AY971374. PMID:17119627

Stanley Kubrick and B.F. Skinner : Is a Teaching Machine a Monolith ?

OpenAIRE

浜野, 保樹; ハマノ, ヤスキ; Yasuki, Hamano

1990-01-01

The teaching machine invented by B.F. Skinner was recog-nized as one of few clear achievements of scientific pedagogy and even appeared in SF. Arthur C. Clarke who wrote the script of the SF movie "2001: A Space Odyssey" with Stanley Kubrick wanted to scientifically define a monolith to be a God who had given intelligence to our ancestors. In other words, he wanted to describe a monolith as a teaching machine as well as a God. However Kubrick did not want to make clear about what a monolith i...

Dicty_cDB: Contig-U01505-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available y1 Gm-c1004 Glycine max cDNA clone GENOME... 32 3.7 2 ( DV211690 ) 0089P0160Z_H09_T7 Mimulus guttatus library 2 Mimu...38TG Tetrahymena thermophila EST library str... 38 2.5 2 ( AC177658 ) Strongylocentrotus purpuratus clone R3...6 1.4 1 ( BG041778 ) saa41a04.y1 Gm-c1059 Glycine soja cDNA clone GENO... 46 1.4 1 ( BF645094 ) NF034E10EC1F1082 Elicited cell cultur...e Medicago t... 46 1.4 1 ( BF644741 ) NF014E01EC1F1005 Elicited cell culture Medica...a oleracea var. alboglabra EST, clone AAF... 44 5.4 1 ( CN828044 ) EL2662R Brassica embryo library (EL) Brassic

Validation of the BPUMP BF1112 upper-arm blood pressure monitor for home blood pressure monitoring according to the European Society of Hypertension International Protocol revision 2010.

Science.gov (United States)

Chen, Qi; Kang, Yuan-Yuan; Li, Yan; Wang, Ji-Guang

2017-04-01

The present study aimed to evaluate the accuracy of the automated oscillometric upper-arm blood pressure (BP) monitor BPUMP BF1112 for home BP monitoring according to the International Protocol of the European Society of Hypertension revision 2010 (ESH-IP2010). Systolic and diastolic BPs were sequentially measured in 33 adult Chinese (13 women, mean age 46.7 years) using a mercury sphygmomanometer (two observers) and the BF1112 device (one supervisor). A total of 99 pairs of comparisons were obtained from 33 participants for judgments in two parts with three grading phases. The BPUMP BF1112 device achieved the targets in part 1 of the validation study. The number of absolute differences between device and observers within 5, 10, and 15 mmHg was 85/99, 96/99, and 97/99, respectively, for systolic BP, and 83/99, 97/99, and 99/99, respectively, for diastolic BP. The device also fulfilled the criteria in part 2 of the validation study. A total of 31 and 30 participants for systolic and diastolic BP, respectively, had at least two of the three device-observer differences within 5 mmHg (required≥24mmHg). No participant for systolic or diastolic BP had all the three device-observer comparisons greater than 5 mmHg. The BPUMP BP monitor BF1112 has passed the requirements of the ESH-IP2010, and hence can be recommended for home use in adults.

Dicty_cDB: Contig-U02024-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 34903 ) S237P6354FC9.T0 PortugueseWaterDog Canis familiar... 40 1.9 2 ( BF298679 ) 019PbH12 Pb cDNA #20, Cha...rum chromosome 8. 32 1.9 13 ( AL590484 ) Human DNA sequence from clone RP11-76E18 on chrom... 34 1.9 5 ( BV4

Field safety notices released by manufacturers in cases of failure of products for infection testing: analysis of cases reported to the BfArM between 2005 and 2007.

Science.gov (United States)

Siekmeier, R; Lisson, K; Wetzel, D

2010-11-04

The European Directive 98/79/EC for in vitro diagnostic medical devices (IVD) regulates marketing and post marketing surveillance of IVD in the European Economic Area. Manufacturers have to inform the responsible Competent Authorities (CA) about incidents and field safety corrective actions (FSCA) related to IVD. In Germany, the Federal Institute for Drugs and Medical Devices (BfArM) is the responsible CA for most IVD, only few IVD as specified in Annex II of the Directive are under the responsibility of the Paul Ehrlich Institute (PEI). In case of a FSCA manufacturers have to inform customers by means of a Field Safety Notice (FSN) which should be sent to BfArM prior to release and is published on the BfArM homepage. Between beginning of 2005 and end of 2007 the BfArM received a total of 1025 reports regarding IVD. From these, 38 related to tests, reagents, calibrators, and control materials for infection testing, 13 related to analysers and general consumables (n = 8 and n = 5, respectively) based on culture techniques, and 7 related to analysers and general consumables (n = 5 and n = 2, respectively) based on molecular biological methods. FSCA were performed in Germany in 32 (84.2%) of all notifications related to tests reagents, calibrators, and control materials as well as in 13 (100%) and 7 (100%) of notifications related to analysers and consumables based on culture techniques and molecular biological methods, respectively. A number of relevant deficiencies regarding the quality of the FSN were separately demonstrated for FSN in German and English language. In brief, manufacturers often sent their FSN to the BfArM with delay. Additionally, a subset of FSN provided insufficient information on the product related risks or the measures to be performed by the customer to mitigate product related risks. Furthermore, customer confirmation forms often were missing in the FSN sent to the BfArM. Our data suggest that for IVD for infection testing FSCA and FSN are

Pulse discrimination of background and gamma-ray source by digital pulse shape discrimination in a BF3 detector

International Nuclear Information System (INIS)

Kim, Jinhyung; Kim, J. H.; Choi, H. D.

2014-01-01

As a representative method of non-destructive assay, accurate neutron measurement is difficult due to large background radiation such as γ-ray, secondary radiation, spurious pulse, etc. In a BF 3 detector, the process of signal generation is different between neutron and other radiations. As the development of detection technique, all of signal data can be digitized by digital measurement method. In the previous study, Applied Nuclear Physics Group in Seoul National University has developed digital Pulse Shape Discrimination (PSD) method using digital oscilloscope. In this study, optimization of parameters for pulse discrimination is discussed and γ-ray region is determined by measuring 60 Co source. The background signal of BF 3 detector is discriminated by digital PSD system. Parameters for PSD are optimized through FOM calculation. And the γ-ray region is determined by measuring 60 Co source. In the future, the performance of developed system will be tested in low and high intensity neutron field

Li ⁺ solvation and kinetics of Li⁺–BF₄^-/PF ₆ ^- ion pairs in ethylene carbonate. A molecular dynamics study with classical rate theories

Energy Technology Data Exchange (ETDEWEB)

Chang, Tsun-Mei [Department of Chemistry, University of Wisconsin–Parkside, Kenosha, Wisconsin 53141, USA; Dang, Liem X. [Physical Sciences Division, Pacific Northwest National Laboratory, Richland, Washington 93352, USA

2017-10-28

Using our polarizable force-field models and employing classical rate theories of chemical reactions, we examine the ethylene carbonate (EC) exchange process between the first and second solvation shells around Li+ and the dissociation kinetics of ion pairs Li+-[BF4] and Li+-[PF6] in this solvent. We calculate the exchange rates using transition state theory and correct them with transmission coefficients computed by the reactive flux; Impey, Madden, and McDonald approaches; and Grote-Hynes theory. We found the residence times of EC around Li+ ions varied from 70 to 450 ps, depending on the correction method used. We found the relaxation times changed significantly from Li+-[BF4] to Li+-[PF6] ion pairs in EC. Our results also show that, in addition to affecting the free energy of dissociation in EC, the anion type also significantly influence the dissociation kinetics of ion pairing. This work was supported by the U.S. Department of Energy, Office of Science, Office of Basic Energy Sciences, Division of Chemical Sciences, Geosciences, and Biosciences. The calculations were carried out using computer resources provided by the Office of Basic Energy Sciences.

BF3·Et2O-promoted cleavage of the Csp-Csp2 bond of 2-propynolphenols/anilines: route to C2-alkenylated benzoxazoles and benzimidazoles.

Science.gov (United States)

Song, Xian-Rong; Qiu, Yi-Feng; Song, Bo; Hao, Xin-Hua; Han, Ya-Ping; Gao, Pin; Liu, Xue-Yuan; Liang, Yong-Min

2015-02-20

A novel BF3·Et2O-promoted tandem reaction of easily prepared 2-propynolphenols/anilines and trimethylsilyl azide is developed to give C2-alkenylated benzoxazoles and benzimidazoles in moderate to good yields. Most reactions could be accomplished in 30 min at room temperature. This tandem process involves a Csp-Csp2 bond cleavage and a C-N bond formation. Moreover, both tertiary and secondary propargylic alcohols with diverse functional groups were tolerated under the mild conditions.

Improved production of 2,5-furandicarboxylic acid by overexpression of 5-hydroxymethylfurfural oxidase and 5-hydroxymethylfurfural/furfural oxidoreductase in Raoultella ornithinolytica BF60.

Science.gov (United States)

Yuan, Haibo; Li, Jianghua; Shin, Hyun-Dong; Du, Guocheng; Chen, Jian; Shi, Zhongping; Liu, Long

2018-01-01

2,5-Furandicarboxylic acid (FDCA) is a promising bio-based building block and can be produced by biotransformation of 5-hydroxymethylfurfural (HMF). To improve the FDCA production, two genes-one encoding HMF oxidase (HMFO; from Methylovorus sp. strain MP688) and another encoding for HMF/Furfural oxidoreductase (HmfH; from Cupriavidus basilensis HMF14)-were introduced into Raoultella ornithinolytica BF60. The FDCA production in the engineered whole-cell biocatalyst increased from 51.0 to 93.6mM, and the molar conversion ratio of HMF to FDCA increased from 51.0 to 93.6%. Copyright © 2017 Elsevier Ltd. All rights reserved.

Effects of Royal Jelly and Bee Pollen on the Growth of Selected Probiotic Bacteria (Bf. animalis Spp. Lactis, L. acidophilus and L. casei

Directory of Open Access Journals (Sweden)

Guldas Metin

2016-12-01

Full Text Available In this research article, the effects of bee pollen and royal jelly on the selected probiotic bacteria, as growth factors, were investigated. The probiotic cultures were activated in MRS broth at 37°C. Then, bee pollen and royal jelly (10 mg/100 μL, 25 mg/250 μL, 50 mg/500 μL, 75 mg/750 μL, and 100 mg/1000 μL were added on the probiotic cultures in MRS broth and sampled at 0, 24, and 48 hours of incubation. The medias used for enumeration of the probiotic cultures were RCA (Reinforced Clostridial Agar for Bf. animalis spp. lactis, MRS (deMann, Rogosa and Sharpe Agar with D-sorbitol for Lb. acidophilus and MRS-Vancomycine Agar for Lb. casei. The lactic acid production by Lb. acidophilus, Lb. casei, and Bf. animalis spp. lactis, and acetic acid production by Bf. animalis spp. lactis, were determined to compare the bacterial proliferation. The probiotic cultures were mainly affected by the bee pollen and royal jelly during the first 24 hours. The changes observed in the number of probiotic counts between 24 and 48 hours were not significant, statistically (P<0.05. Generally, the probiotic bacterial counts increased parallel to the concentration of bee pollen or royal jelly up to 75mg, and remained unchanged above this concentration. In terms of lactic acid production and bacterial growth, the most significant growth was observed on Lb. acidophilus when bee pollen or royal jelly was added.

Observations of zodiacal light of the isolated Herbig BF Ori Ae star

International Nuclear Information System (INIS)

Grinin, V.P.; Kiselev, N.N.; Minikulov, N.Kh.; AN Tadzhikskoj SSR, Dushanbe

1989-01-01

The isolated Herbig BF Ori Ae-star belongs to the subclass of young irreguLar variables with non-periodic Algol-type brightness variations. In the course of polarization and photometrical patrol observations carried out in 1987-88 in the Crimea and Sanglock, high linear polarization has been observed in deep minima. The analysis of the observations show, that the most probably a source of polarization is the scattered light from the circumstellar dust disklike envelope that is the analogue of the solar zodiacal light. It is concluded that the bimodal distribution oF positional angles of linear polarization in L 1641 reflects a complex structure of the magnetic field in this giant cloud

Synthesis of 11C labelled methyl esters: transesterification of enol esters versus BF3 catalysed esterification-a comparative study

International Nuclear Information System (INIS)

Ackermann, Uwe; Blanc, Paul; Falzon, Cheryl L.; Issa, William; White, Jonathan; Tochon-Danguy, Henri J.; Sachinidis, John I.; Scott, Andrew M.

2006-01-01

C-11 labelled methyl esters have been synthesized via the transesterification of enol esters in the presence of C-11 methanol and 1,3 dichlorodibutylstannoxane as catalyst. This method leaves functional groups intact and allows access to a wider variety of C-11 labelled methyl esters compared to the BF 3 catalysed ester formation, which uses carboxylic acids and C-11 methanol as starting materials

Vector coherent state representations of SO5 contains SU2 + SU2 contains U1 + U1 and SO5 contains U1 + U1

International Nuclear Information System (INIS)

Pan Feng

1991-01-01

VCS representations of SO 5 contains SU 2 + SU 2 contains U 1 + U 1 and SO 5 contains U 1 + U 1 are discussed. Reduced matrix elements for SO 5 contains SU 2 + SU 2 are derived. The multiplicity of a weight for SO 5 is determined by using the K-matrix technique

Synthesis, spectroscopic and catalytic properties of some new boron hybrid molecule derivatives by BF2 and BPh2 chelation

Science.gov (United States)

Kilic, Ahmet; Alcay, Ferhat; Aydemir, Murat; Durgun, Mustafa; Keles, Armagan; Baysal, Akın

2015-05-01

A new series of Schiff base ligands (L1-L3) and their corresponding fluorine/phenyl boron hybrid complexes [LnBF2] and [LnBPh2] (n = 1, 2 or 3) have been synthesized and well characterized by both analytical and spectroscopic methods. The Schiff base ligands and their corresponding fluorine/phenyl boron hybrid complexes have been characterized by NMR (1H, 13C and 19F), FT-IR, UV-Vis, LC-MS, and fluorescence spectroscopy as well as melting point and elemental analysis. The fluorescence efficiencies of phenyl chelate complexes are greatly red-shifted compared to those of the fluorine chelate analogs based on the same ligands, presumably due to the large steric hindrance and hard π → π∗ transition of the diphenyl boron chelation, which can effectively prevent molecular aggregation. The boron hybrid complexes were applied to the transfer hydrogenation of acetophenone derivatives to 1-phenylethanol derivatives in the presence of 2-propanol as the hydrogen source. The catalytic studies showed that boron hybrid complexes are good catalytic precursors for transfer hydrogenation of aromatic ketones in 0.1 M iso-PrOH solution. Also, we have found that both steric and electronic factors have a significant impact on the catalytic properties of this class of molecules.

Comments on the feasibility studies concerning the decommissioning options LAW retrieval, relocation and backfilling for the Asse facility with respect to the applicability of the BfS evaluation criteria

International Nuclear Information System (INIS)

Alt, Stefan; Kallenbach-Herbert, Beate; Neles, Julia

2009-01-01

The comments on the feasibility studies cover the decommissioning options LAW retrieval, relocation and backfilling for the Asse facility with respect to the applicability of the BfS evaluation criteria. The respective BfS criteria include the evaluation with respect to the safety during the operational phase, the environmental impacts in case of an uncontrollable brine intrusion; the preliminary long-term safety assessment; the feasibility; and the time required.

Development and Preliminary Psychometric Evaluation of a Brief Self-Report Questionnaire for the Assessment of the DSM-5 level of Personality Functioning Scale: The LPFS Brief Form (LPFS-BF).

Science.gov (United States)

Hutsebaut, Joost; Feenstra, Dine J; Kamphuis, Jan H

2016-04-01

The Diagnostic and Statistical Manual of Mental Disorders (5th ed.; DSM-5; American Psychiatric Association, 2013) alternative model for personality disorders (PDs) introduced a new paradigm for the assessment of PDs that includes levels of personality functioning indexing the severity of personality pathology irrespective of diagnosis. In this study, we describe the development and preliminary psychometric evaluation of a newly developed brief self-report questionnaire to assess levels of personality functioning, the Level of Personality Functioning Scale-Brief Form (LPFS-BF; Bender, Morey, & Skodol, 2011). Patients (N = 240) referred to a specialized setting for the assessment and treatment of PDs completed the LPFS-BF, the Brief Symptom Inventory (BSI; Derogatis, 1975), the Severity Indices of Personality Problems (SIPP-118; Verheul et al., 2008), and were administered the Structured Clinical Interview for DSM-IV Axis I Personality Disorders (SCID-I; APA, 1994; First, Spitzer, Gibbon, & Williams, 1997) and the SCID Axis II Personality Disorders (SCID-II; First, Spitzer, Gibbon, Williams, & Benjamin, 1996). When constrained to a 2-factor oblique solution, the LPFS-BF yielded a structure that corresponded well to an interpretation of Self- and Interpersonal Functioning scales. The instrument demonstrated fair to satisfactory internal consistency and promising construct validity. The LPFS-BF constitutes a short, user-friendly instrument that provides a quick impression of the severity of personality pathology, specifically oriented to the DSM-5 model. Clearly, more research is needed to test its validity and clinical utility. (c) 2016 APA, all rights reserved).

Stabilization and reactivity of a terminal phosphidounit on Pt(II). Synthesis and X-ray structure of cationic diphelylphosphine [Pt{C6H3(CH2NMe2)2-2,6}(PHPh2)][CF3SO3] and Diphenyl-phosphido Bridged Pt(II)-Pd(II) Complex [Pt{C6H3(CH2NMe2)2-2,6} (µ-PPh2) Pd(C6H4CH2NMe2-2)(H2O)][BF4] CH2Cl2

NARCIS (Netherlands)

Koten, G. van; Maassarani, F.; Davidson, M.F.; Wehman-Ooyevaar, ICM; Grove, D.M.; Koten, M.A. van; Smeets, W.J.J.; Spek, A.L.

1995-01-01

Reaction of diphenylphosphine with the complexes [Pt(NCN)(H{2}O)]X (NCN = C{6}H{3}(CH{2}NMe{2}){2}-2, 6; X = BF{4} (1a), OSO{2}CF{3} (1b)) leads to substitution of the H{2}O ligand to afford the ionic Pt(II) complexes [Pt(NCN)(PHPh{2})]X (X = BF{4} (2a), OSO{2}CF{3} (2b)). The X-ray structure of the

Gibb's energy and intermolecular free length of 'Borassus Flabellifier' (BF) and Adansonia digitata (AnD) aqueous binary mixture

International Nuclear Information System (INIS)

Phadke, Sushil; Shrivastava, Bhakt Darshan; Ujle, S K; Mishra, Ashutosh; Dagaonkar, N

2014-01-01

One of the potential driving forces behind a chemical reaction is favourable a new quantity known as the Gibbs free energy (G) of the system, which reflects the balance between these forces. Ultrasonic velocity and absorption measurements in liquids and liquid mixtures find extensive application to study the nature of intermolecular forces. Ultrasonic velocity measurements have been successfully employed to detect weak and strong molecular interactions present in binary and ternary liquid mixtures. After measuring the density and ultrasonic velocity of aqueous solution of 'Borassus Flabellifier' BF and Adansonia digitata And, we calculated Gibb's energy and intermolecular free length. The velocity of ultrasonic waves was measured, using a multi-frequency ultrasonic interferometer with a high degree of accuracy operating Model M-84 by M/s Mittal Enterprises, New Delhi, at a fixed frequency of 2 MHz. Natural sample 'Borassus Flabellifier' BF fruit pulp and Adansonia digitata AnD powder was collected from Dhar, District of MP, India for this study.

Relationship between body fat and BMI in a U.S. Hispanic population-based cohort study: Results from HCHS/SOL

Science.gov (United States)

To evaluate the percentage of body fat (%BF)-BMI relationship, identify %BF levels corresponding to adult BMI cut points, and examine %BF-BMI agreement in a diverse Hispanic/Latino population. %BF by bioelectrical impedance analysis was corrected against %BF by 18O dilution in 434 participants of th...

Phylogenetic analysis of HIV-1 pol gene: first subgenomic evidence of CRF29-BF among Iranian HIV-1 patients

Directory of Open Access Journals (Sweden)

Kazem Baesi

2014-09-01

Full Text Available Objective: To identify the dominant subtype among the HIV-1 strains circulation in Iran. Methods: In this cross sectional study 100 HIV positive patients participated. HIV-1 RNA was extracted from plasma. RT nested-PCR was performed and the final products were sequenced and phylogenetically analyzed; reference sequences were downloaded from Los Alamos, aligned with Iranian pol sequences in the study and analyzed by neighbor-joining method. Results: The results of the phylogenetic analysis showed that HIV-1 subtype CRF-35AD was the dominant subtype among HIV-1 infected patients in Iran; this analysis also suggested a new circulating recombinant form that had not previously been identified in Iran: CRF-29BF. Conclusions: The impact of HIV diversity on pathogenesis, transmission and clinical management have been discussed in different studies; therefore, analyses of HIV genetic diversity is required to design effective antiretroviral strategies for different HIV subtypes.

Synthesis of the compound tetrakis (2- methoxy isobutyl isonitrile) copper (I) tetrafluoroborate -(Cu[MIBI]4BF4): substance used in the production of the radiopharmaceutical sestamibi 99m Tc

International Nuclear Information System (INIS)

Silva, Katia Suzi da Silveira

2005-01-01

The radiopharmaceutical SESTAMIBI- 99m Tc presents interest and application in the clinical routine in Nuclear Medicine, especially for evaluation of the myocardium function and in the diagnosis of some tumors types, and the Center of Radiopharmacy of the IPEN has interest in the development of this radiopharmaceutical for attendance of the nuclear medicine class necessities. In this work it was demonstrated the synthesis and characterization of the active compound tetrakis (2- methoxy isobutyl isonitrile) copper (I) tetrafluoroborate - Cu[MIBI] 4 BF 4 - to be used in the preparation of lyophilized reagents for labeling with technetium- 99m as well as labeling studies and biological distribution. The synthesis of the reagent Cu[MIBI] 4 BF 4 was carried out in accordance with previously described procedures, in 5 steps and the compounds were characterized for infra-red, magnetic nuclear resonance, melting point and thin layer chromatography. The characterization of the chelate of MIBI -Cu[MIBI] 4 BF 4 - was carried out using high performance liquid chromatography, compared with a standard sample of the product and presented similar results, as described in literature. The lyophilized reagent was prepared and labeled with technetium- 99m , showing high radiochemical purity, higher than 97%, with high stability. Biological distribution in different animals showed good uptake in the heart, in time compatible with the acquisition of scintigraphy images, demonstrating the applicability of the reagent synthesized in the attainment of cardiac scintigraphy images. (author)

Electroreduction Property and MD Simulation of Nitrobenzene in Ionic Liquid [BMim][Tf2N]/[BMim][BF4

International Nuclear Information System (INIS)

Zeng, Jianping; Zhang, Yinxu; Sun, Ruyao; Chen, Song

2014-01-01

Highlights: • The two different common accessible ionic liquids are mixed in a simple and economic way. • In some compound ratios, the dynamic performance of nitrobenzene is superior to either of ionic liquids. • Modification and functionalization of ionic liquids in electrochemical field is feasible. • The mass transfer of diffusion of nitrobenzene in ionic liquids can be simulated with molecular dynamics. • Molecular dynamics explains the improvement of nitrobenzene in composite ionic liquids. - Abstract: The two different common accessible ionic liquids [BMim][BF 4 ] and [BMim][Tf 2 N] were mixed each other in a simple and economic way. In some compound ratios, the dynamic performance of nitrobenzene in electric reduction was superior to that of any single kind of ionic liquid has been appeared. The interaction and mass transfer of diffusion of nitrobenzene in composite ionic liquids with different volume ratios were studied with molecular dynamics (MD) simulation. The improvement of the electroreduction performance of nitrobenzene in composite ionic liquids was verified and was tried to explain. This provides a new idea for the modification and functionalization of ionic liquids in electrochemical field. The experimental results showed that kinematic viscosity and electroconductibility of different ionic liquid systems display a regular change. And the change law has been basically unchanged after adding water. The two different functional ionic liquids were complemented each other in a simple and economic way, which has compensated for the disadvantage of mono-component ionic liquids. At 25 °C, electroreduction property of V [BMim][BF4] :V [BMim][Tf2N] = 1:1 is the best in cyclic voltammetry experiments of nitrobenzene in different composite ionic liquids. Its electrochemical behavior is significantly affected by scan rate, temperature, concentration of nitrobenzene and concentration of water. The MD simulation results showed most of interaction

Measurement of the Color-Suppressed B0->D(*)0 pi0 /omega/eta/eta Prime Branching Fractions

Energy Technology Data Exchange (ETDEWEB)

Prudent, X

2008-11-05

The authors report results on the branching fraction (BF) measurement of the color-suppressed decays {bar B}{sup 0} {yields} D{sup 0}{pi}{sup 0}, D*{sup 0}{pi}{sup 0}, D{sup 0}{eta}, D*{sup 0}{eta}, D{sup 0}{omega}, D*{sup 0}{omega}, D{sup 0}{eta}{prime}, and D*{sup 0}{eta}{prime}. They measure the branching fractions BF(D{sup 0}{pi}{sup 0}) = (2.78 {+-} 0.08 {+-} 0.20) x 10{sup -4}, BF(D*{sup 0}{pi}{sup 0}) = (1.78 {+-} 0.13 {+-} 0.23) x 10{sup -4}, BF(D{sup 0}{eta}) = (2.41 {+-} 0.09 {+-} 0.17) x 10{sup -4}, BF(D*{sup 0}{eta}) = (2.32 {+-} 0.13 {+-} 0.22) x 10{sup -4}, BF(D{sup 0}{omega}) = (2.77 {+-} 0.13 {+-} 0.22) x 10{sup -4}, BF(D*{sup 0}{omega}) = (4.44 {+-} 0.23 {+-} 0.61) x 10{sup -4}, BF(D{sup 0}{eta}{prime}) = (1.38 {+-} 0.12 {+-} 0.22) x 10{sup -4} and BF(D*{sup 0}{eta}{prime}) = (1.29 {+-} 0.23 {+-} 0.23) x 10{sup -4}, where the first uncertainty is statistical and the second is systematic. The result is based on a sample of (454 {+-} 5) x 10{sup 6} B{bar B} pairs collected at the {Upsilon}(4S) resonance from 1999 to 2007, with the BABAR detector at the PEP-II storage rings at the Stanford Linear Accelerator Center. The measurements are compared to theoretical predictions by factorization, SCET and pQCD. The presence of final state interactions predictions by factorization, SCET and pQCD. The presence of final state interactions is confirmed and the measurements seem to be more in favor of SCET compared to pQCD.

Dicty_cDB: Contig-U15582-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ) EST1120673 Aquilegia cDNA library Aquilegia formo... 36 0.36 3 ( AC115612 ) Dictyostelium discoideum chrom... cDNA clone ... 46 4.1 1 ( BX858993 ) AGENAE Rainbow trout normalized testis library (t... 46 4.1 1 ( BF0889...discoideum chromosome 2 map 2567470... 40 0.11 12 ( AL844509 ) Plasmodium falciparum chromosome 13. 38 0.15 17 ( EU016597 ) Unculture...EST1196545 Aquilegia cDNA library Aquilegia formo... 36 0.28 3 ( DT766291 ) EST1200140 Aquilegia cDNA libr...ary Aquilegia formo... 36 0.29 3 ( DT729293 ) EST1163143 Aquilegia cDNA library Aqu

Obesity, leanness, and mortality: effect modification by physical activity in men and women

DEFF Research Database (Denmark)

Heitmann, Berit; Hills, Andrew P; Frederiksen, Peder

2009-01-01

The 13-year mortality from BMI, body fat (BF), and fat-free mass (FFM) was examined among active and sedentary adults. In total, 2,819 men and women aged 35-65 years in 1987/1988, participating in the Danish MONICA project, were included, and followed for 13.6 years for total mortality. In men......, physical activity modified the health hazard of both a high and a low BMI, and the U-shaped association disappeared among the active (hazard ratio (HR) = 0.86, CI: 0.72-1.02). Among active men, FFM was inversely related to mortality (HR = 0.55, 95% CI: 0.40-0.77) whereas a direct positive trend was seen...... for BF. Among women, physical activity modified association between BMI and mortality, but the U-shaped association remained among the active. Among women, no significant associations were found between either BF or FFM and total mortality. All effects were independent of waist- and hip...

Design, synthesis and photoelectrochemical properties of hexagonal metallomacrocycles based on triphenylamine: [M6(4,4'-bis(2,2':6',2''-terpyridinyl)triphenylamine)6(X)12]; [M = Fe(II), PF6- and Zn(II), BF4-].

Science.gov (United States)

Hwang, Seok-Ho; Moorefield, Charles N; Wang, Pingshan; Fronczek, Frank R; Courtney, Brandy H; Newkome, George R

2006-08-07

Synthesis of a novel bis(terpyridine) ligand, 4,4'-bis(2,2':6',2''-terpyridinyl)triphenylamine, utilizing triphenylamine, as a specific angle controller, has led to the self-assembly of a unique hexagonal metallomacrocycle family, [Fe6(2)6(PF6)12] and [Zn6(2)6(BF4)12], utilizing terpyridine-metal(II)-terpyridine connectivity. The crystal structure of the novel ligand shows that the angle between the two terpyridinyl moieties is 119.69 degrees , which enabled the formation of the hexagonal-shaped macrocycles. The crystal packing architectures of this starting ligand revealed channels induced by solvent encapsulation. Following complexation of this ligand with transition metals [Fe(II) or Zn(II)] in a one-pot reaction, the resultant structures were characterized by (1)H and (13)C NMR, UV/Vis and mass spectroscopies. The expected metal-to-ligand charge transfer (MLCT; lambda(max) = 582 nm) and emission (lambda(em) = 575 nm) characteristics were exhibited by both [Fe6(2)6(PF6)12] and[Zn6(2)6(BF4)12]. The photoelectrochemical characteristics of these hexagonal metallomacrocycles demonstrate that they can be used as sensitizers in dye-sensitized solar cells.

Rate theory of solvent exchange and kinetics of Li(+) - BF4 (-)/PF6 (-) ion pairs in acetonitrile.

Science.gov (United States)

Dang, Liem X; Chang, Tsun-Mei

2016-09-07

In this paper, we describe our efforts to apply rate theories in studies of solvent exchange around Li(+) and the kinetics of ion pairings in lithium-ion batteries (LIBs). We report one of the first computer simulations of the exchange dynamics around solvated Li(+) in acetonitrile (ACN), which is a common solvent used in LIBs. We also provide details of the ion-pairing kinetics of Li(+)-[BF4] and Li(+)-[PF6] in ACN. Using our polarizable force-field models and employing classical rate theories of chemical reactions, we examine the ACN exchange process between the first and second solvation shells around Li(+). We calculate exchange rates using transition state theory and weighted them with the transmission coefficients determined by the reactive flux, Impey, Madden, and McDonald approaches, and Grote-Hynes theory. We found the relaxation times changed from 180 ps to 4600 ps and from 30 ps to 280 ps for Li(+)-[BF4] and Li(+)-[PF6] ion pairs, respectively. These results confirm that the solvent response to the kinetics of ion pairing is significant. Our results also show that, in addition to affecting the free energy of solvation into ACN, the anion type also should significantly influence the kinetics of ion pairing. These results will increase our understanding of the thermodynamic and kinetic properties of LIB systems.

Convergence of exterior solutions to radial Cauchy solutions for $\\partial_t^2U-c^2\\Delta U=0$

Directory of Open Access Journals (Sweden)

Helge Kristian Jenssen

2016-09-01

Full Text Available Consider the Cauchy problem for the 3-D linear wave equation $\\partial_t^2U-c^2\\Delta U=0$ with radial initial data $U(0,x=\\Phi(x=\\varphi(|x|$, $U_t(0,x=\\Psi(x=\\psi(|x|$. A standard result states that $U$ belongs to $C([0,T];H^s(\\mathbb{R}^3$ whenever $(\\Phi,\\Psi\\in H^s\\times H^{s-1}(\\mathbb{R}^3$. In this article we are interested in the question of how U can be realized as a limit of solutions to initial-boundary value problems on the exterior of vanishing balls $B_\\varepsilon$ about the origin. We note that, as the solutions we compare are defined on different domains, the answer is not an immediate consequence of $H^s$ well-posedness for the wave equation.

Capillary evaporation of the ionic liquid [EMIM][BF4] in nanoscale solvophobic confinement

Science.gov (United States)

Shrivastav, Gourav; Remsing, Richard C.; Kashyap, Hemant K.

2018-05-01

Solvent density fluctuations play a crucial role in liquid-vapor transitions in solvophobic confinement and can also be important for understanding solvation of polar and apolar solutes. In the case of ionic liquids (ILs), density fluctuations can be used to understand important processes in the context of nanoscale aggregation and colloidal self-assemblies. In this article, we explore the nature of density fluctuations associated with capillary evaporation of the IL 1-ethyl-3-methylimidazolium tetrafluoroborate ([EMIM][BF4]) in the confined region of model solvophobic nanoscale sheets by using molecular dynamics simulations combined with non-Boltzmann sampling techniques. We demonstrate that density fluctuations of the confined IL play an important role in capillary evaporation, suggesting analogies to dewetting transitions involving water. Significant changes in the interfacial structure of the IL are also detailed and suggested to underlie a non-classical (non-parabolic) dependence of the free energy barrier to evaporation on the degree of confinement.

Magnetoelectric and electric measurements of the (1-x)BiFeO{sub 3}–(x)Pb(Fe{sub 1/2}Nb{sub 1/2})O{sub 3} solid solutions

Energy Technology Data Exchange (ETDEWEB)

Bochenek, D., E-mail: dariusz.bochenek@us.edu.pl [University of Silesia, Faculty of Computer Science and Material Science, Institute of Technology and Mechatronics, 12, Żytnia St., 41–200, Sosnowiec (Poland); Niemiec, P. [University of Silesia, Faculty of Computer Science and Material Science, Institute of Technology and Mechatronics, 12, Żytnia St., 41–200, Sosnowiec (Poland); Guzdek, P. [Institute of Electron Technology Cracow Division, 39, Zabłocie St., Cracow, 30-701 (Poland); Wzorek, M. [Institute of Electron Technology, Al. Lotników 32/46, 02-668, Warsaw (Poland)

2017-07-01

In the paper ferro–electro–magnetic (1-x)BiFeO{sub 3}-(x)Pb(Fe{sub 1/2}Nb{sub 1/2})O{sub 3} (BF-PFN) solid solutions were obtained (containing the percentage BF/PFN: 60/40 and 70/30). Individual components of the solid solution were prepared by follows methods: synthesizing a powder BF was performed by calcining the simple oxides (Bi{sub 2}O{sub 3}, Fe{sub 2}O{sub 3}), and synthesizing a powder PFN was carried out by calcining a mixture of complex oxides (FeNbO{sub 4}, PbO). Compaction of synthesized and mixed BiFeO{sub 3}, PbFe{sub 1/2}Nb{sub 1/2}O{sub 3} powders was carried out by free sintering methods. X–ray, microstructure, dielectric, magnetic and magnetoelectric studies, DC electrical conductivity and electrical hysteresis loop were carried out. Magnetoelectric effect measurements performed at room temperature showed coupling between electric and magnetic subsystem of the BF–PFN solid solutions. - Highlights: • BF-PFN samples have a densely packed microstructure, with well crystallized grains. • Bi atoms possibly migrate from BF toward PFN component during sintering. • BF-PFN have a diffuse character of the ferroelectric–paraelectric phase transition. • Magnetoelectric coefficient (α{sub ME}) for BF-PFN is higher, than for pure BF. • The α{sub ME} for BF-PFN is about three times higher than for 0.75BiFeO{sub 3}–0.25BaTiO{sub 3}.

Li+ solvation and kinetics of Li+-BF4-/PF6- ion pairs in ethylene carbonate. A molecular dynamics study with classical rate theories

Science.gov (United States)

Chang, Tsun-Mei; Dang, Liem X.

2017-10-01

Using our polarizable force-field models and employing classical rate theories of chemical reactions, we examine the ethylene carbonate (EC) exchange process between the first and second solvation shells around Li+ and the dissociation kinetics of ion pairs Li+-[BF4] and Li+-[PF6] in this solvent. We calculate the exchange rates using transition state theory and correct them with transmission coefficients computed by the reactive flux, Impey, Madden, and McDonald approaches, and Grote-Hynes theory. We found that the residence times of EC around Li+ ions varied from 60 to 450 ps, depending on the correction method used. We found that the relaxation times changed significantly from Li+-[BF4] to Li+-[PF6] ion pairs in EC. Our results also show that, in addition to affecting the free energy of dissociation in EC, the anion type also significantly influences the dissociation kinetics of ion pairing.

Second expert discussion on the BMU/BfS concept of man-machine interaction in nuclear power plants

International Nuclear Information System (INIS)

Gersinska, R.; Hennig, R.; Kociok, B.

1992-04-01

The purpose of this meeting was to assess the need for further research on the impact of human factors. As a result, the following topics were defined as future research projects: Technical requirements on the interface man-machine during the operation of nuclear power plants; technical, organizational and personal requirements during service, maintenance and repair in nuclear power plants; technical, organizational and personel requirements for accident management. For the examination of these key subjects detailled performance criteria were set up by the BfS. (orig./DG) [de

Temperature dependence of the elastic constant of Borassus Flabellifier 'BF' material by acoustic response

International Nuclear Information System (INIS)

Phadke, Sushil; DShrivastava, B; Dagaonkar, N; Mishra, Ashutosh

2012-01-01

The homogeneous continuous materials are widely used for many structural applications. Migrations of atoms or molecules are the mechanism of mechanical and kinetic processes in materials for their synthesis processing as well as for their structural evolutions. The elastic constant of solids provides valuable information on their mechanical and dynamical properties. In particular, they provide information on the stability and stiffness of materials. In the present study author investigated relation between elastic constant and temperature in Borassus Flabellifier 'BF' wood part. Determination of elastic properties of material is based on the longitudinal wave's velocities via ultrasonic methods. The resonant frequencies of the specimens were measured by Ultrasonic Interferometer (for solids) dual frequency using longitudinal cubic piezoelectric crystal of quartz of frequency 123.62 KHz. The temperature variations from room temperature were done by PID control unit, Mittal Enterprises, New Delhi, India. Characterization of the samples was done by scanning electron microscope (SEM) Model JEOL JSM5400 at 5.0kvx750, 10 μm.

Main areas of work of the German Radiation Protection Office (BfS). Final disposal of radioactive wastes

International Nuclear Information System (INIS)

Kleemann, U.

2006-01-01

The Federal Ministry for Environment, Nature Conservation and Reactor Safety (BMU) formulated twelve questions which are in principle relevant to all host rock formations and require clarification in any case. The task of the BfS was to compile a comparison of different host rock formations on the basis of the answers given to these twelve questions for the individual projects. The main focus was on whether these safety-related questions merit different answers for different host rock formations and whether this has an impact on the requirements to be placed on final disposal concepts

Dicty_cDB: Contig-U13257-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 1903.... 52 2e-05 (Q3V1N1) RecName: Full=Malignant fibrous histiocytoma-amplified ... 52 2e-05 AK171731_1( A...51 3e-05 (Q9Y4C4) RecName: Full=Malignant fibrous histiocytoma-amplified ... 51 3e-05 Z83230_4( Z83230 |pid:...gnant fibrous histiocytoma-amplified ... 44 0.003 DQ526607_1( DQ526607 |pid:none) Arabidopsis thali...ne/threonine-protein kinase roco4; EC=2.7.11.1; AltName: Full=Ras of complex proteins and C-terminal of roc ...6 0.19 2 ( EY270450 ) BF01053B1A07.f1 Normalized subtracted keck librar... 46 0.21 2 ( EK334602 ) 1095467035856 Global-Ocean-Sampli

Electronic and structural aspects of spin transitions observed by optical microscopy. The case of [Fe(ptz)6](BF4)2.

Science.gov (United States)

Chong, Christian; Mishra, Haritosh; Boukheddaden, Kamel; Denise, Stéphane; Bouchez, Guillaume; Collet, Eric; Ameline, Jean-Claude; Naik, Anil D; Garcia, Yann; Varret, François

2010-02-11

The colorimetric analysis of images recorded with an optical microscope during the onset of the spin crossover transformation allows monitoring separately the involved electronic and structural aspects, through the separation of resonant absorption and scattering effects. Complementary information can also be obtained by using the polarized modes of the microscope. These potentialities are illustrated by the observation of [Fe(ptz)(6)](BF(4))(2) single crystals during the onset of the thermal transitions in the 110-140 K range. We characterized the interplay between the electronic (HS LS) and structural (order disorder) transformations. Elastic stresses and mechanical effects (hopping, self-cleavage) generated by the volume change upon electronic transition are also illustrated, with their impact on the photoswitching properties of the crystals.

Systematic study of spin crossover and structure in [Co(terpyRX)2](Y)2 systems (terpyRX = 4'-alkoxy-2,2':6',2''-terpyridine, X = 4, 8, 12, Y = BF4(-), ClO4(-), PF6(-), BPh4(-))

DEFF Research Database (Denmark)

Nielsen, Pia; Nielsen, Hans Toftlund; Bond, Andrew

2009-01-01

A family of spin crossover cobalt(II) complexes of the type [Co(terpyRX)(2)](Y)(2) x nH(2)O (X = 4, 8, 12 and Y = BF(4)(-), ClO(4)(-), PF(6)(-), BPh(4)(-)) has been synthesized, whereby the alkyl chain length, RX, and counteranion, Y, have been systematically varied. The structural (single crystal...

Path integral for coherent states of the dynamical U2 group and U2/1 supergroup

International Nuclear Information System (INIS)

Kochetov, E.A.

1992-01-01

A part-integral formulation in the representation of coherent states for the unitary U 2 group and U 2/1 supergroup is introduced. U 2 and U 2/1 path integrals are shown to be defined on the coset spaces U 2 /U 1 xU 1 and U 2/1 /U 1/1 xU 1 , respectively. These coset appears as curved classical phase spaces. Partition functions are expressed as path integrals over these spaces. In the case when U 2 and U 2/1 are the dynamical groups, the corresponding path integrals are evaluated with the help of linear fractional transformations that appear as the group (supergroup) action in the coset space (superspace). Possible applications for quantum models are discussed. 9 refs

Boron Profile Sharpening in Ultra-Shallow p+-n Junction Produced by Plasma Immersion Ion Implantation from BF3 Plasma

International Nuclear Information System (INIS)

Lukichev, V.; Rudenko, K.; Orlikovsky, A.; Pustovit, A.; Vyatkin, A.

2008-01-01

We have investigated plasma immersion ion implantation (PI 3 ) of boron with energies of 500 eV (doses up to 2x10 15 cm -2 ) from BF 3 plasma with He pre-amorphizing implantation (PAI)(energy 3 keV, dose 5x10 16 cm -2 ). Implanted samples were subjected to RTA (T = 900 to 1050 deg. C, t = 2 to 24 sec and spike anneal). SIMS analysis of boron profiles revealed its anomalous behavior. For short RTA times the profile tail (below 5x10 19 cm -3 ) moves toward the surface and then, as in the usual diffusion, toward the bulk at longer annealing times.

Novel doubly charged cation based electrolytes for non-aqueous supercapacitors

Energy Technology Data Exchange (ETDEWEB)

Jaenes, Alar; Kurig, Heisi; Romann, Tavo; Lust, Enn [Institute of Chemistry, University of Tartu, 14a Ravila Street, 50411 Tartu (Estonia)

2010-04-15

The electrochemical characteristics for the electrical double layer capacitors based on the titanium carbide derived carbon (CDC-TiC) electrodes in 0.4 M N,N-dimethyl-1,4-diazabicyclo[2,2,2]octanediium tetrafluoroborate (DMDABCO(BF{sub 4}){sub 2}), 0.2 M DMDABCO(BF{sub 4}){sub 2} + 0.2 M triethylmethylammonium tetrafluoroborate (TEMABF{sub 4}), and 0.4 M TEMABF{sub 4} in {gamma}-butyrolactone ({gamma}-BL) have been studied using cyclic voltammetry, constant current charging/discharging and electrochemical impedance spectroscopy. The ideal electrical double layer capacitor behaviour was observed in a wide region of cell voltages (U {<=} 3.0 V) for the CDC-TiC electrodes in 0.4 M DMDABCO(BF{sub 4}){sub 2} in {gamma}-BL. The geometry of solvation shells around DMDABCO{sup 2+}, TEMA{sup +}, and BF{sub 4}{sup -} have been optimized with molecular dynamics calculations and the coordination numbers equal to 15, 7 or 8, respectively, have been proposed and compared with electrochemical and gas sorption data for CDC-TiC. The gravimetric capacitance (129 F g{sup -1}), high gravimetric energy (40.6 Wh kg{sup -1}) and power (93 kW kg{sup -1}) were established for the CDC-TiC electrodes in 0.4 M DMDABCO(BF{sub 4}){sub 2} {gamma}-BL solution. (author)

Nuclear Hyperfine Structure in the Donor – Acceptor Complexes (CH3)3N-BF3 and (CH)33N-B(CH3)3

Science.gov (United States)

The donor-acceptor complexes (CH3)3N-BF3 and (CH3)3N-B(CH3)3 have been reinvestigated at high resolution by rotational spectroscopy in a supersonic jet. Nuclear hyperfine structure resulting from both nitrogen and boron has been resolved and quadrupole coupling constants have bee...

OpenU 1.0

NARCIS (Netherlands)

Alberts, Jules; Finders, Anton; Martens, Harrie; Obreza, Matija; Schaeps, Leon; Slootmaker, Aad; Slot, Wim; Storm, Jeroen; Ternier, Stefaan; Van der Vegt, Wim; Vogten, Hubert

2013-01-01

Alberts, J., Finders, A., Martens, H., Obreza, M., Schaeps, L., Slootmaker, A., Slot, W., Storm, J., Ternier, S., Van der Vegt, W., & Vogten, H. (2012). OpenU (Version 1.0) [Software]. Heerlen, The Netherlands: Open Universiteit. Available under the GNU Lesser General Public License (LGPL3).

Photoassociation spectroscopy of 87Rb2 (5s1/2+5p1/2)0u+ long-range molecular states: Coupling with the (5s1/2+5p3/2)0u+ series analyzed using the Lu-Fano approach

International Nuclear Information System (INIS)

Jelassi, H.; Viaris de Lesegno, B.; Pruvost, L.

2006-01-01

We report on photoassociation of cold 87 Rb atoms providing the spectroscopy of (5s 1/2 +5p 1/2 )0 u + long-range molecular states, in the energy range of [-12.5, -0.7 cm -1 ] below the dissociation limit. A Lu-Fano approach coupled to the LeRoy-Bernstein formula is used to analyze the data. The Lu-Fano graph exhibits the coupling of the molecular series with the (5s 1/2 +5p 3/2 )0 u + one, which is due to spin effects in the molecule. A two-channel model involving an improved LeRoy-Bernstein formula allows us to characterize the molecular series, to localize (5s 1/2 +5p 3/2 )0 u + levels, to evaluate the coupling, and to predict the energy and width of the first predissociated level of (5s 1/2 +5p 3/2 )0 u + series. An experimental spectrum confirms the prediction

Tank 241-U-102, Grab Samples 2U-99-1, 2U-99-2 and 2U-99-3 Analytical Results for the Final Report

International Nuclear Information System (INIS)

STEEN, F.H.

1999-01-01

This document is the final report for tank 241-U-102 grab samples. Five grab samples were collected from riser 13 on May 26, 1999 and received by the 222-S laboratory on May 26 and May 27, 1999. Samples 2U-99-3 and 2U-99-4 were submitted to the Process Chemistry Laboratory for special studies. Samples 2U-99-1, 2U-99-2 and 2U-99-5 were submitted to the laboratory for analyses. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999 (TSAP) (Sasaki, 1999) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Fowler 1995, Mulkey and Miller 1998). The analytical results are presented in the data summary report. None of the subsamples submitted for differential scanning calorimetry (DSC), total organic carbon (TOC) and plutonium 239 (Pu239) analyses exceeded the notification limits as stated in TSAP

A wide dynamic range BF3 neutron monitor with front-end electronics based on a logarithmic amplifier

International Nuclear Information System (INIS)

Ferrarini, M.; Varoli, V.; Favalli, A.; Caresana, M.; Pedersen, B.

2010-01-01

This paper describes a wide dynamic range neutron monitor based on a BF 3 neutron detector. The detector is used in current mode, and front-end electronics based on a logarithmic amplifier are used in order to have a measurement capability ranging over many orders of magnitude. The system has been calibrated at the Polytechnic of Milan, CESNEF, with an AmBe neutron source, and has been tested in a pulsed field at the PUNITA facility at JRC, Ispra. The detector has achieved a dynamic range of over 6 orders of magnitude, being able to measure single neutron pulses and showing saturation-free response for a reaction rate up to 10 6 s -1 . It has also proved effective in measuring the PUNITA facility pulse integral fluence.

Synthesis, characterization, structure and properties of heterobimetallic complexes [CuNi(μ-OAc) (μ-OH) (μ-OH2) (bpy)2] (BF4)2 and [CuNi(bz)3(bpy)2] ClO4 from 2,2‧ bipyridine

Science.gov (United States)

Kurbah, Sunshine D.; Kumar, A.; Syiemlieh, I.; Dey, A. K.; Lal, R. A.

2018-02-01

Heterobimetallic complexes of the composition [CuNi(bpy)2 (μ-OAc) (μ-OH) (μ-OH2)](BF4)2 (1) and [CuNi(bz)3 (bpy)2]ClO4 (2) were synthesized in moderate yield through solid state reaction and have been characterized by elemental analyses, molar conductance, mass spectra, magnetic moment, EPR, UV-Vis, IR spectroscopies and cyclic voltammetry. The ground state in complex (1) is doublet while that in complex (2), the ground state is a mixture of doublet and quartet, respectively. The structure of the complexes has been established by X-ray crystallography. The electron transfer reactions of the complexes have been investigated by cyclic voltammetry.

COMPARISON BETWEEN FENTANYL 2 μG/mL VERSUS DEXMEDETOMIDINE 1.5 μG/mL AS ADJUVANTS WITH ISOBARIC BUPIVACAINE 0.0625% IN EPIDURAL LABOUR ANALGESIA

Directory of Open Access Journals (Sweden)

Karuna Harsoor

2016-11-01

Full Text Available BACKGROUND Low-dose bupivacaine with opioids like fentanyl have been used traditionally as an adjunct for epidural labour analgesia, but has side effects like pruritus, urinary retention, nausea, vomiting, etc. Dexmedetomidine, an α-2 adrenergic agonist with a high placental retention, decreased sympathetic outflow and norepinephrine release thereby causing sedation, anxiolysis, analgesia, sympatholysis and maternal haemodynamic stability. Hence, this study was carried out to compare dexmedetomidine and fentanyl as adjuvants in epidural labour analgesia. MATERIALS AND METHODS A prospective randomised, double-blind study was conducted in 60 term parturients in active labour of ASA I and II physical status. They were randomised into 2 groups with 30 parturients in each and received 15 mL of 0.0625% Inj. Bupivacaine plus either 1.5 μg/mL Inj. Dexmedetomidine (BD group or 2 μg/mL Inj. Fentanyl (BF group. VAS, sedation scores, modified four grade Bromage scale, haemodynamics, peripheral oxygen saturation were recorded at baseline and regular intervals. When VAS was ≥4, subsequent doses of 5 mL of the respective group drug was administered. Parturients were ambulated when Bromage scale was 0 with no postural hypotension. Duration of analgesia, labour outcome, neonatal Apgar scores and side effects were noted. RESULTS Demography and haemodynamic stability were similar and comparable. Duration of analgesia was significantly longer in BD group (131.83±45.760 than BF group (85.33±22.512 (p<0.0001. More no. of top-ups was needed in BF group (1.80±1.518 than BD group (0.17±0.461 (p<0.0001. Significantly reduced VAS scores was observed in BD group than BF group. Mean sedation scores (p<0.05 and maximum Bromage scores (p=0.004 were significantly higher in BD group than BF group. Ambulation was less in BD group (3 parturients than BF group (26 parturients. Side effects were significantly more in BF group than BD group (p=0.007. The labour outcomes

Rate theory of solvent exchange and kinetics of Li+ − BF4−/PF6− ion pairs in acetonitrile

International Nuclear Information System (INIS)

Dang, Liem X.; Chang, Tsun-Mei

2016-01-01

In this paper, we describe our efforts to apply rate theories in studies of solvent exchange around Li + and the kinetics of ion pairings in lithium-ion batteries (LIBs). We report one of the first computer simulations of the exchange dynamics around solvated Li + in acetonitrile (ACN), which is a common solvent used in LIBs. We also provide details of the ion-pairing kinetics of Li + -[BF 4 ] and Li + -[PF 6 ] in ACN. Using our polarizable force-field models and employing classical rate theories of chemical reactions, we examine the ACN exchange process between the first and second solvation shells around Li + . We calculate exchange rates using transition state theory and weighted them with the transmission coefficients determined by the reactive flux, Impey, Madden, and McDonald approaches, and Grote-Hynes theory. We found the relaxation times changed from 180 ps to 4600 ps and from 30 ps to 280 ps for Li + -[BF 4 ] and Li + -[PF 6 ] ion pairs, respectively. These results confirm that the solvent response to the kinetics of ion pairing is significant. Our results also show that, in addition to affecting the free energy of solvation into ACN, the anion type also should significantly influence the kinetics of ion pairing. These results will increase our understanding of the thermodynamic and kinetic properties of LIB systems.

When are active Brownian particles and run-and-tumble particles equivalent? Consequences for motility-induced phase separation

OpenAIRE

Cates, M. E.; Tailleur, J.

2012-01-01

Active Brownian particles (ABPs, such as self-phoretic colloids) swim at fixed speed $v$ along a body-axis ${\\bf u}$ that rotates by slow angular diffusion. Run-and-tumble particles (RTPs, such as motile bacteria) swim with constant $\\u$ until a random tumble event suddenly decorrelates the orientation. We show that when the motility parameters depend on density $\\rho$ but not on ${\\bf u}$, the coarse-grained fluctuating hydrodynamics of interacting ABPs and RTPs can be mapped onto each other...

Adsorption of reactive blue BF-5G dye by soybean hulls: kinetics, equilibrium and influencing factors.

Science.gov (United States)

Honorio, Jacqueline Ferandin; Veit, Márcia Teresinha; Gonçalves, Gilberto da Cunha; de Campos, Élvio Antonio; Fagundes-Klen, Márcia Regina

2016-01-01

The textile industry is known for the high use of chemicals, such as dyes, and large volumes of effluent that contaminate waters, a fact that has encouraged research and improved treatment techniques. In this study, we used unprocessed soybean hulls for the removal of reactive blue BF-5G dye. The point of zero charge of soybean hulls was 6.76. Regarding the speed of agitation in the adsorption process, the resistance to mass transfer that occurs in the boundary layer was eliminated at 100 rpm. Kinetics showed an experimental amount of dye adsorbed at equilibrium of 57.473 mg g(-1) obtained under the following conditions: dye initial concentration = 400 mg L(-1); diameter of particle = 0.725 mm; dosage = 6 g L(-1); pH 2; 100 rpm; temperature = 30 °C; and duration of 24 hours. The pseudo-second order best showed the dye removal kinetics. The adsorption isotherms performed at different temperatures (20, 30, 40 and 50 °C) showed little variation in the concentration range assessed, being properly adjusted by the Langmuir isotherm model. The maximum capacity of dye adsorption was 72.427 mg g(-1) at 30 °C. Since soybean hull is a low-cost industrial byproduct, it proved to be a potential adsorbent for the removal of the textile dye assessed.

78 FR 27408 - Revised OIG's Provider Self-Disclosure Protocol

Science.gov (United States)

2013-05-10

... voluntarily identify, disclose, and resolve instances of potential fraud involving the Federal health care programs (as defined in section 1128B(f) of the Social Security Act (the Act), 42 U.S.C. 1320a-7b(f)). The...

Dicty_cDB: Contig-U02520-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ) KBrH001K21F KBrH, Brassica rapa HindIII BAC libra... 46 3.3 1 ( CT538104 ) A BAC library has been constructed from culti...1 ( DR026249 ) Osmo00116 F. cylindrus osmotic stress library Fra... 46 3.3 1 ( DN805411 ) 76947238 Sea Urchi...( CV793140 ) c-030216-1w_E04.abd cDNA library of Tamarix andro... 46 3.3 1 ( CV672849 ) RET7SJ_07D06.T7 Schistosoma japonicum re...012 2 ( CK416159 ) AUF_IpPit_34_o05 Pituitary cDNA library Ictalurus... 54 0.013 1 ( FE840166 ) CCAG48972.g1...99 ) NF075H11EC1F1095 Elicited cell culture Medicago t... 48 0.20 2 ( BF647354 ) NF075A06EC1F1040 Elicited cell culture Medic

Residual tensile stresses and piezoelectric properties in BiFeO3-Bi(Zn1/2Ti1/2O3-PbTiO3 ternary solid solution perovskite ceramics

Directory of Open Access Journals (Sweden)

Weilin Zheng

2016-08-01

Full Text Available For low dielectric loss perovskite-structured (1-x-yBiFeO3-xBi(Zn1/2Ti1/2O3-yPbTiO3 (BF-BZT-PT (x = 0.04-0.15 and y = 0.15-0.26 ceramics in rhombohedral/tetragonal coexistent phase, structural phase transitions were studied using differential thermal analyzer combined with temperature-dependent dielectric measurement. Two lattice structural phase transitions are disclosed in various BF-BZT-PT perovskites, which is different from its membership of BiFeO3 exhibiting just one lattice structural phase transition at Curie temperature TC= 830oC. Consequently, residual internal tensile stresses were revealed experimentally through XRD measurements on ceramic pellets and counterpart powders, which are reasonably attributed to special structural phase transition sequence of BF-BZT-PT solid solution perovskites. Low piezoresponse was observed and argued extrinsically resulting from residual tensile stresses pinning ferroelectric polarization switching. Post-annealing and subsequent quenching was found effective for eliminating residual internal stresses in those BZT-less ceramics, and good piezoelectric property of d33 ≥ 28 pC/N obtained for 0.70BF-0.08BZT-0.22PT and 0.05 wt% MnO2-doped 0.70BF-0.04BZT-0.26PT ceramics with TC ≥ 640oC, while it seemed no effective for those BZT-rich BF-BZT-PT ceramics with x = 0.14 and 0.15 studied here.

Dicty_cDB: Contig-U15843-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available BHY5562.rev CBHY Mycosphaerella fijiensis MfEST5... 36 7.1 2 ( BQ114953 ) EST600529 mixed potato tissues Sol...lus trich... 36 7.1 2 ( FD665298 ) CBBW522.rev CBBW Mycosphaerella fijiensis MfEST4 ... 36 7.1 2 ( FD692768 ...) CBHY4190.rev CBHY Mycosphaerella fijiensis MfEST5... 36 7.1 2 ( BP035364 ) Lotus japonicus cDNA, clone:MFB... 7.3 2 ( BF053354 ) EST438584 potato leaves and petioles Solanum tube... 36 7.3 2 ( FD686209 ) CBHX5588.rev CBHX Mycosphaerella fiji...ensis MfEST4... 36 7.3 2 ( FD687727 ) CBHY1213.rev CBHY Mycosphaerella fijiensis MfE

A wide dynamic range BF{sub 3} neutron monitor with front-end electronics based on a logarithmic amplifier

Energy Technology Data Exchange (ETDEWEB)

Ferrarini, M., E-mail: michele.ferrarini@polimi.i [Politecnico di Milano, Dipartimento Energia, via G. Ponzio 34/3, I-20133 Milano (Italy); Fondazione CNAO, via Caminadella 16, 20123 Milano (Italy); Varoli, V. [Politecnico di Milano, Dipartimento Energia, via G. Ponzio 34/3, I-20133 Milano (Italy); Favalli, A. [European Commission, Joint Research Centre, Institute for the Protection and Security of Citizen, TP 800, Via E. Fermi, 21027 Ispra (Vatican City State, Holy See) (Italy); Caresana, M. [Politecnico di Milano, Dipartimento Energia, via G. Ponzio 34/3, I-20133 Milano (Italy); Pedersen, B. [European Commission, Joint Research Centre, Institute for the Protection and Security of Citizen, TP 800, Via E. Fermi, 21027 Ispra (Italy)

2010-02-01

This paper describes a wide dynamic range neutron monitor based on a BF{sub 3} neutron detector. The detector is used in current mode, and front-end electronics based on a logarithmic amplifier are used in order to have a measurement capability ranging over many orders of magnitude. The system has been calibrated at the Polytechnic of Milan, CESNEF, with an AmBe neutron source, and has been tested in a pulsed field at the PUNITA facility at JRC, Ispra. The detector has achieved a dynamic range of over 6 orders of magnitude, being able to measure single neutron pulses and showing saturation-free response for a reaction rate up to 10{sup 6} s{sup -1}. It has also proved effective in measuring the PUNITA facility pulse integral fluence.

Role of the two-component regulatory system arlRS in ica operon and aap positive but non-biofilm-forming Staphylococcus epidermidis isolates from hospitalized patients.

Science.gov (United States)

Wu, Yang; Liu, Jingran; Jiang, Juan; Hu, Jian; Xu, Tao; Wang, Jiaxue; Qu, Di

2014-11-01

The ica operon and aap gene are important factors for Staphylococcus epidermidis biofilm formation. However, we found 15 out of 101 S. epidermidis strains isolated from patients had both the ica operon and the aap gene in the genome but could not form biofilms (ica(+)aap(+)/BF(-) isolates). Compared with standard strain RP62A, the 15 ica(+)aap(+)/BF(-) isolates had similar growth curves and initial attachment abilities, but had much lower apparent transcription levels of the icaA gene and significantly less production of polysaccharide intercellular adhesion (PIA). Furthermore, the expression of accumulation-associated protein in ica(+)aap(+)/BF(-) isolates was much weaker than in RP62A. The mRNA levels of icaADBC transcription-related regulatory genes, including icaR, sarA, rsbU, srrA, arlRS and luxS, were measured in the 15 ica(+)aap(+)/BF(-) clinical isolates. The mRNA levels of arlR and rsbU in all of the ica(+)aap(+)/BF(-) isolates were lower than in RP62A at 4 h. At 10 h, 14/15 of the isolates showed lower mRNA levels of arlR and rsbU than shown by RP62A. However, expression of sarA, luxS, srrA and icaR varied in different ica(+)aap(+)/BF(-) isolates. To further investigate the role of arlRS in biofilm formation, we analyzed icaA, sarA and rsbU transcription, PIA synthesis, Aap expression and biofilm formation in an arlRS deletion mutant of S. epidermidis strain 1457 and all were much less than in the wild type strain. This is consistent with the hypothesis that ArlRS may play an important role in regulating biofilm formation by the ica(+)aap(+)/BF(-)S. epidermidis clinical isolates and operate via both ica-dependent and Aap-dependent pathways. Copyright © 2014 Elsevier Ltd. All rights reserved.

Development of NRESP98 Monte Carlo codes for the calculation of neutron response functions of neutron detectors. Calculation of the response function of spherical BF{sub 3} proportional counter

Energy Technology Data Exchange (ETDEWEB)

Hashimoto, M.; Saito, K.; Ando, H. [Power Reactor and Nuclear Fuel Development Corp., Oarai, Ibaraki (Japan). Oarai Engineering Center

1998-05-01

The method to calculate the response function of spherical BF{sub 3} proportional counter, which is commonly used as neutron dose rate meter and neutron spectrometer with multi moderator system, is developed. As the calculation code for evaluating the response function, the existing code series NRESP, the Monte Carlo code for the calculation of response function of neutron detectors, is selected. However, the application scope of the existing NRESP is restricted, the NRESP98 is tuned as generally applicable code, with expansion of the geometrical condition, the applicable element, etc. The NRESP98 is tested with the response function of the spherical BF{sub 3} proportional counter. Including the effect of the distribution of amplification factor, the detailed evaluation of the charged particle transportation and the effect of the statistical distribution, the result of NRESP98 calculation fit the experience within {+-}10%. (author)

Energy Level Statistics of SO(5) Limit of Super-symmetry U(6/4) in Interacting Boson-Fermion Model

International Nuclear Information System (INIS)

Bai Hongbo; Zhang Jinfu; Zhou Xianrong

2005-01-01

We study the energy level statistics of the SO(5) limit of super-symmetry U(6/4) in odd-A nucleus using the interacting boson-fermion model. The nearest neighbor spacing distribution (NSD) and the spectral rigidity (Δ 3 ) are investigated, and the factors that affect the properties of level statistics are also discussed. The results show that the boson number N is a dominant factor. If N is small, both the interaction strengths of subgroups SO B (5) and SO BF (5) and the spin play important roles in the energy level statistics, however, along with the increase of N, the statistics distribution would tend to be in Poisson form.

7 CFR 51.2541 - U.S. Fancy, U.S. Extra No. 1, U.S. No. 1 And U.S. Select Grades.

Science.gov (United States)

2010-01-01

... PRODUCTS 1,2 (INSPECTION, CERTIFICATION, AND STANDARDS) United States Standards for Grades of Pistachio.... Fancy,” “U.S. Extra No. 1,” “U.S. No. 1,” and “U.S. Select” consists of pistachio nuts in the shell...

Neutron Energy Spectra from Neutron Induced Fission of 235U at 0.95 MeV and of 238U at 1.35 and 2.02 MeV

Energy Technology Data Exchange (ETDEWEB)

Almen, E; Holmqvist, B; Wiedling, T

1971-09-15

The shapes of fission neutron spectra are of interest for power reactor calculations. Recently it has been suggested that the neutron induced fission spectrum of 235U may be harder than was earlier assumed. For this reason measurements of the neutron spectra of some fissile isotopes are in progress at our laboratory. This report will present results from studies of the energy spectra of the neutrons emitted in the neutron induced fission of 235U and 238U. The measurements were performed at an incident neutron energy of 0.95 MeV for 235U and at energies of 1.35 and 2.02 MeV for 238U using time-of-flight techniques. The time-of-flight spectra were only analysed at energies higher than those of the incident neutrons and up to about 10 MeV. Corrections for neutron attenuation in the uranium samples were calculated using a Monte Carlo program. The corrected fission neutron spectra were fitted to Maxwellian temperature distributions. For 235U a temperature of 1.27 +- 0.01 MeV gives the best fit to the experimental data and for 238U the corresponding values are 1.29 +- 0.03 MeV at 1.35 MeV and 1.29 +- 0.02 MeV at 2.02 MeV

A NLTE line formation for neutral and singly-ionised calcium in model atmospheres of B-F stars

Science.gov (United States)

Sitnova, T. M.; Mashonkina, L. I.; Ryabchikova, T. A.

2018-03-01

We present non-local thermodynamic equilibrium (NLTE) line formation calculations for Ca I and Ca II in B-F stars. The sign and the magnitude of NLTE abundance corrections depend on line and stellar parameters. We determine calcium abundances for nine stars with reliable stellar parameters. For all stars, where the lines of both species could be measured, the NLTE abundances are found to be consistent within the error bars. We obtain consistent NLTE abundances from Ca II lines in the visible and near infra-red (IR, 8912-27, 9890 Å) spectrum range, in contrast with LTE, where the discrepancy between the two groups of lines ranges from -0.5 dex to 0.6 dex for different stars. Our NLTE method reproduces the Ca II 8912-27, 9890 Å lines observed in emission in the late B-type star HD 160762 with the classical plane-parallel and LTE model atmosphere. NLTE abundance corrections for lines of Ca I and Ca II were calculated in a grid of model atmospheres with 7000 K ≤ Teff ≤ 13000 K, 3.2 ≤ log g ≤ 5.0, -0.5 ≤ [Fe/H] ≤0.5, ξt= 2.0 km s-1. Our NLTE results can be applied for calcium NLTE abundance determination from Gaia spectra, given that accurate continuum normalisation and proper treatment of the hydrogen Paschen lines are provided. The NLTE method can be useful to refine calcium underabundances in Am stars and to provide accurate observational constraints on the models of diffusion.

A NLTE line formation for neutral and singly ionized calcium in model atmospheres of B-F stars

Science.gov (United States)

Sitnova, T. M.; Mashonkina, L. I.; Ryabchikova, T. A.

2018-07-01

We present non-local thermodynamic equilibrium (NLTE) line formation calculations for Ca I and Ca II in B-F stars. The sign and the magnitude of NLTE abundance corrections depend on line and stellar parameters. We determine calcium abundances for nine stars with reliable stellar parameters. For all stars, where the lines of both species could be measured, the NLTE abundances are found to be consistent within the error bars. We obtain consistent NLTE abundances from Ca II lines in the visible and near infra-red (IR, 8912-27, 9890 Å) spectrum range, in contrast with LTE, where the discrepancy between the two groups of lines ranges from -0.5 to 0.6 dex for different stars. Our NLTE method reproduces the Ca II 8912-27, 9890 Å lines observed in emission in the late B-type star HD 160762 with the classical plane-parallel and LTE model atmosphere. NLTE abundance corrections for lines of Ca I and Ca II were calculated in a grid of model atmospheres with 7000 ≤ Teff ≤ 13 000 K, 3.2 ≤ log g ≤ 5.0, -0.5 ≤ [Fe/H] ≤0.5, ξt = 2.0 km s-1. Our NLTE results can be applied for calcium NLTE abundance determination from Gaia spectra, given that accurate continuum normalization and proper treatment of the hydrogen Paschen lines are provided. The NLTE method can be useful to refine calcium underabundances in Am stars and to provide accurate observational constraints on the models of diffusion.

Different features of the MHC class I heterodimer have evolved at different rates. Chicken B-F and beta 2-microglobulin sequences reveal invariant surface residues

DEFF Research Database (Denmark)

Kaufman, J; Andersen, R; Avila, D

1992-01-01

molecules and the MHC-encoded nonclassical molecules more than CD1 or the class I-like FcR. In contrast, the chicken alpha 3 domain is equally homologous to all alpha 3 domains, to beta 2m and to class II beta 2 domains. For each pair of extracellular domains (alpha 1 vs alpha 2, alpha 3 vs beta 2m...... of small exons in the cytoplasmic region. The cDNA sequences were compared to turkey beta 2m, the apparent allele B-F12 alpha and other vertebrate homologs, using the 2.6 A structure of the human HLA-A2 molecule as a model. Both chicken alpha 1 and alpha 2 domains resemble mammalian classical class I...... the ends of the peptide, two residues that bind CD8, and three residues that are phosphorylated. The positions of the allelic residues are conserved. There are other patches of invariant residues on alpha 1, alpha 2, and beta 2m; these might bind TCR or other molecules involved in class I function...

Equilibrium electrode U(4)-U and redox U(4)-U(3) potentials in molten alkali metal chlorides medium

Energy Technology Data Exchange (ETDEWEB)

Smirnov, M V; Kudyakov, V Ya; Komarov, V E; Salyulev, A B [AN SSSR, Sverdlovsk. Inst. Ehlektrokhimii

1979-02-01

Conditional standard electrode potentials of uranium are determined for diluted solutions of its tetrachloride in alkali metal chloride melts (LiCl, NaCl, NaCl-KCl, KCl, RbCl and CsCl) when using U(4) ion activity coefficient values experimentally found by the tensimetric method. These potentials shift to the electronegative side at the temperature decrease and alkali cation radius increase rsub(Msup(+)) according to the empiric ratio E*U(4)-U= -3.06+6.87x10/sup -4/ T-(1.67-10/sup -4/T-0.44) 1/rsub(Msup(+)) +-0.01. The temperature dependences of formal conditional redox potentials of the U(4)-U(3) system for above melted chlorides are estimated. The E*U(4)-U(3) value also becomes more electronegative in the series LiCl, NaCl, NaCl-KCl, KCl, RbCl and CsCl. This alternation is satisfactorily described by the empiric expression E*U(4)-U(3)= -1.74+1.74x10/sup -4/T-(0.71x10/sup -4/T-0.20) 1rsub(Msup(+)) +-0.05. The calculated values Eu*(4)-U(3) are compared with those directly measured for the NaCl-KCl equimolar mixture and 3LiCl-2KCl eutectic mixture. A satisfactory confirmity has been observed.

Equilibrium electrode U(4)-U and redox U(4)-U(3) potentials in molten alkali metal chlorides medium

International Nuclear Information System (INIS)

Smirnov, M.V.; Kudyakov, V.Ya.; Komarov, V.E.; Salyulev, A.B.

1979-01-01

Conditional standard electrode potentials of uranium are determined for diluted solutions of its tetrachloride in alkali metal chloride melts (LiCl, NaCl, NaCl-KCl, KCl, RbCl and CsCl) when using U(4) ion activity coefficient values experimentally found by the tensimetric method. These potentials shift to the electronegative side at the temperature decrease and alkali cation radius increase rsub(Msup(+)) according to the empiric ratio E*U(4)-U= -3.06+6.87x10 -4 T-(1.67-10 -4 T-0.44) 1/rsub(Msup(+)) +-0.01. The temperature dependences of formal conditional redox potentials of the U(4)-U(3) system for above melted chlorides are estimated. The E*U(4)-U(3) value also becomes more electronegative in the series LiCl, NaCl, NaCl-KCl, KCl, RbCl and CsCl. This alternation is satisfactorily described by the empiric expression E*U(4)-U(3)= -1.74+1.74x10 -4 T-(0.71x10 -4 T-0.20) 1rsub(Msup(+)) +-0.05. The calculated values Eu*(4)-U(3) are compared with those directly measured for the NaCl-KCl equimolar mixture and 3LiCl-2KCl eutectic mixture. A satisfactory confirmity has been observed

VG2 URA TRAJECTORY DERIVED SUMM U1 COORDS 48SEC V1.0

Data.gov (United States)

National Aeronautics and Space Administration — This dataset contains Voyager 2 spacecraft position vectors relative to Uranus in minus U1 coordinates. The U1 or Uranus West Longitude System coordinate system is a...

Higgs phenomenology in the minimal S U (3 )L×U (1 )X model

Science.gov (United States)

Okada, Hiroshi; Okada, Nobuchika; Orikasa, Yuta; Yagyu, Kei

2016-07-01

We investigate the phenomenology of a model based on the S U (3 )c×S U (3 )L×U (1 )X gauge theory, the so-called 331 model. In particular, we focus on the Higgs sector of the model which is composed of three S U (3 )L triplet Higgs fields and is the minimal form for realizing a phenomenologically acceptable scenario. After the spontaneous symmetry breaking S U (3 )L×U (1 )X→S U (2 )L×U (1 )Y , our Higgs sector effectively becomes that with two S U (2 )L doublet scalar fields, in which the first- and the second-generation quarks couple to a different Higgs doublet from that which couples to the third-generation quarks. This structure causes the flavor-changing neutral current mediated by Higgs bosons at the tree level. By taking an alignment limit of the mass matrix for the C P -even Higgs bosons, which is naturally realized in the case with the breaking scale of S U (3 )L×U (1 )X much larger than that of S U (2 )L×U (1 )Y, we can avoid current constraints from flavor experiments such as the B0-B¯ 0 mixing even for the Higgs bosons masses that are O (100 ) GeV . In this allowed parameter space, we clarify that a characteristic deviation in quark Yukawa couplings of the Standard Model-like Higgs boson is predicted, which has a different pattern from that seen in two Higgs doublet models with a softly broken Z2 symmetry. We also find that the flavor-violating decay modes of the extra Higgs boson, e.g., H /A →t c and H±→t s , can be dominant, and they yield the important signature to distinguish our model from the two Higgs doublet models.

Simultaneous biodegradation of bifenthrin and chlorpyrifos by Pseudomonas sp. CB2.

Science.gov (United States)

Zhang, Qun; Li, Shuhuai; Ma, Chen; Wu, Nancun; Li, Chunli; Yang, Xinfeng

2018-05-04

The degradation of bifenthrin (BF) and chlorpyrifos (CP), either together or individually, by a bacterial strain (CB2) isolated from activated sludge was investigated. Strain CB2 was identified as belonging to genus Pseudomonas based on the morphological, physiological, and biochemical characteristics and a homological analysis of the 16S rDNA sequence. Strain CB2 has the potential to degrade BF and CP, either individually or in a mixture. The optimum conditions for mixture degradation were as follows: OD 600nm = 0.5; incubation temperature = 30°C; pH = 7.0; BF-CP mixture (10 mg L -1 of each). Under these optimal conditions, the degradation rate constants (and half-lives) were 0.4308 d -1 (1.61 d) and 0.3377 d -1 (2.05 d) for individual BF and CP samples, respectively, and 0.3463 d -1 (2.00 d) and 0.2931 d -1 (2.36 d) for the BF-CP mixture. Major metabolites of BF and CP were 2-methyl-3-biphenylyl methanol and 3,5,6-trichloro-2-pyridinol, respectively. No metabolite bioaccumulation was observed. The ability of CB2 to efficiently degrade BF and CP, particularly in a mixture, may be useful in bioremediation efforts.

Emission line relative intensity variations in the symbiotic stars: CI Cygni, BF Cygni, AX Persei and V1016 Cygni

International Nuclear Information System (INIS)

Oliversen, N.A.

1982-01-01

Low resolution spectra (lambda 3800 to lambda 5900) are presented of the symbiotic stars CI Cygni, BF Cygni, AX Persei and V1016 Cygni, which were obtained with the Washburn Observatory Boller and Chivens cassegrain spectrograph and intensified Reticon. The spectra were obtained as part of a monitoring program covering 36 months since November 1978. The nebular electron temperature and density are derived from the [O III] lambda 5007 and lambda 4363 emission lines and the uv intercombination lines of lambda 1661 and lambda 1667. Relative emission line intensity variations were observed in all four stars. The relative emission line changes correlated with photometric minima for CI Cyg, AX Per and possibly BF Cyg. These changes are interpreted as due to a red giant eclipsing a nebula surrounding the exciting source. Based on the [O III] line ratio change, the nebular density of V1016 Cyg has continued to decline since 1978. The thesis also contains a discussion of the use of the emision lines of [Ne III] lambda 3869, [O III] lambda 5007, lambda 4363 and He lambda 5876 to derive nebular electron temperature and density. A decline in the intensity ratios of I(lambda 3869)/(lambda 5007) and I(lambda 5876)/I(lambda 5007) were observed during the 1980 minimum of CI Cyg. The observed I(lambda 3869)/I(lambda 5007) decline was too large to be explained by temperature or density changes. The [Ne III] and He II regions in CI Cyg are therefore closer to the hot source than the more extended (o III] emission region. Contained within the appendix is a discussion of a graphical method of solution ot the nebular temperature and density, which is based on the emission lines of [Ne III], [O III] and He I

238U, 234U and 232Th in seawater

International Nuclear Information System (INIS)

Chen, J.H.; Edwards, R.L.; Wasserburg, G.J.

1986-01-01

We have developed techniques to determine 238 U, 234 U and 232 Th concentrations in seawater by isotope dilution mass spectrometry. Using these techniques, we have measured 238 U, 234 U and 232 Th in vertical profiles of unfiltered, acidified seawater from the Atlantic and 238 U and 234 U in vertical profiles from the Pacific. Determinations of 234 U/ 238 U at depths ranging from 0 to 4900 m in the Atlantic (7 0 44'N, 40 0 43'W) and the Pacific (14 0 41'N, 160 0 01'W) Oceans are the same within experimental error (±5per mille, 2σ). The average of these 234 U/ 238 U measurements is 144±2per mille (2σ) higher than the equilibrium ratio of 5.472 x 10 -5 . U concentrations, normalized to 35per mille salinity, range from 3.162 to 3.281 ng/g, a range of 3.8%. The average concentration of the Pacific samples (31 0 4'N, 159 0 1'W) is ∝1% higher than that of the Atlantic (7 0 44'N, 40 0 43'W and 31 0 49'N, 64 0 6'W). 232 Th concentrations from an Atlantic profile range from 0.092 to 0.145 pg/g. The observed constancy of the 234 U/ 238 U ratio is consistent with the predicted range of 234 U/ 238 U using a simple two-box model and the residence time of deep water in the ocean determined from 14 C. The variation in salinity-normalized U concentrations suggests that U may be much more reactive in the marine environment than previously thought. (orig./WB)

Heat transfer measurements in a forced convection loop with two molten-fluoride salts: LiF--BeF2--ThF2--UF4 and eutectic NaBF4--NaF

International Nuclear Information System (INIS)

Silverman, M.D.; Huntley, W.R.; Robertson, H.E.

1976-10-01

Heat transfer coefficients were determined experimentally for two molten-fluoride salts [LiF-BeF 2 -ThF 2 -UF 4 (72-16-12-0.3 mole %) and NaBF 4 -NaF (92-8 mole %] proposed as the fuel salt and coolant salt, respectively, for molten-salt breeder reactors. Information was obtained over a wide range of variables, with salt flowing through 12.7-mm-OD (0.5-in.) Hastelloy N tubing in a forced convection loop (FCL-2b). Satisfactory agreement with the empirical Sieder-Tate correlation was obtained in the fully developed turbulent region at Reynolds moduli above 15,000 and with a modified Hausen equation in the extended transition region (Re approx.2100-15,000). Insufficient data were obtained in the laminar region to allow any conclusions to be drawn. These results indicate that the proposed salts behave as normal heat transfer fluids with an extended transition region

Supersymmetric U boson and the old U(1) problem

International Nuclear Information System (INIS)

Kim, B.R.

1983-01-01

In the supersymmetric SU(3)xSU(2)xU(1)xUsup(')(1) model the new gauge group Usup(')(1) enforces the introduction of mirror fermions. In this note we address the inverse question. If one starts with SU(3)xSU(2)xU(1) including mirror fermions, what physical arguments other than the supersymmetric require the introduction of a new gauge group Usup(')(1). It turns out that the old U(1) problem is closely related with this question. Further we give an estimate for the upper bound for the parameter of the supersymmetric U boson r and x. (orig.)

Synthesis of basalt fiber@Zn1-xMgxO core/shell nanostructures for selective photoreduction of CO2 to CO

Science.gov (United States)

Kwak, Byeong Sub; Kim, Kang Min; Park, Sun-Min; Kang, Misook

2017-06-01

This study focused on the development of a catalyst for converting carbon dioxide, the main cause of global warming, into a beneficial energy source. Core@shell structured particles, BF@ZnO and BF@Zn1-xMgxO, are synthesized in order to selectively obtain CO gas from the photoreduction of CO2. A modified sol-gel process is used to synthesize the core@shell structures with a three-dimensional microstructure, which are subsequently characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), energy dispersive spectrometry (EDAX), ultraviolet (UV)-vis absorption, photoluminescence (PL), and photocurrent density analysis. The CO2 adsorption abilities of the core@shell particles are estimated through CO2-temperature programmed desorption (TPD). The core@shell structured BF@Zn1-xMgxO particles including the Mg ingredient significantly increased the adsorption of CO2 gas at the microfiber/nanoparticle interface. Both the BF@ZnO and BF@Zn1-xMgxO particles selectively reduce the carbon dioxide to carbon monoxide, with almost no other reduced products being observed. These results are attributed to the effective adsorption of CO2 gas and inhibited recombination of the photogenerated electron-hole pairs. BF@Zn0.75Mg0.25O exhibited superior photocatalytic behavior and selectively produced 5.0 μmolgcat-1 L-1 of CO gas after 8 h of reaction.

Synthesis of basalt fiber@Zn{sub 1-x}Mg{sub x}O core/shell nanostructures for selective photoreduction of CO{sub 2} to CO

Energy Technology Data Exchange (ETDEWEB)

Kwak, Byeong Sub; Kim, Kang Min [Department of Chemistry, College of Science, Yeungnam University, Gyeongsan, Gyeongbuk 38541 (Korea, Republic of); Park, Sun-Min, E-mail: psm@kicet.re.kr [Korea Institute of Ceramic Engineering and Technology (KICET), Jinju, Gyeongnam 52851 (Korea, Republic of); Kang, Misook, E-mail: mskang@ynu.ac.kr [Department of Chemistry, College of Science, Yeungnam University, Gyeongsan, Gyeongbuk 38541 (Korea, Republic of)

2017-06-15

Highlights: • ZnO and Zn{sub 1-x}Mg{sub x}O crystals were grown onto the BFs. • The core@shell structured BF@Zn{sub 1-x}Mg{sub x}O particles significantly increased the adsorption of CO{sub 2} gas. • The BF@ZnO or BF@Zn{sub 1-x}Mg{sub x}O particles selectively reduce the carbon dioxide to carbon monoxide. - Abstract: This study focused on the development of a catalyst for converting carbon dioxide, the main cause of global warming, into a beneficial energy source. Core@shell structured particles, BF@ZnO and BF@Zn{sub 1-x}Mg{sub x}O, are synthesized in order to selectively obtain CO gas from the photoreduction of CO{sub 2}. A modified sol-gel process is used to synthesize the core@shell structures with a three-dimensional microstructure, which are subsequently characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), energy dispersive spectrometry (EDAX), ultraviolet (UV)–vis absorption, photoluminescence (PL), and photocurrent density analysis. The CO{sub 2} adsorption abilities of the core@shell particles are estimated through CO{sub 2}-temperature programmed desorption (TPD). The core@shell structured BF@Zn{sub 1-x}Mg{sub x}O particles including the Mg ingredient significantly increased the adsorption of CO{sub 2} gas at the microfiber/nanoparticle interface. Both the BF@ZnO and BF@Zn{sub 1-x}Mg{sub x}O particles selectively reduce the carbon dioxide to carbon monoxide, with almost no other reduced products being observed. These results are attributed to the effective adsorption of CO{sub 2} gas and inhibited recombination of the photogenerated electron–hole pairs. BF@Zn{sub 0.75}Mg{sub 0.25}O exhibited superior photocatalytic behavior and selectively produced 5.0 μmolg{sub cat}{sup −1} L{sup −1} of CO gas after 8 h of reaction.

Dicty_cDB: Contig-U16093-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16093-1 gap included 1020 2 4899973 4899063 MINUS 29 31 U16093 7 0 0 0 0 2 ...18 0 0 0 0 0 2 0 Show Contig-U16093-1 Contig ID Contig-U16093-1 Contig update 2004. 6.11 Contig sequence >Contig-U16093-1 (Contig...-U16093-1Q) /CSM_Contig/Contig-U16093-1Q.Seq.d TTTTTTTTTTTTTTTTTAATTTTTTTTTTTCATAAAACTT...AAAATTAAATT Gap gap included Contig length 1020 Chromosome number (1..6, M) 2 Chr...pdate 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U16093-1 (Contig-U16093-1Q) /CSM_Contig/Contig-U16093-1Q

Dicty_cDB: Contig-U06384-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U06384-1 no gap 660 5 3008439 3007779 MINUS 2 2 U06384 2 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06384-1 Contig ID Contig-U06384-1 Contig update 2001. 8.30 Contig sequence >Contig-U06384-1 (Contig...-U06384-1Q) /CSM_Contig/Contig-U06384-1Q.Seq.d TGAAAAAATTAGAGACAACAAGTGGATCAGCACGTAAAGTATGGCGTTTA...AAATAAAAATTAATTTCC AAAAATAAAA Gap no gap Contig length 660 Chromosome number (1.....own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06384-1 (Contig-U06384-1Q) /CSM_Contig/Contig-U063

SU(2) x U(1) x U'(1) models which are slightly different from the Weinberg-Salam model

International Nuclear Information System (INIS)

Gao, C.; Wu, D.

1981-01-01

We discuss SU(2) x U(1) x U'(1) models by a uniform formula which is convenient for their comparison with the standard Weinberg-Salam model. As examples, we give three interesting models which are based on different grand unification models. In one model, U'(1) does not contribute to the electromagnetic interaction; in the other two, both U(1) and U'(1) do contribute to the electromagnetic interaction. Also, the first two models can approach the standard Weinberg-Salam model as close as one wants; but the third model has limitations on it

Dicty_cDB: Contig-U13455-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13455-1 no gap 750 2 945431 946181 PLUS 2 2 U13455 0 0 0 0 0 0 1 0 0 1 0 0 0 0 Show Contig...-U13455-1 Contig ID Contig-U13455-1 Contig update 2002.12.18 Contig sequence >Contig-U13455-1 (Contig...-U13455-1Q) /CSM_Contig/Contig-U13455-1Q.Seq.d TAATTCCAACAACATCAACAAATTCAACAACAATTACAAATGCAACAACA TA...CAATAATAATAATAATAACAATAACAATAATAATAA Gap no gap Contig length 750 Chromosome number (1..6, M) 2 Chromosome l...KMLEYIQKNPSATRPSCIQVVQQPSSKVVWKNRRLDTPFKVKVDLKAASAMA GTNLTTASVITIGIVTDHKGKLQIDSVENFTEAFNGQGLAVFQGLKMTKGTWGKE

Dicty_cDB: Contig-U01997-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U01997-1 gap included 886 2 1683026 1682230 MINUS 3 4 U01997 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U01997-1 Contig ID Contig-U01997-1 Contig update 2001. 8.29 Contig sequence >Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig/Contig-U01997...ATTGAAATAATATTTATTTATTTTTTTAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap gap included Contig...nfkvfgieiifiyffkkkkkkkkkkkkkkkkkkk own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig.../Contig-U01997-1Q.Seq.d (896 letters) Database: CSM 6905 sequences; 5,674,871 total l

Evaluation of Columbia, USMARC Composite, Suffolk, and Texel rams as terminal sires in an extensive rangeland production system: VII. Accuracy of ultrasound predictors and their association with carcass weight, yield, and value.

Science.gov (United States)

Notter, D R; Mousel, M R; Leeds, T D; Zerby, H N; Moeller, S J; Lewis, G S; Taylor, J B

2014-06-01

Use of lamb BW or chilled carcass weights (CCW), live-animal ultrasound or direct carcass measurements of backfat thickness (BF; mm) and LM area (LMA; cm(2)), and carcass body wall thickness (BWall; mm) to predict carcass yield and value was evaluated using 512 crossbred lambs produced over 3 yr by mating Columbia, U.S. Meat Animal Research Center Composite, Suffolk, and Texel rams to adult Rambouillet ewes. Lambs were harvested at 3 BW endpoints within each year. The predictive value of 3 to 5 additional linear measurements of live-animal or carcass size and shape was also evaluated. Residual correlations (adjusted for effects of year, breed, and harvest group) between ultrasound and direct measurements were 0.69 for BF and 0.65 for LMA. Increasing ultrasound or carcass LMA had positive effects (P carcass (i.e., on dressing percentage) and, at comparable CCW, on weight of high-value cuts (rack, loin, leg, and sirloin) before trimming (HVW), weight of trimmed high-value cuts (trimmed rack and loin and trimmed boneless leg and sirloin; TrHVW), and carcass value before (CVal) and after (TrCVal) trimming of high-value cuts. By contrast, ultrasound and direct measures of BF had positive effects on yields of CCW and on HVW and CVal but large negative effects on TrHVW and TrCVal. After adjusting for BW at scanning, increases of 1 mm in ultrasound BF or 1 cm(2) in ultrasound LMA were associated with changes of US$-0.32 (P Carcass BWall was generally superior to carcass BF as a predictor of TrHVW and TrCVal. Carcass LMA was superior to ultrasound LMA but carcass BF was inferior to ultrasound BF for prediction of carcass yield and value. Increasing LMA thus would be expected to improve carcass yield and value. Addition of linear measurements of live-animal or carcass size and shape to the prediction model reduced residual SD (RSD) for TrHVW and TrCVal by 0.4 to 2.2%, but subsequent removal of ultrasound or direct measures of BF and LMA from the prediction model increased

Structure and Lamb shift of 2s1/2-2p3/2 levels in lithiumlike U89+ through neonlike U82+

International Nuclear Information System (INIS)

Beiersdorfer, P.; Knapp, D.; Marrs, R.E.; Elliott, S.R.; Chen, M.H.

1993-01-01

The first Doppler-shift-free crystal-spectrometer measurement of stationary highly stripped uranium ions from a high-energy electron beam ion trap is presented. Thirteen 2s 1/2- 2p 3/2 transitions in eight ionization states bteween Li-like U 89+ and Ne-like U 82+ are identified and measured with an accuracy as high as 37 ppm, providing benchmarks for testing relativistic correlation and quantum electrodynamic effects in highly charged multielectron ions. A value of 47.39±0.35 eV is found for the 2s 1/2 Lamb shift in Li-like U 89+ , in excellent agreement with theory

Structure and lamb shift of 2s1/2-2p3/2 levels in lithiumlike U89+ through neonlike U82+

International Nuclear Information System (INIS)

Beiersdorfer, P.; Knapp, D.; Marrs, R.E.; Elliott, S.; Chen, M.H.

1993-01-01

The first Doppler-shift-free crystal- spectrometer measurements from stationary highly stripped uranium ions are presented. Eleven 2s 1/2 -2p 3/2 transitions in eight ionization stages between Li-like U 89+ and Ne-like U 82+ are identified and measured with an accuracy as high as 45 ppm, providing benchmarks for testing relativistic correlation and quantum electrodynamical effects in highly charged multi-electron ions. A value of 47.38 ± 0.35 eV is found for the 2s 1/2 Lamb shift in Li-like U 89+ , in excellent agreement with the theoretical value of 47.58 eV

Dicty_cDB: Contig-U11195-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11195-1 gap included 2858 2 4308456 4311316 PLUS 16 27 U11195 0 2 0 8 1 0 0... 3 0 2 0 0 0 0 Show Contig-U11195-1 Contig ID Contig-U11195-1 Contig update 2002.12.18 Contig sequence >Contig-U11195-1 (Contig...-U11195-1Q) /CSM_Contig/Contig-U11195-1Q.Seq.d AGCATTGGAACAAATCGAATTACGTGAAAAGATACCATTGTT...TATCACCTGCTCTTTATCCTTCAAATTTAAGT AATTCAACATTGGCCCAAAGAGTTACATGGATAAATAAATTATAAATAAT GTATAAAATCATTCTCTC Gap gap included Contig... EYREKIPLLDLPWGASKPWTLVDLRDDYDEDLMVRFYNELMLPNFPVKNELEPLSNFISA LSEERRESFNPHLSEVHVLLALRWPTDSSDLQPTIGAGIIFEYFSN

Dicty_cDB: Contig-U09640-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09640-1 gap included 1368 2 219988 218635 MINUS 4 5 U09640 0 0 2 0 0 0 0 0 0 0 0 0 1 1 Show Contig...-U09640-1 Contig ID Contig-U09640-1 Contig update 2002. 9.13 Contig sequence >Contig-U09640-1 (Contig...-U09640-1Q) /CSM_Contig/Contig-U09640-1Q.Seq.d ACTGTTGGCCTACTGGNAAAAAATAGTGTAATAATAACCAACAAT...AACAACAACAACAAAAACAAAAACAAATTTTAATT AAATAAAATAATAATATAAAATATAATA Gap gap included Contig...ate 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U09640-1 (Contig-U09640-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U10291-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10291-1 no gap 932 4 3203354 3204286 PLUS 2 2 U10291 0 0 1 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U10291-1 Contig ID Contig-U10291-1 Contig update 2002. 9.13 Contig sequence >Contig-U10291-1 (Contig...-U10291-1Q) /CSM_Contig/Contig-U10291-1Q.Seq.d GTAAAGGTTTTATGTGTATATTTTTTAATGACCTTTTCGAATTAGTTTCA ...CAAAATAGATTAAATCTTAGTTACTCTCATGC TAATCAATATGTTGAGAGTTTTCCATCACAAATGTTATCAACAATTGCAA AATTCATTAGTTTCTTATTTGGTT...SLMYSL FNYIFDENGIIKSEFQDPTQRKRLSRGLSRRFMTIGILGLFTTPFIFFFLLINFFFEYAE ELKNRPGSLFSREWSPLARWEFRELNELPHYFQNRLNLSY

Dicty_cDB: Contig-U11141-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11141-1 gap included 2122 2 1113359 1111236 MINUS 6 12 U11141 0 1 0 2 0 0 0... 1 0 2 0 0 0 0 Show Contig-U11141-1 Contig ID Contig-U11141-1 Contig update 2002.12.18 Contig sequence >Contig-U11141-1 (Contig...-U11141-1Q) /CSM_Contig/Contig-U11141-1Q.Seq.d AAAAAACAATCTTAAAACACACACACACTCAACACACTATCA...AAATCAAAATCAAAATCAAA ATAATAATAATTATAATAATAGCTATAATAAT Gap gap included Contig length 2122 Chromosome number ...HNYFGKVSRGIVSLSDYKYYGYLRSVHLIGYE QHEEELIKTIKSLPVGVSTLELSGHLNKIIFKEGSL--- ---DDSTIGAILNSFSSSSSRETFPRSVESLHLNI

Dicty_cDB: Contig-U12073-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12073-1 gap included 912 2 2118980 2119867 PLUS 4 5 U12073 0 0 0 2 0 0 0 1 0 1 0 0 0 0 Show Contig...-U12073-1 Contig ID Contig-U12073-1 Contig update 2002.12.18 Contig sequence >Contig-U12073-1 (Contig...-U12073-1Q) /CSM_Contig/Contig-U12073-1Q.Seq.d CTGTTGGCCTACTGGNAATTGAAACAATTGTTTCAGCAAATATTA...AAGA Gap gap included Contig length 912 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start point ...GPXSXDY*r own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12073-1 (Contig-U12073-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U01204-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U01204-1 gap included 918 2 1928287 1927368 MINUS 2 3 U01204 0 0 0 0 0 2 0 0 0 0 0 0 0 0 Show Contig...-U01204-1 Contig ID Contig-U01204-1 Contig update 2001. 8.29 Contig sequence >Contig-U01204-1 (Contig-U01204-1Q) /CSM_Contig/Contig-U01204...AAAAATAATAA Gap gap included Contig length 918 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start...LAWEVFWVGTPLFVLMASAFNQIHWALAWVLMVIILQSGFMN--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQ...fgwvlhyly*whqhsikfighwhgy*w*sfynlvl*--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQVLSDNN

Dicty_cDB: Contig-U11342-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11342-1 gap included 2051 2 611517 609465 MINUS 4 7 U11342 0 2 1 1 0 0 0 0 0 0 0 0 0 0 Show Contig...-U11342-1 Contig ID Contig-U11342-1 Contig update 2002.12.18 Contig sequence >Contig-U11342-1 (Contig...-U11342-1Q) /CSM_Contig/Contig-U11342-1Q.Seq.d GTCAACATTAACATCATCATCATCATCATCACCATCTAGTAATAA...GAATTTGGTAATTTTAAAATCACTNATTAATATATTAAACAAAATTA TAAAAATAAAA Gap gap included Contig...EFFFIDRKSLLVNFP RGSICAQILKLIGNLYGSNDIIFKINTNNVSFFDGTIGANNSTNNSNSNQPMTPQQVVIK YLNPTARWKRREISNFEYLMTLNTIAGRTYN

Dicty_cDB: Contig-U15462-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15462-1 no gap 546 4 3384206 3383661 MINUS 2 2 U15462 0 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U15462-1 Contig ID Contig-U15462-1 Contig update 2004. 6.11 Contig sequence >Contig-U15462-1 (Contig...-U15462-1Q) /CSM_Contig/Contig-U15462-1Q.Seq.d CTTTAGATTGGGGNTCAAGAAAAATATTGAAGTATTTGGTGGTGATAAGA...ATTCGATTCACTATCTTATA Gap no gap Contig length 546 Chromosome number (1..6, M) 4 Chromosome length 5430582 St...VMKLGFEVKDLITNDPKCDLFDSLS Y own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15462-1 (Contig

Dicty_cDB: Contig-U09720-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09720-1 gap included 1323 2 5906974 5908260 PLUS 1 2 U09720 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09720-1 Contig ID Contig-U09720-1 Contig update 2002. 9.13 Contig sequence >Contig-U09720-1 (Contig-U09720-1Q) /CSM_Contig/Contig-U09720...ATNATTATTATAAAAATTT Gap gap included Contig length 1323 Chromosome number (1..6, ...QLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLKNQREIIAQSLKIXKKL*linqxll*kf ...AEMFDIDSRNNHAIENDGRLDDA LVCSVGIALAPQSIFQSWKSMSEHKREKYFEQLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLK

Dicty_cDB: Contig-U09379-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09379-1 gap included 899 2 1392012 1392912 PLUS 1 2 U09379 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09379-1 Contig ID Contig-U09379-1 Contig update 2002. 9.13 Contig sequence >Contig-U09379-1 (Contig...-U09379-1Q) /CSM_Contig/Contig-U09379-1Q.Seq.d AAAAATTTTTTAAACTAAAAAATAAAAAAAATAAATAAAAAAAAA...TTTAAAAATAATAATAAAAGTGAATATTATAATATTAT AATCTTTTTGGTATAATTGAAAAAGATCAATAATATATTAAAATTTCCAA AAAAAAAAA Gap gap included Contig...VSVCRAYATETATIENKTQIMGKMSGAQGAGFVLGPGIGFLLNFCNFTIG--- ---INNK******sn*finykl***f*kikqphfknlkiiikvniiil*sfwyn

Dicty_cDB: Contig-U03323-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U03323-1 no gap 533 2 4820223 4820756 PLUS 2 1 U03323 0 0 0 0 0 0 0 0 0 0 0 0 1 1 Show Contig...-U03323-1 Contig ID Contig-U03323-1 Contig update 2001. 8.29 Contig sequence >Contig-U03323-1 (Contig...-U03323-1Q) /CSM_Contig/Contig-U03323-1Q.Seq.d ACATGTGACATTACTATTGGTAAATGTCAATGTTTAAAAAATACATGGTC ...TCAATAATGGTGGTGGTGGTGGTTTAGGT GAAACCCCCAATAGTAATAGTAATAGTGGTGAACTAGTTATCCCACCAAA ATCAAATACTACATTAAATGAAGAAACAGGTGG Gap no gap Contig... Link to clone list U03323 List of clone(s) est1= FC-IC0176F ,1,534 Translated Amino Acid sequence TCDITIGKC

Dicty_cDB: Contig-U13680-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13680-1 no gap 822 5 2371965 2372786 PLUS 2 2 U13680 0 2 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U13680-1 Contig ID Contig-U13680-1 Contig update 2002.12.18 Contig sequence >Contig-U13680-1 (Contig...-U13680-1Q) /CSM_Contig/Contig-U13680-1Q.Seq.d AAAAAGATTCTCAAGGAATTCACCGTGTTTATACTTCTTATGGTAGAACT ...GGGAATCAATGATTTAAATATCTACCAAATTCAAAAGG AAGGTGATGTCGAGTCACATTCATTACAATCACCATCGAAATTATTATTT CATGGTTCAAGAGCATCGAATT Gap no gap Contig...**sirtinkdig*kslc*snhsidk*ffsynh*twy*ntigclingt s*kw*tcfeknqylfewynqsiisrvgeikfrifhnyst*tw*rfrcclkeyh*kfgsie

Dicty_cDB: Contig-U10335-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10335-1 no gap 1353 2 2769724 2768368 MINUS 3 6 U10335 0 0 2 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U10335-1 Contig ID Contig-U10335-1 Contig update 2002. 9.13 Contig sequence >Contig-U10335-1 (Contig...-U10335-1Q) /CSM_Contig/Contig-U10335-1Q.Seq.d ATTTTTTTTCTAAATATATAAAAAATAATAATAATAATAATAATATAAT...AAACATAATAAAACAAAAGATAAAAATAAAA ACA Gap no gap Contig length 1353 Chromosome numb...SSLATNNNINNNKRITIPDNH SNNPDKLLEIQLINKIFDISKAFDGKSNNLVSSFQNCTNNNNNNNNNTDNNNNNNISNNN NNNNVPTLQPLSFNNRNNLVNGNISSSSSSNSSNNNIGSSNSNNVTIG

Missile Liquid Propellant Systems Maintenance. AFS 445X1.

Science.gov (United States)

1981-06-01

4 bf~~ II It - S .. Ui0 j lt 1 1 I I . ,. 1111 ,w I,,,Q , . S0 111 S01111 1 1 60 1 I ’m 041 w0 UI I It I 45w IV taZ& 󈨔 4140 A, : :wt xi Z Z 1 ww .1...0 6 0 a 0- Jewe ~ l .8 2~ I- sca4 a - 0 I,01 04 ~ ~ ~ P .A0 3~ W 40 * 2 U £ WIa -00 1 t - 0 a* d . 0 ~ 4 A- aiSI so a-- r.a 0W 01 P - At0 i4 Im a-I

Dicty_cDB: Contig-U15323-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15323-1 no gap 1230 2 3760829 3759661 MINUS 76 108 U15323 2 0 21 0 9 4 0 0 22 4 13 0 1 0 Show Contig...-U15323-1 Contig ID Contig-U15323-1 Contig update 2004. 6.11 Contig sequence >Contig-U15323-1 (Contig-U15323-1Q) /CSM_Contig/Contig-U1532...TAAAATTTAAGCAATCATTCCAT Gap no gap Contig length 1230 Chromosome number (1..6, M) 2 Chromosome length 846757...VGLLVFFNILYCTPLYYILFFFKMNSKFADELIATAKAIVAPGKGILAADESTNTIGAR FKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQKMADG...MNSKFADELIATAKAIVAPGKGILAADESTNTIGAR FKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQK

Dicty_cDB: Contig-U10837-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10837-1 gap included 1996 2 5280203 5282199 PLUS 8 9 U10837 0 3 0 3 1 0 0 1 0 0 0 0 0 0 Show Contig...-U10837-1 Contig ID Contig-U10837-1 Contig update 2002.12.18 Contig sequence >Contig-U10837-1 (Contig-U10837-1Q) /CSM_Contig/Contig-U10837...TCNT Gap gap included Contig length 1996 Chromosome number (1..6, M) 2 Chromosome...YSSKGYFKHLDSFLSEISVP LCESVSKSSTLVFSLLFNMLEYSTADYRYPILKILTALVKCGVNPAETKSSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIG...SSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIGTKKFSNKVDRGT LLAGNYFNKVLVDTVPGVRSSVNSLTKSIYSTTQI

Dicty_cDB: Contig-U13202-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13202-1 no gap 1083 4 1301578 1302630 PLUS 41 45 U13202 8 0 13 0 0 2 16 0 2 0 0 0 0 0 Show Contig...-U13202-1 Contig ID Contig-U13202-1 Contig update 2002.12.18 Contig sequence >Contig-U13202-1 (Contig...-U13202-1Q) /CSM_Contig/Contig-U13202-1Q.Seq.d ACTGTTGGCCTACTGGGATTTTCTGCAGTAATAATAAAATCAAATA...TTTGTAATTTTAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap no gap Contig len...kvgqfirvprgaqpaqtskftlmih*gvkshffsmlqpnwpncttigpvq nqarcgsllgfwvlqnqlltvlcihnnekcsikfygygyl**nlitvvkvvmpslhg

Dicty_cDB: Contig-U11883-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11883-1 gap included 599 2 1457179 1457762 PLUS 1 2 U11883 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U11883-1 Contig ID Contig-U11883-1 Contig update 2002.12.18 Contig sequence >Contig-U11883-1 (Contig...-U11883-1Q) /CSM_Contig/Contig-U11883-1Q.Seq.d TACAAAATTTATATATATATATAATATTTTTAAATAATTATATTT...ATTTAGATGTATTTGGTATTCAAACATTA ACCGAACAACAAGCCTCTACAAAATTATTAACTTTTGTCATTTCAAAATC AGGTGAAAA Gap gap included Contig...ffkixn*kikkgfhvkxksflwfkxxx--- ---xxxx******************yprkyiniti*rn*kdil*ii*rne*rergtksc* nifs*kestpl*fnsxfktniilfstvfnttnvstig

Dicty_cDB: Contig-U07021-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U07021-1 no gap 601 2 3862699 3862098 MINUS 1 2 U07021 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U07021-1 Contig ID Contig-U07021-1 Contig update 2001. 8.30 Contig sequence >Contig-U07021-1 (Contig...-U07021-1Q) /CSM_Contig/Contig-U07021-1Q.Seq.d AAAAAAACAAAATGAATAAATTTAATATTACATCATTATTTATTATTTTA...TTTAATATATTCAGAAGGAAATTC TTATTTACAACAAAATTTCCCATTACTTTCTTANTTAAANTCCGTTAAAA T Gap no gap Contig length 601 C...QACCRTTQLFINYADNSFLDSAGFSPFGKVISGFNNTLNFYGGYGEEPDQSLIYSE GNSYLQQNFPLLSXLXSVK own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig

Multichannel interactions in the (1σ/sub g/)2(1σ/sub u/)nsσ, ndλ(3Σ+/sub u/,3Σ+/sub u/,3Pi/sub u/,3Δ/sub u/) Rydberg structures of He2

International Nuclear Information System (INIS)

Ginter, D.S.; Ginter, M.L.

1988-01-01

We show that a minimal parameter coupled channel model based on eigenquantum defect theory can reproduce quantitatively the known Rydberg structures associated with six channels of nsσ,ndλ( 3 Σ + /sub u/, 3 Σ + /sub u/, 3 Pi/sub u/, 3 Δ/sub u/) v = 0 ancestry in He 2 . Except for a few levels affected by accidental perturbations, these extensive level structures can be reproduced to within average experimental uncertainties. Previously unreported spectral analyses for transitions to the b 3 Pi/sub g/ state from rotational levels in the nl channel segments with n = 12--18 are included in this work. These spectral transitions were predicted and observed in the early stages of this investigation and were used to determine a number of new energy levels for the n = 3--18 data base used in subsequent calculations. The model uses a U matrix modified slightly from a Hund's case (b) to case (d) transformation and energy dependent eigenquantum defects μ/sub α/. Discussed in detail is a specific 14 parameter representation for ∼500 energy levels in which 2 parameters modify U to include interactions between ns and nd and 12 parameters describe the variation of the μ/sub α/'s with energy

Dicty_cDB: Contig-U01750-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U01750-1 no gap 811 3 3337090 3336279 MINUS 2 2 U01750 1 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U01750-1 Contig ID Contig-U01750-1 Contig update 2001. 8.29 Contig sequence >Contig-U01750-1 (Contig...-U01750-1Q) /CSM_Contig/Contig-U01750-1Q.Seq.d GGAAGTTGTAATAATAAAAAAATAAAAATAAAAATAAAAAAATAAAAAAA...GAATACCAAGGTGAAAGAATTTTTCAAAAACTTCCTCAA ATCAACACAAATTTCGAAAAATTAACAATTTGGGAAAAGAAAATCGTTTC AAATCTTTATT Gap no gap Contig...crncnciwsktl*tywiyskiinpi**i*ipr *knfsktssnqhkfrkinnlgkenrfksl own update 2004. 6. 7 Homology vs CSM-cDNA Query= Contig

Dicty_cDB: Contig-U12545-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12545-1 gap included 1165 3 3275272 3276395 PLUS 1 2 U12545 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12545-1 Contig ID Contig-U12545-1 Contig update 2002.12.18 Contig sequence >Contig-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545...CGTTCTAAATCACTCATTAAAAGATTAAAAATTAAANAAGGTAATATC TCACGACNGCTNNCTCATACACACN Gap gap included Contig length 11...vliknlskrkerkis*klyqlkriqlsl vknwlklvlnhslkd*klxkvishdxxliht own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545-1Q.Seq.d (1175 letters) Database: CSM 6905 s

Dicty_cDB: Contig-U15036-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15036-1 no gap 3102 - - - - 16 24 U15036 0 5 1 2 0 1 1 2 3 1 0 0 0 0 Show Contig-U15036-1 Contig... ID Contig-U15036-1 Contig update 2004. 6.11 Contig sequence >Contig-U15036-1 (Contig-U15036-1Q) /CSM_Contig.../Contig-U15036-1Q.Seq.d ATCTTTTTAAAAAAAAAAAAAATAAAACAAATAAAGAAAGAAATTAAATA AATATTAATAAT...AATTTAAAATTAATTTTTAG AT Gap no gap Contig length 3102 Chromosome number (1..6, M) - Chromosome length - Star...RKKQTDAVAEIPVD NPTSTSTTTTTTTTSNATSILSAIHTSTINSNTSSHNNNQQQQQQQQTILPTQPTIINTP TPVRSSVSRSQSPLPSGNGSSIISQEKTPLSTFVLSTCRPSALVLPPGSTIG

Dicty_cDB: Contig-U03367-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U03367-1 no gap 323 - - - - 2 1 U03367 0 0 0 0 0 0 0 0 0 0 0 0 1 1 Show Contig-U03367-1 Contig... ID Contig-U03367-1 Contig update 2001. 8.29 Contig sequence >Contig-U03367-1 (Contig-U03367-1Q) /CSM_Contig/Contig...TTGCGGGTTGGCAGGACTGTNGGNAGGCATGGNCATCGGTATNNTTGGAG ATGCTNGTGTGAGGGCGAATGCT Gap no gap Contig length 323 Chro...HLXXGLXCGLAGLXXGMXIGXXGDAXVRANA own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U03367-1 (Contig...-U03367-1Q) /CSM_Contig/Contig-U03367-1Q.Seq.d (323 letters) Database: CSM 6905 sequ

Dicty_cDB: Contig-U15573-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15573-1 gap included 2005 4 5020093 5018210 MINUS 13 13 U15573 0 5 0 1 1 0 ...0 0 0 1 1 0 2 2 Show Contig-U15573-1 Contig ID Contig-U15573-1 Contig update 2004. 6.11 Contig sequence >Contig-U15573-1 (Contig...-U15573-1Q) /CSM_Contig/Contig-U15573-1Q.Seq.d AGTCTTGAGCTTTTATTGGGTCAACCATTGGGTGAATATAC... AGCNTTAACNGGNAA Gap gap included Contig length 2005 Chromosome number (1..6, M) ...xxlfrsnxslxxxxxxsxnxx Frame C: s*afigstig*iyiylkrfhlfl*skryyqskw*fkifpilkqttiiyen

Dicty_cDB: Contig-U16467-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16467-1 no gap 1261 2 7818565 7817305 MINUS 17 18 U16467 0 0 5 0 1 2 1 0 6 0 0 1 1 0 Show Contig...-U16467-1 Contig ID Contig-U16467-1 Contig update 2004. 6.11 Contig sequence >Contig-U16467-1 (Contig...-U16467-1Q) /CSM_Contig/Contig-U16467-1Q.Seq.d CAACAATTAACATTACTTAAATATAATATTATTATATTTTTTTTTTT...TTCAAATAAATAATTGTTTAGAAATTTCTAGAAAAAAAA AAAAAAAAAAA Gap no gap Contig length 1261 Chromosome number (1..6, M...LK833Z ,1005,1249 Translated Amino Acid sequence qqltllkyniiiffffyllplhlyhy**LKKKTLTIIKYFFQKMNKIALLFTIFFALFAI SFACDEFNPNTSTIG

Dicty_cDB: Contig-U15058-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15058-1 no gap 1987 4 4423139 4424727 PLUS 2 4 U15058 0 0 0 0 0 0 0 0 1 0 1 0 0 0 Show Contig...-U15058-1 Contig ID Contig-U15058-1 Contig update 2004. 6.11 Contig sequence >Contig-U15058-1 (Contig...-U15058-1Q) /CSM_Contig/Contig-U15058-1Q.Seq.d AAAAAAGGTTACTCACAAAGTTAAAGAAATCAATGAAAGATTTACCACCC...ACTCAAGGGGGTAGGAGAATAAAATCAACCGATTATCCAGGCNTTAAG CGACCTTTTTCCCAAAAAAAAAAGATGTTCAGAAAAT Gap no gap Contig len...srx*atffpkkkdvq k own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15058-1 (Contig-U15058-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U14745-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U14745-1 no gap 1780 6 3063854 3065579 PLUS 2 4 U14745 1 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U14745-1 Contig ID Contig-U14745-1 Contig update 2002.12.18 Contig sequence >Contig-U14745-1 (Contig...-U14745-1Q) /CSM_Contig/Contig-U14745-1Q.Seq.d GCGTCCGGACAATTTCAATAAAACAAATTTAAAAATAAATAATTTTTAAT...AATAAAATA ATTTAAATAAAAAAATATTTATTTTATTTTAAGATTAACAAAATAAAATA ATTTAAATAAAAAAATATTTATTTTAAAGA Gap no gap Contig...k*kniyfk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14745-1 (Contig-U14745-1Q) /CSM_Contig/Contig

Oxidation behaviour of plutonium rich (U, Pu)C and (U, Pu)O{sub 2}

Energy Technology Data Exchange (ETDEWEB)

Sali, S.K., E-mail: sksali@barc.gov.in [Fuel Chemistry Division (India); Kulkarni, N.K.; Phatak, Rohan [Fuel Chemistry Division (India); Agarwal, Renu [Product Development Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India)

2016-10-15

Oxidation behaviour of (U{sub 0.3}Pu{sub 0.7})C{sub 1.06} was investigated in air by heating samples up to 1073 K and 1273 K. Thermogravimetry (TG) of the samples and X-ray powder diffraction (XRD) of the intermediate products were used to understand the phenomenon taking place during this process. Theoretical calculations were carried out to understand the multiple phase changes taking place during oxidation of carbide. Theoretical results were validated by XRD analysis of the products obtained at different stages of oxidation. The final oxidized products were found to be a single FCC phase with O/M = 2.15 (M = U + Pu). Oxidation kinetic studies of (U{sub 0.3}Pu{sub 0.7})O{sub 2} and (U{sub 0.47}Pu{sub 0.53})O{sub 2} were carried out in dry air, using thermogravimetry, under non-isothermal conditions. The activation energy of oxidation was found to be 49 and 70 kJ/mol, respectively. Lattice parameter dependence on Pu/M and O/M of plutonium rich mixed oxide (MOX) was established using combined results of XRD and TG analysis of (U{sub 0.3}Pu{sub 0.7})O{sub 2+x} and (U{sub 0.47}Pu{sub 0.53})O{sub 2+x}.

Dicty_cDB: Contig-U12086-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12086-1 gap included 1101 3 5710254 5711336 PLUS 1 2 U12086 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U12086-1 Contig ID Contig-U12086-1 Contig update 2002.12.18 Contig sequence >Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig-U12086...ATCGGATTA Gap gap included Contig length 1101 Chromosome number (1..6, M) 3 Chromosome length 6358359 Start ...te 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig...Sequences producing significant alignments: (bits) Value Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Conti... 404 e-113 Contig

Dicty_cDB: Contig-U09694-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09694-1 gap included 1129 1 4027135 4026071 MINUS 3 4 U09694 2 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09694-1 Contig ID Contig-U09694-1 Contig update 2002. 9.13 Contig sequence >Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig-U0969...TTAAATTAAAACAACAACAATTTCATAATATAAATAAT Gap gap included Contig length 1129 Chromosome number (1..6, M) 1 Chr...iklkqqqfklkqqqfhninn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig...E Sequences producing significant alignments: (bits) Value Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig

Dicty_cDB: Contig-U09615-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09615-1 gap included 1134 3 4459395 4458259 MINUS 1 2 U09615 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09615-1 Contig ID Contig-U09615-1 Contig update 2002. 9.13 Contig sequence >Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U0961...TGCAAGATTAGAAAGATTAGAAAAAGATGCTATGCTAAAAATA Gap gap included Contig length 1134 Chromosome number (1..6, M) ...*wcnlyfrcre*emgkcn iefhiintrfkiwphrcidtighnvgicw**fnfecsfisleiqyrv**mgirfkyw*ww s*c*irpyfnnhafqyydyiwwskfwh*...4. 6.10 Homology vs CSM-cDNA Query= Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U09615-1Q.Seq.d (1

Dicty_cDB: Contig-U01791-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U01791-1 no gap 527 2 7629792 7630319 PLUS 1 1 U01791 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U01791-1 Contig ID Contig-U01791-1 Contig update 2001. 8.29 Contig sequence >Contig-U01791-1 (Contig...-U01791-1Q) /CSM_Contig/Contig-U01791-1Q.Seq.d GTTTGATTATAATTTATATGAATGTGAAATTAGACAAGCATTATCAAATA ...TCGTTCCCTTATGATTTAAGAACAACTTT GAATAGTTACAGAAATGGTGAATTTAGTATTTATCAATAAATTTTTTTTT AAAGATTTATAATTAAAATAAAAAAAA Gap no gap Contig...SILWSIESIGSLIVSAQINDDRETMELLHRYQIPQKFLIPLF QILALIDQLEKDLSHQIELDKFTINRDYYFLKSFSNLIEPPLNCLGILKTSRPHFRIFKL VGKNMISQVLETIG

Dicty_cDB: Contig-U09412-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09412-1 gap included 873 3 3953072 3953946 PLUS 1 2 U09412 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09412-1 Contig ID Contig-U09412-1 Contig update 2002. 9.13 Contig sequence >Contig-U09412-1 (Contig...-U09412-1Q) /CSM_Contig/Contig-U09412-1Q.Seq.d ATTATCACAACTATTTTATAATAAACCAATTTTAAAGATTAAAGT...TGGTTCAATAAAAGAAATTAAATATAATTATCAATAAT AATAATAAATTAATTAATAAATTTAAATCAAAA Gap gap included Contig length 873 ...DCQCGFVSVVENNNNNNNNSDNENNENNENNENNE NNEDLEDFIPRKLLKKSSSTLQSRTYLVIYLGRRGILEIWGLKHRSREYFKTIG

Dicty_cDB: Contig-U08861-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U08861-1 gap included 1295 5 2877914 2879217 PLUS 1 2 U08861 0 0 0 0 1 0 0 0 0 0 0 0 0 0 Show Contig...-U08861-1 Contig ID Contig-U08861-1 Contig update 2002. 9.13 Contig sequence >Contig-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861...CACATTATAAAGTACCAAATAAGTTATTAATTTTAGAAAATA AATTCCAAAGAATGCAATGTCTAAAGTTAATAAAAAAGAATACTAAAATA TTTTC Gap gap included Contig...k**iwsryccnhcl*kkqkttnef*r i*nql*tkistl*stk*vinfrk*ipknamskvnkkey*nif own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861-1Q.Seq.d (1305 letters) Database: C

Dicty_cDB: Contig-U12357-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12357-1 gap included 1333 1 2827305 2828232 PLUS 5 6 U12357 0 1 1 2 0 0 1 0 0 0 0 0 0 0 Show Contig...-U12357-1 Contig ID Contig-U12357-1 Contig update 2002.12.18 Contig sequence >Contig-U12357-1 (Contig-U12357-1Q) /CSM_Contig/Contig-U12357...ATAAAATAAAATTTATTAATTTTCCAACT Gap gap included Contig length 1333 Chromosome numb...RYXEKKKXXXXDSXNXXXXXPXX XXLXXXXPXX--- ---QYEKMKLSGEKVDPTLDASIILGNRYLEKKKVTIGDSENYTITVPFSQILKNQKPLI IQRKTKGTL...-QYEKMKLSGEKVDPTLDASIILGNRYLEKKKVTIGDSENYTITVPFSQILKNQKPLI IQRKTKGTLYYSINLSYASLNPISKAIFNRGLNIKRTYYPVSNSNDVIY

Dicty_cDB: Contig-U16108-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16108-1 gap included 1456 4 1889609 1888449 MINUS 4 6 U16108 0 0 2 0 1 0 1 0 0 0 0 0 0 0 Show Contig...-U16108-1 Contig ID Contig-U16108-1 Contig update 2004. 6.11 Contig sequence >Contig-U16108-1 (Contig-U16108-1Q) /CSM_Contig/Contig-U1610...AAAATCA TAAAATCAAAAATTGTATAATTAAAATAAAAATAAAAAAAAAAACAAAAA TAAAAAAAAAAAACAA Gap gap included Contig length 1...DFLSQFYGELN QPSLNNLTENIITIDQSSFIPIGYTTITAGLNNFAYAYIPTSCKNDKSLCSIHVAFHGCL QTVATIGDNFYTKTGYNEIAETNNIIILYPQALET...---NYVNNDNIKTMFDIQSEHAFITNSFGNNCTYLGPDYINNCNFNAPWDFLSQFYGELN QPSLNNLTENIITIDQSSFIPIGYTTITAGLNNFAYAYIPTSCKNDKSLCSIHVAFHGCL QTVATIG

Dicty_cDB: Contig-U13974-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13974-1 no gap 1782 1 1265322 1267105 PLUS 29 32 U13974 0 0 0 1 2 0 22 0 4 0 0 0 0 0 Show Contig...-U13974-1 Contig ID Contig-U13974-1 Contig update 2002.12.18 Contig sequence >Contig-U13974-1 (Contig...-U13974-1Q) /CSM_Contig/Contig-U13974-1Q.Seq.d AAGAGTTAAAACAAAAATAAAAAAATAAAATAAAAAAAAAAAATTAA...TAAAACAAATAA ACATTAAAATGATATTTAGGTTTTAAATTTAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap no gap Contig...TTRKIYVYDNQNFFPIDNQGFD VDPAKRIYLNEKKTYHNYHFCMKMNTVFTYKGYEVFNFRGDDDVWVFINNKLVIDLGGLH SPIGTSVDTMTLGLTIG

Dicty_cDB: Contig-U12049-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12049-1 gap included 2563 4 3071598 3069091 MINUS 9 17 U12049 0 0 0 0 2 0 0... 1 4 1 1 0 0 0 Show Contig-U12049-1 Contig ID Contig-U12049-1 Contig update 2002.12.18 Contig sequence >Contig-U12049-1 (Contig...-U12049-1Q) /CSM_Contig/Contig-U12049-1Q.Seq.d TAATGAAGGTAGTAATAATAATATAGTTGAAGCATCAAAAGA...TATCATTTAAACTGAAAAAAGTC CAAAAGATTTATGCAATGATTGCTGCGAATATGCTGCAACTTGTTCTCAT TAAAAATAAACAAAAAAATAATA Gap gap included Contig...disngqcvyseiidcgsssienss nqesssdidittastlgstiastigstigltstttttttsqttgtpttppqtvseipisl astistspvsdegtiastiatt

Dicty_cDB: Contig-U09432-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09432-1 gap included 993 5 741953 740957 MINUS 1 2 U09432 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09432-1 Contig ID Contig-U09432-1 Contig update 2002. 9.13 Contig sequence >Contig-U09432-1 (Contig...-U09432-1Q) /CSM_Contig/Contig-U09432-1Q.Seq.d AGGAAATATTTTAATATTTTATTTTTTTTATTTTTTTTATTTATTA...TTTTGGTGGTAAATATAGATATGAAAATAAA CAAATCCAAATTTTAGTTGAATTAAATTTCACTGATACCACTCAAAAAAA AAA Gap gap included Contig...iy*sni*SVKFGICYNYAKYHLSICNHTIYPGSDNQSLYFKLSSIFDS PTILSGYAVIYNSLDQIITNGTYNLILDEDVPTIG

Dicty_cDB: Contig-U10996-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10996-1 gap included 3017 2 5488454 5485454 MINUS 41 76 U10996 0 3 0 24 1 0... 0 8 0 5 0 0 0 0 Show Contig-U10996-1 Contig ID Contig-U10996-1 Contig update 2002.12.18 Contig sequence >Contig-U10996-1 (Contig...-U10996-1Q) /CSM_Contig/Contig-U10996-1Q.Seq.d TGGCCTACTGGTAAAAAAAATTCTAATTTTATTAAAACCC...CTATTTATAATGTATTGTTAAG GCAAAAATAAAAAAAAAAGNAAAAAAA Gap gap included Contig length...LTTTA SSSQQQQQELGLAVLTIRQGYEFENIVKELLDEKKKIEIWSMKPNSKQQWELIKKGSPGN TQMFEDVLLNGNCEGSVMMALKVTREKGSIVFGISFGDATFKTIG

Dicty_cDB: Contig-U12399-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12399-1 gap included 1358 3 4712677 4711450 MINUS 1 2 U12399 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12399-1 Contig ID Contig-U12399-1 Contig update 2002.12.18 Contig sequence >Contig-U12399-1 (Contig-U12399-1Q) /CSM_Contig/Contig-U1239...GAAGATGATATTAGTCTGAGGAAGATATTCTTAAAGA ATTTAACAAATGTTAACA Gap gap included Contig ...*e iekkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMH...kkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMHVYWRL

Dicty_cDB: Contig-U15566-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15566-1 gap included 1830 4 3730704 3729599 MINUS 4 8 U15566 0 0 1 0 1 0 0 0 2 0 0 0 0 0 Show Contig...-U15566-1 Contig ID Contig-U15566-1 Contig update 2004. 6.11 Contig sequence >Contig-U15566-1 (Contig-U15566-1Q) /CSM_Contig/Contig-U1556...CAAGATCCAA TGGAATTTTAATAATAAATAAGAATAATAAAAAAAAAAAA Gap gap included Contig length 1830 Chromosome number (1...ITLTPSEDIEKKLKEI QDENLSNSEIWFAVKSYLEDNNLKEHLYNLVFHYTMPRIDEPVTIGLDHLGNVLVSNR*c tflvvvvvytfgcriephni*qerivlqf*...asilnhirvelsqnqipilkrsfdqillphfekc iieeqqiftnekqrknflsllpisykrqdrkipltpsediekklkeiqdenlsnseiwfa vksylednnlkehlynlvfhytmpridepvtig

Dicty_cDB: Contig-U14236-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U14236-1 no gap 660 2 5626866 5627517 PLUS 1 1 U14236 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U14236-1 Contig ID Contig-U14236-1 Contig update 2002.12.18 Contig sequence >Contig-U14236-1 (Contig...-U14236-1Q) /CSM_Contig/Contig-U14236-1Q.Seq.d NNNNNNNNNNGAAAATCAAAAATTAAAAAGTAACATTACTCTATTATATG ...CAATCACTCCAATTAAA CCATAGTTTT Gap no gap Contig length 660 Chromosome number (1..6...MGSEKSPFNLKQYPSLVKIDDVS QCPKYKCLKRKSLNEWTIGLNIPAFCRESRYDCSLCYKYIECSFSDEF*tnlsalfv

Dicty_cDB: Contig-U15005-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15005-1 no gap 2023 1 1509217 1507616 MINUS 2 4 U15005 0 0 0 0 1 0 1 0 0 0 0 0 0 0 Show Contig...-U15005-1 Contig ID Contig-U15005-1 Contig update 2004. 6.11 Contig sequence >Contig-U15005-1 (Contig...-U15005-1Q) /CSM_Contig/Contig-U15005-1Q.Seq.d AATTTTCTTTTCTTTTTAAAACTTAAGTACCATATGGCAGAATATACAC...ATAATAACGATATTAA Gap no gap Contig length 2023 Chromosome number (1..6, M) 1 Chro...HMAEYTHYFIQYNLTDIFYEDVNIEKYSCSICYESVYKKEIYQCKEIHWF CKTCWAESLFKKKECMICRCIVKSISELSRNRFIEQDFLNIKVNCPNSFKYIDENKNNNN KIKDLENGCKDIITIG

Dicty_cDB: Contig-U11404-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11404-1 gap included 1618 6 1729583 1727965 MINUS 11 19 U11404 0 6 1 1 0 2 ...0 1 0 0 0 0 0 0 Show Contig-U11404-1 Contig ID Contig-U11404-1 Contig update 2002.12.18 Contig sequence >Contig-U11404-1 (Contig...-U11404-1Q) /CSM_Contig/Contig-U11404-1Q.Seq.d ATTTTAAGAGTTTTAATTTTAATAACTATACTTTTAATAAA...TTTTTCTTTTGAACCAGAAAAAAAAA Gap gap included Contig length 1618 Chromosome number ...AGARMLASLATDKLSNVIYLDVSENDFGDEGVSVICDGFVGNSTIKKLILNGNFKQ SK--- ---YEKITIGLDSVFKDLILEESQAQNEASGATPIPDSPVPTRSP

Dicty_cDB: Contig-U10709-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10709-1 gap included 1228 4 757921 759149 PLUS 2 3 U10709 0 0 0 1 1 0 0 0 0 0 0 0 0 0 Show Contig...-U10709-1 Contig ID Contig-U10709-1 Contig update 2002.12.18 Contig sequence >Contig-U10709-1 (Contig...-U10709-1Q) /CSM_Contig/Contig-U10709-1Q.Seq.d ATTAGTAACACAGACATTGGTAACACGAATTTATTACCACCATCAC...ATGTTTAGGTGATAATACTCATAGTCAA Gap gap included Contig length 1228 Chromosome number (1..6, M) 4 Chromosome le...LDIFLIQIGAAIMGSNQFIQHAINIYNLEDWFEIEPFNG SLNKSTEGTPTTTSSQPPSTPSKQTSLRNSAGTVPTTPSQSSSTIVPTLDTIGETTTTTT TTATTTT

Transformation temperatures γU → δUZr2 Y γU →αU in U-Zr-Nb alloys

International Nuclear Information System (INIS)

Komar Varela, Carolina L.; Arico, Sergio F.; Gribaudo, Luis M.; Comision Nacional de Energia Atomica, General San Martin

2009-01-01

The international RERTR program has as primary objective the development of new fuels for research and test reactors to satisfy the requirement of low enrichment in 235 U (lower than 20 %). It is known that the cubic-phase (γU) has an excellent behaviour under irradiation. In this context, in the Materials Department (GIDAT-GAEN-CNEA) U-Zr-Nb alloys are considered candidates for the development of a high-density monolithic-type nuclear fuel. It is necessary to evaluate the thermodynamic parameters that allow to obtain a range of concentrations of the U-Zr-Nb system in which this phase can be retained in the metastable condition with the required 235 U density. In this work, eight U alloys with concentrations ranging from 13.9 to 43.7 wt.% Zr and from 0 to 6.4 wt.% Nb, were fabricated. Dynamical measurements of electrical resistivity, with a cooling rate of 4 o C/min, were performed and the results were analyzed. Considering this cooling rate, a Nb concentration of at least 17.8 wt. % would inhibit the transformation γU→ δUZr 2 and a concentration of al least 23.3 wt % would inhibit the γU → αU transformation. (author)

Dicty_cDB: Contig-U09480-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09480-1 gap included 705 5 4277527 4276817 MINUS 1 2 U09480 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09480-1 Contig ID Contig-U09480-1 Contig update 2002. 9.13 Contig sequence >Contig-U09480-1 (Contig-U09480-1Q) /CSM_Contig/Contig-U09480...AAAAAAAAAA Gap gap included Contig length 705 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start ...**********imaeinienpfhvntkidvntfvnqirgipngsrcdftnsvvkhf sslgynvfvchpnhavtgpyaklhcefrntkfstig...srcdftnsvvkhf sslgynvfvchpnhavtgpyaklhcefrntkfstigydvyiiargrkvtatnfgdggydn wasggh

Dicty_cDB: Contig-U14400-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U14400-1 no gap 1939 4 4053811 4055750 PLUS 5 7 U14400 0 0 2 0 0 1 0 0 1 1 0 0 0 0 Show Contig...-U14400-1 Contig ID Contig-U14400-1 Contig update 2002.12.18 Contig sequence >Contig-U14400-1 (Contig...-U14400-1Q) /CSM_Contig/Contig-U14400-1Q.Seq.d CATTACCAATAAATTTATCTGCTTCAACACCTATACCAATGACATCACCA...AGGTTTATAAAATATATTGAATCAATTTTTGATTAAA Gap no gap Contig length 1939 Chromosome number (1..6, M) 4 Chromosome...HQQQQSKTVTSSTTSTETTTTVESSTTSTTITTSTSTPIPTTITTTPTTPI NSDNSWTFTSFSPKVFKEIRRYYGVDEEFLKSQENSSGIVKFLEVQTIGRSGSFFY

Dicty_cDB: Contig-U04768-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U04768-1 no gap 762 6 2607190 2606476 MINUS 3 3 U04768 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U04768-1 Contig ID Contig-U04768-1 Contig update 2001. 8.29 Contig sequence >Contig-U04768-1 (Contig...-U04768-1Q) /CSM_Contig/Contig-U04768-1Q.Seq.d AAAGTCTTATTTGTTTAAAAAAAAAAAAAAAAAATAAAAAACTTTATTCT...AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAA Gap no gap Contig length 762 Chromosome number (1..6, M...lknf*KMVMMHDEYISPTKLQFGFMIAVAFLG TIGVMGFCQNVFDILLGVISILSIYIGMRGVWKRKKRWLFVFMWLMMGMGFLHLVSFAVV VILHHKNPTKNTVF

Dicty_cDB: Contig-U12765-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12765-1 no gap 1256 6 1467819 1466563 MINUS 3 3 U12765 0 0 0 2 0 0 0 0 0 0 1 0 0 0 Show Contig...-U12765-1 Contig ID Contig-U12765-1 Contig update 2002.12.18 Contig sequence >Contig-U12765-1 (Contig...-U12765-1Q) /CSM_Contig/Contig-U12765-1Q.Seq.d CAAAAAGGAAACACTAGTCCAGTTAGAACCCCAAATACTACTACTACTA...TATCGATTGTTCAAAGGTTTCAATGGTTGATACTAAT TTCTTA Gap no gap Contig length 1256 Chromosome number (1..6, M) 6 Chr...EYQEDLTPIFEPIFLDLIKIL STTTLTGNVFPYYKVFSRLVQFKAVSDLVGTLQCWNSPNFNGKEMERNTILGSLFSPSSA SDDGSTIKQYFSNASTMNKNTIGDA

Dicty_cDB: Contig-U09345-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09345-1 gap included 1216 4 3361857 3360637 MINUS 4 5 U09345 1 0 1 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U09345-1 Contig ID Contig-U09345-1 Contig update 2002. 9.13 Contig sequence >Contig-U09345-1 (Contig-U09345-1Q) /CSM_Contig/Contig-U0934...AATGGTATTTTAAAAATAA Gap gap included Contig length 1216 Chromosome number (1..6, M) 4 Chromosome length 5430...ALFTSSNPKYGCSGCVQLKNQIESFSLSYEPYL NSAGFLEKPIFIVILEVDYNMEVFQTIGLNTIPHLLFIPSGSKPITQKGYAYTGFEQTSS QSISDFIYSHSKI...LLALFTSSNPKYGCSGCVQLKNQIESFSLSYEPYL NSAGFLEKPIFIVILEVDYNMEVFQTIGLNTIPHLLFIPSGSKPI

Dicty_cDB: Contig-U09581-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09581-1 gap included 1235 1 2575525 2576764 PLUS 1 2 U09581 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09581-1 Contig ID Contig-U09581-1 Contig update 2002. 9.13 Contig sequence >Contig-U09581-1 (Contig-U09581-1Q) /CSM_Contig/Contig-U09581...ATCAAAATAAATTTTTGTAACATTAATAATAAATAAN Gap gap included Contig length 1235 Chromosome number (1..6, M) 1 Chro... VFD420Z ,579,1237 Translated Amino Acid sequence KKPGVVTIKGSSFCSQPTITIGDDSCSQPILSVGNDYDSLTCNFQSNAGLSNSTLLVS...ames) Frame A: KKPGVVTIKGSSFCSQPTITIGDDSCSQPILSVGNDYDSLTCNFQSNAGLSNSTLLVSII CDTIQ

Dicty_cDB: Contig-U16457-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16457-1 no gap 1065 3 996438 997502 PLUS 6 5 U16457 0 0 1 0 1 0 2 0 0 0 0 0 1 1 Show Contig...-U16457-1 Contig ID Contig-U16457-1 Contig update 2004. 6.11 Contig sequence >Contig-U16457-1 (Contig...-U16457-1Q) /CSM_Contig/Contig-U16457-1Q.Seq.d ACAATTGGTGTTGCTGCTCTATTCGGTCTTCCAGCTATGGCACGTTCCGC A...TTTAACAAGATTGGAAGAC CAAAAAGAAAAAAAA Gap no gap Contig length 1065 Chromosome numb... Translated Amino Acid sequence TIGVAALFGLPAMARSAAMSLVFLIPFMWIVFSVHYPINSVVADICMSYNNNTGSIEQQL ANYTNPIVSEIFGTC

Inversion of spin levels in Ni sup 2 sup + : Zn(BF sub 4) sub 2 centre dot 6H sub 2 O at all -round compression and effect of transition coincidence

CERN Document Server

Krygin, I M; Nejlo, G N; Prokhorov, A D

2001-01-01

The study of the EPR spectrum of the Ni sup 2 sup + ion, replacing Zn sup 2 sup + in the Zn(BF sub 4) centre dot 6H sub 2 O crystals in the wide temperature range by the all-round compression in the X- and Q-ranges is carried out. The basic changes by varying temperature and pressure occur with the D parameter, characterizing the initial splitting by practically unchanged g-factor. The increase in the temperature is accompanied by the D nonlinear growth. The all-round compression linearly changes the initial splitting and leads to the change in the D-sign, signifying the spin levels inversion by 3.5 kbar. Coincidence of EPR lines, relative to different transitions, leads to the crevasse appearance in the outline of this one, that is connected with cross-relaxation inside the spin system

Dicty_cDB: Contig-U15828-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15828-1 gap included 1593 1 4184040 4182448 MINUS 12 19 U15828 0 0 6 0 0 0 ...0 0 2 0 4 0 0 0 Show Contig-U15828-1 Contig ID Contig-U15828-1 Contig update 2004. 6.11 Contig sequence >Contig-U15828-1 (Contig...-U15828-1Q) /CSM_Contig/Contig-U15828-1Q.Seq.d ATAAAAAAAATTAAAAAATTAAAAAAGTTATCCACCCAAGT...ACA AATATTATAACTGGTACTGCTACTGTTTCAATCCCTCAAAAAAATTTAAT TTATATTTTACCAAATTCAAATACAATTAATCAATCAACAATTACAATTA CAA Gap gap included Contig...SFNPANSDFSFSYNINTTITQPTQIYLNQDIYYPNGFTTNIITGTATVSIPQ KNLIYILPNSNTINQSTITIT own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig

Dicty_cDB: Contig-U01510-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available .4 1 ( BE248608 ) NF021H01DT1F1013 Drought Medicago truncatula cDNA... 42 6.4 1 ( BE205651 ) AOB130 Onion seedling leaf cDNA library...-41B2_Sp6.1 CH216 Xenopus (Silurana) tropica... 42 6.4 1 ( CG770475 ) TcB41.2_F05_SP6 Tribolium BAC library ...ed ... 44 1.6 1 ( CK424003 ) AUF_IpSto_10_c04 Stomach cDNA library Ictalurus p........ 42 6.4 1 ( EI465423 ) PV_GBa0071A02.f PV_GBa Phaseolus vulgaris genomic... 42 6.4 1 ( ED568449 ) SBA034_G14.f Sugar beet BAC libra...ago trunca... 42 6.4 1 ( BF650883 ) NF097E12EC1F1097 Elicited cell culture Medicago t... 42 6.4 1 (

PSA kinetics after prostate brachytherapy: PSA bounce phenomenon and its implications for PSA doubling time

International Nuclear Information System (INIS)

Ciezki, Jay P.; Reddy, Chandana A.; Garcia, Jorge; Angermeier, Kenneth; Ulchaker, James; Mahadevan, Arul; Chehade, Nabil; Altman, Andrew; Klein, Eric A.

2006-01-01

Purpose: To analyze prostate-specific antigen (PSA) kinetics in patients treated with prostate brachytherapy (PI) with a minimum of 5 years of PSA follow-up. Methods and Materials: The records of 162 patients treated with PI for localized prostate cancer with a minimum of 5 years of PSA follow-up were reviewed. A variety of pretreatment and posttreatment variables were examined. Patients were coded as having a PSA bounce if their PSA achieved a nadir, elevated at least 0.2 ng/mL greater than that nadir, and decreased to, or below, the initial nadir. Two definitions of biochemical failure (bF) or biochemical relapse-free survival (bRFS) were used: the classic American Society for Therapeutic Radiology and Oncology consensus definition of three consecutive rises (bF3) and the nadir plus 2 ng/mL definition (bFn+2). Associations between a PSA bounce and the various pre- and posttreatment factors were assessed with logistic regression analysis, and the association between a PSA bounce and bF was examined with the log-rank test. The Mann-Whitney U test was applied to test for differences in the PSA doubling time (PSADT) and the time to a PSA rise between the PSA bounce patients and the bF patients. PSADT was calculated from the nadir to the time of the first PSA rise, because this point is known first in the clinical setting. Results: The 5-year overall bRFS rate was 87% for the bF3 definition and 96% for the bFn+2 definition. A PSA bounce was experienced by 75 patients (46.3%). Patients who experienced a PSA bounce were less likely to have a bF, regardless of the bRFS definition used (bF3: p = 0.0015; bFn+2: p = 0.0040). Among the pre- and posttreatment factors, only younger age predicted for a PSA bounce on multivariate analysis (p = 0.0018). The use of androgen deprivation had no effect on PSA bounce. No difference was found in the PSADT between patients who had a PSA bounce and those with bF. The median PSADT for those with a PSA bounce was 8.3 months vs. 10.3 months

A Study of the Spin-State Transition and Phase Transformation in [Fe(bpp)(2)][CF(3)SO(3)](2).H(2)O and [Fe(bpp)(2)][BF(4)](2) Using Mn(2+) Electron Spin Resonance.

Science.gov (United States)

Sung, Raymond C. W.; McGarvey, Bruce R.

1999-08-09

X-band ESR powder studies have been done on the spin transition in Mn(2+)-doped [Fe(bpp)(2)][CF(3)SO(3)](2).H(2)O and [Fe(bpp)(2)][BF(4)](2) (bpp = 2,6-bis(pyrazol-3-yl) pyridine). The change in D value of Mn(2+) during the thermally induced high-spin (HS) low-spin (LS) transition shows that the spin transition is accompanied by a phase transformation involving a domain mechanism. Irradiation experiments at 77 K have shown that a LS --> HS spin change occurs without a change in the crystalline phase. The rate of the change from the HS phase to the LS phase in the vicinity of 100 K has been measured and is found to be the same as that measured for the corresponding spin change obtained from Mössbauer spectroscopy and magnetic susceptibility studies.

Dicty_cDB: Contig-U09822-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09822-1 gap included 1255 3 5930658 5929418 MINUS 5 6 U09822 3 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09822-1 Contig ID Contig-U09822-1 Contig update 2002. 9.13 Contig sequence >Contig-U09822-1 (Contig-U09822-1Q) /CSM_Contig/Contig-U0982...AAAAGAAAAAAAAAAAAAAAAGATTTAATTAAATAAAAAAAAA AAAAAAAAAAAAAAA Gap gap included Contig length 1255 Chromosome n...,975 est6= VSA519Z ,780,1257 Translated Amino Acid sequence QPFYLVQSMFEPIQDSSFTSIGEIISYDTIG...rfn*ikkkkkk k Frame C: QPFYLVQSMFEPIQDSSFTSIGEIISYDTIGFDGKINTAVMSSLSPSTMYFYCVGDKS

U(1) x U(1) x U(1) symmetry of the Kimura 3ST model and phylogenetic branching processes

International Nuclear Information System (INIS)

Bashford, J D; Jarvis, P D; Sumner, J G; Steel, M A

2004-01-01

An analysis of the Kimura 3ST model of DNA sequence evolution is given on the basis of its continuous Lie symmetries. The rate matrix commutes with a U(1) x U(1) x U(1) phase subgroup of the group GL(4) of 4 x 4 invertible complex matrices acting on a linear space spanned by the four nucleic acid base letters. The diagonal 'branching operator' representing speciation is defined, and shown to intertwine the U(1) x U(1) x U(1) action. Using the intertwining property, a general formula for the probability density on the leaves of a binary tree under the Kimura model is derived, which is shown to be equivalent to established phylogenetic spectral transform methods. (letter to the editor)

Dicty_cDB: Contig-U13894-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13894-1 no gap 1550 2 2081463 2079913 MINUS 30 31 U13894 1 0 15 0 9 1 1 0 1 1 1 0 0 0 Show Contig...-U13894-1 Contig ID Contig-U13894-1 Contig update 2002.12.18 Contig sequence >Contig-U13894-1 (Contig...-U13894-1Q) /CSM_Contig/Contig-U13894-1Q.Seq.d CTTTTTGATTGTATAATTGAAAAAAAAAAAAAAAAAAAAAAAAAAA...TAAATTAAATAATTAAAAAAAACAAAAAAATTAAGTGAAAATCAAAAAA Gap no gap Contig length 1550 Chromosome number (1..6, M) ...V*kkkkikk*k*sk*fklnn*kkqkn*vkikk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13894-1 (Contig

[Current cases of falsified medicinal products within the competence of the Federal Institute for Drugs and Medical Devices (BfArM) : Case studies and extent].

Science.gov (United States)

Wittstock, Marcus; Paeschke, Norbert

2017-11-01

The nature of a falsification of a medicinal product can vary a lot. Therefore the means to detect them and the potential risk to patient safety can also be very different. The whole range of falsification will be described using observed cases from the Federal Institute for Drugs and Medical Devices (BfArM).Based on the relatively low number of detected cases of falsified medicines, the legal supply chain can still be regarded as safe. It has to be assumed that in the illegal supply chain, e. g. illegal internet trade, the majority of the offered medicinal products are not only falsifications due to illegal trade but because they are completely falsified. Therefore there is an especially high risk for the consumer to be harmed by medicinal products that do not fulfil the required specifications.The trend indicates that increased efforts will be necessary to keep the legal supply chain safe and to contain illegal trade with falsifications. The higher federal authorities BfArM, PEI and BVL are involved in this task by coordinating and ensuring the flow of information to the concerned authorities and stakeholders as well as informing the public. Increased efforts are also necessary due to the rising involvement of organised crime in the falsification of medicinal products. A package of measures was enacted with the Falsified Medicines Directive 2011/62/EU to protect the legal supply chain from falsified medicinal products.

Dicty_cDB: Contig-U15541-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15541-1 gap included 2750 - - - - 634 1127 U15541 1 129 1 375 19 0 2 32 4 69 1 0 1 0 Show Contig...-U15541-1 Contig ID Contig-U15541-1 Contig update 2004. 6.11 Contig sequence >Contig-U15541-1 (Contig...-U15541-1Q) /CSM_Contig/Contig-U15541-1Q.Seq.d ATAATAAACGGTGAATACCTCGACTCCTAAATCGATGAAGACCGTAG...AAAAAT AAAAATAAAAATAAATAAATAATCATTTCATATTAATATTTTTTTTTATT TTTAAAAAAA Gap gap included Contig...ffyf*k own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15541-1 (Contig-U15541-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U12682-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12682-1 no gap 1408 4 4961739 4963050 PLUS 47 48 U12682 0 0 0 5 0 0 2 30 0 10 0 0 0 0 Show Contig...-U12682-1 Contig ID Contig-U12682-1 Contig update 2002.12.18 Contig sequence >Contig-U12682-1 (Contig...-U12682-1Q) /CSM_Contig/Contig-U12682-1Q.Seq.d AAACACATCATCCCGTTCGATCTGATAAGTAAATCGACCTCAGGCC...ATGA AACTACTG Gap no gap Contig length 1408 Chromosome number (1..6, M) 4 Chromosome length 5430582 Start po... kwniikwysyinwykswyn**fihsiklqwsy*qcke*si*yiir*ny own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig

Dicty_cDB: Contig-U15069-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15069-1 no gap 1241 1 2719927 2720886 PLUS 37 43 U15069 16 2 0 0 0 5 8 0 0 1 1 0 4 0 Show Contig...-U15069-1 Contig ID Contig-U15069-1 Contig update 2004. 6.11 Contig sequence >Contig-U15069-1 (Contig...-U15069-1Q) /CSM_Contig/Contig-U15069-1Q.Seq.d TTTCAAACCAAAACATAAAATAATTAAAAATGACAACTGTTAAACCA...AAAAATAAAATAAATAAAAATAGTTTTAAA Gap no gap Contig length 1241 Chromosome number (1..6, M) 1 Chromosome length...07Z ,263,623 est42= VSJ431Z ,390,646 est43= CHB363Z ,460,1187 Translated Amino Acid sequence snqnik*lkmttvkptspenprvffditig

Performance analysis of absorption heat transformer cycles using ionic liquids based on imidazolium cation as absorbents with 2,2,2-trifluoroethanol as refrigerant

International Nuclear Information System (INIS)

Ayou, Dereje S.; Currás, Moisés R.; Salavera, Daniel; García, Josefa; Bruno, Joan C.; Coronas, Alberto

2014-01-01

Highlights: • TFE + [emim][BF 4 ] (or [bmim][BF 4 ]) absorption heat transformer cycles are studied. • Influence of various operating conditions on cycle’s performance is investigated. • Performance comparisons with H 2 O + LiBr and TFE + TEGDME cycles are done. • Enthalpy data for TFE + [emim][BF 4 ] (or [bmim][BF 4 ]) liquid mixtures are calculated. • TFE + [emim][BF 4 ] (or [bmim][BF 4 ]) cycles have higher gross temperature lift (GTL). - Abstract: A detailed thermodynamic performance analysis of a single-stage absorption heat transformer and double absorption heat transformer cycles using new working pairs composed of ionic liquids (1-ethyl-3-methylimidazolium tetrafluoroborate ([emim][BF 4 ]) and 1-butyl-3-methylimidazolium tetrafluoroborate ([bmim][BF 4 ])) as absorbent and 2,2,2-trifluoroethanol (TFE) as refrigerant has been studied. Several performance indicators were used to evaluate and compare the performance of the cycles using the TFE + [emim][BF 4 ] and TFE + [bmim][BF 4 ] working pairs with the conventional H 2 O + LiBr and organic TFE + TEGDME working pairs. The obtained results show that the ionic liquid based working pairs are suitable candidates to replace the conventional H 2 O + LiBr working pairs in order to avoid the disadvantages associated with it mainly crystallization and corrosion and also they perform better (higher gross temperature lift) than TFE + TEGDME working pair at several operating conditions considered in this work

[Validation of a French translation of Krueger's personality inventory for DSM-5 in its brief form (PID-5 BF)].

Science.gov (United States)

Combaluzier, S; Gouvernet, B; Menant, F; Rezrazi, A

2018-02-01

Since the publication of the DSM-5 (APA, 2013), the dimensional conception of the personality disorders is co-existing with the classical categorical paradigm. Tools have been proposed for the evaluations of five big pathological factors to be explored further according to the APA (negative affectivity, detachment, antagonism, disinhibition, psychoticism). Despite numerous works using these questionnaires (30 works in 3 years according to Al-Adjani et al., 2015), none of them have yet been translated into French. Also, the main objective of the paper is to present a French translation of the Personality Inventory for DSM -5 by Kruegger et al. (2013) in its brief form of 25 items (PID-5 BF). To reach this goal, we have employed the classic translation-retranslation method (Vallerand, 1989) and tested the consistence and the validity of this French version among a non-clinical sample (n=216) of young adults (age=31.4, SD=4.8), in joining some other questionnaires in their short forms to study the external validity of the PID-5 about the psychological distress (SCL-10, Nguyen, 1983), the categorical diagnosis of personality disorders (SAPAS, Moran et al., 2003) and the classical Big Five dimensions of the personality (BDI 10, Ramamstedt and John, 2007). The internal consistency of this translation has been studied through the classical outcomes on factor analysis for the dimensional repartitions of the items in 5 scales and Cronbach's alpha for the consistency of each found dimensions. The external validity has been explored by studying Pearson's correlations between the outcomes on each dimension of the PID-5 BF and both the clinical dimensions of SCL-10, personality dimensions of the BFI-10 or personality disorders (SAPAS). Factor analysis led to the same repartition of the 25 items as the original versions. Each of the dimensions is consistent enough (α>.65) to be taken into account as clinically significant. The items of the French version of the PID-5 BF follow

Optimized sample preparation for two-dimensional gel electrophoresis of soluble proteins from chicken bursa of Fabricius

Directory of Open Access Journals (Sweden)

Zheng Xiaojuan

2009-10-01

Full Text Available Abstract Background Two-dimensional gel electrophoresis (2-DE is a powerful method to study protein expression and function in living organisms and diseases. This technique, however, has not been applied to avian bursa of Fabricius (BF, a central immune organ. Here, optimized 2-DE sample preparation methodologies were constructed for the chicken BF tissue. Using the optimized protocol, we performed further 2-DE analysis on a soluble protein extract from the BF of chickens infected with virulent avibirnavirus. To demonstrate the quality of the extracted proteins, several differentially expressed protein spots selected were cut from 2-DE gels and identified by matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI-TOF MS. Results An extraction buffer containing 7 M urea, 2 M thiourea, 2% (w/v 3-[(3-cholamidopropyl-dimethylammonio]-1-propanesulfonate (CHAPS, 50 mM dithiothreitol (DTT, 0.2% Bio-Lyte 3/10, 1 mM phenylmethylsulfonyl fluoride (PMSF, 20 U/ml Deoxyribonuclease I (DNase I, and 0.25 mg/ml Ribonuclease A (RNase A, combined with sonication and vortex, yielded the best 2-DE data. Relative to non-frozen immobilized pH gradient (IPG strips, frozen IPG strips did not result in significant changes in the 2-DE patterns after isoelectric focusing (IEF. When the optimized protocol was used to analyze the spleen and thymus, as well as avibirnavirus-infected bursa, high quality 2-DE protein expression profiles were obtained. 2-DE maps of BF of chickens infected with virulent avibirnavirus were visibly different and many differentially expressed proteins were found. Conclusion These results showed that method C, in concert extraction buffer IV, was the most favorable for preparing samples for IEF and subsequent protein separation and yielded the best quality 2-DE patterns. The optimized protocol is a useful sample preparation method for comparative proteomics analysis of chicken BF tissues.

Uniqueness of Positive Solutions of Δu+f(u)=0 in N, N<=3

Science.gov (United States)

Cortázar, Carmen; Elgueta, Manuel; Felmer, Patricio

We study the uniqueness of radial ground states for the semilinear elliptic partial differential equation $Δ u+f(u)=0 {(*)}$ in N. We assume that the function f has two zeros, the origin and u0>0. Above u0 the function f is positive, is locally Lipschitz continuous and satisfies convexity and growth conditions of a superlinear nature. Below u0, f is assumed to be non-positive, non-identically zero and merely continuous. Our results are obtained through a careful analysis of the solutions of an associated initial-value problem, and the use of a monotone separation theorem. It is known that, for a large class of functions f, the ground states of (*) are radially symmetric. In these cases our result implies that (*) possesses at most one ground state.

(+-{1,2-Bis[(2R,5R-2,5-diethylphospholan-1-yl]ethane-κ2P,P′}(η4-cycloocta-1,5-dienerhodium(I tetrafluoridoborate

Directory of Open Access Journals (Sweden)

Stefan Schulz

2010-11-01

Full Text Available The title compound, [Rh(C8H12(C18H36P2]BF4, exhibits a rhodium(I complex cation with a bidentate bisphosphine ligand and a bidentate η2,η2-coordinated cycloocta-1,5-diene ligand. The ligands form a slightly distorted square-planar coordination environment for the Rh(I atom. An intramolecular P–Rh–P bite angle of 83.91 (2° is observed. The dihedral angle between the P—Rh—P and the X—Rh—X planes (X is the centroid of a double bond is 14.0 (1°. The BF4 anion is disordered over two positions in a 0.515 (7:0.485 (7 ratio.

Calorimetric investigation of (Pb0.45Bi0.55)-U system

International Nuclear Information System (INIS)

Agarwal, Renu; Samui, Pradeep; Mukerjee, S.K.; Ramakumar, K.L.

2016-01-01

Lead-bismuth eutectic (LBE) is being considered as a coolant of future high temperature reactors. As lead and bismuth are good spallation target material, they are planned to be used in accelerator driven reactor systems (ADS). Under the clad breach conditions these elements may come in direct contact with uranium of metallic fuel. In our labs, we had earlier investigated binary interactions of U-Pb and U-Bi. To assess interaction behaviour of 'U' with the eutectic melt, it was planned to measure enthalpy of mixing of LBE-U and compares it with the binary mixing. SEM-EDS studies of the product formed after mixing of LBE and 'U' were carried out to establish coexisting phases and their compositions. UPb 3 is Pb-rich compound of U-Pb and UBi 2 is Bi-rich compound of U-Bi. So addition of 'U' in (Pb 0.45 Bi 0.55 ) will result in formation of the more stable compound among UPb 3 and UBi 2

Atomistic simulations of nanocrystalline U0.5Th0.5O2 solid solution under uniaxial tension

Directory of Open Access Journals (Sweden)

Hongxing Xiao

2017-12-01

Full Text Available Molecular dynamics simulations were performed to investigate the uniaxial tensile properties of nanocrystalline U0.5Th0.5O2 solid solution with the Born–Mayer–Huggins potential. The results indicated that the elastic modulus increased linearly with the density relative to a single crystal, but decreased with increasing temperature. The simulated nanocrystalline U0.5Th0.5O2 exhibited a breakdown in the Hall–Petch relation with mean grain size varying from 3.0 nm to 18.0 nm. Moreover, the elastic modulus of U1-yThyO2 solid solutions with different content of thorium at 300 K was also studied and the results accorded well with the experimental data available in the literature. In addition, the fracture mode of nanocrystalline U0.5Th0.5O2 was inclined to be ductile because the fracture behavior was preceded by some moderate amount of plastic deformation, which is different from what has been seen earlier in simulations of pure UO2.

Bose-Fermi U(6/2j+1) supersymmetries and high-spin anomalies

International Nuclear Information System (INIS)

Morrison, I.; Jarvis, P.D.

1985-01-01

A supersymmetric extension of the interacting boson model (IBM) is constructed to describe high-spin anomalies in both even- and odd-mass spectra of the Hg, Pt region (190<=A<=200). Supergroup chains such as U(6/2j+1)containsOsp(6/2j+1)containsO(6)xSp(2j+1)... or U(6/2j+1)containsU(5/2j+1)xU(1)containsOsp(5/2j+1)... incorporate a single j-shell fermion in addition to the usual 's' and 'd' bosons (L=0 and L=2). The orthosympletic supergroup reflects the strong pairing force in the subspace of the fermion intruder level. The model agrees favourably with experiment and microscopic calculation. (orig.)

The Arabidopsis splicing factors, AtU2AF65, AtU2AF35, and AtSF1 shuttle between nuclei and cytoplasms

KAUST Repository

Park, Hyo-Young

2017-04-21

The Arabidopsis splicing factors, AtU2AF65, AtU2AF35, and AtSF1 shuttle between nuclei and cytoplasms. These proteins also move rapidly and continuously in the nuclei, and their movements are affected by ATP depletion. The U2AF65 proteins are splicing factors that interact with SF1 and U2AF35 proteins to promote U2snRNP for the recognition of the pre-mRNA 3\\' splice site during early spliceosome assembly. We have determined the subcellular localization and movement of these proteins\\' Arabidopsis homologs. It was found that Arabidopsis U2AF65 homologs, AtU2AF65a, and AtU2AF65b proteins interact with AtU2AF35a and AtU2AF35b, which are Arabidopsis U2AF35 homologs. We have examined the mobility of these proteins including AtSF1 using fluorescence recovery after photobleaching and fluorescence loss in photobleaching analyses. These proteins displayed dynamic movements in nuclei and their movements were affected by ATP depletion. We have also demonstrated that these proteins shuttle between nuclei and cytoplasms, suggesting that they may also function in cytoplasm. These results indicate that such splicing factors show very similar characteristics to their human counterparts, suggesting evolutionary conservation.

The Arabidopsis splicing factors, AtU2AF65, AtU2AF35, and AtSF1 shuttle between nuclei and cytoplasms

KAUST Repository

Park, Hyo-Young; Lee, Keh Chien; Jang, Yun Hee; Kim, SoonKap; Thu, May Phyo; Lee, Jeong Hwan; Kim, Jeong-Kook

2017-01-01

The Arabidopsis splicing factors, AtU2AF65, AtU2AF35, and AtSF1 shuttle between nuclei and cytoplasms. These proteins also move rapidly and continuously in the nuclei, and their movements are affected by ATP depletion. The U2AF65 proteins are splicing factors that interact with SF1 and U2AF35 proteins to promote U2snRNP for the recognition of the pre-mRNA 3' splice site during early spliceosome assembly. We have determined the subcellular localization and movement of these proteins' Arabidopsis homologs. It was found that Arabidopsis U2AF65 homologs, AtU2AF65a, and AtU2AF65b proteins interact with AtU2AF35a and AtU2AF35b, which are Arabidopsis U2AF35 homologs. We have examined the mobility of these proteins including AtSF1 using fluorescence recovery after photobleaching and fluorescence loss in photobleaching analyses. These proteins displayed dynamic movements in nuclei and their movements were affected by ATP depletion. We have also demonstrated that these proteins shuttle between nuclei and cytoplasms, suggesting that they may also function in cytoplasm. These results indicate that such splicing factors show very similar characteristics to their human counterparts, suggesting evolutionary conservation.