WorldWideScience

Sample records for betaine

  1. Betaine

    Science.gov (United States)

    ... use betaine powder, follow these steps: Shake the bottle gently before removing the cap. Using the measuring scoop provided, measure the number ... Drink or eat the mixture immediately. Replace the cap tightly on the bottle after using.

  2. Cocamidopropyl betaine.

    Science.gov (United States)

    Jacob, Sharon E; Amini, Sadegh

    2008-01-01

    Cocamidopropyl betaine (CAPB) is an amphoteric synthetic detergent that has been increasingly used in cosmetics and personal hygiene products (eg, shampoos, contact lens solutions, toothpaste detergents, makeup removers, bath gels, skin care products, cleansers, liquid soaps, antiseptics, and gynecologic and anal hygiene products) because it induces relatively mild skin irritation. Delayed T-cell-mediated type IV hypersensitivity reactions to CAPB have been reported, and contact sensitization prevalence is estimated at between 3.0 and 7.2%. The increasing rates of sensitization led to CAPB's being named Allergen of the Year in 2004. Related impurities rendered during the manufacturing process (such as amidoamine and dimethylaminopropylamine) are thought to play a role in sensitization. PMID:18627690

  3. THE BETAINES FROM CHINESE SEAWEEDS

    Institute of Scientific and Technical Information of China (English)

    韩丽君; 范晓; 严小军

    2002-01-01

    Cation-exchange chromatography was selected to extract and separate betaines from marine algae. On the basis of the special chemical characteristics of the betaines and their analogues, Dragendorff's reagent (KBiI4) was used to test the existence of betaines and their analogues in marine algae. The total content of betaines from seven species was obtained by using the Reinkeate salt precipitation method. The results showed that the content of betaines in two species of Chlorophyta and two species of Rhodophyta were relatively high,and that the content of betaines in Enteromopha prolifera could even reach to 0.9%. The content in the three species of Phaeophyta was relatively low.

  4. Biochemical diversity of betaines in earthworms

    Energy Technology Data Exchange (ETDEWEB)

    Liebeke, Manuel [Department of Surgery and Cancer, Imperial College London, Sir Alexander Fleming Building, London SW7 2AZ (United Kingdom); Bundy, Jacob G., E-mail: j.bundy@imperial.ac.uk [Department of Surgery and Cancer, Imperial College London, Sir Alexander Fleming Building, London SW7 2AZ (United Kingdom)

    2013-01-25

    Highlights: ► We develop a method for rapid untargetted analysis of betaines. ► We profile betaines in a comparative study of ten earthworm species. ► Earthworms contain a surprisingly high number of different betaine metabolites. ► Earthworms contain betaines normally seen only in plants or marine animals. -- Abstract: The ability to accumulate osmoprotectant compounds, such as betaines, is an important evolutionary feature in many organisms. This is particularly the case for organisms that live in variable environments, which may have fluctuations in moisture and salinity levels. There is, surprisingly, very little known about betaines in soil invertebrates in general, and there is almost no information about earthworms – a group that are important ‘ecosystem engineers’ and key indicators of soil health. Here, we describe a fast and reliable {sup 1}H–{sup 13}C heteronuclear single quantum coherence (HSQC) 2D NMR approach for the metabolic profiling of a series of betaines and related metabolites in tissue extracts, and list {sup 1}H and {sup 13}C chemical shifts for the trimethylammonium signal for 23 such compounds. The analysis of ten different species from three different families (Lumbricidae, Megascolecidae and Glossoscolecidae) showed an unexpected diversity of betaines present in earthworms. In total ten betaines were identified, including hydroxyproline-betaine, proline-betaine, taurine-betaine, GABA-betaine and histidine-betaine, and a further eleven as-yet unassigned putative betaine metabolites detected. The findings clearly indicate a hitherto-unappreciated important role for betaine metabolism in earthworms.

  5. Betaine potassium iodide dihydrate: a new compound of betaine

    International Nuclear Information System (INIS)

    Betaine potassium iodide dihydrate, [(CH3)3N+CH2COO-]2.KI.2H2O, BKI for short, is a new compound of the aminoacid betaine with a triclinic symmetry and the space group P1-bar at room temperature. The study of dielectric properties provided evidence for the existence of a structural phase transition occurring around 100 K. The spontaneous electric polarization is zero in both phases. A study of dielectric dispersion disclosed two relaxational modes with different relevance in the high and in the low temperature phases. The main features observed in BKI are consistently described by the Landau theory, by assuming a quadratic coupling between the primary order parameter and the electric polarization. (author). Letter-to-the-editor

  6. Betaine transport in kidney and liver: use of betaine in liver injury.

    Science.gov (United States)

    Kempson, Stephen A; Vovor-Dassu, Komi; Day, Christopher

    2013-01-01

    Betaine, also known as trimethylglycine, is an important human nutrient obtained from a variety of foods and also can be synthesized from choline. Betaine is much more abundant in kidney and liver compared to other mammalian organs. The principal role of betaine in the kidney is osmoprotection in cells of the medulla and it enters these cells via the betaine/γ-aminobutyric acid (GABA) transporter protein (BGT1), which is upregulated by hyperosmotic stress. This process has been studied in great detail. In liver, the main role of betaine is a methyl donor in the methionine cycle. However, recent studies showed that BGT1 is much more abundant in liver compared to kidney medulla. Despite this, the role of BGT1 in liver has received little attention. Entry of betaine into liver cells is a necessary first step for its action at the cellular level. Increased interest in betaine has developed because of a number of therapeutic uses. These include treatment of nonalcoholic fatty liver and hyperhomocysteinemia, a risk factor for atherosclerotic disease. Several important questions need to be addressed to better understand the potential of betaine as a therapeutic agent for other liver diseases, such as alcohol-induced injury. Heavy alcohol consumption is the most common cause for liver-related deaths and altered liver metabolism may contribute to hepatic, vascular, coronary, and cerebral diseases. PMID:24429813

  7. Cereal foods are the major source of betaine in the Western diet--analysis of betaine and free choline in cereal foods and updated assessments of betaine intake.

    Science.gov (United States)

    Ross, Alastair B; Zangger, Alicia; Guiraud, Seu Ping

    2014-02-15

    Betaine and its precursor choline are important components of one-carbon metabolism, remethylating homocysteine into methionine and providing methyl groups for DNA methylation. Cereals are the main source of betaine in the diet, though there is little literature available on the content of betaine in cereal products, nor on betaine intake from cereals. Betaine and free-choline concentrations were measured by liquid-chromatography with tandem mass spectrometry in a wide range of commercially available cereal foods and cereal fractions. Whole grain wheat and related fractions were the best overall common source of betaine, while the pseudocereal quinoa had the highest amount of betaine measured (3900 μg/g). Based on estimates of dietary intake data cereal foods provide approximately 60-67% of betaine in Western diets, and 20-40% of betaine in South-East Asian diets. Average intake of betaine was 131 mg/d, well below those used in intervention studies using betaine to lower blood homocysteine. PMID:24128557

  8. Betaine supplementation lowers plasma homocysteine in healthy men and women

    NARCIS (Netherlands)

    Steenge, G.R.; Verhoef, P.; Katan, M.B.

    2003-01-01

    Elevated levels of plasma total homocysteine are associated with a higher risk of cardiovascular disease. Betaine and 5-methyltetrahydrofolate can remethylate homocysteine into methionine via independent reactions. We determined the effect of daily betaine supplementation, compared with both folic a

  9. The metabolism and biotechnological application of betaine in microorganism.

    Science.gov (United States)

    Zou, Huibin; Chen, Ningning; Shi, Mengxun; Xian, Mo; Song, Yimin; Liu, Junhong

    2016-05-01

    Glycine betaine (betaine) is widely distributed in nature and can be found in many microorganisms, including bacteria, archaea, and fungi. Due to its particular functions, many microorganisms utilize betaine as a functional chemical and have evolved different metabolic pathways for the biosynthesis and catabolism of betaine. As in animals and plants, the principle role of betaine is to protect microbial cells against drought, osmotic stress, and temperature stress. In addition, the role of betaine in methyl group metabolism has been observed in a variety of microorganisms. Recent studies have shown that betaine supplementation can improve the performance of microbial strains used for the fermentation of lactate, ethanol, lysine, pyruvate, and vitamin B12, during which betaine can act as stress protectant or methyl donor for the biosynthesis of structurally complex compounds. In this review, we summarize the transport, synthesis, catabolism, and functions of betaine in microorganisms and discuss potential engineering strategies that employ betaine as a methyl donor for the biosynthesis of complex secondary metabolites such as a variety of vitamins, coenzymes, and antibiotics. In conclusion, the biocompatibility, C/N ratio, abundance, and comprehensive metabolic information of betaine collectively indicate that this molecule has great potential for broad applications in microbial biotechnology. PMID:27005411

  10. The betaine/GABA transporter and betaine: roles in brain, kidney and liver

    Directory of Open Access Journals (Sweden)

    Stephen A Kempson

    2014-04-01

    Full Text Available The physiological roles of the betaine/GABA transporter (BGT1; slc6a12 are still being debated. BGT1 is a member of the solute carrier family 6 (the neurotransmitter, sodium symporter transporter family and mediates cellular uptake of betaine and GABA in a sodium- and chloride- dependent process. Most of the studies of BGT1 concern its function and regulation in the kidney medulla where its role is best understood. The conditions here are hostile due to hyperosmolarity and significant concentrations of NH4Cl and urea. To withstand the hyperosmolarity, cells trigger osmotic adaptation, involving concentration of a transcriptional factor TonEBP/NFAT5 in the nucleus, and accumulate betaine and other osmolytes. Data from renal cells in culture, primarily MDCK, revealed that transcriptional regulation of BGT1 by TonEBP/NFAT5 is relatively slow. To allow more acute control of the abundance of BGT1 protein in the plasma membrane, there is also post-translation regulation of BGT1 protein trafficking which is dependent on intracellular calcium and ATP. Further, betaine may be important in liver metabolism as a methyl donor. In fact, in the mouse the liver is the organ with the highest content of BGT1. Hepatocytes express high levels of both BGT1 and the only enzyme that can metabolize betaine, namely betaine:homocysteine –S-methyltransferase (BHMT1. The BHMT1 enzyme removes a methyl group from betaine and transfers it to homocysteine, a potential risk factor for cardiovascular disease. Finally, BGT1 has been proposed to play a role in controlling brain excitability and thereby represents a target for anticonvulsive drug development. The latter hypothesis is controversial due to very low expression levels of BGT1 relative to other GABA transporters in brain, and also the primary location of BGT1 at the surface of the brain in the leptomeninges. These issues are discussed in detail.

  11. Osmoprotectants in Halomonas elongata: High-affinity betaine transport system and choline-betaine pathway

    OpenAIRE

    Nieto Gutiérrez, Joaquín José; Cánovas, David; Vargas, C.; Ventosa Ucero, Antonio; Csonka, Laszlo N.

    1996-01-01

    The osmoregulatory pathways of the moderately halophilic bacterium Halomonas elongata DSM 3043 have been investigated. This strain grew optimally at 1.5 to 2 M NaCl in M63 glucose-defined medium. It required at least 0.5 M NaCl for growth, which is a higher concentration than that exhibited by the H. elongata type strain ATCC 33173. Externally provided betaine, choline, or choline-O-sulfate (but not proline, ectoine, or proline betaine) enhanced the growth of H. elongata on 3 M NaCl-glucose-M...

  12. The betaine content of sweat from adolescent females

    Directory of Open Access Journals (Sweden)

    Greg Horrace

    2010-01-01

    Full Text Available Abstract Background This study was developed to establish whether betaine was present in the sweat of females and to determine any correlations with other sweat components. Methods Sweat patches were placed on eight trained adolescent Highland dancers (age = 13.6 ± 2.3 yr, who then participated in a dance class for 2 hours. Patches were removed, and the sweat recovered via centrifugation. The sweat was subsequently analyzed for betaine, choline, sodium, potassium, chloride, lactate, glucose, urea and ammonia. Results Betaine was present in the sweat of all subjects (232 ± 84 μmol·L-1, which is higher than typically found in plasma. The concentration of several sweat components were correlated, in particular betaine with most other measured components. Conclusion Betaine, an osmoprotectant and methyl donor, is a component of sweat that may be lost from the body in significant amounts.

  13. Betaine is a positive regulator of mitochondrial respiration

    International Nuclear Information System (INIS)

    Highlights: • Betaine enhances cytochrome c oxidase activity and mitochondrial respiration. • Betaine increases mitochondrial membrane potential and cellular energy levels. • Betaine’s anti-tumorigenic effect might be due to a reversal of the Warburg effect. - Abstract: Betaine protects cells from environmental stress and serves as a methyl donor in several biochemical pathways. It reduces cardiovascular disease risk and protects liver cells from alcoholic liver damage and nonalcoholic steatohepatitis. Its pretreatment can rescue cells exposed to toxins such as rotenone, chloroform, and LiCl. Furthermore, it has been suggested that betaine can suppress cancer cell growth in vivo and in vitro. Mitochondrial electron transport chain (ETC) complexes generate the mitochondrial membrane potential, which is essential to produce cellular energy, ATP. Reduced mitochondrial respiration and energy status have been found in many human pathological conditions including aging, cancer, and neurodegenerative disease. In this study we investigated whether betaine directly targets mitochondria. We show that betaine treatment leads to an upregulation of mitochondrial respiration and cytochrome c oxidase activity in H2.35 cells, the proposed rate limiting enzyme of ETC in vivo. Following treatment, the mitochondrial membrane potential was increased and cellular energy levels were elevated. We propose that the anti-proliferative effects of betaine on cancer cells might be due to enhanced mitochondrial function contributing to a reversal of the Warburg effect

  14. Betaine fermentation and oxidation by marine desulfuromonas strains.

    Science.gov (United States)

    Heijthuijsen, J H; Hansen, T A

    1989-04-01

    Two bacterial strains were dominant in anaerobic enrichment cultures with betaine (N,N,N-trimethylglycine) as a substrate and intertidal mud as an inoculum. One was a coccoid bacterium which was a trimethylamine (TMA)-fermenting methanogen similar to Methanococcoides methylutens. The other strain, a rod-shaped, gram-negative, motile bacterium, fermented betaine. On the basis of its ability to oxidize acetate and ethanol to CO(2) with sulfur as an electron acceptor, its inability to reduce sulfate and sulfite, its morphology, the presence of c-type cytochromes, and other characteristics, the isolated strain PM1 was identified as Desulfuromonas acetoxidans. Although only malate and fumarate were known as substrates for fermentative growth of this species, the type strain (DSM 684) also fermented betaine. Strain PM1 grew with a doubling time of 9.5 h at 30 degrees C on betaine and produced approximately 1 mol of TMA per mol of betaine, 0.75 mol of acetate, and presumably CO(2) as fermentation products but only in the presence of selenite (100 nM). In this fermentation, betaine is probably reductively cleaved to TMA and acetate, and part of the acetate is then oxidized to CO(2) to provide the reducing equivalents for the initial cleavage reaction. In the presence of sulfur, betaine was converted to TMA and presumably CO(2) with the formation of sulfide; then, only traces of acetate were produced. PMID:16347897

  15. Glycine betaine as a direct substrate for methanogens (Methanococcoides spp.).

    Science.gov (United States)

    Watkins, Andrew J; Roussel, Erwan G; Parkes, R John; Sass, Henrik

    2014-01-01

    Nine marine methanogenic Methanococcoides strains, including the type strains of Methanococcoides methylutens, M. burtonii, and M. alaskense, were tested for the utilization of N-methylated glycines. Three strains (NM1, PM2, and MKM1) used glycine betaine (N,N,N-trimethylglycine) as a substrate for methanogenesis, partially demethylating it to N,N-dimethylglycine, whereas none of the strains used N,N-dimethylglycine or sarcosine (N-methylglycine). Growth rates and growth yields per mole of substrate with glycine betaine (3.96 g [dry weight] per mol) were similar to those with trimethylamine (4.11 g [dry weight] per mol). However, as glycine betaine is only partially demethylated, the yield per methyl group was significantly higher than with trimethylamine. If glycine betaine and trimethylamine are provided together, trimethylamine is demethylated to dimethyl- and methylamine with limited glycine betaine utilization. After trimethylamine is depleted, dimethylamine and glycine betaine are consumed rapidly, before methylamine. Glycine betaine extends the range of substrates that can be directly utilized by some methanogens, allowing them to gain energy from the substrate without the need for syntrophic partners. PMID:24162571

  16. Betaine is a positive regulator of mitochondrial respiration

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Icksoo, E-mail: icksoolee@dankook.ac.kr

    2015-01-09

    Highlights: • Betaine enhances cytochrome c oxidase activity and mitochondrial respiration. • Betaine increases mitochondrial membrane potential and cellular energy levels. • Betaine’s anti-tumorigenic effect might be due to a reversal of the Warburg effect. - Abstract: Betaine protects cells from environmental stress and serves as a methyl donor in several biochemical pathways. It reduces cardiovascular disease risk and protects liver cells from alcoholic liver damage and nonalcoholic steatohepatitis. Its pretreatment can rescue cells exposed to toxins such as rotenone, chloroform, and LiCl. Furthermore, it has been suggested that betaine can suppress cancer cell growth in vivo and in vitro. Mitochondrial electron transport chain (ETC) complexes generate the mitochondrial membrane potential, which is essential to produce cellular energy, ATP. Reduced mitochondrial respiration and energy status have been found in many human pathological conditions including aging, cancer, and neurodegenerative disease. In this study we investigated whether betaine directly targets mitochondria. We show that betaine treatment leads to an upregulation of mitochondrial respiration and cytochrome c oxidase activity in H2.35 cells, the proposed rate limiting enzyme of ETC in vivo. Following treatment, the mitochondrial membrane potential was increased and cellular energy levels were elevated. We propose that the anti-proliferative effects of betaine on cancer cells might be due to enhanced mitochondrial function contributing to a reversal of the Warburg effect.

  17. Antiferroelectric films of deuterated betaine phosphate

    Science.gov (United States)

    Balashova, E. V.; Krichevtsov, B. B.; Svinarev, F. B.; Zaitseva, N. V.

    2016-07-01

    Thin films of partially deuterated betaine phosphate have been grown by the evaporation on Al2O3(110) and NdGaO3(001) substrates with a preliminarily deposited structure of interdigitated electrodes. The grown films have a polycrystalline block structure with characteristic dimensions of blocks of the order of 0.1-1.5 mm. The degree of deuteration of the films D varies in the range of 20-50%. It has been found that, at the antiferroelectric phase transition temperature T c afe = 100-114 K, the fabricated structures exhibit an anomaly of the electrical capacitance C, which is not accompanied by a change in the dielectric loss tangent tanδ. The strong-signal dielectric response is characterized by the appearance of a ferroelectric nonlinearity at temperatures T > T c afe , which is transformed into an antiferroelectric nonlinearity at T diagram has been constructed.

  18. Glycine betaine confers enhanced osmotolerance and cryotolerance on Listeria monocytogenes.

    OpenAIRE

    Ko, R; Smith, L T; Smith, G.M

    1994-01-01

    Listeria monocytogenes is a gram-positive food-borne pathogen that is notably resistant to osmotic stress and can grow at refrigerator temperatures. These two characteristics make it an insidious threat to public health. Like several other organisms, L. monocytogenes accumulates glycine betaine, a ubiquitous and effective osmolyte, intracellularly when grown under osmotic stress. However, it also accumulates glycine betaine when grown under chill stress at refrigerator temperatures. Exogenous...

  19. Betaine Fermentation and Oxidation by Marine Desulfuromonas Strains

    OpenAIRE

    Heijthuijsen, J. H. F. G.; Hansen, T. A.

    1989-01-01

    Two bacterial strains were dominant in anaerobic enrichment cultures with betaine (N,N,N-trimethylglycine) as a substrate and intertidal mud as an inoculum. One was a coccoid bacterium which was a trimethylamine (TMA)-fermenting methanogen similar to Methanococcoides methylutens. The other strain, a rod-shaped, gram-negative, motile bacterium, fermented betaine. On the basis of its ability to oxidize acetate and ethanol to CO2 with sulfur as an electron acceptor, its inability to reduce sulfa...

  20. Orally administered betaine has an acute and dose-dependent effect on serum betaine and plasma homocysteine concentrations in healthy humans.

    Science.gov (United States)

    Schwab, Ursula; Törrönen, Anneli; Meririnne, Esa; Saarinen, Markku; Alfthan, Georg; Aro, Antti; Uusitupa, Matti

    2006-01-01

    Betaine, i.e., trimethylglycine, is linked to homocysteine metabolism. A 3-mo daily betaine supplementation decreased even normal plasma total homocysteine (tHcy) concentrations in humans. The pharmacokinetic characteristics and metabolism of betaine in humans have not been investigated in detail. The aim of this study was to assess the pharmacokinetics of orally administered betaine and its acute effect on plasma tHcy concentrations. Healthy volunteers (n = 10; 3 men, 7 women) with normal body weight (mean +/- SD, 69.5 +/- 17.0 kg), 40.8 +/- 12.4 y old, participated in the study. The betaine doses were 1, 3, and 6 g. The doses were mixed with 150 mL of orange juice and ingested after a 12-h overnight fast by each volunteer according to a randomized double-blind crossover design. Blood samples were drawn for 24 h and a 24-h urine collection was performed. Orally administered betaine had an immediate and dose-dependent effect on serum betaine concentration. Single doses of 3 and 6 g lowered plasma tHcy concentrations (P = 0.019 and P < 0.001, respectively), unlike the 1-g dose. After the highest dose, the concentrations remained low during the 24 h of monitoring. The change in plasma tHcy concentration was linearly associated with betaine dose (P = 0.006) and serum betaine concentration (R2 = 0.17, P = 0.025). The absorption and elimination of betaine were dose dependent. The urinary excretion of betaine seemed to increase with an increasing betaine dose, although a very small proportion of ingested betaine was excreted via urine. In conclusion, a single dose of orally administered betaine had an acute and dose-dependent effect on serum betaine concentration and resulted in lowered plasma tHcy concentrations within 2 h in healthy subjects. PMID:16365055

  1. Methane formation from betaine with trimethylamine as intermediary. Methanbildung aus Betain ueber Trimethylamin als Zwischenprodukt

    Energy Technology Data Exchange (ETDEWEB)

    Naumann, E.

    1983-07-01

    A defined mixed culture of C-sporogenes and Methanoscarina barkeri of the Fusaro strain converted betaine into methane as the main fermentation product in the presence of an equal amount of L-alanine. Methane formation took place in two clearly distinct phases. In the first phase, the substrate mixture was completely converted by C. sporogenes, while the total trimethylamine plus 15.5% of the expected acetate was converted by M. barkeri, Fusaro strain. In the second phase, methane was formed exclusively from the remaining acetate. There was no syntrophic association between the two organisms.

  2. Ferrocenylmethylation reactions with a phosphinoferrocene betaine.

    Science.gov (United States)

    Zábranský, Martin; Císařová, Ivana; Štěpnička, Petr

    2015-08-28

    A phosphinoferrocene betaine, N-{[1'-(diphenylphosphino)ferrocenyl]methyl}-N,N-dimethyl-3-sulfo-1-propanaminium, inner salt, Ph2PfcCH2NMe2(CH2)3SO3 (; fc = ferrocene-1,1'-diyl), was prepared by alkylation of Ph2PfcCH2NMe2 () with 1,3-propanesultone, and was studied as a ferrocenylmethylation agent. The treatment of with NaOH in hot water-dimethyl sulfoxide produced phosphinoalcohol Ph2PfcCH2OH () in a 64% yield, whereas a similar reaction with MeONa in dimethylsulfoxide-methanol furnished the corresponding ether, Ph2PfcCH2OMe (), in a 47% yield. In subsequent experiments, betaine was employed in the synthesis of phosphinoferrocene sulfones, Ph2PfcCH2SO2R, where R = Me (), Ph (), and 4-tolyl (). Compounds and some by-products of the ferrocenylmethylation reactions, namely alcohol , 1'-(diphenylphosphino)-1-methylferrocene (), and 1-{[diphenyl(2,4-cyclopentadien-1-ylidene)phosphoranyl]methyl}-1'-(diphenylphosphino)ferrocene () structurally characterised. Reactions of as the representative with ZnX2/NaX (X = Br and I) afforded unique coordination polymers [ZnNaX3()(CH3OH)]n featuring tetrahedral Zn(ii) and octahedral Na(i) centres bridged by halide ions, solvating methanol and the sulfone ligands. The reaction of with ZnBr2/KBr produced an analogous product, [ZnKBr3()(CH3OH)]n, while that with ZnBr2/LiBr furnished a different, pseudodimeric complex [Zn2Li2Br6()2(CH3OH)4(H2O)]·CH3OH, featuring tetrahedrally coordinated Zn(ii) and Li(i) centres bridged by . Reactions of with ZnBr2/MBr (M = Rb, Cs) and NaCl/ZnCl2 did not yield similar products because of an easy precipitation (low solubility) of the respective alkali metal halides. PMID:26205555

  3. Identification of an ATP-Driven, Osmoregulated Glycine Betaine Transport System in Listeria monocytogenes

    OpenAIRE

    Ko, Rinkei; Smith, Linda Tombras

    1999-01-01

    The ability of the gram-positive, food-borne pathogen Listeria monocytogenes to tolerate environments of elevated osmolarity and reduced temperature is due in part to the transport and accumulation of the osmolyte glycine betaine. Previously we showed that glycine betaine transport was the result of Na+-glycine betaine symport. In this report, we identify a second glycine betaine transporter from L. monocytogenes which is osmotically activated but does not require a high concentration of Na+ ...

  4. Salmonella typhimurium proP gene encodes a transport system for the osmoprotectant betaine.

    OpenAIRE

    Cairney, J; Booth, I R; Higgins, C F

    1985-01-01

    Betaine (N,N,N-trimethylglycine) can be accumulated to high intracellular concentrations and serves an important osmoprotective function in enteric bacteria. We found that the proP gene of Salmonella typhimurium, originally identified as encoding a minor transport system for proline (permease PP-II), plays an important role in betaine uptake. Mutations in proP reduced the ability of betaine to serve as an osmoprotectant. Transport of betaine into the cells was also severely impaired in these ...

  5. Betaine synthesis from radioactive precursors in attached, water-stressed barley leaves

    International Nuclear Information System (INIS)

    In wilted barley leaves, betaine accumulates at about 200 nanomoles per 10 centimeters leaf per day. Results with 14C-labeled precursors were qualitatively and quantitatively consistent with de novo synthesis of this betaine from serine via ethanolamine, choline, and betaine aldehyde and indicated that water stress may increase the activities of all steps in this pathway except the last. Doses (I micromole) of each 14C-labeled precursor were supplied as droplets to the tips of attached, 10-centimeter, second-leaf blades of turgid and wilted plants, and the incorporation of 14C into betaine was followed. From the rates of betaine labeling, estimates were made of the potential capacities (nanomoles per 10 centimeters leaf per day) for the methylation and oxidation steps. Labeling of betaine from absolute value 14C choline, absolute value 14C ethanolamine, and absolute value 14C serine was about 7- to 10-fold greater in leaves wilted for 2 days than in turgid leaves, whereas label from absolute value 14C betaine aldehyde appeared in betaine at about the same rate in both turgid and wilted leaves. In leaves wilted for 2 days, the potential capacities for converting absolute value 14C ethanolamine, absolute value 14C choline, and absolute value 14C betaine aldehyde to betaine all approached or exceeded the rate of betain accumulation (about 200 nanomoles per 10 centimeters leaf per day); in turgid leaves, only the potential for converting betaine aldehyde to betaine exceeded this rate. The rate of conversion of absolute value 14C ethanolamine to betaine increased 4-fold after 6 to 10 hours of wilting, which was soon enough to account for the onset of betaine accumulation

  6. Betaine and beet molasses enhance L-lactic acid production by Bacillus coagulans.

    Directory of Open Access Journals (Sweden)

    Ke Xu

    Full Text Available Lactic acid is an important chemical with various industrial applications, and it can be efficiently produced by fermentation, in which Bacillus coagulans strains present excellent performance. Betaine can promote lactic acid fermentation as an effective osmoprotectant. Here, positive effect of betaine on fermentation by B. coagulans is revealed. Betaine could enhance lactic acid production by protecting l-LDH activity and cell growth from osmotic inhibition, especially under high glucose concentrations and with poor organic nitrogen nutrients. The fermentation with 0.05 g/L betaine could produce 17.9% more lactic acid compared to the fermentation without betaine. Beet molasses, which is rich in sucrose and betaine, was utilized in a co-feeding fermentation and raised the productivity by 22%. The efficient lactic acid fermentation by B. coagulans is thus developed by using betaine and beet molasses.

  7. Effects of betaine on lipopolysaccharide-induced memory impairment in mice and the involvement of GABA transporter 2

    OpenAIRE

    Miwa Masaya; Tsuboi Mizuki; Noguchi Yumiko; Enokishima Aoi; Nabeshima Toshitaka; Hiramatsu Masayuki

    2011-01-01

    Abstract Background Betaine (glycine betaine or trimethylglycine) plays important roles as an osmolyte and a methyl donor in animals. While betaine is reported to suppress expression of proinflammatory molecules and reduce oxidative stress in aged rat kidney, the effects of betaine on the central nervous system are not well known. In this study, we investigated the effects of betaine on lipopolysaccharide (LPS)-induced memory impairment and on mRNA expression levels of proinflammatory molecul...

  8. Investigation of a betainic alkaloid from Punica granatum.

    Science.gov (United States)

    Schmidt, Andreas; Mordhorst, Thorsten; Nieger, Martin

    2005-07-01

    Spectroscopic investigations reveal that a hydroquinone pyridinium alkaloid isolated from the leaves of pomegranates Punica granatum L. (X-ray) exists as a mixture of a conjugated and a cross-conjugated heterocyclic mesomeric betaine in aqueous and DMSO-d6 solution. Twofold deprotonation yields an anionic tripole. PMID:15938201

  9. Betaine-containing toothpaste relieves subjective symptoms of dry mouth.

    Science.gov (United States)

    Söderling, E; Le Bell, A; Kirstilä, V; Tenovuo, J

    1998-04-01

    Subjects with dry mouth often experience irritation of the oral mucosa when using sodium lauryl sulfate containing products for oral hygiene. Betaine, or trimethylglycine, reduces skin-irritating effects of ingredients of cosmetics such as sodium lauryl sulfate. The aim of the present study was to compare the effects of a betaine-containing toothpaste with a regular toothpaste on the oral microbial flora, the condition of the oral mucosa, and subjective symptoms of dry mouth in subjects with chronic dry mouth symptoms. Thirteen subjects with chronic dry mouth symptoms and with a paraffin-stimulated salivary flow rate < or = 1 mL/min participated in the double-blind crossover study. Ten subjects had a very low salivary flow rate (< or = 0.6 mL/min). The subjects used both experimental toothpastes (with or without 4% betaine) twice a day for 2 weeks. Oral examinations and microbiologic sample collections were made at the base lines preceding the two experimental periods and at the end. Standardized questions on subjective symptoms of dry mouth were used when the subjects were interviewed at the end of the two experimental periods. No study-induced significant changes were observed in the microbiologic variables (plaque index, mutans streptococci, lactobacilli, Candida species) or in the appearance of the oral mucosa. The use of the betaine-containing toothpaste was, however, associated with a significant relief of several subjective symptoms of dry mouth. Betaine appears thus to be a promising ingredient of toothpastes in general and especially of toothpastes designed for patients with dry mouth. PMID:9669455

  10. Betaine and Beet Molasses Enhance L-Lactic Acid Production by Bacillus coagulans

    OpenAIRE

    Ke Xu; Ping Xu

    2014-01-01

    Lactic acid is an important chemical with various industrial applications, and it can be efficiently produced by fermentation, in which Bacillus coagulans strains present excellent performance. Betaine can promote lactic acid fermentation as an effective osmoprotectant. Here, positive effect of betaine on fermentation by B. coagulans is revealed. Betaine could enhance lactic acid production by protecting l-LDH activity and cell growth from osmotic inhibition, especially under high glucose con...

  11. Effects of betaine intake on plasma homocysteine concentrations and consequences for health.

    Science.gov (United States)

    Olthof, M R; Verhoef, P

    2005-02-01

    High plasma concentrations of homocysteine may increase risk of cardiovascular disease. Folic acid lowers plasma homocysteine by 25% maximally, because 5-methyltetrahydrofolate is a methyl donor in the remethylation of homocysteine to methionine. Betaine (trimethylglycine) is also a methyl donor in homocysteine remethylation, but effects on homocysteine have been less thoroughly investigated. Betaine in high doses (6 g/d and higher) is used as homocysteine-lowering therapy for people with hyperhomocysteinemia due to inborn errors in the homocysteine metabolism. Betaine intake from foods is estimated at 0.5-2 g/d. Betaine can also be synthesized endogenously from its precursor choline. Studies in healthy volunteers with plasma homocysteine concentrations in the normal range show that betaine supplementation lowers plasma fasting homocysteine dose-dependently to up to 20% for a dose of 6 g/d of betaine. Moreover, betaine acutely reduces the increase in homocysteine after methionine loading by up to 50%, whereas folic acid has no effect. Betaine doses in the range of dietary intake also lower homocysteine. This implies that betaine can be an important food component that attenuates homocysteine rises after meals. If homocysteine plays a causal role in the development of cardiovascular disease, a diet rich in betaine or choline might benefit cardiovascular health through its homocysteine-lowering effects. However betaine and choline may adversely affect serum lipid concentrations, which can of course increase risk of cardiovascular disease. However, whether the potential beneficial health effects of betaine and choline outweigh the possible adverse effects on serum lipids is as yet unclear. PMID:15720203

  12. Hydration and vibrational dynamics of betaine (N,N,N-trimethylglycine)

    OpenAIRE

    Li, Tanping; Cui, Yaowen; Mathaga, John; Kumar, Revati; Kuroda, Daniel G.

    2015-01-01

    Zwitterions are naturally occurring molecules that have a positive and a negative charge group in its structure and are of great importance in many areas of science. Here, the vibrational and hydration dynamics of the zwitterionic system betaine (N,N,N-trimethylglycine) is reported. The linear infrared spectrum of aqueous betaine exhibits an asymmetric band in the 1550-1700 cm−1 region of the spectrum. This band is attributed to the carboxylate asymmetric stretch of betaine. The potential of ...

  13. Dissociation of gaseous zwitterion glycine-betaine by slow electrons.

    Science.gov (United States)

    Kopyra, J; Abdoul-Carime, H

    2010-05-28

    In this work, we investigate dissociation processes induced by low-energy electrons to gas phase N,N,N-trimethylglycine [glycine-betaine, (CH(3))(3)N(+)CH(2)COO(-)] molecules. Glycine-betaine represents a model system for zwitterions. All negative fragments are observed to be produced only at subelectronic excitation energies (<4 eV). With the exception of the loss of a neutral H atom that could arise from any C[Single Bond]H bond breaking, we tentatively suggest that the zwitterion dissociates exclusively from the fragmentation of the cation site of the molecule, subsequent to the attachment of the excess electron. Within the context of radiation induced damage to biological systems, the present findings contribute to a more complete description of the fragmentation mechanism occurring to amino acids, peptides, and proteins since they adopt usually a zwitterion structure. PMID:20515090

  14. Betaine conjugated cationic pullulan as effective gene carrier.

    Science.gov (United States)

    Ambattu, Lizebona August; Rekha, M R

    2015-01-01

    Polyethyleneimne (PEI) is a very efficient transfecting agent but is toxic due to high charge density. To generate a vector which is efficient and less cytotoxic, PEI was conjugated with pullulan (PPEI). Further conjugation was done on PPEI with zwitter ionic betaine which possess antifouling property. PEI of molecular weight 1.2, 2, and 10 kDa were used in the study. Buffering capacity of pullulan-PEI-betaine (PPB) conjugates was found to be sufficient enough for the polymers to make endosomal escape. The polymers proved to be less cytotoxic and highly hemocompatible than PEI. Nuclear localization of YOYO tagged DNA was observed with the nanoplexes developed using PPEI and PPBs of PEI 10 kDa. Transfection efficiency was evaluated using p53 expressing gene and the live dead assay demonstrated very high transfection efficiency with PPB conjugates of PEI 10 kDa. PMID:25304750

  15. Motional narrowing of broadband absorption of solvatochromic indicator Betaine 30

    Energy Technology Data Exchange (ETDEWEB)

    Renge, Indrek [Institute of Physics, University of Tartu, Riia Street 142, EE51014 Tartu (Estonia)], E-mail: indrek.renge@ut.ee

    2009-05-15

    Temperature dependence of the absorption spectra of Betaine 30 (2,6-diphenyl-4-(2,4,6-triphenylpyridinio)-phenolate, widely known as Reichardt's dye) is compared with that of the broadband spectra of other dyes. The double value of the half-width (2 hwhm) of Betaine 30 absorption band between 10 and 293 K in a polymer decreases by 130{+-}20 cm{sup -1}, from 4220 to 4090 cm{sup -1}. This unprecedented narrowing with increasing temperature is ascribed to hydrogen bond symmetrization due to thermally activated proton tunneling in a pigment-solvent complex. The averaging of charge distribution along the proton coordinate causes motional narrowing of inhomogeneous width.

  16. Insights from Theory and Experiment on the Photochromic spiro-Dihydropyrrolo-Pyridazine/Betaine System.

    Science.gov (United States)

    Fernando, Amendra; Shrestha, Tej B; Liu, Yao; Malalasekera, Aruni P; Yu, Jing; McLaurin, Emily J; Turro, Claudia; Bossmann, Stefan H; Aikens, Christine M

    2016-02-18

    We elucidated the photochromic spiro-4a,5-dihydropyrrolo[1,2-b]pyridazine/betaine (DPP/betaine) system by comparing state-of-the-art density functional theory calculations with nanosecond/millisecond UV-vis absorption spectroscopy, as well as steady-state absorption and cyclization kinetics. Time-dependent density functional theory calculations are employed to examine the transformations occurring after photoexcitation. This study shows that the photochromic spiro-4a,5-dihydropyrrolo[1,2-b]pyridazine and spiro-1,8a-dihydroindolizine (DHI) systems react according to similar pathways. However, notable differences exist. Although photoexcitation of the spiro-DPP system also leads to cis-betaines, which then isomerize to trans-betaines, we found two distinct classes of cis isomers (cis-betaine rotamer-1 and cis-betaine rotamer-2), which do not exist in spiro-1,8a-dihydroindolizine. Similar to our previous study on the spiro-DHI/betaine system, a complicated potential-energy landscape between cis and trans isomers exists in the spiro-DPP system, consisting of a network of transition states and intermediates. Because the spiro-DPP/betaine is even more complicated than the spiro-DHI/betaine system, (substituted) photochromic systems featuring a 4a,5-dihydropyrrolo[1,2-b]pyridazine functional unit will require thorough in silico design to function properly as logical gates or in devices for information storage. PMID:26812493

  17. Betaine enhances antidepressant-like, but blocks psychotomimetic effects of ketamine in mice.

    Science.gov (United States)

    Lin, Jen-Cheng; Lee, Mei-Yi; Chan, Ming-Huan; Chen, Yi-Chyan; Chen, Hwei-Hsien

    2016-09-01

    Ketamine is emerging as a new hope against depression, but ketamine-associated psychotomimetic effects limit its clinical use. An adjunct therapy along with ketamine to alleviate its adverse effects and even potentiate the antidepressant effects might be an alternative strategy. Betaine, a methyl derivative of glycine and a dietary supplement, has been shown to have antidepressant-like effects and to act like a partial agonist at the glycine site of N-methyl-D-aspartate receptors (NMDARs). Accordingly, betaine might have potential to be an adjunct to ketamine treatment for depression. The antidepressant-like effects of ketamine and betaine were evaluated by forced swimming test and novelty suppressed feeding test in mice. Both betaine and ketamine produced antidepressant-like effects. Furthermore, we determined the effects of betaine on ketamine-induced antidepressant-like and psychotomimetic behaviors, motor incoordination, hyperlocomotor activity, and anesthesia. The antidepressant-like responses to betaine combined with ketamine were stronger than their individual effects. In contrast, ketamine-induced impairments in prepulse inhibition, novel object recognition test, social interaction, and rotarod test were remarkably attenuated, whereas ketamine-induced hyperlocomotion and loss of righting reflex were not affected by betaine. These findings revealed that betaine could enhance the antidepressant-like effects, yet block the psychotomimetic effects of ketamine, suggesting that betaine can be considered as an add-on therapy to ketamine for treatment-resistant depression and suitable for the treatment of depressive symptoms in patients with schizophrenia. PMID:27363702

  18. Glycine Betaine as a Direct Substrate for Methanogens (Methanococcoides spp.)

    OpenAIRE

    Watkins, Andrew J.; Roussel, Erwan; Parkes, R. John; Sass, Henrik

    2014-01-01

    International audience Nine marine methanogenic Methanococcoides strains, including the type strains of Methanococcoides methylutens, M. burtonii, and M. alaskense, were tested for the utilization of N-methylated glycines. Three strains (NM1, PM2, and MKM1) used glycine betaine (N,N,N-trimethylglycine) as a substrate for methanogenesis, partially demethylating it to N,N-dimethylglycine, whereas none of the strains used N,N-dimethylglycine or sarcosine (N-methylglycine). Growth rates and gr...

  19. Betaine-homocysteine methyltransferase: human liver genotype-phenotype correlation

    OpenAIRE

    Feng, Qiping; Kalari, Krishna; Fridley, Brooke L.; Jenkins, Gregory; Ji, Yuan; Abo, Ryan; Hebbring, Scott; Zhang, Jianping; Nye, Monica D.; Leeder, J Steven; Weinshilboum, Richard M.

    2010-01-01

    Betaine-homocysteine methyltransferase (BHMT) catalyzes the remethylation of homocysteine. BHMT is highly expressed in the human liver. In the liver, BHMT catalyzes up to 50% of homocysteine metabolism. Understanding the relationship between BHMT genetic polymorphisms and function might increase our understanding of the role of this reaction in homocysteine remethylation and in S-adenosylmethionine-dependent methylation. To help achieve those goals, we measured levels of BHMT enzyme activity ...

  20. Mesomeric betaine chemistry in solution: Solvent effect on the structure and spectra of uracilyl-pyridinium betaine

    Energy Technology Data Exchange (ETDEWEB)

    Schmidt, A., E-mail: schmidt@ioc.tu-clausthal.de [Institute of Organic Chemistry, Clausthal University of Technology, Leibnizstrasse 6, D-38678 Clausthal-Zellerfeld (Germany); Lindner, A.S. [Institute of Organic Chemistry, Clausthal University of Technology, Leibnizstrasse 6, D-38678 Clausthal-Zellerfeld (Germany); Casado, J.; Lopez Navarrete, J.T. [Departamento de Quimica Fisica, Facultad de Ciencias, Universidad de Malaga, Malaga 29071 (Spain); Ramirez, F.J., E-mail: ramirez@uma.es [Departamento de Quimica Fisica, Facultad de Ciencias, Universidad de Malaga, Malaga 29071 (Spain)

    2010-05-25

    Graphical abstract: Vibrational Raman, UV-vis and fluorescence spectroscopies, supported by DFT calculations, demonstrate that a polar environment quinoidizes the cationic part and aromatizes the anionic moiety of cross-conjugated mesomeric betaines. - Abstract: The presence of positive and negative delocalized charges in a heterocyclic conjugated system gives rise to an interesting class of molecules known as mesomeric betaines. These can be conveniently represented by dipolar canonical formulae. Among them, cross-conjugation appears when the charges are placed in separated parts of the common {pi}-electron system. This fact makes cross-conjugated mesomeric betaines (CCMB) suitable systems to study intramolecular electron transfer processes. In this paper, we studied Raman and electronic spectra of an uracilyl-pyridinium CCMB in solution. Vibrational results demonstrated that the presence of a polar environment quinoidizes the cationic part and aromatizes the anionic moiety of this molecule, which gave us useful information to propose the more relevant mesomeric structures of this molecule in solution. Raman spectroscopy was able to account for cross-conjugation by characterizing conjugational-sensitive bands. The effect of the solvent polarity was studied by electronic spectroscopy, allowing us to establish spectroscopy-structure relationships.

  1. Characterization of Glycine Betaine Porter I from Listeria monocytogenes and Its Roles in Salt and Chill Tolerance

    OpenAIRE

    Mendum, Mary Lou; Smith, Linda Tombras

    2002-01-01

    Listeria monocytogenes is a pathogenic bacterium that can grow at low temperatures and elevated osmolarity. The organism survives these stresses by the intracellular accumulation of osmolytes: low-molecular-weight organic compounds which exert a counterbalancing force. The primary osmolyte in L. monocytogenes is glycine betaine, which is accumulated from the environment via two transport systems: glycine betaine porter I, an Na+-glycine betaine symporter; and glycine betaine porter II, an ATP...

  2. Betaine as a determinant of postmethionine load total plasma homocysteine before and after B-vitamin supplementation.

    NARCIS (Netherlands)

    Holm, P.I.; Bleie, O.; Ueland, P.M.; Lien, E.A.; Refsum, H.; Nordrehaug, J.E.; Nygard, O.

    2004-01-01

    OBJECTIVE: Betaine is a substrate in the betaine-homocysteine methyltransferase reaction, converting homocysteine to methionine. There are only sparse data on plasma betaine as a determinant of the plasma total homocysteine (tHcy) concentration. METHODS AND RESULTS: Ninety patients undergoing corona

  3. Are dietary choline and betaine intakes determinants of total homocysteine concentration?

    Science.gov (United States)

    Elevated homocysteine concentrations are associated with an increased risk of cardiovascular disease and a decline in cognitive function. Intakes of choline and betaine, as methyl donors, may affect homocysteine concentrations. The objective was to examine whether choline and betaine intakes, assess...

  4. Modulation of Colitis-associated Colon Tumorigenesis by Baicalein and Betaine.

    Science.gov (United States)

    Kim, Dong Hwan; Sung, Bokyung; Chung, Hae Young; Kim, Nam Deuk

    2014-09-01

    In this review, we will summarize the current understanding of modulation of colitis-associated colon tumorigenesis by two natural products, baicalein and betaine, which have anti-inflammatory activities. Baicalein and betaine have been shown to provide various health benefits to organism in many ways. Baicalein is a phenolic flavonoid derived originally from the root of Scutellaria baicalensis Georgi. From ancient times, baicalein has widely been used in oriental medicines as an anti-inflammatory and anti-cancer therapy. Betaine, trimethylglycine, is an essential biochemical molecule of the methionine/homocysteine cycle and is synthesized by conversion of choline. Betaine is an important human nutrient obtained from various foods including sugar beet and lycium. Betaine has provided various health benefits including disease prevention. However, the action mechanisms of their activity remain poorly understood. Recent studies reported the effects of baicalein and betaine on cytotoxicity against colon cancer cells and chemically induced colitis-associated colon tumorigenesis in mice. Administrations of baicalein and betaine containing diets significantly inhibited the incidence of tumors and hyperplasia with down-regulation of inflammation. Therefore, baicalein and betaine might be applicable to the prevention of inflammation-associated colon carcinogenesis. PMID:25337584

  5. An analytical method for the determination of betaine (trimethylglycine) from hair.

    Science.gov (United States)

    Pulliainen, K; Nevalainen, H; Väkeväinen, H; Jutila, K; Gummer, C L

    2010-04-01

    Hair fibres have no active renewable protective mechanisms yet hair (wool and fur) provides an essential protective function. Therefore, it is possible that hair contains a number of internal components to maintain fibre and protein structure and function through a range of normal environmental conditions. Trimethylglycine (betaine) provides cellular and protein protection during times of high osmotic stress and low water concentrations. These conditions are very pertinent to everyday cosmetic procedures such as shampooing, bleach or perming. Therefore, we have conducted preliminary investigations to establish the presence of natural betaine in hair as a possible ingredient to provide protection and maintain protein function. Using an high performance liquid chromatography (HPLC) technique designed for the analysis of betaine in blood and urine, we have demonstrated, via simple hot water extraction, a measurable level of betaine in blood and human hair. Further, we have demonstrated, in principle, the possibility of adding betaine back to the fibre via cosmetic products such as shampoos. PMID:19818084

  6. Alleviation of hepatic fat accumulation by betaine involves reduction of homocysteine via up-regulation of betaine-homocysteine methyltransferase (BHMT).

    Science.gov (United States)

    Ahn, Chul Won; Jun, Doo Sung; Na, Jong Deok; Choi, Yeo Jin; Kim, Young Chul

    2016-08-26

    We investigated the anti-lipogenic effect of betaine in rats fed methionine and choline-deficient diet (MCD). Intake of MCD for 3 wk resulted in a significant accumulation of hepatic lipids, which was prevented by betaine supplementation in drinking water (1%). Phosphorylation of AMP-activated protein kinase (AMPK), acetyl-CoA carboxylase (ACC), sterol regulatory element-binding protein-1c (SREBP-1c), and liver kinase B1 (LKB1) was inhibited by MCD intake, and these changes were all inhibited by betaine feeding. Meanwhile, betaine supplementation reversed the reduction of methionine and S-adenosylmethionine (SAM), and the elevation of homocysteine levels in the liver, which could be attributable to the induction of betaine-homocysteine methyltransferase (BHMT) and methionine adenosyltransferase (MAT). Different cell lines were used to clarify the role of homocysteine on activation of the AMPK pathway. Homocysteine treatment decreased pAMPK, pACC, pSREBP-1c and pLKB1 in HepG2 cells. Metformin-induced activation of AMPK was also inhibited by homocysteine. Treatment with hydroxylamine, a cystathionine β-synthase inhibitor, resulted in a reduction of pAMPK, pACC and pSREBP-1c, accompanied by an elevation of intracellular homocysteine. Betaine treatment prevented the homocysteine-induced reduction of pAMPK, pACC, pSREBP-1c and pLKB1 in H4IIE cells, but not in HepG2 cells. Also the elevation of cellular homocysteine and inhibition of protein expression of BHMT were prevented by betaine only in H4IIE cells which express BHMT. The results suggest that the beneficial effect of betaine against hepatic lipid accumulation may be attributed, at least in part, to the depletion of homocysteine via up-regulation of BHMT in hepatocytes. PMID:27320863

  7. Synthesis and characterization of hydrophobically modified polymeric betaines

    Directory of Open Access Journals (Sweden)

    Alexey Shakhvorostov

    2015-09-01

    Full Text Available Polymeric betaines containing long alkyl chains C12H25, C14H29, C16H33 and C18H37 were synthesized by Michael addition reaction of alkylaminocrotonates and methacrylic acid (MAA. They were characterized by FTIR, 13C NMR, DSC, DLS, GPC, cryo-TEM, viscometry and zeta-potential measurements. The polymers were fully soluble in DMF, THF and DMSO, partially dissolved in aromatic hydrocarbons (benzene, toluene, o-xylene and formed colloid solutions in aqueous KOH. In aqueous KOH and DMSO solutions, hydrophobically modified polymeric betaines behaved as polyelectrolytes. The average hydrodynamic size and zeta potential of diluted aqueous solutions of hydrophobic polybetainess containing dodecyl-, tetradecyl-, hexadecyl-, and octadecyl groups were studied as a function of pH. Anomalous low values of the isoelectric point (IEP of amphoteric macromolecules were found to be in the range of pH 2.7-3.4. According to DLS data, the average size of macromolecules tends to decrease with dilution. Zeta-potential of amphoteric macromolecules in aqueous solution is much higher than that in DMSO. The cryo-TEM results revealed that in both aqueous KOH and DMSO media, the micron- and nanosized vesicles existed. The structural organization of vesicles in water and DMSO is discussed. The wax inhibition effect of hydrophobic polybetaines at a decrease of the pour point temperatures of high paraffinic oils was better in comparison with commercial available ethylene-vinylacetate copolymers (EVA.

  8. 1H NMR determination of urinary betaine in patients with premature vascular disease and mild homocysteinemia.

    Science.gov (United States)

    Lundberg, P; Dudman, N P; Kuchel, P W; Wilcken, D E

    1995-02-01

    Urinary N,N,N-trimethylglycine (betaine) and N,N-dimethylglycine (DMG) have been identified and quantified for clinical purposes by proton nuclear magnetic resonance (1H NMR) measurement in previous studies. We have assessed these procedures by using both one-dimensional (1-D) and 2-D NMR spectroscopy, together with pH titration of urinary extracts to help assign 1H NMR spectral peaks. The betaine calibration curve linearity was excellent (r = 0.997, P = 0.0001) over the concentration range 0.2-1.2 mmol/L, and CVs for replicate betaine analyses ranged from 7% (n = 10) at the lowest concentration to 1% (n = 9) at the highest. The detection limit for betaine was < 15 mumol/L. Urinary DMG concentrations were substantially lower than those of betaine. Urinary betaine and DMG concentrations measured by 1H NMR spectroscopy from 13 patients with premature vascular disease and 17 normal controls provided clinically pertinent data. We conclude that 1H NMR provides unique advantages as a research tool for determination of urinary betaine and DMG concentrations. PMID:7533065

  9. Salmonella typhimurium proP gene encodes a transport system for the osmoprotectant betaine.

    Science.gov (United States)

    Cairney, J; Booth, I R; Higgins, C F

    1985-12-01

    Betaine (N,N,N-trimethylglycine) can be accumulated to high intracellular concentrations and serves an important osmoprotective function in enteric bacteria. We found that the proP gene of Salmonella typhimurium, originally identified as encoding a minor transport system for proline (permease PP-II), plays an important role in betaine uptake. Mutations in proP reduced the ability of betaine to serve as an osmoprotectant. Transport of betaine into the cells was also severely impaired in these mutants. The kinetics of uptake via PP-II suggest that betaine, rather than proline, is the important physiological substrate for this transport system. Betaine uptake via PP-II was regulated by osmotic pressure at two different levels: transcription of the proP gene was increased by increasing osmolarity, and, in addition, activity of the transport system itself was dependent upon the osmotic pressure of the medium. The specificity of the transport system was also altered by increasing osmolarity which enhanced the affinity for betaine while reducing that for proline. PMID:3905767

  10. Effect of betaine on growth performance and resistance on Vibriosis in white shrimp (Penaeus vannamei

    Directory of Open Access Journals (Sweden)

    Ponpai, T.

    2007-09-01

    Full Text Available Effects of betaine fortified in the feed on growth performance and resistance to Vibriosis was conducted in P. vannamei of average initial weight 2 gram. In the 6-week feeding trial different feed formulae were tested. Formula 1 feed control was without betaine fortification while in formula 2 through 5 contained betaine at 1.0, 2.0, 3.0 and 4.0 percent, respectively. Determination of weight gain was carried out at 2 week intervals. The results showed that there was no significant difference among treatments in survival, feed conversion ratio or feed intake although average individual weight gain showed a difference with higher weight gain in those given 4 percent fortified feed compared with control. A similar result was obtained for specific growth rate, which was higher for 4 percent betaine than the control. The feed with 4 percent betaine fortification resulted in the best performance on immune response while the best capacity to eliminate V. harveyi in plasma was noted in the treatment with 3 percent betaine supplementation. In conclusion, betaine has been shown to be effective in its application to enhance growth and immunity, and this might help support the sustainability of the shrimp industry.

  11. Betaine inhibits Toll-like receptor 4 expression in rats with ethanol-induced liver injury

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    AIM:To test whether ethanol feeding could induce Toll-like receptor 4(TLR4)responses,assess the hepatoprotective effect of betaine and its inhibitive effect on TLR4 in animal models of alcoholic liver injury.METHODS:Forty-eight female Sprague-Dawley rats were randomly divided into four groups as control,model,low and high dose betaine groups.Except control group,all rats were fed with high fat-containing diet plus ethanol and fish oil gavages for 8 wk.Betaine was administered intragastrically after exposure...

  12. Gbu Glycine Betaine Porter and Carnitine Uptake in Osmotically Stressed Listeria monocytogenes Cells

    OpenAIRE

    Mendum, Mary Lou; Smith, Linda Tombras

    2002-01-01

    The food-borne pathogen Listeria monocytogenes grows actively under high-salt conditions by accumulating compatible solutes such as glycine betaine and carnitine from the medium. We report here that the dominant transport system for glycine betaine uptake, the Gbu porter, may act as a secondary uptake system for carnitine, with a Km of 4 mM for carnitine uptake and measurable uptake at carnitine concentrations as low as 10 μM. This porter has a Km for glycine betaine uptake of about 6 μM. The...

  13. Inhibitors of bacterial growth in urine: what is the role of betaines?

    Science.gov (United States)

    Chambers, S T; Peddie, B A; Randall, K; Lever, M

    1999-05-01

    It has long been recognised that some individuals produce urine that is inhibitory to uropathogens. This may be partly explained by inhibitors. Several inhibitors have been identified in urine including urea and organic acids. Bacteria adapt to high osmolarity by activating osmoregulated betaine porters and accumulating organic osmolytes intracellularly. The preferred substrate is glycine betaine, which is present in urine, and promotes rapid growth by balancing osmotic forces and stabilising macromolecular structures against the toxicity of urea and low pH. Other dietary betaines such as trigonelline may also be taken but enhance urea toxicity. The importance of such compounds in vivo is unknown. PMID:10394986

  14. An improved method for the determination of betaine in Echinacea products.

    Science.gov (United States)

    Ganzera, M; Pujol, P; Walker, L; Khan, I A

    2001-07-01

    A rapid and sensitive HPLC method for the separation and quantification of betaine in Echinacea products has been developed. Strong cation-exchange (SCX) material was used as stationary phase, and a mixture of methanol and 50 mM choline buffer (pH 3.5) as mobile phase. After formation of the bromophenacyl derivative, betaine was detected at 254 nm with a detection limit of 0.2 microgram/ml. The method was successfully used to analyze several Echinacea market products, and significant variations in their betaine content from 0.04 to 0.64% were observed. PMID:11487974

  15. Biosynthesis, translocation, and accumulation of betaine in sugar beet and its progenitors in relation to salinity.

    Science.gov (United States)

    Hanson, A D; Wyse, R

    1982-10-01

    Like other halophytic chenopods, sugar beet (Beta vulgaris L.) can accumulate high betaine levels in shoots and roots. N,N,N-trimethylglycine impedes sucrose crystallization and so lowers beet quality. The objective of this research was to examine the genetic variability and physiological significance of betaine accumulation in sugar beet and its relatives. Three cultivated genotypes of B. vulgaris and two genotypes of the wild progenitor B. maritima L. were grown with and without gradual salinization (final NaCl concentration = 150 millimolar). At 6 weeks old, all five genotypes had moderately high betaine levels in shoots and roots when unsalinized (averages for all genotypes: shoots = 108 micromoles per gram dry weight; roots = 99 micromoles per gram dry weight). Salinization raised betaine levels of shoots and roots 2- to 3-fold, but did not greatly depress shoot or root growth. The genotype WB-167-an annual B. maritima type-always had approximately 40% lower betaine levels in roots than the other four genotypes, although the betaine levels in the shoots were not atypically low.THE SITE AND PATHWAY OF BETAINE SYNTHESIS WERE INVESTIGATED IN YOUNG, SALINIZED SUGAR BEET PLANTS BY: (a) supplying 1 micromole [(14)C]ethanolamine to young leaf blades or to the taproot sink of intact plants; (b) supplying tracer [(14)C]formate to discs of leaf, hypocotyl, and taproot tissues in darkness. Conversion of both (14)C precursors to betaine was active only in leaf tissue. Very little (14)C appeared in the phospholipid phosphatidylcholine before betaine was heavily labeled; this was in marked contrast to the labeling patterns in salinized barley. Phosphorylcholine was a prominent early (14)C metabolite of both [(14)C]ethanolamine and [(14)C]formate in all tissues of sugar beet. Betaine translocation was examined in young plants of sugar beet and WB-167 by applying tracer [methyl-(14)C]betaine to a young expanded leaf and determining the distribution of (14)C after 3 days. In

  16. Synthesis of glycine betaine from exogenous choline in the moderately halophilic bacterium Halomonas elongata

    OpenAIRE

    Nieto Gutiérrez, Joaquín José; Cánovas, David; Vargas, C.; Csonka, Laszlo N.; Ventosa Ucero, Antonio

    1998-01-01

    The role of choline in osmoprotection in the moderate halophile Halomonas elongata has been examined. Transport and conversion of choline to betaine began immediately after addition of choline to the growth medium. Intracellular accumulation of betaine synthesized from choline was salt dependent up to 2.5 M NaCl. Oxidation of choline was enhanced at 2.0 M NaCl in the presence or absence of externally provided betaine. This indicates that the NaCl concentration in the growth medium has major e...

  17. Effects of betaine on body composition, performance, and homocysteine thiolactone

    Science.gov (United States)

    2013-01-01

    Background This study investigated the effects of long term betaine supplementation on body composition, performance, and homocysteine thiolactone (HCTL) in experienced strength trained men. Methods Twenty-three subjects were matched for training experience (4.8 ± 2.3 years) and body fat percentage (BF%: 16.9 ± 8.0%), randomly assigned to either a placebo (PL; n = 12) or betaine group (BET; n = 11; 2.5 g/day), and completed a 6 week periodized training program consisting of 3 two-week micro-cycles. Bench press and back squat training volumes were recorded and changes in training volume were assessed at each micro-cycle. Fasting urine was collected at baseline (BL), weeks 2, 4 and 6, and assayed for HCTL. Subjects were tested prior to and following 6 weeks of treatment. Arm and thigh cross sectional area (CSA) was estimated via girth and skin fold measurements. Body density was estimated via skin fold calipers and used to estimate BF%, fat mass (FM), and lean body mass (LBM). Performance was assessed via vertical jump (VJ), bench press 1 RM (BP), and back squat 1 RM (BS). Results Arm CSA increased significantly (p < .05) in BET but not PL. No differences existed between group and time for changes in thigh CSA. Back squat training volume increased significantly (p < .05) for both groups throughout training. Bench press training volume was significantly (p < .05) improved for BET compared to PL at microcycles one and three. Body composition (BF%, FM, LBM) improved significantly (p < .05) in BET but not PL. No differences were found in performance variables (BP, BS, VJ) between groups, except there was a trend (p = .07) for increased VJ power in BET versus PL. A significant interaction (p < .05) existed for HCTL, with increases from BL to week 2 in PL, but not BET. Additionally, HCTL remained elevated at week 4 in PL, but not BET. Conclusion Six-weeks of betaine supplementation improved body composition, arm size, bench press

  18. Effects of betaine on lipopolysaccharide-induced memory impairment in mice and the involvement of GABA transporter 2

    Directory of Open Access Journals (Sweden)

    Miwa Masaya

    2011-11-01

    Full Text Available Abstract Background Betaine (glycine betaine or trimethylglycine plays important roles as an osmolyte and a methyl donor in animals. While betaine is reported to suppress expression of proinflammatory molecules and reduce oxidative stress in aged rat kidney, the effects of betaine on the central nervous system are not well known. In this study, we investigated the effects of betaine on lipopolysaccharide (LPS-induced memory impairment and on mRNA expression levels of proinflammatory molecules, glial markers, and GABA transporter 2 (GAT2, a betaine/GABA transporter. Methods Mice were continuously treated with betaine for 13 days starting 1 day before they were injected with LPS, or received subacute or acute administration of betaine shortly before or after LPS injection. Then, their memory function was evaluated using Y-maze and novel object recognition tests 7 and 10-12 days after LPS injection (30 μg/mouse, i.c.v., respectively. In addition, mRNA expression levels in hippocampus were measured by real-time RT-PCR at different time points. Results Repeated administration of betaine (0.163 mmol/kg, s.c. prevented LPS-induced memory impairment. GAT2 mRNA levels were significantly increased in hippocampus 24 hr after LPS injection, and administration of betaine blocked this increase. However, betaine did not affect LPS-induced increases in levels of mRNA related to inflammatory responses. Both subacute administration (1 hr before, and 1 and 24 hr after LPS injection and acute administration (1 hr after LPS injection of betaine also prevented LPS-induced memory impairment in the Y-maze test. Conclusions These data suggest that betaine has protective effects against LPS-induced memory impairment and that prevention of LPS-induced changes in GAT2 mRNA expression is crucial to this ameliorating effect.

  19. Betaine and Carnitine Derivatives as Herbicidal Ionic Liquids.

    Science.gov (United States)

    Pernak, Juliusz; Niemczak, Michał; Chrzanowski, Łukasz; Ławniczak, Łukasz; Fochtman, Przemysław; Marcinkowska, Katarzyna; Praczyk, Tadeusz

    2016-08-16

    This study focused on the synthesis and subsequent characterization of herbicidal ionic liquids based on betaine and carnitine, two derivatives of amino acids, which were used as cations. Four commonly used herbicides (2,4-D, MCPA, MCPP and Dicamba) were used as anions in simple (single anion) and oligomeric (two anions) salts. The obtained salts were subjected to analyzes regarding physicochemical properties (density, viscosity, refractive index, thermal decomposition profiles and solubility) as well as evaluation of their herbicidal activity under greenhouse and field conditions, toxicity towards rats and biodegradability. The obtained results suggest that the synthesized herbicidal ionic liquids displayed low toxicity (classified as category 4 compounds) and showed similar or improved efficacy against weed compared to reference herbicides. The highest increase was observed during field trials for salts containing 2,4-D as the anion, which also exhibited the highest biodegradability (>75 %). PMID:27374836

  20. Effect of betaine supplementation on plasma nitrate/nitrite in exercise-trained men

    Directory of Open Access Journals (Sweden)

    McCarthy Cameron G

    2011-03-01

    Full Text Available Abstract Background Betaine, beetroot juice, and supplemental nitrate have recently been reported to improve certain aspects of exercise performance, which may be mechanistically linked to increased nitric oxide. The purpose of the present study was to investigate the effect of betaine supplementation on plasma nitrate/nitrite, a surrogate marker or nitric oxide, in exercise-trained men. Methods We used three different study designs (acute intake of betaine at 1.25 and 5.00 grams, chronic intake of betaine at 2.5 grams per day for 14 days, and chronic [6 grams of betaine per day for 7 days] followed by acute intake [6 grams], all involving exercise-trained men, to investigate the effects of orally ingested betaine on plasma nitrate/nitrite. Blood samples were collected before and at 30, 60, 90, and 120 min after ingestion of 1.25 and 5.00 grams of betaine (Study 1; before and after 14 days of betaine supplementation at a dosage of 2.5 grams (Study 2; and before and after 7 days of betaine supplementation at a dosage of 6 grams, followed by acute ingestion of 6 grams and blood measures at 30 and 60 min post ingestion (Study 3. Results In Study 1, nitrate/nitrite was relatively unaffected and no statistically significant interaction (p = 0.99, dosage (p = 0.69, or time (p = 0.91 effects were noted. Similar findings were noted in Study 2, with no statistically significant interaction (p = 0.57, condition (p = 0.98, or pre/post intervention (p = 0.17 effects noted for nitrate/nitrite. In Study 3, no statistically significant changes were noted in nitrate/nitrite between collection times (p = 0.97. Conclusion Our data indicate that acute or chronic ingestion of betaine by healthy, exercise-trained men does not impact plasma nitrate/nitrite. These findings suggest that other mechanisms aside from increasing circulating nitric oxide are likely responsible for any performance enhancing effect of betaine supplementation.

  1. Modulation of Colitis-associated Colon Tumorigenesis by Baicalein and Betaine

    OpenAIRE

    Kim, Dong Hwan; Sung, Bokyung; Chung, Hae Young; Kim, Nam Deuk

    2014-01-01

    In this review, we will summarize the current understanding of modulation of colitis-associated colon tumorigenesis by two natural products, baicalein and betaine, which have anti-inflammatory activities. Baicalein and betaine have been shown to provide various health benefits to organism in many ways. Baicalein is a phenolic flavonoid derived originally from the root of Scutellaria baicalensis Georgi. From ancient times, baicalein has widely been used in oriental medicines as an anti-inflamm...

  2. Growth-regulating Activity of Cinnamamide and Betaine Cinnamamide on Wheat

    Directory of Open Access Journals (Sweden)

    Chen Weiyan

    2015-03-01

    Full Text Available A series of Cinnamamide and betaine Cinnamamide developed from the structure of cinnamic acid were synthesized. Different concentrations of Cinnamamide and betaine Cinnamamide were employed to check their effects on seed germination and early growth in wheat. The preliminary results showed that, under the condition of this experiment, target compounds have high activity in promoting seed germination, accelerating the lengths of root and shoot and improving the quality of wheat.

  3. Effects of supplementation of betaine hydrochloride on physiological performances of broilers exposed to thermal stress

    OpenAIRE

    Haldar, Sudipto

    2015-01-01

    Abhay K Singh,1 Tapan K Ghosh,1 David C Creswell,2 Sudipto Haldar1 1Department of Animal Nutrition, Faculty of Veterinary and Animal Sciences, West Bengal University of Animal and Fishery Sciences, Kolkata, India; 2Creswell Nutrition, Sydney, Australia Background: Betaine has the potential to spare methionine and choline as methyl-group donors, and is thought to improve broiler performance under conditions of stress. An experiment was conducted to ascertain the effects of supplemental betain...

  4. Dietary Intake and Plasma Levels of Choline and Betaine in Children with Autism Spectrum Disorders

    Directory of Open Access Journals (Sweden)

    Joanna C. Hamlin

    2013-01-01

    Full Text Available Abnormalities in folate-dependent one-carbon metabolism have been reported in many children with autism. Because inadequate choline and betaine can negatively affect folate metabolism and in turn downstream methylation and antioxidant capacity, we sought to determine whether dietary intake of choline and betaine in children with autism was adequate to meet nutritional needs based on national recommendations. Three-day food records were analyzed for 288 children with autism (ASDs who participated in the national Autism Intervention Research Network for Physical Health (AIR-P Study on Diet and Nutrition in children with autism. Plasma concentrations of choline and betaine were measured in a subgroup of 35 children with ASDs and 32 age-matched control children. The results indicated that 60–93% of children with ASDs were consuming less than the recommended Adequate Intake (AI for choline. Strong positive correlations were found between dietary intake and plasma concentrations of choline and betaine in autistic children as well as lower plasma concentrations compared to the control group. We conclude that choline and betaine intake is inadequate in a significant subgroup of children with ASDs and is reflected in lower plasma levels. Inadequate intake of choline and betaine may contribute to the metabolic abnormalities observed in many children with autism and warrants attention in nutritional counseling.

  5. Effect of betaine on HSP70 expression and cell survival during adaptation to osmotic stress.

    Science.gov (United States)

    Petronini, P G; De Angelis, E M; Borghetti, A F; Wheeler, K P

    1993-07-15

    Induced expression of the HSP70 gene in 3T3 and SV-3T3 cells was monitored by measurements of the synthesis of HSP70 and of the cellular contents of both HSP70 and its mRNA. The presence of betaine (N-trimethylglycine) at concentrations of 2.5-25 mM decreased the induction of HSP70 gene expression caused by incubation of 3T3 and SV-3T3 cells in hypertonic (0.5 osM) medium. This effect was accompanied by an enhancement of SV-3T3 cell adaptation, assayed by colony formation, to the hyperosmotic conditions. In contrast, the presence of betaine did not affect HSP70 gene expression induced in these cells by heat shock. After 6 h incubation with 25 mM betaine under hypertonic (0.5 osM) conditions the intracellular concentration of betaine in SV-3T3 cells was about 195 mM, compared with about 70 mM under isotonic (0.3 osM) conditions. Hence, with this concentration of extracellular betaine, the marked increase in the accumulation of betaine within the cells presumably counteracts the imposed osmotic pressure and eliminates the signal that otherwise initiates increased expression of the HSP70 gene. PMID:8343134

  6. A reliable method for spectrophotometric determination of glycine betaine in cell suspension and other systems.

    Science.gov (United States)

    Valadez-Bustos, Ma Guadalupe; Aguado-Santacruz, Gerardo Armando; Tiessen-Favier, Axel; Robledo-Paz, Alejandrina; Muñoz-Orozco, Abel; Rascón-Cruz, Quintin; Santacruz-Varela, Amalio

    2016-04-01

    Glycine betaine is a quaternary ammonium compound that accumulates in a large variety of species in response to different types of stress. Glycine betaine counteracts adverse effects caused by abiotic factors, preventing the denaturation and inactivation of proteins. Thus, its determination is important, particularly for scientists focused on relating structural, biochemical, physiological, and/or molecular responses to plant water status. In the current work, we optimized the periodide technique for the determination of glycine betaine levels. This modification permitted large numbers of samples taken from a chlorophyllic cell line of the grass Bouteloua gracilis to be analyzed. Growth kinetics were assessed using the chlorophyllic suspension to determine glycine betaine levels in control (no stress) cells and cells osmotically stressed with 14 or 21% polyethylene glycol 8000. After glycine extraction, different wavelengths and reading times were evaluated in a spectrophotometer to determine the optimal quantification conditions for this osmolyte. Optimal results were obtained when readings were taken at a wavelength of 290 nm at 48 h after dissolving glycine betaine crystals in dichloroethane. We expect this modification to provide a simple, rapid, reliable, and cheap method for glycine betaine determination in plant samples and cell suspension cultures. PMID:26774956

  7. Osmotic control of glycine betaine biosynthesis and degradation in Rhizobium meliloti

    International Nuclear Information System (INIS)

    Intracellular accumulation of glycine betaine has been shown to confer an enhanced level of osmotic stress tolerance in Rhizobium meliloti. In this study, the authors used a physiological approach to investigate the mechanism by which glycine betaine is accumulated in osmotically stressed R. meliloti. Results from growth experiments, 14C labeling of intermediates, and enzyme activity assays are presented. The results provide evidence for the pathway of biosynthesis and degradation of glycine betaine and the osmotic effects on this pathway. High osmolarity in the medium decreased the activities of the enzymes involved in the degradation of glycine betaine but not those of enzymes that lead to its biosynthesis from choline. Thus, the concentration of the osmoprotectant glycine betaine is increased in stressed cells. This report demonstrates the ability of the osmolarity of the growth medium to regulate the use of glycine betaine as a carbon and nitrogen source or as an osmoprotectant. The mechanisms of osmoregulation in R. meliloti and Escherichia coli are compared

  8. Three Transporters Mediate Uptake of Glycine Betaine and Carnitine by Listeria monocytogenes in Response to Hyperosmotic Stress

    OpenAIRE

    Angelidis, Apostolos S.; Smith, Gary M.

    2003-01-01

    The uptake and accumulation of the potent osmolytes glycine betaine and carnitine enable the food-borne pathogen Listeria monocytogenes to proliferate in environments of elevated osmotic stress, often rendering salt-based food preservation inadequate. To date, three osmolyte transport systems are known to operate in L. monocytogenes: glycine betaine porter I (BetL), glycine betaine porter II (Gbu), and a carnitine transporter OpuC. We investigated the specificity of each transporter towards e...

  9. Higher Dietary Choline and Betaine Intakes Are Associated with Better Body Composition in the Adult Population of Newfoundland, Canada.

    Directory of Open Access Journals (Sweden)

    Xiang Gao

    Full Text Available Choline is an essential nutrient and betaine is an osmolyte and methyl donor. Both are important to maintain health including adequate lipid metabolism. Supplementation of dietary choline and betaine increase muscle mass and reduce body fat in animals. However, little data is available regarding the role of dietary choline and betaine on body composition in humans.To investigate the association between dietary choline and betaine intakes with body composition in a large population based cross-sectional study.A total of 3214 subjects from the CODING (Complex Disease in Newfoundland population: Environment and Genetics study were assessed. Dietary choline and betaine intakes were computed from the Willett Food Frequency questionnaire. Body composition was measured using dual-energy X-ray absorptiometry following a 12-hour fast. Major confounding factors including age, sex, total calorie intake and physical activity level were controlled in all analyses.Significantly inverse correlations were found between dietary choline and betaine intakes, with all obesity measurements: total percent body fat (%BF, percent trunk fat (%TF, percent android fat (%AF, percent gynoid fat (%GF and anthropometrics: weight, body mass index, waist circumference, waist-to-hip ratio in both women and men (r range from -0.13 to -0.47 for choline and -0.09 to -0.26 for betaine, p<0.001 for all. Dietary choline intake had stronger association than betaine. Moreover, obese subjects had the lowest dietary choline and betaine intakes, with overweight subjects in the middle, and normal weight subjects consumed the highest dietary choline and betaine (p<0.001. Vice versa, when subjects were ranked according to dietary choline and betaine intakes, subjects with the highest intake of both had the lowest %TF, %AF, %GF, %BF and highest %LM among the groups in both sexes.Our findings indicate that high dietary choline and betaine intakes are significantly associated with favorable body

  10. Effect of natural betaine on estimates of semen quality in mature AI boars during summer heat stress.

    Science.gov (United States)

    Cabezón, F A; Stewart, K R; Schinckel, A P; Barnes, W; Boyd, R D; Wilcock, P; Woodliff, J

    2016-07-01

    This study evaluated the effect of supplemental dietary betaine at three concentrations (0.0%, 0.63% and 1.26%) on semen characteristics, quality and quality after storage on boars. The trial was conducted between 22 July and 1 October 2014 in a boar stud located in Oklahoma. Boars were blocked by age within genetic line and randomly allotted to receive 0% (CON, n (line T)=22, n (line L)=10), 0.63% (BET-0.63%, n (line T)=21, n (line L)=6) or 1.26% (BET-1.26%, n (line T)=23, n (line L)=7). The diets containing betaine were fed over 10 weeks, to ensure supplemental betaine product (96% betaine) daily intakes of 16.34 and 32.68g, for the BET-0.63% and BET-1.26% diets, respectively. Serum homocysteine concentrations were less for animals with betaine treatments (P=0.016). Rectal temperatures of the boars were unaffected by betaine diets. Betaine tended to increase total sperm in the ejaculates when collectively compared with data of the control animals (P=0.093). Sperm morphology analysis indicated there was a greater percent of sperm with distal midpiece reflex (P=0.009) and tail (P=0.035) abnormalities in boars fed the BET-1.26% than boars fed the BET-0.63% diet. Betaine concentration in the seminal plasma was greater in boars with betaine treatments, with animals being fed the 0.63% and 1.26% diets having 59.2% and 54.5% greater betaine concentrations in seminal plasma as compared with boars of the control group (P=0.046). In conclusion, betaine supplementation at 0.63% and 1.26% tended to increase sperm concentration in the ejaculates by 6% and 13%, respectively, with no negative impacts on semen quality when 0.63% of betaine was included in the diet. PMID:27095614

  11. Distinct Difference in Absorption Pattern in Pigs of Betaine Provided as a Supplement or Present Naturally in Cereal Dietary Fiber

    DEFF Research Database (Denmark)

    Hedemann, Mette Skou; Theil, Peter Kappel; Lærke, Helle Nygaard;

    2015-01-01

    high-fiber breads differing in amount and source of dietary fiber (two experiments, n = 6 pigs each). Plasma betaine peaked after 30 min when betaine was fed as a supplement, whereas it peaked after 120–180 min when high-fiber breads were fed. Plasma betaine showed no diet × time interaction after...... feeding with high-fiber breads, indicating that the absorption kinetic did not differ between fiber sources. The net absorption of choline was not affected by the experimental diets. In conclusion, betaine in cereal sources has to be liberated from the matrix prior to absorption, causing delayed...

  12. Betaine accumulation and (/sup 14/C)formate metabolism in water-stressed barley leaves

    Energy Technology Data Exchange (ETDEWEB)

    Hanson, A.D.; Nelsen, C.E.

    1978-01-01

    Barley (Hordeum vulgare L.) plants at the three-leaf stage were water-stressed by flooding the rooting medium with polyethylene glycol 6000 with an osmotic potential of -19 bars, or by withholding water. While leaf water potential fell and leaf kill progressed, the betaine (trimethylglycine) content of the second leaf blade rose from about 0.4 micromole to about 1.5 micromoles in 4 days. The time course of betaine accumulation resembled that of proline. Choline levels in unstressed second leaf blades were low (<0.1 micromole per blade) and remained low during water stress. Upon relief of stress, betaine-like proline-remained at a high concentration in drought-killed leaf zones, but betaine did not disappear as rapidly as proline during recovery. When (methyl-/sup 14/C)choline was applied to second leaf blades of intact plants in the growth chamber, water-stressed plants metabolized 5 to 10 times more /sup 14/C label to betaine than control plants during 22 hours. When infiltrated with tracer quantities of (/sup 14/C)formate and incubated for various times in darkness or light, segments cut from water-stressed leaf blades incorporated about 2- to 10-fold more /sup 14/C into betaine than did segments from unstressed leaves. In segments from stressed leaves incubated with (/sup 14/C)formate for about 18 hours in darkness, betaine was always the principal /sup 14/C-labeled soluble metabolite. This /sup 14/C label was located exclusively in the N-methyl groups of betaine; thus, reducing equivalents were available in stressed leaves for the reductive steps of methyl group biosynthesis from formate. Incorporation of /sup 14/C from formate into choline was also increased in stressed leaf tissue, but choline was not a major product formed from (/sup 14/C)formate. These results are consistent with a net de novo synthesis of betaine from 1- and 2-carbon precursors during water stress and indicate that the betaine so accumulated may be a metabolically inert end product.

  13. Betaine Accumulation and [C]Formate Metabolism in Water-stressed Barley Leaves.

    Science.gov (United States)

    Hanson, A D; Nelsen, C E

    1978-08-01

    Barley (Hordeum vulgare L.) plants at the three-leaf stage were water-stressed by flooding the rooting medium with polyethylene glycol 6000 with an osmotic potential of -19 bars, or by withholding water. While leaf water potential fell and leaf kill progressed, the betaine (trimethylglycine) content of the second leaf blade rose from about 0.4 micromole to about 1.5 micromoles in 4 days. The time course of betaine accumulation resembled that of proline accumulation. Choline levels in unstressed second leaf blades were low (<0.1 micromole per blade) and remained low during water stress. Upon relief of stress, betaine-like proline-remained at a high concentration in drought-killed leaf zones, but betaine did not disappear as rapidly as proline from viable leaf tissue during recovery.When [methyl-(14)C]choline was applied to second leaf blades of intact plants in the growth chamber, water-stressed plants metabolized 5 to 10 times more (14)C label to betaine than control plants during 22 hours. When infiltrated with tracer quantities of [(14)C]formate and incubated for various times in darkness or light, segments cut from water-stressed leaf blades incorporated about 2- to 10-fold more (14)C into betaine than did segments from unstressed leaves. In segments from stressed leaves incubated with [(14)C]formate for about 18 hours in darkness, betaine was always the principal (14)C-labeled soluble metabolite. This (14)C label was located exclusively in the N-methyl groups of betaine, demonstrating that reducing equivalents were available in stressed leaves for the reductive steps of methyl group biosynthesis from formate. Incorporation of (14)C from formate into choline was also increased in stressed leaf tissue, but choline was not a major product formed from [(14)C]formate.These results are consistent with a net de novo synthesis of betaine from 1- and 2-carbon precursors during water stress, and indicate that the betaine so accumulated may be a metabolically inert end

  14. Comparative study of urea and betaine solutions by dielectric spectroscopy: liquid structures of a protein denaturant and stabilizer.

    Science.gov (United States)

    Hayashi, Yoshihito; Katsumoto, Yoichi; Oshige, Ikuya; Omori, Shinji; Yasuda, Akio

    2007-10-11

    We performed dielectric spectroscopy measurements on aqueous solutions of glycine betaine (N,N,N-trimethylglycine), which is known to be a strong stabilizer of globular proteins, over a wide concentration range (3-62 wt %) and compared the results with our previously published data for aqueous solutions of urea, a representative protein denaturant. The hydration number of betaine (9), calculated on the basis of the reduction in the dielectric relaxation strength of bulk water with addition of betaine, is significantly larger than that of urea (2). Furthermore, the dielectric relaxation time increased with betaine concentration, while that remained nearly constant for the urea-water system over a wide concentration range. This difference between urea and betaine is probably related to their opposite effects on the protein stabilization. PMID:17877386

  15. Proximate Composition, and l-Carnitine and Betaine Contents in Meat from Korean Indigenous Chicken

    OpenAIRE

    Jung, Samooel; Bae, Young Sik; Yong, Hae In; Lee, Hyun Jung; Seo, Dong Won; Park, Hee Bok; Lee, Jun Heon; Jo, Cheorun

    2015-01-01

    This study investigated the proximate composition and l-carnitine and betaine content of meats from 5 lines of Korean indigenous chicken (KIC) for developing highly nutritious meat breeds with health benefits from the bioactive compounds such as l-carnitine and betaine in meat. In addition, the relevance of gender (male and female) and meat type (breast and thigh meat) was examined. A total of 595 F1 progeny (black [B], grey-brown [G], red-brown [R], white [W], and yellow-brown [Y]) from 70 f...

  16. Synergistic effects of betaine and conjugated linoleic acid on the growth and carcass composition of growing Iberian pigs.

    Science.gov (United States)

    Fernández-Fígares, I; Conde-Aguilera, J A; Nieto, R; Lachica, M; Aguilera, J F

    2008-01-01

    An experiment was conducted to determine the efficacy of dietary betaine, CLA, or both as growth promotants and carcass modifiers in growing Iberian pigs. Twenty gilts (20 kg of BW) were individually penned and fed barley- and soybean meal-based diets (12% CP, 0.81% Lys, and 14.8 MJ of ME/kg of DM) containing either no added betaine or CLA (control), 0.5% betaine, 1% CLA, or 0.5% betaine + 1% CLA, at 95% of ad libitum energy intake. An additional group of 5 pigs was slaughtered at the beginning of the experiment to obtain the initial body composition. At 30 kg of BW, a balance experiment was conducted. At 50 kg of BW, pigs were slaughtered and viscera was removed and weighed. Betaine or CLA alone did not affect growth performance. However, betaine + CLA increased ADG (601 vs. 558 g, P = 0.03) and gain relative to ME intake (25.4 vs. 22.2 g/MJ, P = 0.03) compared with control pigs. Digestibility of nutrients and metabolizability of energy did not differ among diets (P = 0.46 to 0.75). Carcass protein, water, and lean deposition (g/d) increased (19.8, 24.2, and 23.4%, respectively, P pigs fed betaine + CLA compared with control pigs. Similarly, protein deposition relative to ME intake increased by 28% in betaine + CLA-supplemented pigs (P pigs fed betaine + CLA-supplemented diets tended to increase (P = 0.07 to 0.09) and carcass fat content tended to decrease (P = 0.09). Similarly, estimated composition of carcass gain was affected, such that water and lean content tended to increase (P = 0.06 to 0.08), whereas fat tended to decrease (P = 0.08) in pigs fed betaine + CLA-supplemented diets. Longissimus muscle area was not altered by treatments (P = 0.49). The liver of pigs fed betaine + CLA diets had increased weight (19%, P pigs. Overall, dietary supplementation of betaine + CLA increased ADG, protein, water, and lean deposition in growing Iberian gilts. There appears to be a synergistic action when betaine and CLA are used together. PMID:18086868

  17. Impact of dietary betaine and conjugated linoleic acid on insulin sensitivity, protein and fat metabolism of obese pigs.

    Science.gov (United States)

    Fernández-Fígares, I; Lachica, M; Martín, A; Nieto, R; González-Valero, L; Rodríguez-López, J M; Aguilera, J F

    2012-07-01

    To determine possible mechanisms of action that might explain the nutrient partitioning effect of betaine and conjugated linoleic acid (CLA) in Iberian pigs and to address potential adverse effects, twenty gilts were restrictively fed from 20 to 50 kg BW Control, 0.5% betaine, 1% CLA or 0.5% betaine + 1% CLA diets. Serum hormones and metabolites profile were determined at 30 kg BW and an oral glucose test was performed before slaughter. Pigs were slaughtered at 50 kg BW and livers were obtained for chemical and histological analysis. Decreased serum urea in pigs fed betaine and betaine + CLA diets (11%; P = 0.0001) indicated a more efficient N utilization. The increase in serum triacylglycerol (58% and 28%, respectively; P = 0.0098) indicated that CLA and betaine + CLA could have reduced adipose tissue triacylglycerol synthesis from preformed fatty acids. Serum glucose, low-density lipoprotein (LDL) cholesterol and non-esterified fatty acids were unaffected. CLA and betaine + CLA altered serum lipids profile, although liver of pigs fed CLA diet presented no histopathological changes and triglyceride content was not different from Control pigs. Compared with controls, serum growth hormone decreased (20% to 23%; P = 0.0209) for all treatments. Although serum insulin increased in CLA, and especially in betaine + CLA pigs (28% and 83%; P = 0.0001), indices of insulin resistance were unaffected. In conclusion, CLA, and especially betaine + CLA, induced changes in biochemical parameters and hormones that may partially explain a nutrient partitioning effect in young pigs. Nevertheless, they exhibited weak, although detrimental, effects on blood lipids. Moreover, although livers were chemically and histologically normal, pigs fed CLA diet challenged with a glucose load had higher serum glucose than controls. PMID:23031465

  18. Betaine (trimethylglycine) as a nutritional agent prevents oxidative stress after chronic ethanol consumption in pancreatic tissue of rats.

    Science.gov (United States)

    Kanbak, Gungör; Dokumacioglu, Ali; Tektas, Aysegul; Kartkaya, Kazim; Erden Inal, Mine

    2009-03-01

    In this study, we investigated the free radical-mediated cytotoxic effects of chronic ethanol consumption on the pancreatic tissue and a possible cytoprotective effect of betaine as a methyl donor and an important participant in the methionine cycle. Twenty-four male Wistar rats were divided into control, ethanol, and ethanol+betaine groups. Prior to sacrifice, all groups were fed 60 mL/diet per day for two months. Rats in the ethanol group were fed with ethanol 8 g/kg/day. The ethanol+betaine groups were fed ethanol plus betaine (0.5 % w/v). Malondialdehyde levels and adenosine deaminase, superoxide dismutase, and xanthine oxidase activities were determined in pancreatic tissues of rats. Compared to control group, MDA levels increased significantly in the ethanol group (p<0.05). MDA levels in the ethanol+betaine group were significantly decreased compared to the ethanol group (p<0.05). ADA activity in the ethanol+betaine group decreased significantly when compared to the ethanol group (p<0.05). XO activities in ethanol-fed rats were decreased significantly compared to the control group (p<0.05). XO activity in the betaine group was increased significantly (p<0.05) compared to the ethanol group. SOD activity in the ethanol group decreased significantly compared to control group (p<0.001). SOD activity in the ethanol+betaine group decreased significantly (p<0.05) compared to the control group. We think that betaine, as a nutritional methylating agent, may be effective against ethanol-mediated oxidative stress in pancreatic tissue. PMID:20108209

  19. Effects of Betaine Intake on Plasma Homocysteine Concentrations and Consequences for Health

    NARCIS (Netherlands)

    Olthof, M.R.; Verhoef, P.

    2005-01-01

    High plasma concentrations of homocysteine may increase risk of cardiovascular disease. Folic acid lowers plasma homocysteine by 25% maximally, because 5-methyltetrahydrofolate is a methyl donor in the remethylation of homocysteine to methionine. Betaine (trimethylglycine) is also a methyl donor in

  20. The solvatochromism of phenolate betaines: comparing different cavities of a polarized continuum model.

    Science.gov (United States)

    Rezende, Marcos Caroli; Domínguez, Moisés

    2015-08-01

    Two variations of the polarized continuum model employing default ("PCM model") and SMD radii ("SMD model") were compared for the reproduction of the solvatochromic behavior of Reichardt's betaine dye, and of eight other phenolate betaines that exhibit a negative, positive or an inverted solvatochromic behavior. Molecules were optimized at the CAM B3LYP/6-31+G(d,p) level of theory, and transition energies were calculated with the TD-DFT method. The PCM model failed to reproduce the negative and the inverted solvachromism of these dyes in protic solvents. The SMD model, though not entirely accounting for hydrogen-bond effects in small, polar hydroxylic solvents, should be recommended as a better alternative for the theoretical simulation of the solvatochromism of phenolate betaines in medium to highly polar solvents. Graphical Abstract A comparison of two polarized continuum models ("default PCM" and "PCM/SMD") for reproducing the solvatochromism of phenolate betaines, with nine examples of negative, positive, and inverted behavior. PMID:26224604

  1. The association of betaine, homocysteine and related metabolites with cognitive function in Dutch elderly people

    NARCIS (Netherlands)

    Eussen, S.J.P.M.; Ueland, P.M.; Clarke, R.; Blom, H.J.; Hoefnagels, W.H.L.; Staveren, van W.A.; Groot, de C.P.G.M.

    2007-01-01

    The importance of the one-carbon metabolites, choline and homocysteine, to brain function is well known. However, the associations between the one-carbon metabolites choline, betaine, methionine and dimethylglycine with cognition in elderly are unclear. We therefore examined the associations of thes

  2. The association of betaine, homocysteine and related metabolites with cognitive function in Dutch elderly people.

    NARCIS (Netherlands)

    Eussen, S.; Ueland, P.M.; Clarke, R.; Blom, H.J.; Hoefnagels, W.H.L.; Staveren, W.A. van; Groot, L.C. de

    2007-01-01

    The importance of the one-carbon metabolites, choline and homocysteine, to brain function is well known. However, the associations between the one-carbon metabolites choline, betaine, methionine and dimethylglycine with cognition in elderly are unclear. We therefore examined the associations of thes

  3. Surviving environmental stress: the role of betaine aldehyde dehydrogenase in marine crustaceans

    Directory of Open Access Journals (Sweden)

    NA Stephens-Camacho

    2015-02-01

    Full Text Available Betaine aldehyde dehydrogenase (BADH belongs to the aldehyde dehydrogenases (ALDH family, an ancestral group of enzymes responsible for aldehyde detoxification in several organisms. The BADH enzyme catalyzes the irreversible oxidation of betaine aldehyde to glycine betaine (GB an important osmoptrotector and osmoregulator accumulated in response to cellular osmotic stress. The BADH enzymes have been extensively described in terrestrial organisms, but information in marine crustaceans remains scarce. Research on crustacean stress-adaptive capacity to environmental stressors relates GB accumulation in response to salinity variations. Although GB de novo synthesis is confirmed on crustaceans, its metabolic pathways and regulation mechanism are unexplored. In this work, the state of the knowledge of betaine aldehyde dehydrogenase enzymes in marine crustaceans is summarized, as a mechanism to overcome the deleterious effects of changes in temperature, salinity and dissolved oxygen concentration in seawater. The purpose of this review is to provide a more comprehensive overview to set the basis for exploring novel functions and properties of BADHs on the response of crustaceans to environmental stress.

  4. The Effect of Ethylene Glycol, Glycine Betaine, and Urea on Lysozyme Thermal Stability

    Science.gov (United States)

    Schwinefus, Jeffrey J.; Leslie, Elizabeth J.; Nordstrom, Anna R.

    2010-01-01

    The four-week student project described in this article is an extension of protein thermal denaturation experiments to include effects of added cosolutes ethylene glycol, glycine betaine, and urea on the unfolding of lysozyme. The transition temperatures and van't Hoff enthalpies for unfolding are evaluated for six concentrations of each cosolute,…

  5. Physiological and Growth Responses of Tomato Progenies Harboring the Betaine Alhyde Dehydrogenase Gene to Salt Stress

    Institute of Scientific and Technical Information of China (English)

    Shu-Feng Zhou; Xian-Yang Chen; Xing-Ning Xue; Xin-Guo Zhang; Yin-Xin Li

    2007-01-01

    The responses of five transgenlc tomato (Lycoperslcon esculentum Mill) lines containing the betaine aldehyde dehydrogenase (BADH) gene to salt stress were evaluated. Proline, betaine (N, N, N-trimethylglycine, hereafter betaine), chlorophyll and ion contents, BADH activity, electrolyte leakage (EL), and some growth parameters of the plants under 1.0% and 1.5% NaCl treatments were examined. The transgenic tomatoes had enhanced BADH activity and betaine content, compared to the wild type under stress conditions. Salt stress reduced chlorophyll contents to a higher extent in the wild type than in the transgenic plants. The wild type exhibited significantly higher proline content than the transgenic plants at 0.9% and 1.3% NaCl. Cell membrane of the wild type was severely damaged as determined by higher EL under salinity stress. K+ and Ca2+ contents of all tested lines decreased under salt stress,but the transgenic plants showed a significantly higher accumulation of K+ and Ca2+ than the wild type. In contrast,the wild type had significantly higher Cl- and Na+ contents than the transgenic plants under salt stress. Although yield reduction among various lines varied, the wild type had the highest yield reduction. Fruit quality of the transgenic plants was better in comparison with the wild type as shown by a low ratio of blossom end rot fruits.The results show that the transgenic plants have improved salt tolerance over the wild type.

  6. Betaine-homocysteine methyltransferase: human liver genotype-phenotype correlation

    Science.gov (United States)

    Feng, Qiping; Kalari, Krishna; Fridley, Brooke L.; Jenkins, Gregory; Ji, Yuan; Abo, Ryan; Hebbring, Scott; Zhang, Jianping; Nye, Monica D.; Leeder, J. Steven; Weinshilboum, Richard. M.

    2010-01-01

    Betaine-homocysteine methyltransferase (BHMT) catalyzes the remethylation of homocysteine. BHMT is highly expressed in the human liver. In the liver, BHMT catalyzes up to 50% of homocysteine metabolism. Understanding the relationship between BHMT genetic polymorphisms and function might increase our understanding of the role of this reaction in homocysteine remethylation and in S-adenosylmethionine-dependent methylation. To help achieve those goals, we measured levels of BHMT enzyme activity and immunoreactive protein in 268 human hepatic surgical biopsy samples from adult subjects as well as 73 fetal hepatic tissue samples obtained at different gestational ages. BHMT protein levels were correlated significantly (p<0.001) with levels of enzyme activity in both fetal and adult tissue, but both were decreased in fetal tissue when compared with levels in the adult hepatic biopsies. To determine possible genotype-phenotype correlations, 12 tag SNPs for BHMT and the closely related BHMT2 gene were selected from SNPs observed during our own gene resequencing studies as well as from HapMap data were used to genotype DNA from the adult hepatic surgical biopsy samples, and genotype-phenotype association analysis was performed. Three SNPs (rs41272270, rs16876512, and rs6875201), located 28 kb upstream, in the 5′-UTR and in intron 1 of BHMT, respectively, were significantly correlated with both BHMT activity (p=3.41E-8, 2.55E-9 and 2.46E-10, respectively) and protein levels (p=5.78E-5, 1.08E-5 and 6.92E-6, respectively). We also imputed 230 additional SNPs across the BHMT and BHMT2 genes, identifying an additional imputed SNP, rs7700790, that was also highly associated with hepatic BHMT enzyme activity and protein. However, none of the 3 genotyped or one imputed SNPs displayed a “shift” during electrophoretic mobility shift assays. These observations may help us to understand individual variation in the regulation of BHMT in the human liver and its possible relationship

  7. Molecular cloning of a plant betaine-aldehyde dehydrogenase, an enzyme implicated in adaptation to salinity and drought.

    OpenAIRE

    Weretilnyk, E A; Hanson, A D

    1990-01-01

    Many plants, as well as other organisms, accumulate betaine (N,N,N-trimethylglycine) as a nontoxic or protective osmolyte under saline or dry conditions. In plants, the last step in betaine synthesis is catalyzed by betaine-aldehyde dehydrogenase (BADH, EC 1.2.1.8), a nuclear-encoded chloroplastic enzyme. A cDNA clone for BADH (1812 base pairs) was selected from a lambda gt10 cDNA library derived from leaves of salt-stressed spinach (Spinacia oleracea L.). The library was screened with oligon...

  8. Application of NMR-based metabonomics suggests a relationship between betaine absorption and elevated creatine plasma concentrations in catheterised sows

    DEFF Research Database (Denmark)

    Yde, Christian Clement; Westerhuis, Johan A.; Bertram, Hanne Christine S.;

    2012-01-01

    these metabolites from the small intestine. The LF diet resulted in a higher betaine concentration in the blood than the two high-fibre diets (P¼0·008). This leads to higher plasma concentrations of methionine (P¼0·0028) and creatine (P¼0·020) of endogenous origin. In conclusion, the use of NMR...... spectroscopy for measuring nutrient uptake in the present study elucidated the relationship between betaine uptake and elevated creatine plasma concentrations....

  9. Estimation of usual intake and food sources of choline and betaine in New Zealand reproductive age women.

    Science.gov (United States)

    Mygind, Vanessa L; Evans, Sophie E; Peddie, Meredith C; Miller, Jody C; Houghton, Lisa A

    2013-01-01

    Recently, choline has been associated with neurodevelopment, cognitive function and neural tube defect incidence. However, data on usual intakes are limited, and estimates of dietary intakes of choline and its metabolite betaine, are not available for New Zealanders. The objective of the present study was to determine usual intake and food sources of choline and betaine in a group of New Zealand reproductive age women. Dietary intake data were collected from a sample of 125 women, aged 18-40 years, by means of a 3-day weighed food record, and usual choline and betaine intake distributions were determined. The mean (SD) daily intakes of choline and betaine were 316 (66) mg and 178 (66) mg, respectively. The total choline intake relative to energy intake and body weight was 0.18 mg/kcal and 5.1 mg/kg, respectively. Only 16% of participants met or exceeded the Adequate Intake (AI) for adult women of 425 mg of choline. The top five major food contributors of choline were eggs, red meat, milk, bread and chicken; and of betaine were bread, breakfast cereal, pasta, grains and root vegetables (carrots, parsnips, beetroot, swedes). Our findings contribute towards the recent emergence of published reports on the range of dietary choline and betaine intakes consumed by free-living populations. In our sample of New Zealand women, few participants were meeting or exceeding the AI level. Given recent epidemiological evidence suggesting health benefits of increased choline and betaine intakes, recommendations should be made to encourage the consumption of choline and betaine-rich foods. PMID:23635379

  10. Identification and Disruption of BetL, a Secondary Glycine Betaine Transport System Linked to the Salt Tolerance of Listeria monocytogenes LO28

    OpenAIRE

    Sleator, Roy D.; Gahan, Cormac G. M.; Abee, Tjakko; Hill, Colin

    1999-01-01

    The trimethylammonium compound glycine betaine (N,N,N-trimethylglycine) can be accumulated to high intracellular concentrations, conferring enhanced osmo- and cryotolerance upon Listeria monocytogenes. We report the identification of betL, a gene encoding a glycine betaine uptake system in L. monocytogenes, isolated by functional complementation of the betaine uptake mutant Escherichia coli MKH13. The betL gene is preceded by a consensus ςB-dependent promoter and is predicted to encode a 55-k...

  11. Proteomics reveal a concerted upregulation of methionine metabolic pathway enzymes, and downregulation of carbonic anhydrase-III, in betaine supplemented ethanol-fed rats

    OpenAIRE

    Kharbanda, Kusum K; Vigneswara, Vasanthy; McVicker, Benita L.; Newlaczyl, Anna U.; Bailey, Kevin; Tuma, Dean; David E Ray; Carter, Wayne G.

    2009-01-01

    We employed a proteomic profiling strategy to examine the effects of ethanol and betaine diet supplementation on major liver protein level changes. Male Wistar rats were fed control, ethanol or betaine supplemented diets for 4 weeks. Livers were removed and liver cytosolic proteins resolved by one-dimensional and two-dimensional separation techniques. Significant upregulation of betaine homocysteine methyltransferase-1, methionine adenosyl transferase-1, and glycine N-methyltransferase were t...

  12. Osmotically inducible uptake of betaine via amino acid transport system A in SV-3T3 cells.

    Science.gov (United States)

    Petronini, P G; De Angelis, E; Borghetti, A F; Wheeler, K P

    1994-05-15

    The osmotically inducible uptake of betaine (NNN-trimethylglycine) by SV-3T3 cells has been studied and compared with the similar process in MDCK cells. Betaine uptake by SV-3T3 cells could be described in terms of a saturable, Na(+)-dependent, component plus a small non-saturable, Na(+)-independent, component. Transport was active, producing considerable accumulation of betaine in the cells. After exposure of the cells to hypertonic conditions for 6 h, there was a marked increase in betaine uptake. Kinetic analysis indicated that this increase resulted from an increase in the Vmax. value of the saturable component, from about 88 to 185 nmol of betaine/5 min per mg of protein, the corresponding Km values of about 15 and 10 mM not being significantly different. This induction of transport activity was detectable only after about 2 h exposure of the cells to hypertonic medium, closely paralleling an induction of influx of N-methylaminoisobutyric acid, and was prevented by the presence of cycloheximide. Betaine influx was markedly inhibited by several neutral amino acids, particularly those transported by system A, such as N-methylaminoisobutyric acid and the imino acid proline. A high concentration (25 mM) of betaine also significantly inhibited the uptake of proline by SV-3T3 cells. Although very similar results were obtained with MDCK cells, prolonged exposure of cells to hypertonic conditions revealed distinct differences. When the hypertonic incubation was extended from 6 h to 24 h, betaine transport in SV-3T3 cells either remained the same or decreased, whereas it showed a further marked increase in MDCK cells, and also became sensitive to inhibition by gamma-aminobutyric acid. mRNA for the betaine transporter BGT-1 [Yamauchi, Uchida, Kwon, Preston, Brooks Robey, Garcia-Perez, Burg and Handler (1992) J. Biol. Chem. 267, 649-652] was detectable in MDCK cells exposed to hypertonic medium for 24 h, but not in SV-3T3 cells under any conditions. It is concluded that

  13. Structure-activity study of new inhibitors of human betaine-homocysteine S-methyltransferase

    Czech Academy of Sciences Publication Activity Database

    Vaněk, Václav; Buděšínský, Miloš; Kabeleová, Petra; Šanda, Miloslav; Kožíšek, Milan; Hančlová, Ivona; Mládková, Jana; Brynda, Jiří; Rosenberg, Ivan; Koutmos, M.; Garrow, T. A.; Jiráček, Jiří

    2009-01-01

    Roč. 52, č. 12 (2009), s. 3652-3665. ISSN 0022-2623 R&D Projects: GA MŠk 1M0508 Grant ostatní: GA MŠk(CZ) LC06077; NIH(US) R01TW0052501 Institutional research plan: CEZ:AV0Z40550506 Keywords : BHMT * betain * homocysteine * methionine * inhibitor Subject RIV: CE - Biochemistry Impact factor: 4.802, year: 2009

  14. Hydration and vibrational dynamics of betaine (N,N,N-trimethylglycine).

    Science.gov (United States)

    Li, Tanping; Cui, Yaowen; Mathaga, John; Kumar, Revati; Kuroda, Daniel G

    2015-06-01

    Zwitterions are naturally occurring molecules that have a positive and a negative charge group in its structure and are of great importance in many areas of science. Here, the vibrational and hydration dynamics of the zwitterionic system betaine (N,N,N-trimethylglycine) is reported. The linear infrared spectrum of aqueous betaine exhibits an asymmetric band in the 1550-1700 cm(-1) region of the spectrum. This band is attributed to the carboxylate asymmetric stretch of betaine. The potential of mean force computed from ab initio molecular dynamic simulations confirms that the two observed transitions of the linear spectrum are related to two different betaine conformers present in solution. A model of the experimental data using non-linear response theory agrees very well with a vibrational model comprising of two vibrational transitions. In addition, our modeling shows that spectral parameters such as the slope of the zeroth contour plot and central line slope are both sensitive to the presence of overlapping transitions. The vibrational dynamics of the system reveals an ultrafast decay of the vibrational population relaxation as well as the correlation of frequency-frequency correlation function (FFCF). A decay of ∼0.5 ps is observed for the FFCF correlation time and is attributed to the frequency fluctuations caused by the motions of water molecules in the solvation shell. The comparison of the experimental observations with simulations of the FFCF from ab initio molecular dynamics and a density functional theory frequency map shows a very good agreement corroborating the correct characterization and assignment of the derived parameters. PMID:26049458

  15. Betaine reduces the expression of inflammatory adipokines caused by hypoxia in human adipocytes.

    Science.gov (United States)

    Olli, K; Lahtinen, S; Rautonen, N; Tiihonen, K

    2013-01-14

    Obesity is characterised by a state of chronic low-grade inflammation and the elevated circulating and tissue levels of inflammatory markers, including inflammation-related adipokines, released from white adipose tissue. The expression and release of these adipokines generally rises as the adipose tissue expands and hypoxic conditions start to develop within the tissue. Here, the effect of betaine, a trimethylglycine having a biological role as an osmolyte and a methyl donor, on the expression of inflammation-related markers was tested in human adipocytes under hypoxia. Differentiated adipocytes were cultivated under low (1 %) oxygen tension for 8-20 h. The expression of different adipokines, including IL-6, leptin, PPARγ, TNF-α and adiponectin, was measured by quantitative PCR by determining the relative mRNA level from the adipocytes. Hypoxia, in general, led to a decrease in the expression of PPARγ mRNA in human adipocytes, whereas the expression levels of leptin and IL-6 mRNA were substantially increased by hypoxia. The cultivation of adipocytes under hypoxia also led to a reduction in the expression of TNF-α mRNA. The results showed that hypoxia increased the relative quantification of leptin gene transcription, and that betaine (250 μmol/l) reduced this effect, caused by low oxygen conditions. Under hypoxia, betaine also reduced the mRNA level of the pro-inflammatory markers IL-6 and TNF-α. These results demonstrate that the extensive changes in the expression of inflammation-related adipokines in human adipocytes caused by hypoxia can be diminished by the presence of physiologically relevant concentrations of betaine. PMID:22424556

  16. The association of betaine, homocysteine and related metabolites with cognitive function in Dutch elderly people

    OpenAIRE

    Eussen, S.J.P.M.; Ueland, P. M.; Clarke, R; Blom, H.J.; Hoefnagels, W.H.L.; Staveren, van, R.; Groot, de, W.T.

    2007-01-01

    The importance of the one-carbon metabolites, choline and homocysteine, to brain function is well known. However, the associations between the one-carbon metabolites choline, betaine, methionine and dimethylglycine with cognition in elderly are unclear. We therefore examined the associations of these metabolites with cognition in a double-blind, placebo-controlled trial. Individuals (n 195) were randomized to receive daily oral capsules with either 1000 ¿g cobalamin (vitamin B12), or 1000 ¿g ...

  17. Betaine: a potential agent for the treatment of hepatopathy associated with short bowel syndrome

    Directory of Open Access Journals (Sweden)

    Guilherme Teixeira Araújo

    2014-06-01

    Full Text Available Background: The hepatopathy associated with short bowel syndrome (SBS is a multifactorial disease associated with poor prognosis. Besides intestinal transplantation, no other treatment has been shown effective. The current study evaluated the efficacy of betaine for the treatment of hepatopathy associated with SBS. Methods: A prospective, unicentric, non-placebo controlled trial was carried out. After initial evaluation, 10g of betaine anhydrous was administrated to SBS patients in two divided doses for three months. The hepatic steatosis was assessed through nuclear magnetic resonance (NMR, the inflammatory response by interleukin-6 (IL-6, tumor necrosis factor-α (TNF-α and ferritin, besides the hepatic lesion through hepatic enzymes and bilirubin. Furthermore, the effect of betaine on homocysteine was evaluated as well as its safety and tolerability in this group of patients. Results: After three months supplementation, patients showed decreased percentage of hepatic fat (p = 0.03 through triphasic NMR examination. There was no significant reduction of serum levels for inflammatory proteins and hepatic lesion markers. Homocysteinemia also did not present significant decrease. The most prevalent side effects were diarrhea and nausea, reported in 62% of the participants; however, these symptoms were transient and not severe enough to justify the treatment interruption. Parenteral nutrition-dependent patients did not present different hepatic lesion degree compared to patients who do not need the prolonged use of it. Conclusions: Betaine was shown to be a potential agent for the treatment of hepatopathy associated with SBS, which was evidenced by NMR, although the markers for hepatic lesion have not presented significant decrease.

  18. Hepatoprotective Effects of Betaine Against Oxidative Stress Induced by Levodopa and Benserazide in Rats

    Directory of Open Access Journals (Sweden)

    M Alirezaei

    2015-02-01

    Results: The study results indicated that the treatment of rats with levodopa and benserazide significantly increased total homocysteine (tHcy in plasma of the LD/Ben. group in comparison with the other groups (p <0.05. tHcy concentration was also significantly higher in LD group in comparison with control, betaine and LD/Bet. groups. Lipid peroxidation (TBARS amount of liver increased significantly in LD/Ben. group when compared to the control group which this index decreased by betaine treatment. In contrast, glutathione peroxidase and superoxide dismutase activities in liver were significantly higher in the LD-treated rats as compared to the LD/Ben. group. Serumic dopamine concentration decreased significantly in LD/Ben.-treated rats in comparison with LD and LD/Bet. groups. Conclusion: Taken together, it seems that betaine acts as an antioxidant agent regarding decrease of LD/Ben.-induced oxidative stress and is able to decrease their oxidative effects in liver of rats.

  19. Proline, glycine betaine, total phenolics and pigment contents in response to osmotic stress in maize seedlings

    Directory of Open Access Journals (Sweden)

    SAJJAD MOHARRAMNEJAD

    2015-12-01

    Full Text Available In order to evaluate the fresh weight, RWC, pigment content, total phenolics, proline and glycine betaine responses of maize inbred lines to osmotic stress, a factorial experiment was carried out under laboratory conditions with two maize inbred lines (B73 and MO17 and two osmotic stress levels induced by PEG (control and -0.6 MPa. Fresh weight significantly decreased under drought stress. On the basis of percent inhibition in fresh weight at the osmotic stress MO17 was ranked as tolerant (inhibition 45.30%, and B73 drought sensitive (inhibition more than 50%. Leaf relative water content (RWC was significantly decreased in both inbred lines under osmotic stress. The pigment concentrations were substantially declined in both maize inbreds under osmotic stressed conditions. However, this reduction was less in B73 than MO17. Osmoitc stress declined the levels of total phenolics in both maize inbreds. On the other hand, the osmotic stress markedly enhanced the levels of proline and glycine betaine in both maize inbreds, but this was more pronounced in MO17. The present results showed that osmotic stress retards the growth and some biochemical attributes of maize inbreds. In conclusion, the level of proline and glycine betaine in maize could improve drought tolerance.

  20. Osmotic Regulation of Betaine Content in Leymus chinensis Under Saline-alkali Stress and Cloning and Expression of Betaine Aldehyde Dehydrogenase(BADH)Gene

    Institute of Scientific and Technical Information of China (English)

    CUI Xi-yan; WANG Yong; GUO Ji-xun

    2008-01-01

    The potted Leymus chinensis seedlings were treated with saline-alkali solution of six different(from Ⅰ to Ⅵ) concentrations.The results demonstrate that the betaine content and Betaine-aldehyde dehydrogenase(BADH:EC 1.2.1.8) activities have a direct relation with increased stressing time in the same treatment;both exhibit a single peak with increasing the concentration of saline-alkali solution,and number V shows the highest value.The BADH gene of Leymus chinensis Was cloned by RT-PCR and RACE technology and Was designated as LcBADH.The cDNA sequence of LcBADH Was 1774bp including the open reading frame(ORF)of 1521bp(coding 506 amino acids).The vector of prokaryotic expression was constructed by inserting the LcBADH gene fragment into pET30a(+)and transformed into E. coli BL21(DE3).The result of SDS-PAGE shows that the idio-protein with a molecular mass of 56.78 kDa was effectively expressed in the recombinant bacteria induced by isopropyl β-D-thiogalactoside(IPTG).

  1. Homocystinuria due to cystathionine beta-synthase deficiency--the effects of betaine treatment in pyridoxine-responsive patients.

    Science.gov (United States)

    Wilcken, D E; Dudman, N P; Tyrrell, P A

    1985-12-01

    Homocystinuria due to cystathionine beta-synthase deficiency may be responsive to pyridoxine, a precursor of the cofactor pyridoxal phosphate, and the amount of residual enzyme activity present is the probable determinant of this. In six treated pyridoxine-responsive patients whose biochemical control of fasting plasma amino acid levels appeared optimal, we assessed the effects on plasma amino acids of standard oral methionine loads (4g/m2 of body area) before and after adding betaine (trimethylglycine) 6 g/d, to the treatment regimen of pyridoxine and folic acid. Our aim was to define the capacity of these patients to metabolize methionine and to determine whether betaine would effect a reduction in postload homocysteine levels. During the 24 hours after the methionine challenge all patients had higher plasma methionine and homocysteine and lower cysteine than did 17 normal subjects. After betaine these homocysteine responses were reduced to near normal, and there was a trend toward increased methionine. There was a direct correlation between premethionine fasting homocysteine and mean homocysteine responses during the 24 hours following the methionine load, both before (r = 0.79) and after betaine (r = 0.71). Betaine also increased plasma cysteine levels in patients with the more severe biochemical abnormalities. After betaine there were modest increases in plasma serine (mean increase 25%; P less than 0.025). Since the vascular complications of homocystinuria are related to increased plasma homocysteine, betaine therapy may reduce this risk in patients receiving a standard pyridoxine and folic acid regimen in whom there are abnormal homocysteine responses after a standard methionine load. PMID:3934499

  2. Effect of Betaine on the Regulation of the Lipid Metabolism in Laying Hen

    Institute of Scientific and Technical Information of China (English)

    ZOU Xiao-ting; LU Jian-jun

    2002-01-01

    The experiment was conducted to investigate the effects of betaine on lipid metabolism of laying hens. 1 600 ISA brown laying hens of 20 weeks of age were alloted randomly into 4 groups each with 4 replicates of 100 layers, the layers were given a corn-soybean basal diet with 0,400,600 and 800 mg/kg betaine respectirely. Results indicated that supplementation of 600 mg/kg betaine significantly improved lay performance, and increased egg production 8.67 % ( P < 0.04), decreased feed/egg ratio by 9.02 % ( P < 0.03) compared with control, but there were no significant differences in egg weight and feed intake. It was found that supplementation of 600 mg/kg betaine decreased weights of abdominal fat by 19.63 % (P < 0.02)and 22.35%(P<0.02), and decreased liver fat by 8.52%(P<0.05) and 16.28%(P<0.01) in 50 and 70 weeks of age respectively. Compared with control, in 70 weeks of age, activity of LPL in abdominal fat was decreased by 44.83% (P < 0.01), HSL activity in abdominal fat increased by 50.0% (P < 0.02), and MDH activity in liver was decreased by 28.74% (P<0.03). Supplementation of 600 betaine increased levels of T3 by 43.29%( P < 0.05) and 43.95 % ( P < 0.02) in 50 and 70 weeks of age respectively, and increased the concentration of cAMP in hypothalamus and anterior pituitary by 59.89% ( P < 0.01) and 24.03% ( P < 0.05) respectively in 70 weeks of age. The concentration of serum gluclose (GLU) , FFA and phospholipid were increased by 44.50% (P<0.03), 19.66%(P<0.03) and 71.66% (P<0.01) in 50 weeks of age. The concentration of serum gluclose (GLU), FFA and phospholipid were increased by 16.25% ( P < 0.05), 22.51% ( P < 0.02) and 22.42%(P<0.01) in 70 weeks of age.

  3. Corticoadrenal activity in rat regulates betaine-homocysteine S-methyltransferase expression with opposite effects in liver and kidney

    Indian Academy of Sciences (India)

    Osvaldo Fridman; Analía V Morales; Laura E Bortoni; Paula C Turk-Noceto; Elio A Prieto

    2012-03-01

    Betaine-homocysteine -methyltransferase (BHMT) is an enzyme that converts homocysteine (Hcy) to methionine using betaine as a methyl donor. Betaine also acts as osmolyte in kidney medulla, protecting cells from high extracellular osmolarity. Hepatic BHMT expression is regulated by salt intake. Hormones, particularly corticosteroids, also regulate BHMT expression in rat liver. We investigated to know whether the corticoadrenal activity plays a role in kidney BHMT expression. BHMT activity in rat kidneys is several orders of magnitude lower than in rat livers and only restricted to the renal cortex. This study confirms that corticosteroids stimulate BHMT activity in the liver and, for the first time in an animal model, also up-regulate the BHMT gene expression. Besides, unlike the liver, corticosteroids in rat kidney down-regulate BHMT expression and activity. Given that the classical effect of adrenocortical activity on the kidney is associated with sodium and water re-absorption by the distal tubule leading to volume expansion, by promoting lesser use of betaine as a methyl donor, corticosteroids would preserve betaine for its other role as osmoprotectant against changes in the extracellular osmotic conditions. We conclude that corticosteroids are, at least in part, responsible for the inhibition of BHMT expression and activity in rat kidneys.

  4. Betaine inhibits in vitro and in vivo angiogenesis through suppression of the NF-κB and Akt signaling pathways.

    Science.gov (United States)

    Yi, Eui-Yeun; Kim, Yung-Jin

    2012-11-01

    Angiogenesis is defined as the formation of new blood vessels form existing vessels surrounding a tumor. The process of angiogenesis is an important step for tumor growth and metastasis, as is inflammation. Thus, angiogenesis inhibitors that suppress inflammation have been studied as an anticancer treatment. Recently, many research groups have investigated the anti-angiogenic activity of natural compounds since some have been demonstrated to have anticancer properties. Among many natural compounds, we focused on betaine, which is known to suppress inflammation. Betaine, trimethylglycine (TMG), was first discovered in the juice of sugar beets and was later shown to be present in wheat, shellfish and spinach. In Southeast Asia, betaine is used in traditional oriental medicine for the treatment of hepatic disorders. Here, we report the anti-angiogenic action of betaine. Betaine inhibited in vitro angiogenic cascade, tube formation, migration and invasion of human umbilical vein endothelial cells (HUVECs). Betaine also inhibited in vivo angiogenesis in the mouse Matrigel plug assay. The mRNA expression levels of basic fibroblast growth factor (bFGF), matrix metalloproteinase-2 (MMP-2) and matrix metalloproteinase-9 (MMP-9) in HUVECs were decreased by betaine treatment. In addition, betaine suppressed NF-κB and Akt activation. PMID:22940742

  5. Cardioprotective potential of Irish macroalgae: generation of glycine betaine and dimethylsulfoniopropionate containing extracts by accelerated solvent extraction.

    Science.gov (United States)

    Valverde, Juan; Hayes, Maria; McLoughlin, Pádraig; Rai, Dilip K; Soler-Vila, Anna

    2015-06-01

    Accelerated solvent extraction (ASE®) was used to generate 18 macroalgal extracts from Irish seaweeds. The glycine betaine and dimethylsulfoniopriopionate content of the generated ASE® extracts were estimated using (1)H-NMR and confirmed for selected extracts using ultra performance liquid chromatography and mass spectrometry. Dimethylsulfoniopriopionate was only identified in the ASE® extract generated from Codium fragile ISCG0029. Glycine betaine was identified in the ASE® extract generated from Ulva intestinalis ISCG0356 using (1)H-NMR. Mass spectrometry analysis found that the seaweed species Cytoseira nodicaulis ISCG0070, Cytoseira tamariscofolia ISCG0283, and Polysiphonia lanosa ISCG0462 also had a glycine betaine content that ranged from 1.39 ng/ml to 105.11 ng/ml. Generated ASE® macroalgal extracts have potential for use as functional food ingredients in food products. PMID:26018918

  6. SIT1 is a betaine/proline transporter that is activated in mouse eggs after fertilization and functions until the 2-cell stage.

    Science.gov (United States)

    Anas, Mohamed-Kheir Idris; Lee, Martin B; Zhou, Chenxi; Hammer, Mary-Anne; Slow, Sandy; Karmouch, Jennifer; Liu, X Johné; Bröer, Stefan; Lever, Michael; Baltz, Jay M

    2008-12-01

    Betaine (N,N,N-trimethylglycine) added to culture media is known to substantially improve the development of preimplantation mouse embryos in vitro, and to be imported into 1-cell embryos by a transporter that also accepts proline. Here, we found that the betaine/proline transporter is active in preimplantation mouse embryos only for a short period of development, between the 1- and 2-cell stages. Betaine/proline transport was activated after fertilization, beginning approximately 4 hours post-egg activation and reaching a maximum by approximately 10 hours. One- and 2-cell embryos contained endogenous betaine, indicating that a likely function for the transporter in vivo is the accumulation or retention of intracellular betaine. The appearance of transport activity after egg activation was independent of protein synthesis, but was reversibly blocked by disruption of the Golgi with brefeldin A. We assessed two candidates for the betaine/proline transporter: SIT1 (IMINO; encoded by Slc6a20a) and PROT (Slc6a7). mRNA from both genes was present in eggs and 1-cell embryos. However, when exogenously expressed in Xenopus oocytes, mouse PROT did not transport betaine and had an inhibition profile different from that of the embryonic transporter. By contrast, exogenously expressed mouse SIT1 transported both betaine and proline and closely resembled the embryonic transporter. A morpholino oligonucleotide designed to block translation of SIT1, when present from the germinal vesicle stage, blocked the appearance of betaine transport activity in parthenogenotes. Thus, SIT1 is likely to be a developmentally restricted betaine transporter in mouse preimplantation embryos that is activated by fertilization. PMID:19029042

  7. Uptake of betaine into mouse cumulus-oocyte complexes via the SLC7A6 isoform of y+L transporter.

    Science.gov (United States)

    Corbett, Hannah E; Dubé, Chantal D; Slow, Sandy; Lever, Michael; Trasler, Jacquetta M; Baltz, Jay M

    2014-04-01

    Betaine (N,N,N-trimethylglycine) has previously been shown to function in cell volume homeostasis in early mouse embryos and also to be a key donor to the methyl pool in the blastocyst. A betaine transporter (SLC6A20A or SIT1) has been shown to be activated after fertilization, but there is no saturable betaine uptake in mouse oocytes or eggs. Unexpectedly, the same high level of betaine is present in mature metaphase II (MII) eggs as is found in one-cell embryos despite the lack of transport in oocytes or eggs. Significant saturable betaine transport is, however, present in intact cumulus-oocyte complexes (COCs). This transport system has an affinity for betaine of ∼227 μM. The inhibition profile indicates that betaine transport by COCs could be completely blocked by methionine, proline, leucine, lysine, and arginine, and transport is dependent on Na(+) but not Cl(-). This is consistent with transport by a y+L-type amino acid transport system. Both transcripts and protein of one y+L isoform, SLC7A6 (y+LAT2), are present in COCs, with little or no expression in isolated germinal vesicle (GV)-stage oocytes, MII eggs, or one-cell embryos. Betaine accumulated by COCs is transferred into the enclosed GV oocyte, which requires functional gap junctions. Thus, at least a portion of the endogenous betaine in MII eggs could be derived from transport into cumulus cells and subsequent transfer into the enclosed oocyte before gap junction closure during meiotic maturation. The oocyte-derived betaine then could be regulated and supplemented by the SIT1 transporter that arises in the embryo after fertilization. PMID:24599290

  8. Radiotracer evidence implicating phosphoryl and phosphatidyl bases as intermediates in betaine synthesis by water-stressed barley leaves

    International Nuclear Information System (INIS)

    In pulse-chase experiments with barley wilted leaves, label from [14C]-ethanolamine continued to accumulate in betaine as it was being lost from phosphatidylcholine. When [14C]monomethylethanolamine was supplied to wilted leaves, phosphatidylcholine was initially more heavily labeled than betaine. These results are qualitatively consistent with a precursor-to-product relationship between phosphatidylcholine and betaine. The following experiments, in which tracer amounts of [14C]ethanolamine or [14C]formate were supplied to wilted barley leaves, implicated phosphoryl and phosphatidyl bases as intermediates in the methylation steps between ethanolamine and phosphatidylcholine. Label from both [14C]ethanolamine and [14C]formate entered phosphorylmonomethylethanolamine and phosphorylcholine very rapidly; these phosphoryl bases were the most heavily labeled products at 15 to 30 minutes after label addition and lost label rapidly as the fed 14C-labeled precursor was depleted. Phosphatidylmonomethylethanolamine and phosphatidylcholine were also significantly labeled from [14C]ethanolamine and [14]formate at early times; the corresponding free bases and nucleotide bases were not. Addition of a trapping pool of phosphorylcholine reduced [14C]ethanolamine conversion to both phosphatidylcholine and betaine, and resulted in accumulation of labe in the trap. A computer model of the synthesis of betaine via phosphatidylcholine was developed from 14C kinetic data. The model indicates that about 20% of the total leaf phosphatidylcholine behaves as an intermediate in betaine biosynthesis and that a marked decrease (greater than or equal to2-fold) in the half-life of this metabolically active phosphatidylcholine fraction accompanies wilting

  9. Dietary Betaine Impacts the Physiological Responses to Moderate Heat Conditions in a Dose Dependent Manner in Sheep.

    Science.gov (United States)

    DiGiacomo, Kristy; Simpson, Sarah; Leury, Brian J; Dunshea, Frank R

    2016-01-01

    Heat exposure (HE) results in decreased production in ruminant species and betaine is proposed as a dietary mitigation method. Merino ewes ( n = 36, 40 kg, n = 6 per group) were maintained at thermoneutral (TN, n = 18, 21 °C) or cyclical HE ( n = 18, 18-43 °C) conditions for 21 days, and supplemented with either 0 (control), 2 or 4 g betaine/day. Sheep had ad libitum access to water and were pair fed such that intake of sheep on the TN treatment matched that of HE animals. Heart rate (HR), respiration rate (RR), rectal (T R ) and skin temperatures (T S ) were measured 3 times daily (0900 h, 1300 h, 1700 h). Plasma samples were obtained on 8 days for glucose and NEFA analysis. The HE treatment increased T R by 0.7 °C (40.1 vs. 39.4 °C for HE and TN respectively p breaths/min (133 vs. 87 breaths/min, p breaths/min for control, 2 and 4 g betaine/day, p < 0.001) compared to control. Betaine supplementation decreased plasma NEFA concentrations by ~25 μM (80, 55 and 54 μmol/L for 0, 2 and 4 g/day respectively, p = 0.05). These data indicate that dietary betaine supplementation at 2 g betaine/day provides improvements in physiological responses typical of ewes exposed to heat stress and may be a beneficial supplement for the management of sheep during summer. PMID:27589811

  10. Betaine supplementation reduces congenital defects after prenatal alcohol exposure (Conference Presentation)

    Science.gov (United States)

    Karunamuni, Ganga; Gu, Shi; Doughman, Yong Qiu; Sheehan, Megan M.; Ma, Pei; Peterson, Lindsy M.; Linask, Kersti K.; Jenkins, Michael W.; Rollins, Andrew M.; Watanabe, Michiko

    2016-03-01

    Over 500,000 women per year in the United States drink during pregnancy, and 1 in 5 of this population also binge drink. As high as 20-50% of live-born children with prenatal alcohol exposure (PAE) present with congenital heart defects including outflow and valvuloseptal anomalies that can be life-threatening. Previously we established a model of PAE (modeling a single binge drinking episode) in the avian embryo and used optical coherence tomography (OCT) imaging to assay early-stage cardiac function/structure and late-stage cardiac defects. At early stages, alcohol/ethanol-exposed embryos had smaller cardiac cushions and increased retrograde flow. At late stages, they presented with gross morphological defects in the head and chest wall, and also exhibited smaller or abnormal atrio-ventricular (AV) valves, thinner interventricular septae (IVS), and smaller vessel diameters for the aortic trunk branches. In other animal models, the methyl donor betaine (found naturally in many foods such as wheat bran, quinoa, beets and spinach) ameliorates neurobehavioral deficits associated with PAE but the effects on heart structure are unknown. In our model of PAE, betaine supplementation led to a reduction in gross structural defects and appeared to protect against certain types of cardiac defects such as ventricular septal defects and abnormal AV valvular morphology. Furthermore, vessel diameters, IVS thicknesses and mural AV leaflet volumes were normalized while the septal AV leaflet volume was increased. These findings highlight the importance of betaine and potentially methylation levels in the prevention of PAE-related birth defects which could have significant implications for public health.

  11. Transcriptional Regulation and Posttranslational Activity of the Betaine Transporter BetL in Listeria monocytogenes Are Controlled by Environmental Salinity

    OpenAIRE

    Sleator, Roy D.; Wood, Janet M.; Hill, Colin

    2003-01-01

    While the genetic elements contributing to the salinity tolerance of Listeria monocytogenes have been well characterized, the regulatory signals and responses (genetic and/or biochemical) that govern these mechanisms have yet to be elucidated. Encoded by betL, the first genetic element to be linked to listerial osmotolerance, the secondary betaine uptake system BetL is a member of the betaine-carnitine-choline transporter family. Preceded by consensus σA- and σB-dependent promoter sites, betL...

  12. Choline but not its derivative betaine blocks slow vacuolar channels in the halophyte Chenopodium quinoa: implications for salinity stress responses.

    Science.gov (United States)

    Pottosin, Igor; Bonales-Alatorre, Edgar; Shabala, Sergey

    2014-11-01

    Activity of tonoplast slow vacuolar (SV, or TPC1) channels has to be under a tight control, to avoid undesirable leak of cations stored in the vacuole. This is particularly important for salt-grown plants, to ensure efficient vacuolar Na(+) sequestration. In this study we show that choline, a cationic precursor of glycine betaine, efficiently blocks SV channels in leaf and root vacuoles of the two chenopods, Chenopodium quinoa (halophyte) and Beta vulgaris (glycophyte). At the same time, betaine and proline, two major cytosolic organic osmolytes, have no significant effect on SV channel activity. Physiological implications of these findings are discussed. PMID:25240200

  13. Prevention of strychnine-induced seizures and death by the N-methylated glycine derivatives betaine, dimethylglycine and sarcosine.

    Science.gov (United States)

    Freed, W J

    1985-04-01

    Betaine (N,N,N-trimethylglycine) and N,N-dimethylglycine have been reported to have anticonvulsant properties in animals. The purpose of the present study was to determine whether these compounds can antagonize strychnine-induced seizures when administered intraperitoneally and to compare their effects with those of sarcosine (N-methylglycine) and glycine. Betaine, N,N-dimethylglycine and sarcosine were equipotent in decreasing the incidence of seizures and death, causing a 38 to 72 percent decrease in the incidence of seizures and death at a dosage of 5 mmole/kg. Glycine had no effect. Thus anticonvulsant activity is conferred to glycine by a single N-methylation. PMID:2581277

  14. Scientific Opinion on the safety and efficacy of betaine anhydrous as a feed additive for all animal species based on a dossier submitted by Trouw Nutritional International B.V.

    Directory of Open Access Journals (Sweden)

    EFSA Panel on Additives and Products or Substances used in Animal Feed (FEEDAP

    2013-05-01

    Full Text Available Glycine betaine (betaine acts as a methyl group donor in transmethylation reactions in organisms. Betaine occurs in numerous vertebrate tissues as an osmolyte, ensuring osmoprotection. Betaine is safe for piglets at the maximum supplementation rate of 2 000 mg/kg complete feed with a margin of safety below 5. This conclusion is extended to all pigs and extrapolated to all animal species and categories. The use of betaine as a feed additive up to a supplementation of 2 000 mg/kg complete feed is unlikely to pose concerns for consumer safety. In the absence of data, betaine anhydrous should be considered hazardous by inhalation, irritant to skin, eyes and mucous membranes and a skin sensitiser. The supplementation of feed with betaine anhydrous does not pose a risk to the environment. Betaine has the potential to become efficacious in all animal species and categories when administered via feed or water for drinking. The FEEDAP Panel made some recommendations on (i introduction of a maximum content for supplemental betaine in complete feed and water for drinking; (ii avoidance of simultaneous use of betaine in feed and water for drinking; and (iii avoidance of simultaneous inclusion of betaine and choline chloride in premixtures.

  15. Synthesis and surface activities of a novel di-hydroxyl-sulfate-betaine-type zwitterionic gemini surfactants

    International Nuclear Information System (INIS)

    A series of novel di-hydroxyl-sulfate-betaine-type zwitterionic gemini surfactants of 1,2-bis[N-ethyl-N-(2-hydroxyl-3-sulfopropyl)-alkylammonium] alkyl betaines (DBAs–n, where s and n represent the spacer length of 2, 4 and 6 and the hydrocarbon chain length of 8, 12, 14, 16 and 18, respectively) were synthesized by reacting alkylamine with sodium 3-chloro-2-hydroxypropanesulfonate (the alternative sulphonated agent), followed by the reactions with a,ω-dibromoalkyl and then ethyl bromide. Their adsorption and aggregation properties were investigated by means of equilibrium surface tension, dynamic light-scattering (DLS) and transmission electron microscopy (TEM). DBAs–n gemini surfactants showed excellent surface activities and packed tightly at the interface. For example, the minimum CMC value for DBAs–n series was of the order of 10−5 M and the surface tension of water can be decreased as low as 22.2 mN/m. It was also found that the aggregates of DBAs–n solutions were significantly dependent on their hydrocarbon chain lengths. The aggregates changed from vesicles to entangled fiber-like micelles as the chain length increased from dodecyl to tetradecyl.

  16. Effect of exogenous proline, betaine, and carnitine on growth of Listeria monocytogenes in a minimal medium.

    Science.gov (United States)

    Beumer, R R; Te Giffel, M C; Cox, L J; Rombouts, F M; Abee, T

    1994-04-01

    Three Listeria monocytogenes strains isolated from food or food-processing environments were used to assess the response of this species to salinity in a chemically defined minimal medium. Growth in a minimal medium containing five essential amino acids and glucose as a carbon and energy source was comparable to growth in a rich medium (brain heart infusion broth). In the absence and presence of 3% NaCl the final cell numbers reached in minimal medium were 10(9) and 10(7) CFU/ml, respectively. Growth under the latter conditions could not be detected by spectrophotometry by measuring A660. Apparently, this technique was not suitable for these experiments since the detection level was > 10(7) CFU/ml. Exogenously added proline (10 mM), trimethylglycine (betaine) (1 mM), and beta-hydroxy-gamma-N-trimethyl aminobutyrate (carnitine) (1 mM) significantly stimulated growth under osmotic stress conditions in minimal medium at both 37 and 10 degrees C. Betaine and carnitine are present in foods derived from plants and animals, respectively. Therefore, these compounds can contribute significantly to growth of L. monocytogenes in various foods at high osmolarities. PMID:8017923

  17. Identification and disruption of BetL, a secondary glycine betaine transport system linked to the salt tolerance of Listeria monocytogenes LO28.

    Science.gov (United States)

    Sleator, R D; Gahan, C G; Abee, T; Hill, C

    1999-05-01

    The trimethylammonium compound glycine betaine (N,N, N-trimethylglycine) can be accumulated to high intracellular concentrations, conferring enhanced osmo- and cryotolerance upon Listeria monocytogenes. We report the identification of betL, a gene encoding a glycine betaine uptake system in L. monocytogenes, isolated by functional complementation of the betaine uptake mutant Escherichia coli MKH13. The betL gene is preceded by a consensus sigmaB-dependent promoter and is predicted to encode a 55-kDa protein (507 amino acid residues) with 12 transmembrane regions. BetL exhibits significant sequence homologies to other glycine betaine transporters, including OpuD from Bacillus subtilis (57% identity) and BetP from Corynebacterium glutamicum (41% identity). These high-affinity secondary transporters form a subset of the trimethylammonium transporter family specific for glycine betaine, whose substrates possess a fully methylated quaternary ammonium group. The observed Km value of 7.9 microM for glycine betaine uptake after heterologous expression of betL in E. coli MKH13 is consistent with values obtained for L. monocytogenes in other studies. In addition, a betL knockout mutant which is significantly affected in its ability to accumulate glycine betaine in the presence or absence of NaCl has been constructed in L. monocytogenes. This mutant is also unable to withstand concentrations of salt as high as can the BetL+ parent, signifying the role of the transporter in Listeria osmotolerance. PMID:10224004

  18. Betalain and betaine composition of greenhouse- or field-produced beetroot ( Beta vulgaris L.) and inhibition of HepG2 cell proliferation.

    Science.gov (United States)

    Lee, Eun Jin; An, Dami; Nguyen, Chau T T; Patil, Bhimanagouda S; Kim, Jeongyun; Yoo, Kil Sun

    2014-02-12

    The composition of betalain, red or yellow pigments, and betaine (trimethylglycine or glycinebetaine) of nine beetroot ( Beta vulgaris L.) cultivars produced in the greenhouse or field was studied. Inhibition of HepG2 cell proliferation by betanin and betaine was also tested. Four predominant betalains, two betacyanins (betanin and isobetanin) and two betaxanthins (vulgaxanthin I and miraxanthin V), were isolated and quantified. Betanin and vulgaxanthin I were the major compounds in red and yellow beetroot extracts, respectively, and they comprised >90% of the betalain content in the tested cultivars. The total betalain content of beetroots produced from the field was between 650 and 800 μg/g fresh weight, approximately 25% higher than those from the greenhouse. The betaine content of the beetroot grown in the field was between 3.0 and 4.8 mg/g fresh weight, approximately 20% higher than in plants from the greenhouse. There was great variation among the cultivars with respect to their contents of betalains and betaine. In vitro cancer cell cytotoxicity was evaluated using a 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyl tetrazolium bromide assay on HepG2 cells after exposure to betanin and betaine at concentrations ranging from 0 to 400 μg/mL and from 0 to 800 μg/mL for 48 h, respectively. Betanin resulted in a 49% inhibition of HepG2 cell proliferation at 200 μg/mL, and betaine yielded a 25% inhibition at 800 μg/mL, implying a higher cytotoxicity of betanin compared with betaine. The results indicated that the contents of health-beneficial compounds in beetroots, betalains and betaine, could be increased by modifying the growing conditions and that betanin and betaine extracted from beetroots had some anticancer effects against HepG2 cells. PMID:24467616

  19. Effects of betaine on ethanol-stimulated secretion of IGF-Ⅰ and IGFBP-1 in rat primary hepatocytes: involvement of p42/44 MAPK activation

    Institute of Scientific and Technical Information of China (English)

    Myeong Soo Lee; Myung-Sunny Kim; Soo Young Park; Chang-Won Kang

    2006-01-01

    AIM: To evaluate the effects of betaine on the ethanolinduced secretion of IGF-Ⅰ and IGFBP-1 using radioimmunoassay and Western blotting, respectively, in primary cultured rat hepatocytes.METHODS: Hepatocytes isolated from male Sprague-Dawley rats were incubated with various concentrations of ethanol and PD98059 procedures. The hepatocytes were also treated with different doses of betaine (10-5,10-4, and 10-3 mol/L). We measured IGF-Ⅰ and IGFBP-1 using radioimmunoassay and Western blotting, respectively.RESULTS: The ethanol-induced inhibition of IGF-Ⅰ secretion was attenuated by betaine in a concentration-dependent manner in primary cultured rat hepatocytes. At 10-3 mol/L, betaine significantly increased IGF-Ⅰ secretion but decreased IGFBP-1 secretion. In addition, p42/44 mitogen-activated protein kinase (MAPK) activity was accelerated significantly from 10 min to 5 h after treatment with 10-3 mol/L betaine. Furthermore, the changes in IGF-1 and IGFBP-1 secretion resulting from the increased betaine-induced p42/44 MAPK activity in primary cultured rat hepatocytes was blocked by treatment with the MAPK inhibitor PD98059. Betaine treatment blocked the ethanol-induced inhibition of IGF-Ⅰ secretion and p42/44 MAPK activity, and the ethanol-induced increase in IGFBP-1 secretion.CONCLUSION: Betaine modulates the secretion of IGF-Ⅰ and IGFBP-1 via the activation of p42/44 MAPK in primary cultured rat hepatocytes. Betaine also alters the MAPK activations induced by ethanol.

  20. Assessment of the effect of betaine on p16 and c-myc DNA methylation and mRNA expression in a chemical induced rat liver cancer model

    International Nuclear Information System (INIS)

    The development and progression of liver cancer may involve abnormal changes in DNA methylation, which lead to the activation of certain proto-oncogenes, such as c-myc, as well as the inactivation of certain tumor suppressors, such as p16. Betaine, as an active methyl-donor, maintains normal DNA methylation patterns. However, there are few investigations on the protective effect of betaine in hepatocarcinogenesis. Four groups of rats were given diethylinitrosamine (DEN) and fed with AIN-93G diets supplemented with 0, 10, 20 or 40 g betaine/kg (model, 1%, 2%, and 4% betaine, respectively), while the control group, received no DEN, fed with AIN-93G diet. Eight or 15 weeks later, the expression of p16 and c-myc mRNA was examined by Real-time PCR (Q-PCR). The DNA methylation status within the p16 and c-myc promoter was analyzed using methylation-specific PCR. Compared with the model group, numbers and areas of glutathione S-transferase placental form (GST-p)-positive foci were decreased in the livers of the rats treated with betaine (P < 0.05). Although the frequency of p16 promoter methylation in livers of the four DEN-fed groups appeared to increase, there is no difference among these groups after 8 or 15 weeks (P > 0.05). Betaine supplementation attenuated the down-regulation of p16 and inhibited the up-regulation of c-myc induced by DEN in a dose-dependent manner (P < 0.01). Meanwhile, increases in levels of malondialdehyde (MDA) and glutathione S-transferase (GST) in model, 2% and 4% betaine groups were observed (P < 0.05). Finally, enhanced antioxidative capacity (T-AOC) was observed in both the 2% and 4% betaine groups. Our data suggest that betaine attenuates DEN-induced damage in rat liver and reverses DEN-induced changes in mRNA levels

  1. Efficiency influence of exogenous betaine on anaerobic sequencing batch biofilm reactor treating high salinity mustard tuber wastewater.

    Science.gov (United States)

    He, Qiang; Kong, Xiang-Juan; Chai, Hong-Xiang; Fan, Ming-Yu; Du, Jun

    2012-01-01

    When treating a composite mustard tuber wastewater with high concentrations of salt (about 20 g Cl(-) L(-1)) and organics (about 8000 mg L(-1) COD) by an anaerobic sequencing batch biofilm reactor (ASBBR) in winter, both high salinity and low temperature will inhibit the activity of anaerobic microorganisms and lead to low treatment efficiency. To solve this problem, betaine was added to the influent to improve the activity of the anaerobic sludge, and an experimental study was carried to investigate the influence of betaine on treating high salinity mustard tuber wastewater by the ASBBR. The results show that, when using anaerobic acclimated sludge in the ASBBR, and controlling biofilm density at 50% and water temperature at 8-12 degrees C, the treatment efficiency of the reactor could be improved by adding the betaine at different concentrations. The efficiency reached the highest when the optimal dosage ofbetaine was 0.5 mmol L(-1). The average effluent COD, after stable acclimation, was 4461 mg L(-1). Relative to ASBBR without adding betaine, the activity of the sludge increased significantly. Meanwhile, the dehydrogenase activity of anaerobic microorganisms and the COD removal efficiency were increased by 18.6% and 18.1%, respectively. PMID:22988630

  2. Double-Headed Sulfur-Linked Amino Acids As First Inhibitors for Betaine-Homocysteine S-Methyltransferase 2

    Czech Academy of Sciences Publication Activity Database

    Mládková, Jana; Vaněk, Václav; Buděšínský, Miloš; Elbert, Tomáš; Demianova, Zuzana; Garrow, T. A.; Jiráček, Jiří

    2012-01-01

    Roč. 55, č. 15 (2012), s. 6822-6831. ISSN 0022-2623 R&D Projects: GA ČR GA203/09/1919; GA ČR(CZ) GAP207/10/1277 Institutional support: RVO:61388963 Keywords : betaine * homocysteine * methionine * BHMT * inhibitor Subject RIV: CE - Biochemistry Impact factor: 5.614, year: 2012

  3. Increased fatty acid β-oxidation as a possible mechanism for fat-reducing effect of betaine in broilers.

    Science.gov (United States)

    Leng, Zhixian; Fu, Qin; Yang, Xue; Ding, Liren; Wen, Chao; Zhou, Yanmin

    2016-08-01

    Two hundred and forty 1-day-old male Arbor Acres broiler chickens were randomly assigned to five dietary treatments with six replicates of eight chickens per replicate cage for a 42-day feeding trial. Broiler chickens were fed a basal diet supplemented with 0 (control), 250, 500, 750 or 1000 mg/kg betaine, respectively. Growth performance was not affected by betaine. Incremental levels of betaine decreased the absolute and relative weight of abdominal fat (linear P < 0.05, quadratic P < 0.01), low-density lipoprotein cholesterol (LDL-C), triglyceride (TG) and total cholesterol (TC) (linear P < 0.05), and increased concentration of nonesterified fatty acid (NEFA) (linear P = 0.038, quadratic P = 0.003) in serum of broilers. Moreover, incremental levels of betaine increased linearly (P < 0.05) the proliferator-activated receptor alpha (PPARα), the carnitine palmitoyl transferase-I (CPT-I) and 3-hydroxyacyl-coenzyme A dehydrogenase (HADH) messenger RNA (mRNA) expression, but decreased linearly (P < 0.05) the fatty acid synthase (FAS) and 3-hydroxyl-3-methylglutaryl-CoA (HMGR) mRNA expression in liver of broilers. In conclusion, this study indicated that betaine supplementation did not affect growth performance of broilers, but was effective in reducing abdominal fat deposition in a dose-dependent manner, which was probably caused by combinations of a decrease in fatty acid synthesis and an increase in β-oxidation. PMID:27071487

  4. Study of betaine calcium chloride dihydrate (BCCD) by neutrons inelastic scattering; Etude du chlorure de betaine et de calcium dihydrate (BCCD) par diffusion inelastique de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Hlinka, J.

    1995-06-27

    The aim of this work is to study the betaine calcium chloride dihydrate (BCCD) lattice dynamics by neutrons inelastic and coherent scattering. In the first part are summarized the main properties of the BCCD as they are determined in some previous experimental works. It has been more particularly emphasized on the structural and dynamical properties of this compound. The theoretical concepts used in incommensurate dielectric materials physics are given in the second part. They are at first introduced generally and then applied to BCCD. In the third part is described the experimental method used in this work : the neutrons inelastic scattering. The experimental results on the BCCD normal phase dynamics are then presented. These results and their interpretation allow to build up a semi-microscopic model introduced in the fifth part. The incommensurate lattice dynamics (at 20 K under the transition temperature towards the modulated phase) is studied in the last part. It has been shown that new aspects in relation to the previous works appear in BCCD. (O.L.). 121 refs., 25 figs., 5 tabs.

  5. Acoustic and volumetric properties of betaine hydrochloride drug in aqueous D(+)-glucose and sucrose solutions

    International Nuclear Information System (INIS)

    Highlights: • Density and speed of sound are measured for B.HCl drug in aq. D(+)-glucose and sucrose. • Solvation behavior of B.HCl drug studied in aqueous D(+)-glucose and sucrose. • Cosphere overlap model is used to understand the transfer partial molar volume. • Hepler’s constant indicated structure making ability of B.HCl drug in studied systems. - Abstract: The densities (ρ) and speeds of sound (u) of betaine hydrochloride (B.HCl) drug (0.01 to 0.06) mol · kg−1 in (0.10, 0.20 and 0.30) mol · kg−1 aqueous D(+)-glucose and sucrose solutions are reported as a function of temperature at T = (293.15 to 313.15) K and atmospheric pressure. The values of density (ρ) and speed of sound (u) are obtained with high precision. These values have been used to estimate the apparent molar volume (V2,ϕ), partial molar volume (V2∞), transfer partial molar volume (ΔtV2∞), apparent molar isentropic compressibility (Ks,2,ϕ), partial molar isentropic compressibility (Ks,2∞), transfer partial molar compressibility (ΔtKs,2∞), hydration number (NH), partial molar expansion (E2∞) and Hepler’s constant (∂2V2∞/∂T2)P. Furthermore, pair (VAB and KAB) and triplet (VABB and KABB) interaction coefficients have been computed from the values of ΔtV2∞ and ΔtKs,2∞. The co-sphere overlap model is used to understand the values of ΔtV2∞ and ΔtKs,2∞. The positive values of (∂2V2∞/∂T2)P indicate structure making ability of betaine hydrochloride in aqueous D(+)-glucose and sucrose solutions at the temperatures and compositions investigated

  6. Assessment of the effect of betaine on p16 and c-myc DNA methylation and mRNA expression in a chemical induced rat liver cancer model

    Directory of Open Access Journals (Sweden)

    Ling Wen-hua

    2009-07-01

    Full Text Available Abstract Background The development and progression of liver cancer may involve abnormal changes in DNA methylation, which lead to the activation of certain proto-oncogenes, such as c-myc, as well as the inactivation of certain tumor suppressors, such as p16. Betaine, as an active methyl-donor, maintains normal DNA methylation patterns. However, there are few investigations on the protective effect of betaine in hepatocarcinogenesis. Methods Four groups of rats were given diethylinitrosamine (DEN and fed with AIN-93G diets supplemented with 0, 10, 20 or 40 g betaine/kg (model, 1%, 2%, and 4% betaine, respectively, while the control group, received no DEN, fed with AIN-93G diet. Eight or 15 weeks later, the expression of p16 and c-myc mRNA was examined by Real-time PCR (Q-PCR. The DNA methylation status within the p16 and c-myc promoter was analyzed using methylation-specific PCR. Results Compared with the model group, numbers and areas of glutathione S-transferase placental form (GST-p-positive foci were decreased in the livers of the rats treated with betaine (P . Although the frequency of p16 promoter methylation in livers of the four DEN-fed groups appeared to increase, there is no difference among these groups after 8 or 15 weeks (P > 0.05. Betaine supplementation attenuated the down-regulation of p16 and inhibited the up-regulation of c-myc induced by DEN in a dose-dependent manner (P P . Finally, enhanced antioxidative capacity (T-AOC was observed in both the 2% and 4% betaine groups. Conclusion Our data suggest that betaine attenuates DEN-induced damage in rat liver and reverses DEN-induced changes in mRNA levels.

  7. Early second trimester maternal plasma choline and betaine are related to measures of early cognitive development in term infants.

    Directory of Open Access Journals (Sweden)

    Brian T F Wu

    Full Text Available BACKGROUND: The importance of maternal dietary choline for fetal neural development and later cognitive function has been well-documented in experimental studies. Although choline is an essential dietary nutrient for humans, evidence that low maternal choline in pregnancy impacts neurodevelopment in human infants is lacking. We determined potential associations between maternal plasma free choline and its metabolites betaine and dimethylglycine in pregnancy and infant neurodevelopment at 18 months of age. METHODOLOGY: This was a prospective study of healthy pregnant women and their full-term, single birth infants. Maternal blood was collected at 16 and 36 weeks of gestation and infant neurodevelopment was assessed at 18 months of age for 154 mother-infant pairs. Maternal plasma choline, betaine, dimethylglycine, methionine, homocysteine, cysteine, total B12, holotranscobalamin and folate were quantified. Infant neurodevelopment was evaluated using the Bayley Scales of Infant Development-III. Multivariate regression, adjusting for covariates that impact development, was used to determine the associations between maternal plasma choline, betaine and dimethylglycine and infant neurodevelopment. RESULTS: The maternal plasma free choline at 16 and 36 weeks gestation was median (interquartile range 6.70 (5.78-8.03 and 9.40 (8.10-11.3 µmol/L, respectively. Estimated choline intakes were (mean ± SD 383 ± 98.6 mg/day, and lower than the recommended 450 mg/day. Betaine intakes were 142 ± 70.2 mg/day. Significant positive associations were found between infant cognitive test scores and maternal plasma free choline (B=6.054, SE=2.283, p=0.009 and betaine (B=7.350, SE=1.933, p=0.0002 at 16 weeks of gestation. Maternal folate, total B12, or holotranscobalamin were not related to infant development. CONCLUSION: We show that choline status in the first half of pregnancy is associated with cognitive development among healthy term gestation infants. More work

  8. Betaine:homocysteine methyltransferase--a new assay for the liver enzyme and its absence from human skin fibroblasts and peripheral blood lymphocytes.

    Science.gov (United States)

    Wang, J A; Dudman, N P; Lynch, J; Wilcken, D E

    1991-12-31

    Chronic elevation of plasma homocysteine is associated with increased atherogenesis and thrombosis, and can be lowered by betaine (N,N,N-trimethylglycine) treatment which is thought to stimulate activity of the enzyme betaine:homocysteine methyltransferase. We have developed a new assay for this enzyme, in which the products of the enzyme-catalysed reaction between betaine and homocysteine are oxidised by performic acid before being separated and quantified by amino acid analysis. This assay confirmed that human liver contains abundant betaine:homocysteine methyltransferase (33.4 nmol/h/mg protein at 37 degrees C, pH 7.4). Chicken and lamb livers also contain the enzyme, with respective activities of 50.4 and 6.2 nmol/h/mg protein. However, phytohaemagglutinin-stimulated human peripheral blood lymphocytes and cultured human skin fibroblasts contained no detectable betaine:homocysteine methyltransferase (less than 1.4 nmol/h/mg protein), even after cells were pre-cultured in media designed to stimulate production of the enzyme. The results emphasize the importance of the liver in mediating the lowering of elevated circulating homocysteine by betaine. PMID:1819467

  9. The organic osmolyte betaine induces keratin 2 expression in rat epidermal keratinocytes - A genome-wide study in UVB irradiated organotypic 3D cultures.

    Science.gov (United States)

    Rauhala, Leena; Hämäläinen, Lasse; Dunlop, Thomas W; Pehkonen, Petri; Bart, Geneviève; Kokkonen, Maarit; Tammi, Markku; Tammi, Raija; Pasonen-Seppänen, Sanna

    2015-12-25

    The moisturizing and potentially protective properties of the organic osmolyte betaine (trimethylglycine) have made it an attractive component for skin care products. Its wide use despite the lack of comprehensive studies addressing its specific effects in skin led us to characterize the molecular targets of betaine in keratinocytes and to explore, whether it modifies the effects of acute UVB exposure. Genome-wide expression analysis was performed on organotypic cultures of rat epidermal keratinocytes, treated either with betaine (10mM), UVB (30 mJ/cm(2)) or their combination. Results were verified with qRT-PCR, western blotting and immunohistochemistry. Additionally, cell proliferation and differentiation were analyzed. Among the 89 genes influenced by betaine, the differentiation marker keratin 2 showed the highest upregulation, which was also confirmed at protein level. Expression of Egr1, a transcription factor, and Purkinje cell protein 4, a regulator of Ca(2+)/calmodulin metabolism, also increased, while downregulated genes included several ion-channel components, such as Fxyd2. Bioinformatics analyses suggest that genes modulated by betaine are involved in DNA replication, might counteract UV-induced processes, and include many targets of transcription factors associated with cell proliferation and differentiation. Our results indicate that betaine controls unique gene expression pathways in keratinocytes, including some involved in differentiation. PMID:26391144

  10. Betaine (N,N,N-trimethylglycine) averts photochemically-induced thrombosis in pial microvessels in vivo and platelet aggregation in vitro.

    Science.gov (United States)

    Nemmar, Abderrahim; Yuvaraju, Priya; Beegam, Sumaya; Ali, Badreldin H

    2015-07-01

    Betaine (N,N,N-trimethylglycine) is an important food component with established health benefits through its homocysteine-lowering effects, and is used to lower total homocysteine concentration in plasma of patients with homocystinuria. It is well established that hyperhomocysteinemia is an established risk factor for cardiovascular disease and stroke. However, the possible protective effect of betaine on coagulation events in vivo and in vitro has thus far not been studied. Betaine was given to mice at oral doses of either 10 mg/kg (n = 6) or 40 mg/kg (n = 6) for seven consecutive days, and control mice (n = 6) received water only. The thrombotic occlusion time in photochemically induced thrombosis in pial arterioles was significantly delayed in mice pretreated with betaine at doses of 10 mg/kg (P < 0.001) and 40 mg/kg (P < 0.01). Similar effects were observed in pial venules with 10 mg/kg (P < 0.05) and 40 mg/kg (P < 0.05) betaine. In vitro, in whole blood samples collected from untreated mice (n = 3-5), betaine (0.01-1 mg/mL) significantly reversed platelet aggregation induced by adenosine diphosphate (5 µM). The number of circulating platelets and plasma concentration of fibrinogen in vivo were not significantly affected by betaine pretreament compared with the control group. Lipid peroxidation (LPO) in mice pretreated with betaine was significantly reduced compared with the control group. Moreover, betaine (0.01-1 mg/mL) caused a dose-dependent and significant prolongation of PT (n = 5) and aPTT (n = 4-6). In conclusion, our data show that betaine protected against coagulation events in vivo and in vitro and decreased LPO in plasma. PMID:25662827

  11. Trehalose/2-sulfotrehalose biosynthesis and glycine-betaine uptake are widely spread mechanisms for osmoadaptation in the Halobacteriales

    Science.gov (United States)

    Youssef, Noha H; Savage-Ashlock, Kristen N; McCully, Alexandra L; Luedtke, Brandon; Shaw, Edward I; Hoff, Wouter D; Elshahed, Mostafa S

    2014-01-01

    We investigated the mechanisms of osmoadaptation in the order Halobacteriales, with special emphasis on Haladaptatus paucihalophilus, known for its ability to survive in low salinities. H. paucihalophilus genome contained genes for trehalose synthesis (trehalose-6-phosphate synthase/trehalose-6-phosphatase (OtsAB pathway) and trehalose glycosyl-transferring synthase pathway), as well as for glycine betaine uptake (BCCT family of secondary transporters and QAT family of ABC transporters). H. paucihalophilus cells synthesized and accumulated ∼1.97–3.72 μmol per mg protein of trehalose in a defined medium, with its levels decreasing with increasing salinities. When exogenously supplied, glycine betaine accumulated intracellularly with its levels increasing at higher salinities. RT-PCR analysis strongly suggested that H. paucihalophilus utilizes the OtsAB pathway for trehalose synthesis. Out of 83 Halobacteriales genomes publicly available, genes encoding the OtsAB pathway and glycine betaine BCCT family transporters were identified in 38 and 60 genomes, respectively. Trehalose (or its sulfonated derivative) production and glycine betaine uptake, or lack thereof, were experimentally verified in 17 different Halobacteriales species. Phylogenetic analysis suggested that trehalose synthesis is an ancestral trait within the Halobacteriales, with its absence in specific lineages reflecting the occurrence of gene loss events during Halobacteriales evolution. Analysis of multiple culture-independent survey data sets demonstrated the preference of trehalose-producing genera to saline and low salinity habitats, and the dominance of genera lacking trehalose production capabilities in permanently hypersaline habitats. This study demonstrates that, contrary to current assumptions, compatible solutes production and uptake represent a common mechanism of osmoadaptation within the Halobacteriales. PMID:24048226

  12. Metabolism of Trimethylamine, Choline, and Glycine Betaine by Sulfate-Reducing and Methanogenic Bacteria in Marine Sediments †

    OpenAIRE

    King, Gary M.

    1984-01-01

    The response of methanogenesis and sulfate reduction to trimethylamine, choline, and glycine betaine was examined in surface sediments from the intertidal region of Lowes Cove, Maine. Addition of these substrates markedly stimulated methanogenesis in the presence of active sulfate reduction, whereas addition of other substrates, including glucose, acetate, and glycine, had no effect on methane production. Sulfate reduction was stimulated simultaneously with methanogenesis by the various quate...

  13. GLYCINE BETAINE AND SALICYLIC ACID INDUCED MODIFICATION IN PRODUCTIVITY OF TWO DIFFERENT CULTIVARS OF WHEAT GROWN UNDER WATER STRESS

    OpenAIRE

    Heshmat S. Aldesuquy; Mohamed A. Abbas; Samy. A. Abo- Hamed; Abeer H. Elhakem; Saeed S. Alsokari

    2012-01-01

    A pot experiment was conducted to evaluate the beneficial effect of foliar application of glycine betaine (10mM), grain presoaking in salicylic acid (0.05 M) and their interaction on drought tolerance of two wheat (Triticum aestivum L.) cultivars (sensitive, Sakha 94 and resistant, Sakha 93). Water stress decreased wheat yield components (spike length, number of spikelets / main spike, 100 kernel weight, grain number / spike, grain yield / spike, grain yield / plant, straw yield / plant, crop...

  14. ROLE OF GLYCINE BETAINE AND SALICYLIC ACID IN IMPROVING GROWTH VIGOUR AND PHYSIOLOGICAL ASPECTS OF DROUGHTED WHEAT CULTIVARS

    OpenAIRE

    Heshmat S. Aldesuquy; Samy. A. Abo- Hamed; Mohmed. A. Abbas; Abeer H. Elhakem

    2012-01-01

    A pot experiment was conducted to evaluate the beneficial effect of foliar application of glycine betaine (10mM), grain presoaking in salicylic acid (0.05 M) and their interaction on two droughted wheat (Triticum aestivum L.) cultivars (sensitive, Sakha 94 and resistant, Sakha 93). In general, water stress caused noticeable increases in root length, number of adventitious roots, soluble sugars and nitrogen but a massive reduction in fresh and dry masses of root, growth vigor of shoot, leaf ar...

  15. Molecular cloning of a plant betaine-aldehyde dehydrogenase, an enzyme implicated in adaptation to salinity and drought

    International Nuclear Information System (INIS)

    Many plants, as well as other organisms, accumulate betaine (N,N,N-trimethylglycine) as a nontoxic or protective osmolyte under saline or dry conditions. In plants, the last step in betaine synthesis is catalyzed by betaine-aldehyde dehydrogenase, a nuclear-encoded chloroplastic enzyme. A cDNA clone for BADH (1812 base pairs) was selected from a λgt10 cDNA library derived from leaves of salt-stressed spinach (Spinacia oleracea L.). The library was screened with oligonucleotide probes corresponding to amino acid sequences of two peptides prepared from purified BADH. The authenticity of the clone was confirmed by nucleotide sequence analysis; this analysis demonstrated the presence of a 1491-base-pair open reading frame that contained sequences encoding 12 peptide fragments of BADH. The clone hybridized to a 1.9-kilobase mRNA from spinach leaves; this mRNA was more abundant in salt-stressed plants, consistent with the known salt induction of BADH activity. The amino acid sequence deduced for the BADH cDNA sequence showed substantial similarities to those for nonspecific aldehyde dehydrogenases from several sources, including absolute conservation of a decapeptide in the probable active site. Comparison of deduced and determined amino acid sequences indicated that the transit peptide may comprise only 7 or 8 residues, which is atypically short for precursors to stromal proteins

  16. Molecular cloning of a plant betaine-aldehyde dehydrogenase, an enzyme implicated in adaptation to salinity and drought.

    Science.gov (United States)

    Weretilnyk, E A; Hanson, A D

    1990-04-01

    Many plants, as well as other organisms, accumulate betaine (N,N,N-trimethylglycine) as a nontoxic or protective osmolyte under saline or dry conditions. In plants, the last step in betaine synthesis is catalyzed by betaine-aldehyde dehydrogenase (BADH, EC 1.2.1.8), a nuclear-encoded chloroplastic enzyme. A cDNA clone for BADH (1812 base pairs) was selected from a lambda gt10 cDNA library derived from leaves of salt-stressed spinach (Spinacia oleracea L.). The library was screened with oligonucleotide probes corresponding to amino acid sequences of two peptides prepared from purified BADH. The authenticity of the clone was confirmed by nucleotide sequence analysis; this analysis demonstrated the presence of a 1491-base-pair open reading frame that contained sequences encoding 12 peptide fragments of BADH. The clone hybridized to a 1.9-kilobase mRNA from spinach leaves; this mRNA was more abundant in salt-stressed plants, consistent with the known salt induction of BADH activity. The amino acid sequence deduced from the BADH cDNA sequence showed substantial similarities to those for nonspecific aldehyde dehydrogenases (EC 1.2.1.3 and EC 1.2.1.5) from several sources, including absolute conservation of a decapeptide in the probable active site. Comparison of deduced and determined amino acid sequences indicated that the transit peptide may comprise only 7 or 8 residues, which is atypically short for precursors to stromal proteins. PMID:2320587

  17. Both the folate cycle and betaine-homocysteine methyltransferase contribute methyl groups for DNA methylation in mouse blastocysts.

    Science.gov (United States)

    Zhang, Baohua; Denomme, Michelle M; White, Carlee R; Leung, Kit-Yi; Lee, Martin B; Greene, Nicholas D E; Mann, Mellissa R W; Trasler, Jacquetta M; Baltz, Jay M

    2015-03-01

    The embryonic pattern of global DNA methylation is first established in the inner cell mass (ICM) of the mouse blastocyst. The methyl donor S-adenosylmethionine (SAM) is produced in most cells through the folate cycle, but only a few cell types generate SAM from betaine (N,N,N-trimethylglycine) via betaine-homocysteine methyltransferase (BHMT), which is expressed in the mouse ICM. Here, mean ICM cell numbers decreased from 18-19 in controls to 11-13 when the folate cycle was inhibited by the antifolate methotrexate and to 12-14 when BHMT expression was knocked down by antisense morpholinos. Inhibiting both pathways, however, much more severely affected ICM development (7-8 cells). Total SAM levels in mouse blastocysts decreased significantly only when both pathways were inhibited (from 3.1 to 1.6 pmol/100 blastocysts). DNA methylation, detected as 5-methylcytosine (5-MeC) immunofluorescence in isolated ICMs, was minimally affected by inhibition of either pathway alone but decreased by at least 45-55% when both BHMT and the folate cycle were inhibited simultaneously. Effects on cell numbers and 5-MeC levels in the ICM were completely rescued by methionine (immediate SAM precursor) or SAM. Both the folate cycle and betaine/BHMT appear to contribute to a methyl pool required for normal ICM development and establishing initial embryonic DNA methylation. PMID:25466894

  18. Betaine treatment of cystathionine β-synthase-deficient homocystinuria; does it work and can it be improved?

    Directory of Open Access Journals (Sweden)

    Maclean KN

    2012-09-01

    Full Text Available Kenneth N MacleanDepartment of Pediatrics, University of Colorado School of Medicine, Aurora, CO, USAAbstract: Inactivating mutations in cystathionine β-synthase result in classical homocystinuria (HCU and are typically accompanied by severe elevations of plasma and tissue homocysteine, methionine, S-adenosylmethionine, S-adenosylhomocysteine and significantly decreased cysteine. HCU is usually accompanied by marfanoid skeletal abnormalities, osteoporosis, ectopia lentis and/or severe myopia, cognitive impairment, and a dramatically increased incidence of atherosclerosis and thromboembolic complications of variable presentation. If untreated, HCU is a serious life-threatening disease. Betaine (N,N,N-trimethylglycine is a zwitterionic quaternary ammonium compound that can lower homocysteine, S-adenosylmethionine, S-adenosylhomocysteine, and increase cysteine in HCU by serving as a methyl donor for the remethylation of homocysteine in a reaction catalyzed by betaine–homocysteine S-methyltransferase. This review considers the clinical efficacy and safety of betaine treatment of HCU. Possible strategies by which the efficacy of this treatment might be improved are discussed.Keywords: homocystinuria, homocysteine, betaine, cystathionine beta-synthase, betaine–homocysteine S-methyltransferase

  19. Development of green betaine-based deep eutectic solvent aqueous two-phase system for the extraction of protein.

    Science.gov (United States)

    Li, Na; Wang, Yuzhi; Xu, Kaijia; Huang, Yanhua; Wen, Qian; Ding, Xueqin

    2016-05-15

    Six kinds of new type of green betaine-based deep eutectic solvents (DESs) have been synthesized. Deep eutectic solvent aqueous two-phase systems (DES-ATPS) were established and successfully applied in the extraction of protein. Betaine-urea (Be-U) was selected as the suitable extractant. Single factor experiments were carried out to determine the optimum conditions of the extraction process, such as the salt concentration, the mass of DES, the separation time, the amount of protein, the temperature and the pH value. The extraction efficiency could achieve to 99.82% under the optimum conditions. Mixed sample and practical sample analysis were discussed. The back extraction experiment was implemented and the back extraction efficiency could reach to 32.66%. The precision experiment, repeatability experiment and stability experiment were investigated. UV-vis, FT-IR and circular dichroism (CD) spectra confirmed that the conformation of protein was not changed during the process of extraction. The mechanisms of extraction were researched by dynamic light scattering (DLS), the measurement of the conductivity and transmission electron microscopy (TEM). DES-protein aggregates and embraces phenomenon play considerable roles in the separation process. All of these results indicated that betaine-based DES-ATPS may provide a potential substitute new method for the separation of proteins. PMID:26992491

  20. Serum betaine is inversely associated with low lean mass mainly in men in a Chinese middle-aged and elderly community-dwelling population.

    Science.gov (United States)

    Huang, Bi-Xia; Zhu, Ying-Ying; Tan, Xu-Ying; Lan, Qiu-Ye; Li, Chun-Lei; Chen, Yu-Ming; Zhu, Hui-Lian

    2016-06-01

    Previous studies have demonstrated that betaine supplements increase lean body mass in livestock and improve muscle performance in human beings, but evidence for its effect on human lean mass is limited. Our study assessed the association of circulating betaine with lean mass and its composition in Chinese adults. A community-based study was conducted on 1996 Guangzhou residents (weight/mass: 1381/615) aged 50-75 years between 2008 and 2010. An interviewer-administered questionnaire was used to collect general baseline information. Fasting serum betaine was assessed using HPLC-MS. A total of 1590 participants completed the body composition analysis performed using dual-energy X-ray absorptiometry during a mean of 3·2 years of follow-up. After adjustment for age, regression analyses demonstrated a positive association of serum betaine with percentage of lean mass (LM%) of the entire body, trunk and limbs in men (all P<0·05) and LM% of the trunk in women (P=0·016). Each sd increase in serum betaine was associated with increases in LM% of 0·609 (whole body), 0·811 (trunk), 0·422 (limbs), 0·632 (arms) and 0·346 (legs) in men and 0·350 (trunk) in women. Multiple logistic regression analysis revealed that the prevalence of lower LM% decreased by 17 % (whole body) and 14 % (trunk) in women and 23 % (whole body), 28 % (trunk), 22 % (arms) and 26 % (percentage skeletal muscle index) in men with each sd increment in serum betaine. Elevated circulating betaine was associated with a higher LM% and lower prevalence of lower LM% in middle-aged and elderly Chinese adults, particularly men. PMID:27079329

  1. Study of betaine calcium chloride dihydrate (BCCD) by neutrons inelastic scattering

    International Nuclear Information System (INIS)

    The aim of this work is to study the betaine calcium chloride dihydrate (BCCD) lattice dynamics by neutrons inelastic and coherent scattering. In the first part are summarized the main properties of the BCCD as they are determined in some previous experimental works. It has been more particularly emphasized on the structural and dynamical properties of this compound. The theoretical concepts used in incommensurate dielectric materials physics are given in the second part. They are at first introduced generally and then applied to BCCD. In the third part is described the experimental method used in this work : the neutrons inelastic scattering. The experimental results on the BCCD normal phase dynamics are then presented. These results and their interpretation allow to build up a semi-microscopic model introduced in the fifth part. The incommensurate lattice dynamics (at 20 K under the transition temperature towards the modulated phase) is studied in the last part. It has been shown that new aspects in relation to the previous works appear in BCCD. (O.L.). 121 refs., 25 figs., 5 tabs

  2. A novel betaine type asphalt emulsifier synthesized and investigated by online FTIR spectrophotometric method

    Directory of Open Access Journals (Sweden)

    Shi Laishun

    2015-01-01

    Full Text Available A novel betaine type asphalt emulsifier 3-(N,N,N-dimethyl acetoxy ammonium chloride-2-hydroxypropyl laurate was synthesized after three steps by the reaction of lauric acid, epichlorohydrin, dimethylamine and sodium chloroacetate. The optimum reaction conditions were obtained for the synthesis of the first step of 3-chloro-2-hydroxypropyl laurate. The esterification yield reaches 97.1% at the optimum conditions of reaction temperature 80ºC, reaction time 6 h, feedstock mole ratio of epichlorohydrin to lauric acid 1.5, mass ratio of catalyst to lauric acid 2%. The chemical structure of the product was characterized by FTIR and 1H NMR. The first synthesis step of 3-chloro-2-hydroxypropyl laurate was monitored by online FTIR technique. The by-product was detected by the online FTIR analysis. Based upon the experimental data, a plausible reaction mechanism was proposed for the reaction. The CMC of the objective product has a lower value of 7.4×10-4 mol/L. The surface tension at CMC is 30.85 mN/m. The emulsifier is a rapid-set asphalt emulsifier.

  3. Synthesis, characterization, and assembly of beta-In2S3 nanoparticles.

    Science.gov (United States)

    Vigneashwari, B; Dash, S; Tyagi, A K; Parameswaran, P; Ravichandran, V; Sunthathiraraj, S Austin

    2007-06-01

    Semiconductor nanoparticles of Indium Sulphide were synthesized by a hydrothermal method using InCl3 and Na2S. Powder X-ray Diffraction analysis confirmed that the product obtained was nanocrystals of single-phase beta-In2S3. The crystallite size distribution was obtained from the diffraction profile and the average size was approximately 5 nm. The compositional analyses performed on the as-prepared powder showed that the material was devoid of any impurity with an In:S ratio very close to 2:3. A colloid of very fine In2S3 particles was obtained from the as-prepared powder by suspending them in acetonitrile. The optical absorption of this colloid showed evidence of strong quantum confinement of excitons and as a result the particles yielded intense photoluminescence in the violet-blue region. These colloidal particles were then electrophoretically driven on to a transparent conducting substrate to assemble into a nanostructure. A Grazing Incidence X-ray Diffraction analysis of the deposited layer revealed that the preferred orientation noticed in the native powder was removed in the deposit. The surface morphology of the deposit studied using SEM and AFM displayed an inherent ordering behaviour in the clusters organized into a two-dimensional film. The locus of the cluster lines tend to form closed circles, at the nanoscopic as well as microscopic scales, indicative of certain strong neighborhood correlations. Such structures may be expected to exhibit novel correlated properties also. PMID:17654997

  4. Suppressed expression of choline monooxygenase in sugar beet on the accumulation of glycine betaine.

    Science.gov (United States)

    Yamada, Nana; Takahashi, Hiroyuki; Kitou, Kunihide; Sahashi, Kosuke; Tamagake, Hideto; Tanaka, Yoshito; Takabe, Teruhiro

    2015-11-01

    Glycine betaine (GB) is an important osmoprotectant and synthesized by two-step oxidation of choline. Choline monooxygenase (CMO) catalyzes the first step of the pathway and is believed to be a rate limiting step for GB synthesis. Recent studies have shown the importance of choline-precursor supply for GB synthesis. In order to investigate the role of CMO for GB accumulation in sugar beet (Beta vulgaris), transgenic plants carrying the antisense BvCMO gene were developed. The antisense BvCMO plants showed the decreased activity of GB synthesis from choline compared to wild-type (WT) plants which is well related to the suppressed level of BvCMO protein. However, GB contents were similar between transgenic and WT plants with the exception of young leaves and storage roots. Transgenic plants showed enhanced susceptibility to salt stress than WT plants. These results suggest the importance of choline-precursor-supply for GB accumulation, and young leaves and storage root are sensitive sites for GB accumulation. PMID:26302482

  5. Homocysteine homeostasis and betaine-homocysteine S-methyltransferase expression in the brain of hibernating bats.

    Directory of Open Access Journals (Sweden)

    Yijian Zhang

    Full Text Available Elevated homocysteine is an important risk factor that increases cerebrovascular and neurodegenerative disease morbidity. In mammals, B vitamin supplementation can reduce homocysteine levels. Whether, and how, hibernating mammals, that essentially stop ingesting B vitamins, maintain homocysteine metabolism and avoid cerebrovascular impacts and neurodegeneration remain unclear. Here, we compare homocysteine levels in the brains of torpid bats, active bats and rats to identify the molecules involved in homocysteine homeostasis. We found that homocysteine does not elevate in torpid brains, despite declining vitamin B levels. At low levels of vitamin B6 and B12, we found no change in total expression level of the two main enzymes involved in homocysteine metabolism (methionine synthase and cystathionine β-synthase, but a 1.85-fold increase in the expression of the coenzyme-independent betaine-homocysteine S-methyltransferase (BHMT. BHMT expression was observed in the amygdala of basal ganglia and the cerebral cortex where BHMT levels were clearly elevated during torpor. This is the first report of BHMT protein expression in the brain and suggests that BHMT modulates homocysteine in the brains of hibernating bats. BHMT may have a neuroprotective role in the brains of hibernating mammals and further research on this system could expand our biomedical understanding of certain cerebrovascular and neurodegenerative disease processes.

  6. Isolation and functional characterization of N-methyltransferases that catalyze betaine synthesis from glycine in a halotolerant photosynthetic organism Aphanothece halophytica.

    Science.gov (United States)

    Waditee, Rungaroon; Tanaka, Yoshito; Aoki, Kenji; Hibino, Takashi; Jikuya, Hiroshi; Takano, Jun; Takabe, Tetsuko; Takabe, Teruhiro

    2003-02-14

    Glycine betaine (N,N,N-trimethylglycine) is an important osmoprotectant and is synthesized in response to abiotic stresses. Although almost all known biosynthetic pathways of betaine are two-step oxidation of choline, here we isolated two N-methyltransferase genes from a halotolerant cyanobacterium Aphanothece halophytica. One of gene products (ORF1) catalyzed the methylation reactions of glycine and sarcosine with S-adenosylmethionine acting as the methyl donor. The other one (ORF2) specifically catalyzed the methylation of dimethylglycine to betaine. Both enzymes are active as monomers. Betaine, a final product, did not show the feed back inhibition for the methyltransferases even in the presence of 2 m. A reaction product, S-adenosyl homocysteine, inhibited the methylation reactions with relatively low affinities. The co-expressing of two enzymes in Escherichia coli increased the betaine level and enhanced the growth rates. Immunoblot analysis revealed that the accumulation levels of both enzymes in A. halophytica cells increased with increasing the salinity. These results indicate that A. halophytica cells synthesize betaine from glycine by a three-step methylation. The changes of amino acids Arg-169 to Lys or Glu in ORF1 and Pro-171 to Gln and/or Met-172 to Arg in ORF2 significantly decreased V(max) and increased K(m) for methyl acceptors (glycine, sarcosine, and dimethylglycine) but modestly affected K(m) for S-adenosylmethionine, indicating the importance of these amino acids for the binding of methyl acceptors. Physiological and functional properties of methyltransferases were discussed. PMID:12466265

  7. The effects of chronic betaine supplementation on exercise performance, skeletal muscle oxygen saturation and associated biochemical parameters in resistance trained men.

    Science.gov (United States)

    Trepanowski, John F; Farney, Tyler M; McCarthy, Cameron G; Schilling, Brian K; Craig, Stuart A; Bloomer, Richard J

    2011-12-01

    Trepanowski, JF, Farney, TM, McCarthy, CG, Schilling, BK, Craig, SA, and Bloomer, RJ. The effects of chronic betaine supplementation on exercise performance, skeletal muscle oxygen saturation, and associated biochemical parameters in resistance trained men. J Strength Cond Res 25(12): 3461-3471, 2011-We examined the effects of chronic betaine supplementation on exercise performance and associated parameters in resistance trained men. Men were randomly assigned in a double-blind manner using a crossover design to consume betaine (2.5 g of betaine mixed in 500 ml of Gatorade®) or a placebo (500 ml of Gatorade®) for 14 days, with a 21-day washout period. Before and after each treatment period, tests of lower- and upper-body muscular power and isometric force were conducted, including a test of upper-body muscular endurance (10 sets of bench press exercise to failure). Muscle tissue oxygen saturation (StO2) during the bench press protocol was measured via near infrared spectroscopy. Blood samples were collected before and after the exercise test protocol for analysis of lactate, nitrate/nitrite (NOx), and malondialdehyde (MDA). When analyzed using a repeated measures analysis of variance, no significant differences were noted between conditions for exercise performance variables (p > 0.05). However, an increase in total repetitions (p = 0.01) and total volume load (p = 0.02) in the 10-set bench press protocol was noted with betaine supplementation (paired t-tests), with values increasing approximately 6.5% from preintervention to postintervention. Although not of statistical significance (p = 0.14), postexercise blood lactate increased to a lesser extent with betaine supplementation (210%) compared with placebo administration (270%). NOx was lower postintervention as compared with preintervention (p = 0.06), and MDA was relatively unchanged. The decrease in StO2 during the bench press protocol was greater with betaine vs. placebo (p = 0.01), possibly suggesting

  8. Surface modification with zwitterionic cysteine betaine for nanoshell-assisted near-infrared plasmonic hyperthermia.

    Science.gov (United States)

    Huang, Chun-Jen; Chu, Sz-Hau; Li, Chien-Hung; Lee, T Randall

    2016-09-01

    Nanoparticles decorated with biocompatible coatings have received considerable attention in recent years for their potential biomedical applications. However, the desirable properties of nanoparticles for in vivo uses, such as colloidal stability, biodistribution, and pharmacokinetics, require further research. In this work, we report a bio-derived zwitterionic surface ligand, cysteine betaine (Cys-b) for the modification of hollow gold-silver nanoshells, giving rise to hyperthermia applications. Cys-b coatings on planar substrates and nanoshells were compared to conventional (11-mercaptoundecyl)tri(ethylene glycol) (OEG-thiol) to investigate their effects on the fouling resistance, colloidal stability, environmental tolerance, and photothermal properties. The results found that Cys-b and OEG-thiol coatings exhibited comparable antifouling properties against bacteria of gram-negative Pseudomonas aeruginosa (P. aeruginosa) and gram-positive Staphylococcus epidermidis (S. epidermidis), NIH-3T3 fibroblasts, and bovine serum albumin. However, when the modified nanoshells were suspended at a temperature of 50°C in aqueous 3M NaCl solutions, shifts in the extinction maximum of the OEG-capped nanoshells with time were observed, while the corresponding spectra of nanoshells capped with Cys-b generally remained unchanged. In addition, when the nanoshells were continuously exposed to NIR irradiation, the temperature of the solution containing nanoshells capped with Cys-b increased to a plateau of 54°C, while that of the OEG-capped nanoshells gradually decreased after reaching a peak temperature. Accordingly, the Cys-b nanoshells were conjugated with anti-HER2 antibodies for targeted delivery to HER2-positive MDA-MB-453 breast cancer cells for hyperthermia treatment. The results showed the selective delivery and effective photothermal cell ablation with the antibody-conjugated Cys-b nanoshells. Therefore, this work demonstrated the promise of bio-derived zwitterionic Cys

  9. Betaine Inhibits Hepatitis B Virus with an Advantage of Decreasing Resistance to Lamivudine and Interferon α.

    Science.gov (United States)

    Zhang, Mengmeng; Wu, Xiaoying; Lai, Furao; Zhang, Xiaoyuan; Wu, Hui; Min, Tian

    2016-05-25

    Betaine (BET) is a native compound known for its ability to protect the liver from toxicants. However, few studies have examined the effects of BET on the most common cause of liver disease, hepatitis B virus (HBV). In this study, the anti-HBV activity of BET was assessed in vitro and in vivo using enzyme-linked immunosorbent assay, quantitative polymerase chain reaction, and Southern blotting. The resistance of HBV to lamivudine and interferon α is challenging in the clinical treatment of HBV. The effect of BET on resistance was also investigated. The results showed that the secretion of HBsAg (HBV surface antigen), HbeAg (HBV e antigen), and HBV DNA in HepG2.2.15 cells was significantly decreased by BET via suppression of GRP78 expression. In duck HBV (DHBV)-infected ducklings, 1.0 or 2.0 g/kg BET significantly reduced serum DHBV DNA, and DHBV DNA did not rebound after the 5 day withdrawal period. BET suppressed HBV DNA rebound produced by the resistance of HBV to lamivudine and decreased the resistance mutation (rtM204V/I) of HBV DNA. Supplementation of BET may improve the anti-HBV effect of interferon α by increasing the expression of antiviral dsRNA-dependent protein kinase induced by the JAK-STAT (JAK = Janus kinase; STAT = signal transducer and activator of transcription) signaling pathway. These results may provide useful information for the clinical application of BET and solution of HBV drug resistance in anti-HBV therapy. PMID:27144395

  10. Molecular mechanisms for interaction of glycine betaine with supra-molecular phycobiliprotein complexes

    Institute of Scientific and Technical Information of China (English)

    XU XiuLing; LI Heng; XIE Jie; ZHAO JingQuan

    2009-01-01

    Glycine betaine (GB) is a biologically important small molecule protecting cells,proteins and enzymes in vivo and in vitro under environmental stresses.Recently,it was found that GB could also relax the structure and inactivate the function of phycobiliproteins and phycobilisome (PBS),a kind of supramolecular complexes,in cyanobacterial cells.The molecular mechanisms for the opposite phenomena are quite ambiguous.Taking PBS and a trimeric or monomeric C-phycocyanin (C-PC) as models,the molecular mechanism for the interaction of GB with supra-molecular complexes or nuclear proteins was investigated.The energetic decoupling of PBS components induced by GB suggests that the PBS core-membrane linking polypeptide was the most sensitive site while the rod-core linker was the next.Biochemistry analysis proves that PBS structure was loosened but not dissociated into the components.On the basis of the results and structure knowledge,it was proposed that GB screened the electrostatic attraction of the opposite charges on a linker and a protein leading to a much looser structure.It was observed that GB induced a spectral blue shift for trimeric C-PC but a red shift for s monomeric C-PC (a nuclear protein),which were ascribed to GB's screening of the electrostatic attraction of a linker to a protein and strengthening of the hydrophobic interaction between C-PC monomers.The trimers and monomers' forming of the same products under high concentration of GB was ascribed to a compromise of the opposite interaction forces.

  11. Molecular mechanisms for interaction of glycine betaine with supra-molecular phycobiliprotein complexes

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Glycine betaine(GB) is a biologically important small molecule protecting cells,proteins and enzymes in vivo and in vitro under environmental stresses.Recently,it was found that GB could also relax the structure and inactivate the function of phycobiliproteins and phycobilisome(PBS),a kind of supramolecular complexes,in cyanobacterial cells.The molecular mechanisms for the opposite phenomena are quite ambiguous.Taking PBS and a trimeric or monomeric C-phycocyanin(C-PC) as models,the molecular mechanism for the interaction of GB with supra-molecular complexes or nuclear proteins was investigated.The energetic decoupling of PBS components induced by GB suggests that the PBS core-membrane linking polypeptide was the most sensitive site while the rod-core linker was the next.Biochemistry analysis proves that PBS structure was loosened but not dissociated into the components.On the basis of the results and structure knowledge,it was proposed that GB screened the electrostatic attraction of the opposite charges on a linker and a protein leading to a much looser structure.It was observed that GB induced a spectral blue shift for trimeric C-PC but a red shift for a monomeric C-PC(a nuclear protein),which were ascribed to GB’s screening of the electrostatic attraction of a linker to a protein and strengthening of the hydrophobic interaction between C-PC monomers.The trimers and monomers’ forming of the same products under high concentration of GB was ascribed to a compromise of the opposite interaction forces.

  12. Effects of Betaine Supplementation to Methionine Deficient Diet on Growth Performance and Carcass Characteristics of Broilers

    Directory of Open Access Journals (Sweden)

    H. Sun

    2008-01-01

    Full Text Available Problem Statement: The efficacy of Methionine (Met sparing effect of Betaine (BET has been shown to be associated with dietary compositions, animal physiological stage and living conditions. This study was to determine the extent to which dietary Met could be replaced by BET in broiler chickens under the feeding conditions specific to Chinese poultry industry.Approach: A total of 900 day-old Arbor Acres broiler chicks were fed three corn-soybean meal-based starter rations (d 1-21 and grower rations (d 22-42 for a total of 42 days. Met levels in the diets were: Diet 1, Met content at the recommended level (Control; diet 2, Met level at 85% of the Control supplemented with BET at the level of 400 (starter or 300 (grower mg kg-1 DM; Diet 3, Met level at 75% of the Control supplemented with BET at the level of 600 (starter or 500 (grower mg khg-1 DM. The broilers were raised in a temperature controlled house with 3 pens (replicates per dietary treatment. Results: In general, treatment had no effect on body weight, feed intake or feed efficiency. Concentrations of growth hormone and insulin-like growth factor-1 in the serum of broilers fed Diet 3 were higher (pConclusions/Recommendations: Supplementation of BET to replace up to 25% of total dietary Met did not affect the growth performance but improved the carcass quality of the broilers. BET could be used to spare 25% of the total Met in broiler diet that was formulated based on the Feeding Standard of China.

  13. Trimethylamine oxide, betaine and other osmolytes in deep-sea animals: depth trends and effects on enzymes under hydrostatic pressure.

    Science.gov (United States)

    Yancey, P H; Rhea, M D; Kemp, K M; Bailey, D M

    2004-06-01

    Most shallow teleosts have low organic osmolyte contents, e.g. 70 mmol/kg or less of trimethylamine oxide (TMAO). Our previous work showed that TMAO contents increase with depth in muscles of several Pacific families of teleost fishes, to about 180 mmol/kg wet wt at 2.9 km depth in grenadiers. We now report that abyssal grenadiers (Coryphaenoides armatus, Macrouridae) from the Atlantic at 4.8 km depth contain 261 mmol/kg wet wt in muscle tissue. This precisely fits a linear trend extrapolated from the earlier data. We also found that anemones show a trend of increasing contents of methylamines (TMAO, betaine) and scyllo-inositol with increasing depth. Previously we found that TMAO counteracts the inhibitory effects of hydrostatic pressure on a variety of proteins. We now report that TMAO and, to a lesser extent, betaine, are generally better stabilizers than other common osmolytes (myo-inositol, taurine and glycine), in terms of counteracting the effects of pressure on NADH Km of grenadier lactate dehydrogenase and ADP Km of anemone and rabbit pyruvate kinase. PMID:15529747

  14. Stress associated with road transportation in desert sheep and goats, and the effect of pretreatment with xylazine or sodium betaine.

    Science.gov (United States)

    Ali, B H; Al-Qarawi, A A; Mousa, H M

    2006-06-01

    The present work investigates some clinical, endocrinological, biochemical and haematological variables in desert sheep and goats stressed in the course of individual road transportation, and the influence thereon of pretreatment with an established anti-stressor drug, xylazine HCl, and a test compound, sodium betaine (trimethylglycine). Road transportation for 2h resulted in variable and statistically insignificant increases in heart, pulse and respiratory rates in both control and experimental animals. Transportation stress significantly increased the concentrations of plasma cortisol, and glucose, and decreased that of magnesium. The endogenous thiocyanate concentration was unaffected. The stress also insignificantly decreased the haematocrit (PCV), and the number of lymphocytes, and increased the concentration of haemoglobin. Pretreatment of sheep and goats with xylazine at a single dose of 0.01 mg/kg by the intravenous route significantly ameliorated the effects induced by the stressful stimulus. The effects of pretreatment of the two species with sodium betaine (10 mg/kg) produced variable and insignificant effects. PMID:16181650

  15. Homogeneous liquid-liquid extraction of rare earths with the betaine-betainium bis(trifluoromethylsulfonyl)imide ionic liquid system.

    Science.gov (United States)

    Vander Hoogerstraete, Tom; Onghena, Bieke; Binnemans, Koen

    2013-01-01

    Several fundamental extraction parameters such as the kinetics and loading were studied for a new type of metal solvent extraction system with ionic liquids. The binary mixture of the ionic liquid betainium bis(trifluoromethylsulfonyl)imide and water shows thermomorphic behavior with an upper critical solution temperature (UCST), which can be used to avoid the slower mass transfer due to the generally higher viscosity of ionic liquids. A less viscous homogeneous phase and mixing on a molecular scale are obtained when the mixture is heated up above 55 °C. The influence of the temperature, the heating and cooling times, were studied for the extraction of neodymium(III) with betaine. A plausible and equal extraction mechanism is proposed in bis(trifluoromethylsulfonyl)imide, nitrate, and chloride media. After stripping of the metals from the ionic liquid phase, a higher recovery of the ionic liquid was obtained by salting-out of the ionic liquid fraction lost by dissolution in the aqueous phase. The change of the upper critical solution temperature by the addition of HCl or betaine was investigated. In addition, the viscosity was measured below and above the UCST as a function of the temperature. PMID:24169434

  16. Crystal and macular structure of 1:1 complex of N-methylmorpholine betaine with salicylic acid

    International Nuclear Information System (INIS)

    The structure of a 1:1 complexes of complex of N-methylmorpholine betaine (MMB) with salicylic acid (SAL) has been determined by a single crystal X-ray analysis. The crystals are orthorhombic, space group Pbca, with a 9.4702(6), b = 13.0559(7) and c = 45.226(2) A (at 140 K). The asymmetric unit is composed of two MMB+·SAL- units (A and B) each formed by a short, nearly linear O-H...O hydrogen bond (2.542(2) and 2.474(2) A) between the carboxylic group of the betaine cation and carboxylate group of the anion. The salicylate anions form short intramolecular O-H...O hydrogen bonds of 2. 472(2) and 2.525(2) A (O-H...O angles 160(2) and 149(2)o) for anion A and B, respectively, between the ortho hydroxyl donor and the COO- group, but the carboxylate acceptor O atom is in each case different. The morpholine rings are in a chair conformation with the -CH2COOH group in equatorial and the methyl group in axial positions. FTIR, and 1H and 13C NMR spectra of the complex are discussed. (author)

  17. Influence of Betaine on the Properties of Polyisoprene Rubber%甜菜碱对聚异戊二烯橡胶性能的影响

    Institute of Scientific and Technical Information of China (English)

    汪志芬; 罗文杰; 方林; 廖双泉; 赵艳芳; 李乐凡; 潘雪梅; 高扬建树

    2014-01-01

    In this study, the inlfuence of betaine (N,N,N-trimethylglycine, non-rubber component in natural rubber) on the curing characteristics, tensile properties and thermal stability of polyisoprene rubber (IR) was investigated. Compared with the IR compound without betaine, the curing rate of the compound with betaine IR increased signiifcantly, the crosslink density increased, tensile properties were improved and the thermal stability was slightly improved. The recommended addition level of betaine was 0.5 phr.%探讨甜菜碱(三甲铵乙内酯,天然橡胶非胶组分)对聚异戊二烯橡胶(IR)硫化特性、强伸性能和热稳定性能的影响。结果表明:与未加甜菜碱的IR相比,添加甜菜碱的IR硫化速度显著提高,交联密度增大,强伸性能改善,热稳定性能略有提高;当甜菜碱用量为0.5份时,IR的综合性能最佳。

  18. Methionine kinetics in adult men: effects of dietary betaine on L-[2H3-methyl-1-13C]methionine

    International Nuclear Information System (INIS)

    The effects of a daily 3-g supplement of betaine on kinetic aspects of L-[2H3-methyl-1-13C]methionine (MET) metabolism in healthy young adult men were explored. Four groups of four subjects each were given a control diet, based on an L-amino acid mixture supplying 29.5 and 21.9 mg.kg-1.d-1 of L-methionine and L-cystine for 4 d before the tracer study, conducted on day 5 during the fed state. Two groups received the control diet and two groups received the betaine supplement. Tracer was given intravenously (iv) or orally. The transmethylation rate of MET (TM), homocysteine remethylation (RM), and oxidation of methionine were estimated from plasma methionine labeling and 13C enrichment of expired air. RM tended to increase (P = 0.14) but the TM and methionine oxidation were significantly (P less than 0.05) higher after betaine supplementation when estimated with the oral tracer. No differences were detected with the intravenous tracer. Methionine concentration in plasma obtained from blood taken from subjects in the fed state was higher (P less than 0.01) with betaine supplementation. These results suggest that excess methyl-group intake may increase the dietary requirement for methionine

  19. Preliminary results of a randomized controlled trial carried out with a fixed combination of S-adenosyl-L-methionine and betaine versus amitriptyline in patients with mild depression

    Directory of Open Access Journals (Sweden)

    Di Pierro F

    2015-02-01

    Full Text Available Francesco Di Pierro,1 Roberto Settembre2 1Scientific Department, Velleja Research, Milan, Italy; 2Neurosurgery Department, Di Venere Hospital, Bari, Italy Background: S-adenosyl-L-methionine (SAMe, a safe, endogenous, pleiotropic methyl donor well known for its antidepressant role, has been assumed to have a possible role in increasing plasma levels of compounds known to be able to raise cardiovascular risk. Although the issue is still being debated, betaine (trimethylglycine, a specific methyl donor involved in the homocysteine circuit, may be able to reduce such a risk and/or, by determining a sparing effect on endogenous SAMe, may be able to improve the clinical efficiency of SAMe itself. Indeed, preliminary results have shown clinical improvement determined by an add-on therapy with betaine administered along with SAMe, versus SAMe alone, to patients affected by mild/moderate depression. Aim: To evaluate the safety and antidepressant role played by the association of SAMe plus betaine versus amitriptyline administered in untreated individuals with a recent diagnosis of mild depression. Methods: This small, open-label, randomized, observational study enrolled 64 individuals with a diagnosis of mild depression according to the Zung Self-Rating Depression Scale. After randomization, they were treated with either Laroxyl® (amitriptyline, 75 mg/day or DDM Metile® (enteric-coated SAMe, 500 mg/day, plus betaine, 250 mg/day for 12 months. Assessment of clinical scores and tolerability was performed at T=0 and after 3, 6, and 12 months. Results: After 3 months, both treatments showed a small and not statistically significant improvement. After 6 and 12 months, both treated groups demonstrated a more noticeable improved response, although the group treated with SAMe plus betaine showed better results in terms of score, number of individuals in remission, and side effects. Compliance was overlapping in both treatments. Conclusion: The association of

  20. Betaine supplementation mitigates cisplatin-induced nephrotoxicity by abrogation of oxidative/nitrosative stress and suppression of inflammation and apoptosis in rats.

    Science.gov (United States)

    Hagar, Hanan; Medany, Azza El; Salam, Reem; Medany, Gamila El; Nayal, Omina A

    2015-02-01

    Cisplatin is one of the most potent chemotherapeutic antitumor drugs used in the treatment of a wide range of solid tumors. Its primary dose-limiting side effect is nephrotoxicity. This study aims to investigate the effect of betaine supplementation on cisplatin-induced nephrotoxicity. A single intraperitoneal injection of cisplatin (5mg/kg) deteriorated the kidney functions as reflected by elevated blood urea nitrogen and serum creatinine levels. Oxidative/nitrosative stress was evident in cisplatin group by increased renal thiobarbituric acid-reactive substances (TBARS), an indicator of lipid peroxidation, reduced renal total antioxidant status and increased renal nitrite concentration. Cisplatin resulted in a decline in the concentrations of reduced glutathione, glutathione peroxidase, catalase, and superoxide dismutase in renal tissues. Renal tumor necrosis factor-α (TNF-α) was also elevated. Expressions of nuclear factor-kappa B (NF-κB) and caspase-3 were up-regulated in renal tissues as indicated by immunohistochemical analysis. Histopathological changes were observed in cisplatin group. Betaine supplementation (250 mg/kg/day) orally via gavage for 21 days prior to cisplatin injection was able to protect against deterioration in kidney function, abrogate the decline in antioxidants enzymes and suppressed the increase in TBARS, nitrite and TNF-α concentrations. Moreover, betaine inhibited NF-κB and caspase-3 activation and improved the histological changes induced by cisplatin. Thus, the present study demonstrated the renoprotective nature of betaine by attenuating the pro-inflammatory and apoptotic mediators and improving antioxidant competence in kidney tissues of cisplatin treated rats. Betaine could be a beneficial dietary supplement to attenuate cisplatin nephrotoxicity. PMID:25488130

  1. Conductimetric determination of phenylpropanolamine HCl, ranitidine HCl, hyoscyamine HBr and betaine HCl in their pure state and pharmaceutical preparations.

    Science.gov (United States)

    Issa, Yousry M; Youssef, Ahmed F A; Mutair, Ali A

    2005-01-01

    Sodium tetraphenylborate and phosphotungstic acid were used as titrants for the conductimetric determination of phenylpropanolamine HCl (PPA.Cl), ranitidine HCl (Ra.Cl), hyoscyamine HBr (Hy.Br) and betaine HCl (Be.Cl) through ion-associate complex formation. The molar combining ratio and the solubility products of the formed ion-associates were studied and calculated. The suggested method has been applied to the determination of the mentioned drugs in their pure state and pharmaceutical preparations with mean recovery values of 97.71-102.97% and relative standard deviations 0.25-0.85%. The accuracy of the method is indicated by excellent recovery and low standard deviation. The results are compared with the pharmacopoeial or the official methods. PMID:15890349

  2. Interaction of novel water-soluble and water-swelling betaine type polyampholytes with some heavy metals ions

    International Nuclear Information System (INIS)

    One of the effective methods of purification of natural and industrial wastewaters from heavy metal ions is application of functional polymers especially containing the acid-base groups. In this paper the interaction of linear and crosslinked poly-betaines with Cu2+, Ni2+ and Co2+ ions in aqueous solution is considered. The mixed solution of [polymer]:[metal ion] with the molar ratio 1:1; 2:1: 4:1 and 6:1 as well as pure polymer solution were titrated by 0.1 N NaOH. The titration curves of polymer-metal mixture are lower than that of pure polymer due to replacement of protons by metal ions

  3. Foliar urea application affects nitric oxide burst and glycine betaine metabolism in two maize cultivars under drought

    International Nuclear Information System (INIS)

    Foliar urea has been proved to act a better role in alleviation of the negative effects of drought stress (DS). However, the modulation mechanism of foliar urea are not conclusive in view of nitric oxide (NO) burst and glycine betaine metabolism and their relationship. Two maize ( Zea mays L.) cultivars (Zhengdan 958, JD958, Jundan 20, ZD20) were grown in hydroponic medium, which were treated with spraying of urea concentration of 15 g L/sup -1/ and two water regimes (non-stress and DS simulated by the addition of polyethylene glycol (PEG, 15% w/v, MW 6000). The ten-day DS treatment increased betaine aldehyde dehydrogenase (BADH) activity, choline content and nitric oxide (NO) content acted as the key enzyme, initial substrate and a nitrogenous signal substance respectively in GB synthesis metabolism, thus, induced to great GB accumulation. The accumulation of NO reached the summit earlier than that of GB. The more positive/less negative responses were recorded in JD958 as compared with ZD20 to DS. Addition of foliar ur ea could increase accumulation of choline and BADH activity as well as NO content, thereby, increase GB accumulation under DS. These positive effects of urea applying foliarly on all parameters measured were more pronounced in cultivar JD20 than those in ZD958 under drought. It is, therefore, concluded that increases of both BADH activity and choline content possibly resulted in enhancement of GB accumulation. Foliar urea application could provoke better GB accumulation by modulation of GB metabolism, possibly mediating by NO burst as a signal molecule during drought, especially in the drought sensitive maize cultivar. (author)

  4. Improved tolerance to various abiotic stresses in transgenic sweet potato (Ipomoea batatas expressing spinach betaine aldehyde dehydrogenase.

    Directory of Open Access Journals (Sweden)

    Weijuan Fan

    Full Text Available Abiotic stresses are critical delimiters for the increased productivity and cultivation expansion of sweet potato (Ipomoea batatas, a root crop with worldwide importance. The increased production of glycine betaine (GB improves plant tolerance to various abiotic stresses without strong phenotypic changes, providing a feasible approach to improve stable yield production under unfavorable conditions. The gene encoding betaine aldehyde dehydrogenase (BADH is involved in the biosynthesis of GB in plants, and the accumulation of GB by the heterologous overexpression of BADH improves abiotic stress tolerance in plants. This study is to improve sweet potato, a GB accumulator, resistant to multiple abiotic stresses by promoted GB biosynthesis. A chloroplastic BADH gene from Spinacia oleracea (SoBADH was introduced into the sweet potato cultivar Sushu-2 via Agrobacterium-mediated transformation. The overexpression of SoBADH in the transgenic sweet potato improved tolerance to various abiotic stresses, including salt, oxidative stress, and low temperature. The increased BADH activity and GB accumulation in the transgenic plant lines under normal and multiple environmental stresses resulted in increased protection against cell damage through the maintenance of cell membrane integrity, stronger photosynthetic activity, reduced reactive oxygen species (ROS production, and induction or activation of ROS scavenging by the increased activity of free radical-scavenging enzymes. The increased proline accumulation and systemic upregulation of many ROS-scavenging genes in stress-treated transgenic plants also indicated that GB accumulation might stimulate the ROS-scavenging system and proline biosynthesis via an integrative mechanism. This study demonstrates that the enhancement of GB biosynthesis in sweet potato is an effective and feasible approach to improve its tolerance to multiple abiotic stresses without causing phenotypic defects. This strategy for trait

  5. Maternal gestational betaine supplementation-mediated suppression of hepatic cyclin D2 and presenilin1 gene in newborn piglets is associated with epigenetic regulation of the STAT3-dependent pathway.

    Science.gov (United States)

    Cai, Demin; Yuan, Mengjie; Jia, Yimin; Liu, Haoyu; Hu, Yun; Zhao, Ruqian

    2015-12-01

    Betaine, which donates methyl groups through methionine metabolism for DNA and protein methylation, is critical for epigenetic gene regulation, especially during fetal development. Here we fed gestational sows with control or betaine supplemented diets (3 g/kg) throughout the pregnancy to explore the effects of maternal betaine on hepatic cell proliferation in neonatal piglets. Neonatal piglets born to betaine-supplemented sows demonstrated a reduction of cell number and DNA content in the liver, which was associated with significantly down-regulated hepatic expression of cell cycle regulatory genes, cyclin D2 (CCND2) and presenilin1 (PSEN1). Moreover, STAT3 binding to the promoter of CCND2 and PSEN1 was also lower in betaine-exposed piglets, accompanied by strong reduction of STAT3 mRNA and protein expression, along with its phosphorylation at Tyr705 and Ser727 residues. Also, prenatal betaine exposure significantly attenuated upstream kinases of STAT3 signaling pathway (phospho-ERK1/2, phospho-SRC and phospho-JAK2) in the livers of neonates. Furthermore, the repressed STAT3 expression in the liver of betaine-exposed piglets was associated with DNA hypermethylation and more enriched repression histone mark H3K27me3 on its promoter, together with significantly up-regulated expression of H3K27me3 and enhancer of zeste homolog 2 (EZH2) proteins, as well as miR-124a, which targets STAT3. Taken together, our results suggest that maternal dietary betaine supplementation during gestation inhibits hepatic cell proliferation in neonatal piglets, at least partly, through epigenetic regulation of hepatic CCND2 and PSEN1 genes via a STAT3-dependent pathway. These neonatal changes in cell cycle and proliferation regulation may lead to lower liver weight and hepatic DNA content at weaning. PMID:26359029

  6. Effects of Dietary L-carnitine and Betaine on Serum Biochemical Indices of Large Yellow Croaker (Pseudosciaena crocea Cultured in Floating Net Cages

    Directory of Open Access Journals (Sweden)

    Wei-guo Sang

    2012-10-01

    Full Text Available The objective of this study was to investigate the biochemical changes of large yellow croaker as affected by dietary supplements. Large yellow croaker (Pseudosciaena crocea is a marine species that is widely cultured in China due to its high commercial value. However, the cage-cultured large yellow croakers were found to be less tasty compared with wild large yellow croakers due to high lipid in their body, which significantly impacts the commercial markets. Triglycerides, cholesterol and free fatty acids are main lipid ingredients in the animal body. The fish were fed with basal diet or basal diet supplemented with L-carnitine (0.08% of dry weight diet or betaine (0.8% of dry weight diet for 12 weeks in seawater floating net cages (3×2×1.5 m each holding 60 fishes. Three net cages were assigned to each dietary treatment, as replications. The seawater temperature ranged from 18 to 31°C and salinity from 25 to 28 g/kg. Fish were hand-fed one of the experimental diets to apparent satiety twice daily (05:00 and 17:30 throughout the 12 week experimental period. The results indicate that L-carnitine or betaine in diets significantly reduced Serum Triglyceride (STG and Serum Cholesterol (SCH levels while increased Serum Free Fatty Acids (SFFA content (p<0.05. The diets of L-carnitine or betaine supplements on serum biochemical indices of that fish species have positive effects. These results suggested that the supplementation with L-carnitine or betaine is one of the effective ways to improve the meat quality of large yellow croakers cultured in floating net cages.

  7. Plasma methionine, choline, betaine, and dimethylglycine in relation to colorectal cancer risk in the European Prospective Investigation into Cancer and Nutrition (EPIC)

    OpenAIRE

    Nitter, Mathilde Hjelle; Norgård, Benedicte Wentzel; Vogel, Stefan; Eussen, Simone; Meyer, Klaus; Ulvik, Arve; Ueland, Per Magne; Nygård, Ottar; Vollset, Stein Emil; Bjørge, Tone; Tjønneland, Anne; Hansen, Louise; Boutron-Ruault, Marie-Christine; Racine, Antoine; Cottet, Vanessa

    2014-01-01

    Background Disturbances in one carbon metabolism may contribute to carcinogenesis by affecting methylation and synthesis of DNA. Choline and its oxidation product betaine are involved in this metabolism and can serve as alternative methyl group donors when folate status is low. Patients and methods We conducted a case–control study nested within the European Prospective Investigation into Cancer and Nutrition (EPIC), to investigate plasma concentrations of the methyl donors methionin...

  8. Preliminary results of a randomized controlled trial carried out with a fixed combination of S-adenosyl-L-methionine and betaine versus amitriptyline in patients with mild depression

    OpenAIRE

    Di Pierro F; Settembre R

    2015-01-01

    Francesco Di Pierro,1 Roberto Settembre2 1Scientific Department, Velleja Research, Milan, Italy; 2Neurosurgery Department, Di Venere Hospital, Bari, Italy Background: S-adenosyl-L-methionine (SAMe), a safe, endogenous, pleiotropic methyl donor well known for its antidepressant role, has been assumed to have a possible role in increasing plasma levels of compounds known to be able to raise cardiovascular risk. Although the issue is still being debated, betaine (trimethylglycine), a specific m...

  9. Does Glycine Betaine and Salicylic Acid Ameliorate the Negative Effect of Drought on Wheat by Regulating Osmotic Adjustment through Solutes Accumulation?

    OpenAIRE

    Heshmat S. Aldesuquy; Mohamed A. Abbas; Abo-Hamed, Samy A.; Abeer H. Elhakem

    2013-01-01

    A pot experiment was conducted to evaluate the beneficial effect of foliar application of glycine betaine (10mM), grain presoaking in salicylic acid (0.05 M) and their interaction on drought tolerance of two wheat (Triticum aestivum L.) cultivars (sensitive, Sakha 94 and resistant, Sakha 93). Osmotic pressure, some osmolytes concentration and grain yield were determined. Water stress caused an increase in osmotic pressure, proline, total soluble nitrogen, total so...

  10. Effect of Folic Acid, Betaine, Vitamin B6, and Vitamin B12 on Homocysteine and Dimethylglycine Levels in Middle-Aged Men Drinking White Wine

    Science.gov (United States)

    Rajdl, Daniel; Racek, Jaroslav; Trefil, Ladislav; Stehlik, Pavel; Dobra, Jana; Babuska, Vaclav

    2016-01-01

    Moderate regular consumption of alcoholic beverages is believed to protect against atherosclerosis but can also increase homocysteine or dimethylglycine, which are putative risk factors for atherosclerosis. We aimed (1) to investigate the effect of alcohol consumption on vitamins and several metabolites involved in one-carbon metabolism; and (2) to find the most effective way of decreasing homocysteine during moderate alcohol consumption. Methods: Male volunteers (n = 117) were randomly divided into five groups: the wine-only group (control, 375 mL of white wine daily for one month) and four groups combining wine consumption with one of the supplemented substances (folic acid, betaine, and vitamins B12 or B6). Significant lowering of homocysteine concentration after the drinking period was found in subjects with concurrent folate and betaine supplementation. Vitamin B12 and vitamin B6 supplementation did not lead to a statistically significant change in homocysteine. According to a multiple linear regression model, the homocysteine change in the wine-only group was mainly determined by the interaction between the higher baseline homocysteine concentration and the change in dimethylglycine levels. Folate and betaine can attenuate possible adverse effects of moderate alcohol consumption. Dimethylglycine should be interpreted together with data on alcohol consumption and homocysteine concentration. PMID:26771632

  11. Effect of Folic Acid, Betaine, Vitamin B6, and Vitamin B12 on Homocysteine and Dimethylglycine Levels in Middle-Aged Men Drinking White Wine

    Directory of Open Access Journals (Sweden)

    Daniel Rajdl

    2016-01-01

    Full Text Available Moderate regular consumption of alcoholic beverages is believed to protect against atherosclerosis but can also increase homocysteine or dimethylglycine, which are putative risk factors for atherosclerosis. We aimed (1 to investigate the effect of alcohol consumption on vitamins and several metabolites involved in one-carbon metabolism; and (2 to find the most effective way of decreasing homocysteine during moderate alcohol consumption. Methods: Male volunteers (n = 117 were randomly divided into five groups: the wine-only group (control, 375 mL of white wine daily for one month and four groups combining wine consumption with one of the supplemented substances (folic acid, betaine, and vitamins B12 or B6. Significant lowering of homocysteine concentration after the drinking period was found in subjects with concurrent folate and betaine supplementation. Vitamin B12 and vitamin B6 supplementation did not lead to a statistically significant change in homocysteine. According to a multiple linear regression model, the homocysteine change in the wine-only group was mainly determined by the interaction between the higher baseline homocysteine concentration and the change in dimethylglycine levels. Folate and betaine can attenuate possible adverse effects of moderate alcohol consumption. Dimethylglycine should be interpreted together with data on alcohol consumption and homocysteine concentration.

  12. Characterization and Crystal Structures of Two Copper(Ⅱ) Complexes Constructed by a Flexible Double Betaine Ligand

    Institute of Scientific and Technical Information of China (English)

    JIANG Ning-Yi; LI Song-Lin

    2007-01-01

    A flexible double betaine 1,4-bis(pyridinil-4-carboxylato)-1,4-dimethylbenzene L has been used to generate two Cu(Ⅱ)-containing metal complexes that exhibit different polymeric structures: [Cu(H2O)2 L]·2NO3 1 and [Cu(H2O)3 L]·2Cl·H2O 2. The crystal structures of 1 and 2have been determined by single-crystal X-ray diffraction method. Crystal data for 1: triclinic, space group P1-, a = 5.253(2), b = 7.406(3), c = 14.792(5) (A), α = 84.195(5), β = 80.014(5), γ =78.053(5)°, V = 553.2(3) (A)3, Z = 1, F(000) = 293, Dc = 1.717 g/cm3, the final R = 0.0385 and wR =0.1079 for 1883 observed reflections (I> 2σ(Ⅰ)); and those for 2: monoclinic, space group P21/c, a =10.222(3), b = 25.287(7), c = 9.277(3) (A),β = 93.572(5)°, V = 2393.2(12) (A)3, Z = 4, F(000) = 1140,Dc = 1.540 g/cm3, the final R = 0.0472 and wR = 0.0956 for 3204 observed reflections (I >2σ(Ⅰ)).

  13. Glycine betaine and salicylic acid induced modification in productivity of two different cultivars of wheat grown under water stress

    Directory of Open Access Journals (Sweden)

    Heshmat S. Aldesuquy

    2012-05-01

    Full Text Available A pot experiment was conducted to evaluate the beneficial effect of foliar application of glycine betaine (10mM, grain presoaking in salicylic acid (0.05 M and their interaction on drought tolerance of two wheat (Triticum aestivum L. cultivars (sensitive, Sakha 94 and resistant, Sakha 93. Water stress decreased wheat yield components (spike length, number of spikelets / main spike, 100 kernel weight, grain number / spike, grain yield / spike, grain yield / plant, straw yield / plant, crop yield / plant, harvest, mobilization and crop indices and the biochemical aspects of grains(grain biomass, carbohydrates, total protein, total phosphorus, ions content and amino acids in both wheat cultivars. The applied chemicals appeared to alleviate the negative effects of water stress on wheat productivity (particularly the sensitive one and the biochemical aspects of yielded grains. The effect was more pronounced with GB+SA treatment. This improvement would result from the repairing effect of the provided chemicals on growth and metabolism of wheat plants grown under water deficit condition. In response to the applied water stress and the used chemicals, the grain yield of the sensitive and resistant wheat cultivars was strongly correlated with all the estimated yield components (shoot length, spike length, plant height, main spike weight, number of spikelets per main spike, 100 kernel weight, grain number per spike, grain weight per plant, straw weight per plant, crop yield per plant, harvest, mobilization and crop indices.

  14. Phonon symmetry selection rules for coherent inelastic neutron scattering in practice. Application to betaine calcium chloride dehydrate (BCCD)

    International Nuclear Information System (INIS)

    Complete text of publication follows. A theorem demonstrating the existence of symmetry selection rules for coherent inelastic neutron scattering by phonons, independent of particular structural features, was recently formulated and proven [1]. In the present contribution, the power of the symmetry method is illustrated in practice, in the case of a molecular crystal with a rather complicated structure. To this purpose, the selection rules for detection of phonon scattering in all crystalline phases of to betaine calcium chloride dehydrate (BCCD) [2] are given explicitly. Comparison with selection rules for Raman and IR spectroscopy is provided. It is shown how these results allow a direct assignment of the optic modes measured in the low temperature ferroelectric phase of BCCD. Finally, the selection rules are used for optimization of the scattering geometry for detection of the so-called pseudophason mode, specific excitation of the commensurate modulated phase. (author) [1] J.M. Perez-Mato, M. Aroyo, J. Hlinka, M. Quilichini and R. Currat, Phys. Rev. Lett., 81 (1998) 2462; [2] G. Schaack and M.Le Maire, Ferroelectrics 208-209 (1998) 1

  15. Effects of glycine betaine on bone marrow death and intestinal damage by gamma rays and carbon ions

    International Nuclear Information System (INIS)

    In this study, we investigated the effects of glycine betaine (GB) on bone marrow death and intestinal damage by gamma rays or carbon ions. C3H/He female mice received an i.p.-injection of GB before or after whole-body irradiation with gamma rays or 50 keV μm-1 carbon ions. The irradiated mice were observed to determine the mortality for 30 days after exposure. Mice were also killed at 3.5 days after the exposure to determine the intestinal damage. The numbers of crypts per transverse circumference were counted using a microscope. For the bone marrow death, GB (93 mg GB per mouse) significantly (p < 0.05) increased the percentage survival for both radiations. For the intestinal damage, GB (93 mg GB per mouse) significantly (p < 0.05) increased the crypt survival for gamma rays, but not for carbon ions. GB might be a potential protector against normal tissue damage as a side effect in radiotherapy. (authors)

  16. Homostachydrine (pipecolic acid betaine) as authentication marker of roasted blends of Coffea arabica and Coffea canephora (Robusta) beans.

    Science.gov (United States)

    Servillo, Luigi; Giovane, Alfonso; Casale, Rosario; Cautela, Domenico; D'Onofrio, Nunzia; Balestrieri, Maria Luisa; Castaldo, Domenico

    2016-08-15

    The occurrence of pipecolic acid betaine (homostachydrine) and its biosynthetic precursor N-methylpipecolic acid was detected for the first time in green coffee beans of Robusta and Arabica species. The analyses were conducted by HPLC-ESI tandem mass spectrometry and the metabolites identified by product ion spectra and comparison with authentic standards. N-methylpipecolic acid was found at similar levels in green coffee beans of Robusta and Arabica, whereas a noticeable difference of homostachydrine content was observed between the two green coffee bean species. Interestingly, homostachydrine content was found to be unaffected by coffee bean roasting treatment because of a noticeable heat stability, a feature that makes this compound a candidate marker to determine the content of Robusta and Arabica species in roasted coffee blends. To this end, a number of certified pure Arabica and Robusta green beans were analyzed for their homostachydrine content. Results showed that homostachydrine content was 1.5±0.5mg/kg in Arabica beans and 31.0±10.0mg/kg in Robusta beans. Finally, to further support the suitability of homostachydrine as quality marker of roasted blends of Arabica and Robusta coffee beans, commercial samples of roasted ground coffee blends were analyzed and the correspondence between the derived percentages of Arabica and Robusta beans with those declared on packages by manufacturers was verified. PMID:27006213

  17. The role of lipids and salts in two-dimensional crystallization of the glycine-betaine transporter BetP from Corynebacterium glutamicum

    DEFF Research Database (Denmark)

    Tsai, Ching-Ju; Ejsing, Christer S.; Shevchenko, Andrej;

    2007-01-01

    The osmoregulated and chill-sensitive glycine-betaine transporter (BetP) from Corynebacterium glutamicum was reconstituted into lipids to form two-dimensional (2D) crystals. The sensitivity of BetP partly bases on its interaction with lipids. Here we demonstrate that lipids and salts influence...... crystal morphology and crystallinity of a C-terminally truncated BetP. The salt type and concentration during crystallization determined whether crystals grew in the form of planar-tubes, sheets or vesicles, while the lipid type influenced crystal packing and order. Three different lipid preparations for...

  18. Hypotaurine, N-methyltaurine, taurine, and glycine betaine as dominant osmolytes of vestimentiferan tubeworms from hydrothermal vents and cold seeps.

    Science.gov (United States)

    Yin, M; Palmer, H R; Fyfe-Johnson, A L; Bedford, J J; Smith, R A; Yancey, P H

    2000-01-01

    Organic osmolytes, solutes that regulate cell volume, occur at high levels in marine invertebrates. These are mostly free amino acids such as taurine, which are "compatible" with cell macromolecules, and methylamines such as trimethylamine oxide, which may have a nonosmotic role as a protein stabilizer, and which is higher in many deep-sea animals. To better understand nonosmotic roles of osmolytes, we used high-performance liquid chromatography and (1)H-nuclear magnetic resonance (NMR) to analyze vestimentiferans (vestimentum tissue) from unusual marine habitats. Species from deep hydrothermal vents were Riftia pachyptila of the East Pacific Rise (2,636 m) and Ridgeia piscesae of the Juan de Fuca Ridge (2,200 m). Species from cold hydrocarbon seeps were Lamellibrachia sp. and an unnamed escarpid species from subtidal sediment seeps (540 m) off Louisiana and Lamellibrachia barhami from bathyal tectonic seeps (1,800-2,000 m) off Oregon. Riftia were dominated by hypotaurine (152 mmol/kg wet wt), an antioxidant, and an unidentified solute with an NMR spectrum consistent with a methylamine. Ridgeia were dominated by betaine (N-trimethylglycine; 109 mmol/kg), hypotaurine (64 mmol/kg), and taurine (61 mmol/kg). The escarpids were dominated by taurine (138 mmol/kg) and hypotaurine (69 mmol/kg). Both Lamellibrachia populations were dominated by N-methyltaurine (209-252 mmol/kg), not previously reported as a major osmolyte, which may be involved in methane and sulfate metabolism. Trunk and plume tissue of the Oregon Lamellibrachia were nearly identical to vestimentum in osmolyte composition. The methylamines may also stabilize proteins against pressure; they were significantly higher in the three deeper-dwelling groups. PMID:11073799

  19. Does Glycine Betaine and Salicylic Acid Ameliorate the Negative Effect of Drought on Wheat by Regulating Osmotic Adjustment through Solutes Accumulation?

    Directory of Open Access Journals (Sweden)

    Heshmat S. Aldesuquy

    2013-08-01

    Full Text Available A pot experiment was conducted to evaluate the beneficial effect of foliar application of glycine betaine (10mM, grain presoaking in salicylic acid (0.05 M and their interaction on drought tolerance of two wheat (Triticum aestivum L. cultivars (sensitive, Sakha 94 and resistant, Sakha 93. Osmotic pressure, some osmolytes concentration and grain yield were determined. Water stress caused an increase in osmotic pressure, proline, total soluble nitrogen, total soluble sugars, organic acids, ions (Na+, K+, Ca+2, Mg+2 and Cl- content as well as Na+/K+ ratio in cell sap flag leaves of both wheat cultivars. The resistant variety had higher values of osmotic pressure, proline, organic acids and ions content than the sensitive one. On the other hand, water stress induced marked decrease (P<0.05 in grain yield. The applied chemicals mitigated the effect of water stress on the used wheat cultivars. The effect was more pronounced with glycine betaine + salicylic acid treatment. The applied chemicals increased the osmotic pressure, the osmolytes concentrations as well as the grain yield. Furthermore, the osmotic pressure of flag leaf sap appeared to depend on proline, TSN, TSS, organic acids and the ions content. The economic yield (grain yield was positively correlated with proline, keto-acids and osmotic pressure but negatively correlated with TSN, TSS and citric acid.

  20. Theoretical study of heavy-atom tuning of nonlinear optical properties in group 15 derivatives of N,N,N-trimethylglycine (betaine).

    Science.gov (United States)

    Milne, Bruce F; Nogueira, Fernando; Cardoso, Cláudia

    2013-03-14

    Nitrogen is a common structural element in the acceptor moieties of organic donor-acceptor nonlinear optical (NLO) chromophores. In order to assess the effect of substitution with heavier group 15 elements, computational studies of the nonlinear optical properties of betaine derivatives, (CH(3))(3)X(+)CH(2)CO(2)(-) (X = N, P, As, Sb, Bi), have been performed. First hyperpolarisabilities, β(HRS)(-2ω; ω, ω), corresponding to hyper-Rayleigh scattering susceptibilities have been estimated for this series using TDDFT quadratic response calculations including polarisable-continuum method water solvation and show a five-fold increase on going from N to Bi. Differential frequency dispersion effects lead to a gradual increase in this ratio as the wavelength of the incident radiation is increased from 1907 nm to 800 nm. The depolarisation ratio of the NLO response indicates that the change in β is accompanied by a change in the type of chromophore from octupolar (X = N) to a linear donor-acceptor type (X = Bi). The observed increase of the NLO response correlates with the changing electronic configurations of the group 15 elements and alterations in the character of the frontier molecular orbitals. Relativistic effects are found to play an important part in enhancement of the NLO response in the Sb and Bi betaine derivatives. These results suggest that derivatisation of organic molecules that otherwise display small β values with heavy group 15 elements is a useful method for creating enhanced NLO chromophores. PMID:23299281

  1. Osmoregulation in Klebsiella pneumoniae: enhancement of anaerobic growth and nitrogen fixation under stress by proline betaine, gamma-butyrobetaine, and other related compounds.

    Science.gov (United States)

    Le Rudulier, D; Bernard, T; Goas, G; Hamelin, J

    1984-03-01

    Exogenous proline betaine ( stachydrine or N- dimethylproline ) or gamma-butyrobetaine (gamma-trimethylaminobutyrate), at a concentration as low as 1 mM, were found to stimulate the growth rate of Klebsiella pneumoniae, wild type M5A1 , in media of inhibitory osmotic strength (0.8 M NaC1). Simultaneously, nitrogen fixation by whole cells, a process particularly sensitive to osmotic stress, was strongly enhanced by these compounds. However, in the absence of sodium chloride, both the growth and nitrogen fixation were not affected by the addition of the methylammonium derivatives in the medium. The sensitivity of the nitrogen fixation to osmotic stress was used as a bioassay to evaluate the potentiality of osmoprotective compound in relation to the number of methyl groups on the nitrogen atom of glycine, proline, and gamma-aminobutyrate. Experiments with sarcosine ( monomethylglycine ), dimethylglycine, and glycine betaine ( trimethylglycine ), or experiments with mono- and di- methylproline or gamma-mono-, gamma-di, gamma-tri- methylaminobutyrate , indicated that the greatest stress tolerance was always obtained with the more N-methylated compounds. PMID:6372974

  2. A Randomized Pilot Study of Inositol in Association with Betaine and Boswellia in the Management of Mastalgia and Benign Breast Lump in Premenopausal Women

    Science.gov (United States)

    Pasta, Vittorio; Dinicola, Simona; Giuliani, Alessandro; Harrath, Abdel Halim; Alwasel, Saleh H.; Tartaglia, Francesco; Cucina, Alessandra; Bizzarri, Mariano

    2016-01-01

    Benign mammary lumps and mastalgia are the most common breast disorders; yet, there is no clear-cut consensus about the best strategy for their treatment. We hypothesized that a combination, including boswellic acid, betaine, and myoinositol, would be beneficial in breast disorders by exerting a pleiotropic effect on multiple pathways. Indeed, myoinositol has already been proven to modulate some factors involved in the genesis of breast diseases, such as fibrosis and metabolic and endocrine cues. In our study, 76 women were randomly assigned to either the experimental or the placebo arm. After six months of treatment, statistically significant differences between the two groups were recorded for pain relief (56% vs 17%) and breast density reduction (60% vs 9%). Furthermore, benign breast mass dimension showed a reduction in the experimental group (40% vs 16%). The combination of boswellic acid, betaine, and myoinositol has been demonstrated to be effective in the treatment of breast pain and radiologically and histologically confirmed benign breast mass and in the reduction of breast density, one of the pivotal risk factors for the development of breast cancer, without any side effects. PMID:27127407

  3. Neutron scattering techniques for betaine calcium chloride dihydrate under applied external field (temperature, electric field and hydrostatic pressure)

    International Nuclear Information System (INIS)

    We have studied with neutron scattering techniques betaine calcium chloride dihydrate (BCCD), a dielectric aperiodic crystal which displays a Devil's staircase type phase diagram made up of several incommensurate and commensurate phases, having a range of stability very sensitive to temperature, electric field and hydrostatic pressure. We have measured a global hysteresis of δ(T) of about 2-3 K in the two incommensurate phases. A structural study of the modulated commensurate phases 1/4 and 1/5 allows us to evidence that the atomic modulation functions are anharmonic. The relevance of the modelization of the modulated structure by polar Ising pseudo-spins is then directly established. On the basis of group theory calculation in the four dimensional super-space, we interpret this anharmonic modulation as a soliton regime with respect to the lowest-temperature non modulated ferroelectric phase. The continuous character of the transition to the lowest-temperature non modulated phase and the diffuse scattering observed in this phase are accounted for the presence of ferroelectric domains separated by discommensurations. Furthermore, we have shown that X-rays induce in BCCD a strong variation with time of irradiation of the intensity of satellite peaks, and more specifically for third order ones. This is why the 'X-rays' structural model is found more harmonic than the 'neutron' one. Under electric field applied along the vector b axis, we confirm that commensurate phases with δ = even/odd are favoured and hence are polar along this direction. We have evidenced at 10 kV / cm two new higher order commensurate phases in the phase INC2, corroborating the idea of a 'complete' Devil's air-case phase diagram. A phenomenon of generalized coexistence of phases occurs above 5 kV / cm. We have characterized at high field phase transitions between 'coexisting' phases, which are distinguishable from classical lock-in transitions. Under hydrostatic pressure, our results contradict

  4. New multilayer coating using quaternary ammonium chitosan and κ-carrageenan in capillary electrophoresis: application in fast analysis of betaine and methionine.

    Science.gov (United States)

    Vitali, Luciano; Della Betta, Fabiana; Costa, Ana Carolina O; Vaz, Fernando Antonio Simas; Oliveira, Marcone Augusto Leal; Vistuba, Jacqueline Pereira; Fávere, Valfredo T; Micke, Gustavo A

    2014-06-01

    The aim of this study was to develop a new multilayer coating with crosslinked quaternary ammonium chitosan (hydroxypropyltrimethyl ammonium chloride chitosan; HACC) and κ-carrageenan for use in capillary electrophoresis. A new semi-permanent multilayer coating was formed using the procedure developed and the method does not require the presence of polymers in the background electrolyte (BGE). The new capillary multilayer coating showed a cathodic electroosmotic flow (EOF) of around 30×10(-9) m(2) V(-1) s(-1) which is pH-independent in the range of pH 2 to 10. The enhanced EOF at low pH obtained contributed significantly to the development of a fast method of separation. The multilayer coating was then applied in the development of a fast separation method to determine betaine and methionine in pharmaceutical formulations by capillary zone electrophoresis (CZE). The BGE used to determine the betaine and methionine concentrations was composed of 10 mmol L(-1) tris(hydroxymethyl) aminomethane, 40 mmol L(-1) phosphoric acid and 10% (v/v) ethanol, at pH 2.1. A fused-silica capillary of 32 cm (50 µm ID×375 µm OD) was used in the experiments and samples and standards were analyzed employing the short-end injection procedure (8.5 cm effective length). The instrumental analysis time of the optimized method was 1.53 min (approx. 39 runs per hour). The validation of the proposed method for the determination of betaine and methionine showed good linearity (R(2)>0.999), adequate limit of detection (LOD <8 mg L(-1)) for the concentration in the samples and inter-day precision values lower than 3.5% (peak area and time migration). The results for the quantification of the amino acids in the samples determined by the CZE-UV method developed were statistically equal to those obtained with the comparative LC-MS/MS method according to the paired t-test with a confidence level of 95%. PMID:24725863

  5. Development of method for determination of Sodium monochloroacetate and sodium dichloroacetate in Cocoamido Propyl Betaine by gas chromatography: FID, ECD and MS

    Energy Technology Data Exchange (ETDEWEB)

    Leao, Claudio; Redigolo, Marcelo Miyada; Amaral, Priscila Oliveira; Bustillos, Oscar Vega, E-mail: claudio.leao@usp.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2015-07-01

    Cocoamide Propyl Betaine is a feedstock for consumer products of cosmetic and household segments. Sodium monochloroacetate and sodium dichloroacetate impurities are toxic, irritating and harmful to the environment and lower concentrations - parts per million level - are required in process control of producers and regulatory affairs. Regarding analytical test method, two conditions should be met: quantification limit, precision and accuracy should be appropriate; different techniques for gas chromatography - ECD, FID and MS - should be available, since for manufacturer is not so easy to keep electron capture detector by radioactive source Ni 63 due to government control and need of qualified radiological protection. The samples are obtained at manufacturers; for the analyte separation, treatment methodologies are employed by liquid-liquid extraction and solid phase extraction. Alternative detectors used in this study are: Flame Ionization and Mass Spectrometer with Electron Ionization. The validation process will be applied to methodology to ensure a selective, robust, accurate and reproducible analytical determination. (author)

  6. Development of method for determination of Sodium monochloroacetate and sodium dichloroacetate in Cocoamido Propyl Betaine by gas chromatography: FID, ECD and MS

    International Nuclear Information System (INIS)

    Cocoamide Propyl Betaine is a feedstock for consumer products of cosmetic and household segments. Sodium monochloroacetate and sodium dichloroacetate impurities are toxic, irritating and harmful to the environment and lower concentrations - parts per million level - are required in process control of producers and regulatory affairs. Regarding analytical test method, two conditions should be met: quantification limit, precision and accuracy should be appropriate; different techniques for gas chromatography - ECD, FID and MS - should be available, since for manufacturer is not so easy to keep electron capture detector by radioactive source Ni 63 due to government control and need of qualified radiological protection. The samples are obtained at manufacturers; for the analyte separation, treatment methodologies are employed by liquid-liquid extraction and solid phase extraction. Alternative detectors used in this study are: Flame Ionization and Mass Spectrometer with Electron Ionization. The validation process will be applied to methodology to ensure a selective, robust, accurate and reproducible analytical determination. (author)

  7. 甜菜碱营养生理功能研究进展%Advance in nutritional and physiological functions of betaine

    Institute of Scientific and Technical Information of China (English)

    李飞; 姚军虎

    2009-01-01

    @@ 甜菜碱(Betaine,BET)又名三甲胺乙内酯(Trimethvlaminoacetate)或三甲基甘氨酸(N,N,N-Trimethylglycine).因为其独特的化学结构,甜菜碱在生命有机体中发挥着多种功能.它可提供三个不稳定的甲基,为多种物质合成提供原料,如肉碱、肌酸、嘌呤及蛋氨酸等.同时,经去甲基作用生成甘氨酸,进入氨基酸代谢池.南于甜菜碱可提供甲基和氨基酸,它可参与机体氨基酸代谢、脂肪代谢及DNA甲基化等过程.

  8. Effect of N-methyl-aspartate and Betaine on Growth Performance and Correlation Between Growth Hormone, Growth Performance and Carcass Composition in Finishing Pigs

    Institute of Scientific and Technical Information of China (English)

    X(U) Zi-rong; FENG Jie; ZOU Xiao-ting

    2002-01-01

    Ninety finishing pigs were selected to study the effect of N-methyl-aspartate and betaine on the internal growth hormone level in the serum and the correlation between the growth hormone level, growth performance and carcass characteristic of finishing pig. The study showed that the two matters could improve pig growth and carcass composition significantly. The correlation analyses indicated that the growth hormone and IGF-I have a positive correlation with the growth rate. Carcass lean ratio, longissimus dorsi area, serum free fatty acid and lipase activity have a negative correlation with the feed conversion ratio, carcass fat ratio and urine nitrogen. But the growth hormone is more effective than IGF-I (P< 0.01 ). The results implicated that both the two matters may act through growth hormone axis(growth hormone - IGF-I) to manipulate pig growth.

  9. beta-Alanine betaine synthesis in the Plumbaginaceae. Purification and characterization of a trifunctional, S-adenosyl-L-methionine-dependent N-methyltransferase from Limonium latifolium leaves.

    Science.gov (United States)

    Rathinasabapathi, B; Fouad, W M; Sigua, C A

    2001-07-01

    beta-Alanine (beta-Ala) betaine is an osmoprotective compound accumulated by most members of the highly stress-tolerant family Plumbaginaceae. Its potential role in plant tolerance to salinity and hypoxia makes its synthetic pathway an interesting target for metabolic engineering. In the Plumbaginaceae, beta-Ala betaine is synthesized by S-adenosyl-L-methionine-dependent N-methylation of beta-Ala via N-methyl beta-Ala and N,N-dimethyl beta-Ala. It was not known how many N-methyltransferases (NMTases) participate in the three N-methylations of beta-Ala. An NMTase was purified about 1,890-fold, from Limonium latifolium leaves, using a protocol consisting of polyethylene glycol precipitation, heat treatment, anion-exchange chromatography, gel filtration, native polyacrylamide gel electrophoresis, and two substrate affinity chromatography steps. The purified NMTase was trifunctional, methylating beta-Ala, N-methyl beta-Ala, and N,N-dimethyl beta-Ala. Gel filtration and sodium dodecyl sulfate-polyacrylamide gel electrophoresis analyses indicated that the native NMTase is a dimer of 43-kD subunits. The NMTase had an apparent K(m) of 45 microM S-adenosyl-l-methionine and substrate inhibition was observed above 200 microM. The apparent K(m) values for the methyl acceptor substrates were 5.3, 5.7, and 5.9 mM for beta-Ala, N-methyl beta-Ala, and N,N-dimethyl beta-Ala, respectively. The NMTase had an isoelectric point of 5.15 and was reversibly inhibited by the thiol reagent p-hydroxymercuribenzoic acid. PMID:11457974

  10. The effect of SAMe and betaine on Hepa 1-6, C34 and E47 liver cell survival in vitro.

    Science.gov (United States)

    Oliva, Joan; Zhong, Jin; Buslon, Virgil S; French, Samuel W

    2012-02-01

    In recent years, methyl one-carbon metabolism has received a great deal of attention because the disruption of methyl balance in a variety of genetically modified mice is associated with the development of various forms of liver injury, namely fatty liver disease and hepatocellular carcinoma (HCC). In addition, patients with liver disease often have an abnormal expression of key genes involved in methionine metabolism as well as elevated serum levels of methionine and homocysteine (Hcy). S-adenosylmethionine (SAMe) has rapidly moved from being a methyl donor to a key metabolite that regulates hepatocyte proliferation, necrosis and differentiation. Biosynthesis of SAMe occurs in all mammalian cells as the first step in methionine catabolism in a reaction catalyzed by methionine adenosyltransferase (MAT). Decreased hepatic SAMe biosynthesis is a consequence of numerous forms of chronic liver injury. In an animal model of chronic liver SAMe deficiency, the liver is predisposed to further injury and develops spontaneous steatohepatitis and HCC. SAMe treatment in experimental animal models of liver injury shows hepatoprotective properties. Meta-analyses also showed that it is effective in the treatment of patients with cholestatic liver diseases. We studied the survival of liver cells treated with SAMe and betaine using Hepa 1-6 and E47/C34 cell lines. We showed that exogenous SAMe decreased the number of Hepa 1-6 and E47/C34 cells, and increased the number of dead cells in vitro. Betaine had no significant effect on the number of surviving cells and the number of dead cells. The combination of both methyl donors significantly increased the survival of liver cells and reduced necrosis, compared to SAMe alone. This study showed the inhibition of the proliferation and increased necrosis in response to SAMe on liver cancer cell lines Hepa 1-6 and C34. PMID:22032937

  11. Effects of DMSO, glycerol, betaine and their combinations in detecting single nucleotide polymorphisms of epidermal growth factor receptor (EGFR) gene promoter sequence in non-small-cell lung cancer (NSCLC) patients.

    Science.gov (United States)

    Jurišić, Vladimir; Obradović, Jasmina; Tošić, Natasa; Pavlović, Sonja; Kulić, Milan; Djordjević, Nataša

    2016-09-01

    The aim of the study was to examine the effects of frequently used polymerase chain reaction (PCR) additives DMSO, glycerol and betaine on amplification of GC-rich epidermal growth factor receptor (EGFR) gene promoter region, in order to detect the presence of -216G>T and -191C>A gene variations in non-small-cell lung cancer (NSCLC) patients. PCR products and restriction fragments were detected by electrophoresis on 8% polyacrylamide gel and 3% agarose gel. Our analysis shows that single used additives including DMSO in concentration of 7% and 10%, glycerol in concentration of 10%, 15% and 20%, as well as betaine in concentration of 1M, 1.5M and 2M significantly enhanced the yield and specificity of PCR reaction. In addition, the combination of 10% DMSO with 15% glycerol has shown positive effects, whereas other analyzed combinations of additives failed to amplify the EGFR promoter region. PMID:27284695

  12. Investigations on ideal mode of cell disruption in extremely halophilic Actinopolyspora halophila (MTCC 263 for efficient release of glycine betaine and trehalose

    Directory of Open Access Journals (Sweden)

    Jayaranjan R. Kar

    2015-03-01

    Full Text Available Actinopolyspora halophila produces glycine betaine and trehalose intracellularly in considerable quantities. These biomolecules are commercially important as they have applications in food, pharmaceuticals, and agricultural sector. Development of an efficient cell disruption technique is an important step for the release of these biomolecules. In this study, various cell disruption methods such as chemical, enzymatic, physico-mechanical and physical methods were evaluated. Cell disruption by osmotic shock was found to be the best suited method for A. halophila which also has a potential to be industrially scaled up. Cell bursting pressure that is generated during osmotic shock in A. halophila was computed using Morse equation and was found to be π = 238.37 ± 29.54 atm or 2.35 ± 0.29 kPa. In addition, it was found that osmotic shock followed a first order release rate kinetics in A. halophila. The findings can be used for commercially important biomolecules from other halophilic and/or halotolerant microbes.

  13. On the molecular structure and UV/vis spectroscopic properties of the solvatochromic and thermochromic pyridinium-N-phenolate betaine dye B30.

    Science.gov (United States)

    Catalán, Javier; Garcia de Paz, Jose Luis; Reichardt, Christian

    2010-06-01

    Quantum chemical calculations as well as vis absorption and fluorescence measurements of the pyridinium-N-phenolate betaine dye B30, dissolved in 1-chlorobutane at temperatures between 343 and 77 K, shed more light on the solvatochromism, thermosolvatochromism, and photophysical behavior of this probe dye, formerly used to establish an empirical scale of solvent polarity, called E(T)(30) or E(T)(N) scale. A new calculated gas-phase E(T)(30) value is reported. Complementary to recent work of Kharlanov and Rettig (J. Phys. Chem. A 2009, 113, 10693-10703), it is shown that fluorescence of B30 in 1-chlorobutane solution is observable already at temperatures just below the solvent's melting point and not only at 77 K. Analogous to increasing solvent polarity, decreasing solvent temperature leads to a large hypsochromic shift of the vis absorption band of B30, dissolved in 1-chlorobutane (Deltalambda = -245 nm from 797 nm at 343 K to 552 nm at 77 K). This thermosolvatochromism can be easily seen: the solution color changes from greenish yellow (343 K) to magenta-violet (77 K). PMID:20446695

  14. Determination of a solvent hydrogen-bond acidity scale by means of the solvatochromism of pyridinium-N-phenolate betaine dye 30 and PCM-TD-DFT calculations.

    Science.gov (United States)

    Cerón-Carrasco, José P; Jacquemin, Denis; Laurence, Christian; Planchat, Aurélien; Reichardt, Christian; Sraïdi, Khadija

    2014-05-01

    Empirical parameters of solvents describing their hydrogen-bond (HB) acidity (e.g., the Kamlet-Taft α parameter) are often difficult to determine for new solvents because they are not directly related to a single definition process. Here, we propose a simple method based on one probe, the betaine dye 30, and one reference process, the solvatochromism of this dye, measured by its first electronic transition energy, ET(30). These ET(30) values are calculated within the time-dependent density functional theory framework, using a polarizable continuum solvent model (PCM). The part of ET(30) values that is not included in the PCM calculation is taken as the HB component of the measured ET(30) values, allowing us to deduce a solvent HB acidity parameter α1. The validity of this simple model is assessed by good linear correlations between α1 and a variety of solute properties mainly depending on the solvent's HB acidity. The quality of fit observed with α1 is at least comparable with that obtained by previous solvent HB acidity scales. The simplicity of our method is illustrated by the determination of α1 and of its companion, the electrostatic solvent parameter ES, for some new green solvents derived from glycerol. PMID:24702635

  15. Rapid determination of cocamidopropyl betaine impurities in cosmetic products by core-shell hydrophilic interaction liquid chromatography-tandem mass spectrometry.

    Science.gov (United States)

    Wang, Perry G; Zhou, Wanlong

    2016-08-26

    Cocamidopropyl betaine (CAPB) is a common surfactant widely used in personal care products. Dimethylaminopropylamine (DMAPA) and lauramidopropyldimethylamine (LAPDMA) are two chemicals present as impurities in CAPB and have been reported as skin sensitizers. A rapid and sensitive ultra-high performance liquid chromatography-tandem mass spectrometry (UHPLC-MS/MS) method, using a core shell hydrophilic interaction liquid chromatography (HILIC) column, has been developed to quantify DMAPA and LAPDMA in cosmetic products. Corresponding stable isotopically labeled analogues of the above native compounds were used as internal standards to compensate for matrix effect and for loss of recovery. Each sample was first screened to determine whether the sample needed to be diluted to minimize matrix effects as well as to fit the calibration range. The concept of matrix effect factor (MEF) was introduced to quantitatively evaluate each sample with a unique matrix using the internal standards. Recoveries at three spiking levels of low, medium, and high concentrations ranged from 98.4 to 112% with RSDs less than 5%. This method has been validated and is the first UHPLC-MS/MS method, which uses core shell HILIC column and stable isotopically labeled internal standards to simultaneously determine these two CAPB impurities in cosmetic products. PMID:27473511

  16. Colina e betaína em rações purificadas na nutrição da tilápia do Nilo (Oreochromis niloticus Choline and betaine in purified diets for Nile tilapia (Oreochromis niloticus

    Directory of Open Access Journals (Sweden)

    Ivan Vieira

    2001-12-01

    Full Text Available Problemas metabólicos observados em produções intensivas de tilápias do Nilo (Oreochromis niloticus têm sido relacionados à deficiência de colina nas rações. Com o objetivo de avaliar o efeito da suplementação dietética da colina na nutrição da espécie, rações purificadas contendo 0; 375; 750; 1.125; 1.500 ou 1.875 mg de cloreto de colina por kg, foram administradas ad libitum por 42 dias a tilápias do Nilo (5,09 ± 0,14 g, estocados em gaiolas de PVC atóxico (volume = 60 L, alojadas em caixas de polipropileno de 1000 L, em ambiente com condições controladas de temperatura e luminosidade, num delineamento experimental em blocos incompletos casualizados, com três parcelas por bloco (n=5. O ganho de peso (GDP e o índice de conversão alimentar (ICA de todos os tratamentos foram superiores ao controle. Não foram observadas diferenças para a quantidade de lipídios no fígado e tecido corporal, e sobrevivência (S%. Num segundo experimento, os peixes foram alimentados com rações suplementadas com 1.250 ou 2.500 mg de cloreto de colina por kg; ou 1.000; 2.000 ou 3.000 mg de betaína por kg. Não foram observadas diferenças significativas para S% e acúmulo de lipídeos hepáticos ou corporais; o ICA e GDP dos tratamentos suplementados com colina foram superiores aos dos tratamentos suplementados com betaína, mas não diferiram entre si. Níveis de suplementação superiores a 375 mg de cloreto de colina por kg de alimento melhoram o ICA e o GDP da tilápia do Nilo, mas a betaína não substitui efetivamente a colina em rações para a espécie.Metabolic problems detected in intensively raised Nile tilapia (Oreochromis niloticus are credited to possible sub-supplementation of coline in commercial feeds. To investigate the utilization of choline and betaine as feed supplement for the Nile tilapia, groups of 10 fingerlings (5.09 ± 0.14 g stocked in 30 PVC cages (60 L, kept under controlled environmental conditions inside

  17. Use of urea and glycine betaine to quantify coupled folding and probe the burial of DNA phosphates in lac repressor-lac operator binding.

    Science.gov (United States)

    Hong, Jiang; Capp, Mike W; Saecker, Ruth M; Record, M Thomas

    2005-12-27

    Thermodynamic analysis of urea-biopolymer interactions and effects of urea on folding of proteins and alpha-helical peptides shows that urea interacts primarily with polar amide surface. Urea is therefore predicted to be a quantitative probe of coupled folding, remodeling, and other large-scale changes in the amount of water-accessible polar amide surface in protein processes. A parallel analysis indicates that glycine betaine [N,N,N-trimethylglycine (GB)] can be used to detect burial or exposure of anionic (carboxylate, phosphate) biopolymer surface. To test these predictions, we have investigated the effects of these solutes (0-3 m) on the formation of 1:1 complexes between lac repressor (LacI) and its symmetric operator site (SymL) at a constant KCl molality. Urea reduces the binding constant K(TO) [initial slope dlnK(TO)/dm(urea) = -1.7 +/- 0.2], and GB increases K(TO) [initial slope dlnK(TO)/dm(GB) = 2.1 +/- 0.2]. For both solutes, this derivative decreases with an increase in solute concentration. Analysis of these initial slopes predicts that (1.5 +/- 0.3) x 10(3) A2 of polar amide surface and (4.5 +/- 1.0) x 10(2) A2 of anionic surface are buried in the association process. Analysis of published structural data, together with modeling of unfolded regions of free LacI as extended chains, indicates that 1.5 x 10(3) A2 of polar amide surface and 6.3 x 10(2) A2 of anionic surface are buried in complexation. Quantitative agreement between structural and thermodynamic results is obtained for amide surface (urea); for anionic surface (GB), the experimental value is approximately 70% of the structural value. For LacI-SymL binding, two-thirds of the structurally predicted change in amide surface (1.0 x 10(3) A2) occurs outside the protein-DNA interface in protein-protein interfaces formed by folding of the hinge helices and interactions of the DNA binding domain (DBD) with the core of the repressor. Since urea interacts principally with amide surface, it is

  18. Application of the local-bulk partitioning and competitive binding models to interpret preferential interactions of glycine betaine and urea with protein surface.

    Science.gov (United States)

    Felitsky, Daniel J; Record, M Thomas

    2004-07-20

    Two thermodynamic models have been developed to interpret the preferential accumulation or exclusion of solutes in the vicinity of biopolymer surface and the effects of these solutes on protein processes. The local-bulk partitioning model treats solute (and water) as partitioning between the region at/or near the protein surface (the local domain) and the bulk solution. The solvent exchange model analyzes a 1:1 competition between water and solute molecules for independent surface sites. Here we apply each of these models to interpret thermodynamic data for the interactions of urea and the osmoprotectant glycine betaine (N,N,N-trimethylglycine; GB) with the surface exposed in unfolding the marginally stable lacI HTH DNA binding domain. The partition coefficient K(P) quantifying accumulation of urea at this protein surface (K(P) approximately equal 1.1) is only weakly dependent on urea concentration up to 6 M urea. However, K(P) quantifying exclusion of GB from the vicinity of this protein surface increases from 0.83 (extrapolated to 0 M GB) to 1.0 (indicating that local and bulk GB concentrations are equal) at 4 M GB (activity > 40 M). We interpret the significant concentration dependence of K(P) for GB, predicted to be general for excluded, nonideal solutes such as GB, as a modest (8%) attenuation of the GB concentration dependence of solute nonideality in the local domain relative to that in the bulk solution. Above 4 M, K(P) for the interaction of GB with the surface exposed in protein unfolding is predicted to exceed unity, which explains the maximum in thermal stability observed for RNase and lysozyme at 4 M GB (Santoro, M. M., Liu, Y. F., Khan, S. M. A., Hou, L. X., and Bolen, D. W. (1992) Biochemistry 31, 5278-5283). Both thermodynamic models provide good two-parameter fits to GB and urea data for lacI HTH unfolding over a wide concentration range. The solute partitioning model allows for a full spectrum of attenuation effects in the local domain

  19. Low-dose gamma irradiation induces water activity, leaf K+/Na+, glycine betaine, antioxidant enzyme activity and reduces lipid peroxidation and protease activity to enhance salt tolerance in pigeonpea [Cajanus cajan (L.) Millsp

    International Nuclear Information System (INIS)

    Soil salinity is a major constraint that limits legume productivity. The present study evaluates the physiological and biochemical basis of radiation affect on salt tolerance response of pigeonpea. Seed gamma irradiation, in general, at 1.92 (control), 5.86 (80 mM) and 8.02 dSm-1 (100 mM) soil electrical conductivity (NaCl stress), enhanced seedling establishment, plant growth, carbon metabolism and gas exchange characteristics such as net photosynthesis, stomatal conductance and transpiration rate. Further, an improvement in salt tolerance response of gamma irradiated (<10 Gy) pigeonpea was related to high seed water activity and leaf K+/Na+, glycine betaine, membrane stability index and enzymic antioxidant activity. (author)

  20. Purification, crystallization and preliminary X-ray analysis of recombinant betaine aldehyde dehydrogenase 2 (OsBADH2), a protein involved in jasmine aroma, from Thai fragrant rice (Oryza sativa L.)

    International Nuclear Information System (INIS)

    Crystals of betaine aldehyde dehydrogenase 2 from rice (O. sativa L.) belonged to a C-centred orthorhombic space group and diffraceted X-rays to 2.6 Å resolution. Fragrant rice (Oryza sativa L.) betaine aldehyde dehydrogenase 2 (OsBADH2) is a key enzyme in the synthesis of fragrance aroma compounds. The extremely low activity of OsBADH2 in catalyzing the oxidation of acetaldehyde is believed to be crucial for the accumulation of the volatile compound 2-acetyl-1-pyrroline (2AP) in many scented plants, including fragrant rice. Recombinant fragrant rice OsBADH2 was expressed in Escherichia coli as an N-terminal hexahistidine fusion protein, purified using Ni Sepharose affinity chromatography and crystallized using the microbatch method. Initial crystals were obtained within 24 h using 0.1 M Tris pH 8.5 with 30%(w/v) PEG 4000 and 0.2 M magnesium chloride as the precipitating agent at 291 K. Crystal quality was improved when the enzyme was cocrystallized with NAD+. Improved crystals were grown in 0.1 M HEPES pH 7.4, 24%(w/v) PEG 4000 and 0.2 M ammonium chloride and diffracted to beyond 2.95 Å resolution after being cooled in a stream of N2 immediately prior to X-ray diffraction experiments. The crystals belonged to space group C2221, with unit-cell parameters a = 66.03, b = 183.94, c = 172.28 Å. An initial molecular-replacement solution has been obtained and refinement is in progress

  1. Neutron scattering techniques for betaine calcium chloride dihydrate under applied external field (temperature, electric field and hydrostatic pressure); Etude par diffusion de neutrons du chlorure de calcium et de betaine dihydrate sous champ externe applique (temperature, champ electrique et pression hydrostatique)

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez, O

    1997-11-17

    We have studied with neutron scattering techniques betaine calcium chloride dihydrate (BCCD), a dielectric aperiodic crystal which displays a Devil`s staircase type phase diagram made up of several incommensurate and commensurate phases, having a range of stability very sensitive to temperature, electric field and hydrostatic pressure. We have measured a global hysteresis of {delta}(T) of about 2-3 K in the two incommensurate phases. A structural study of the modulated commensurate phases 1/4 and 1/5 allows us to evidence that the atomic modulation functions are anharmonic. The relevance of the modelization of the modulated structure by polar Ising pseudo-spins is then directly established. On the basis of group theory calculation in the four dimensional super-space, we interpret this anharmonic modulation as a soliton regime with respect to the lowest-temperature non modulated ferroelectric phase. The continuous character of the transition to the lowest-temperature non modulated phase and the diffuse scattering observed in this phase are accounted for the presence of ferroelectric domains separated by discommensurations. Furthermore, we have shown that X-rays induce in BCCD a strong variation with time of irradiation of the intensity of satellite peaks, and more specifically for third order ones. This is why the `X-rays` structural model is found more harmonic than the `neutron` one. Under electric field applied along the vector b axis, we confirm that commensurate phases with {delta} = even/odd are favoured and hence are polar along this direction. We have evidenced at 10 kV / cm two new higher order commensurate phases in the phase INC2, corroborating the idea of a `complete` Devil`s air-case phase diagram. A phenomenon of generalized coexistence of phases occurs above 5 kV / cm. We have characterized at high field phase transitions between `coexisting` phases, which are distinguishable from classical lock-in transitions. Under hydrostatic pressure, our results

  2. 盐胁迫下三色苋甜菜碱及有关酶含量的变化%Changes in Glycine Betaine and Related Enzyme Contents in Amaranthus tricolor Under Salt Stress

    Institute of Scientific and Technical Information of China (English)

    王羽梅; 孟玉玲; 新居直佑

    2004-01-01

    三色苋(Amaranthus tricolor)不同器官中的甜菜碱(GB)含量显著不同.除子叶外,根、茎和叶的GB含量和茎、叶中的胆碱单加氧酶(CMO)含量都因300 mmol/L的NaCl处理而增加.甜菜碱醛脱氢酶(BADH)的表达无论盐处理与否在所有器官中都能检测到,其含量变化不大.当种子发芽时,具备合成GB的能力,CMO含量增加;在此之前未能检测到CMO,也不能合成GB.研究结果表明三色苋响应盐胁迫而合成GB的关键酶是CMO.%The glycine betaine (GB) and related enzymes contents, i.e., choline monooxygenase (CMO) and betaine aldehyde dehydrogenase (BADH), of seeds, roots, stems, cotyledons, leaves, and flowers in Amaranthus tricolor under salt stress were determined. GB content varied significantly among different organs. GB content in the leaves was higher at the beginning of unfolding stage and decreased during maturation and senescence. GB content in the roots was very low through the life of plant. GB content in the roots, stems, leaves and flowers increased by exposure to NaC1 300 mmol/L, except in the cotyledon where it was low and remained unchanged under salt stress. Induction of GB increase by salt stress was greater in mature and old leaves than in younger leaves.CMO protein content was low in the all organs, but that in stems and leaves was significantly increased by the addition of NaC1 300 mmol/L, and was concomitant with the accumulation of GB in their tissues. BADH protein was detected in all organs. But, the levels of BADH protein did not always vary among different organs as a result of salt stress. The effect of salt stress on BADH protein content was small and in consistent in mature and old leaves. Seeds after being soaked in water for 24 h were unable to synthesize GB. When the seeds started to germinate after being in water for 48 h, they showed an ability to synthesize GB under salt stress. This was accompanied with an increase in their CMO protein content, whereas their

  3. Estresse salino associado à aplicação exógena de espermidina no acúmulo de glicina betaína em Guandu Salt stress associated to exogenous spermidine application on the accumulation of glycine betaine in pigeonpea

    Directory of Open Access Journals (Sweden)

    Moacir Vinícius Pereira Destro

    2008-01-01

    Full Text Available O objetivo do presente trabalho foi verificar o efeito do estresse salino associado à aplicação exógena de espermidina (Spd nos genótipos de guandu, IAC Fava Larga e Caqui, no acúmulo de glicina betaína (GB, visando propor a sua utilização como marcador bioquímico-fisiológico à salinidade. O experimento foi instalado na Unesp, Faculdade de Ciências Agrárias e Veterinárias, em Jaboticabal (SP, no período de outubro a novembro de 2005, conduzido em sala de crescimento, com irradiância de 190 µmol m-2 s-1, fotoperíodo de 12 horas, temperatura de 25ºC e U.R. de 40%. A semeadura foi realizada em areia estéril, com adequado suprimento hídrico. Após 10 dias, as plântulas foram transferidas para solução nutritiva por 20 dias para aclimatação. A seguir, as plântulas foram alocadas nos tratamentos, sendo utilizado o delineamento experimental em blocos casualizados em esquema fatorial 2 x 2 x 4 com os fatores genótipos (IAC Fava Larga e Caqui, Spd (0,0 e 0,5 mM e estresse salino (0, 20, 60 e 80 mM de NaCl. Após 20 dias sob estresse, foram determinados os teores de GB. Pelos resultados obtidos, a GB pode ser indicada como um marcador bioquímico-fisiológico do estresse salino para o 'IAC Fava Larga'.This study was undertaken to evaluate the effect of salt stress associated to exogenous spermidine (Spd application on the accumulation of glycine betaine in the pigeonpea genotypes IAC Fava Larga and Caqui. The use of this compatible osmolyte as a biochemical-physiological indicator of salinity was also evaluated. The experiment was carried out at Unesp, Faculdade de Ciências Agrárias e Veterinárias, in Jaboticabal (SP, from October to November 2005, in a grow room with irradiance of 190 µmol m-2 s-1, photoperiod of 12 hours, temperature set to 25 ºC and the RH to 40%. Seeds were sowed in sterile sand with adequate water supply. After 10 days, seedlings were transferred to nutritive solution during 20 days for acclimation

  4. Method of oil recovery by flooding employing betaine solutions

    Energy Technology Data Exchange (ETDEWEB)

    Koch, K.; Rutzen, H.

    1978-05-23

    A method of extracting mineral oil from subterranean formation by flooding is disclosed comprising the steps of forcing an aqueous liquid into a subterranean formation containing mineral oil and displacing the mineral oil through at least one bore hole in the subterranean formation, the aqueous liquid containing from 0.01% to 15% by weight of an amphoteric surface-active compound.

  5. Preparation and Reactions of Pyridinium Ylids via Decarboxylation of Pyridinium Betaines

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Pyridinium ylids 4 were generated as reaction intermediates from the decarboxylation of pyridinium bctaincs 3, which were preparcd from the reactions of x-amino acid ester hydrochlorides with 2, 4,6-triphenylpyrylium tetrafluoroborate. Protonation, addition and substitution reactions of 4 with electrophiles werc studied in this paper.

  6. Metabolic Shift of Escherichia coli under Salt Stress in the Presence of Glycine Betaine

    OpenAIRE

    Metris, A.; George, S. M.; Mulholland, F.; Carter, A T; Baranyi, J.

    2014-01-01

    An important area of food safety focuses on bacterial survival and growth in unfavorable environments. In order to understand how bacteria adapt to stresses other than nutrient limitation in batch cultures, we need to develop mechanistic models of intracellular regulation and metabolism under stress. We studied the growth of Escherichia coli in minimal medium with added salt and different osmoprotectants. To characterize the metabolic efficiency with a robust parameter, we identified the opti...

  7. Specific potassium ion interactions facilitate homocysteine binding to betaine-homocysteine S-methyltransferase

    Czech Academy of Sciences Publication Activity Database

    Mládková, Jana; Hladílková, Jana; Diamond, C. E.; Tryon, K.; Yamada, K.; Garrow, T. A.; Jungwirth, Pavel; Koutmos, M.; Jiráček, Jiří

    2014-01-01

    Roč. 82, č. 10 (2014), s. 2552-2564. ISSN 0887-3585 R&D Projects: GA ČR(CZ) GAP207/10/1277; GA ČR GBP208/12/G016 Institutional support: RVO:61388963 Keywords : BHMT * homocysteine * potassium * crystal structure * molecular dynamics * simulations * enzyme kinetics Subject RIV: CE - Biochemistry Impact factor: 2.627, year: 2014

  8. Effect of exogenous proline, betaine, and carnitine on growth of Listeria monocytogenes in a minimal medium.

    OpenAIRE

    Beumer, R. R.; te Giffel, M.C.; Cox, L.J.; Rombouts, F M; Abee, T

    1994-01-01

    Three Listeria monocytogenes strains isolated from food or food-processing environments were used to assess the response of this species to salinity in a chemically defined minimal medium. Growth in a minimal medium containing five essential amino acids and glucose as a carbon and energy source was comparable to growth in a rich medium (brain heart infusion broth). In the absence and presence of 3% NaCl the final cell numbers reached in minimal medium were 10(9) and 10(7) CFU/ml, respectively...

  9. Wettability alteration by novel betaines at polymer-aqueous solution interfaces

    Science.gov (United States)

    Hu, Song-Shuang; Zhang, Lei; Xu, Zhi-Cheng; Gong, Qing-Tao; Jin, Zhi-Qiang; Luo, Lan; Zhang, Lu; Zhao, Sui

    2015-11-01

    The wettability of alkyl carboxylbetaine (18C) and alkyl sulfobetaine (18S) at polytetrafluoroethylene (PTFE) and polymethylmethacrylate (PMMA) surfaces have been investigated and the different physicochemical parameters such as critical micelle concentration (CMC), surface tension, contact angle, surface excess, adhesional tension and work of adhesion have been estimated. The results show that the contact angle of 18C and 18S for both solids keep almost a constant value in a wide range of surfactant concentration, but the sharp decrease of contact angle appears after CMC of individual surfactant solution because of the continued increase in surfactant molecules adsorption at solid-liquid interface above CMC, which is quite different from traditional surfactants reported in the literature. In addition, 18C has significantly lower contact angle values on PTFE at high concentrations. For PTFE and PMMA there is a linear relationship existing between the adhesional and surface tension in a range of certain concentrations for all investigated surfactants. The values of slope suggest that adsorption of 18C and 18S at PTFE/PMMA-liquid interfaces are less than that at air-liquid, and the orientation of the surfactant molecules at PTFE-liquid and PMMA-liquid interfaces should not be the same. Moreover, the decrease of PTFE-liquid interfacial tension has been observed while the PMMA-liquid interfacial tension increases at first and decreases afterwards for 18C and 18S. Especially for PTFE, the decrease of γSL for 18C is larger than that for 18S, which indicates that 18S molecules may be vertical orientation due to steric effect while the hemimicelle has been formed for 18C at the PTFE interface. On the other hand, the addition of surfactant molecules will adsorb onto monolayer at PMMA surface again through hydrophobic interaction with hydrophilic group toward the bulk phase of solution above CMC.

  10. The development of a new class of inhibitors for betaine-homocysteine S-methyltransferase

    Czech Academy of Sciences Publication Activity Database

    Pícha, Jan; Vaněk, Václav; Buděšínský, Miloš; Mládková, Jana; Garrow, T. A.; Jiráček, Jiří

    2013-01-01

    Roč. 65, July (2013), s. 256-275. ISSN 0223-5234 R&D Projects: GA ČR(CZ) GAP207/10/1277 Institutional support: RVO:61388963 Keywords : BHMT * inhibitor * homocysteine * phosphonate * phosphinate * amino acid derivative * bioisostere * S-alkylated homocysteine Subject RIV: CE - Biochemistry Impact factor: 3.432, year: 2013

  11. Niedervalente Bismut-Organyle, chirale Stibane und Antimon-Analoge des Betains und Cholins

    OpenAIRE

    Balazs Lucia

    2003-01-01

    The cyclobismuthanes (RBi):sub:n:/sub:, [R = 2-(Me:sub:2:/sub:NCH:sub:2:/sub:)C:sub:6:/sub:H:sub:4:/sub:, n = 3 (:b:1a:/b:), 4 (:b:1b:/b:)] were synthesized by reduction of RBiCl:sub:2:/sub: with Na in liquid ammonia or by reaction of R:sub:2:/sub:BiCl with LiAlH:sub:4:/sub: in ether. The reaction of :b:1a / b:/b: with W(CO):sub:5:/sub:THF (THF = tetrahydrofuran) gives the bismuthinidene complex RBi[W(CO):sub:5:/sub:]:sub:2:/sub: (:b:2:/b:). R:sub:2:/sub:BiCl reacts with Mg in THF to give R:s...

  12. Proton glass behaviour in a solid solution of gamma-irradiated deuterated betaine phosphate sub 0 sub . sub 1 sub 5 betaine phosphite sub 0 sub . sub 8 sub 5

    CERN Document Server

    Banys, J; Klimm, C; Voelkel, G; Kloepperpieper, A

    1997-01-01

    Measurements of the dielectric permittivity are reported for a deuterated solid solution of gamma-irradiated antiferroelectric (betainephosphate) sub 0 sub . sub 1 sub 5 ferroelectric (betainephosphite) sub 0 sub . sub 8 sub 5 at frequencies 20 H sub Z

  13. Variation of Polyphenols and Betaines in Aerial Parts of Young, Field-Grown Amaranthus Genotypes

    DEFF Research Database (Denmark)

    Steffensen, Stine Krogh; Pedersen, Hans Albert; Labouriau, Rodrigo;

    2011-01-01

    Amaranthus hybridus and Amaranthus mantegazzianus are commonly cultivated and the entire young fresh plants consumed as vegetables in regions of Africa and Asia. A. hybridus and A. mantegazzianus were cultivated at four sites in three climate regions of the world: Santa Rosa, Argentina; Lleida, S...

  14. Pretreatment of the yeast antagonist, Candida oleophila with glycine betaine increases oxidative stress tolerance in the microenvironment of apple wounds

    Science.gov (United States)

    In response to wounding, harvested fruit tissues of apple and citrus exhibit the production of reactive oxygen species (ROS). ROS production is greater when yeast antagonists used as biocontrol agents are applied in the wounds. These phenomena result in an oxidative stress environment for the yeas...

  15. Synthesis and characterization of betaine-like diacyl lipids: zwitterionic lipids with the cationic amine at the bilayer interface.

    Science.gov (United States)

    Kohli, Aditya G; Walsh, Colin L; Szoka, Francis C

    2012-02-01

    We synthesized and characterized a series of zwitterionic, acetate-terminated, quaternized amine diacyl lipids (AQ). These lipids have an inverted headgroup orientation as compared to naturally occurring phosphatidylcholine (PC) lipids; the cationic group is anchored at the membrane interface, while the anionic group extends into the aqueous phase. AQ lipids preferentially interact with highly polarizable anions (ClO(4)(-)) over less polarizable ions (Cl(-)), in accord with the Hofmeister series, as measured by the change in zeta potential of AQ liposomes. Conversely, AQ lipids have a weaker association with calcium than do PC lipids. The transition temperatures (Tm) of the AQ lipids are similar to the Tm observed with phosphatidylethanolamine (PE) lipids of the same chain length. AQ lipids form large lipid sheets after heating and sonication; however, in the presence of cholesterol (Chol), these lipids form stable liposomes that encapsulate carboxyfluorescein. The AQ:Chol liposomes retain their contents in the presence of serum at 37°C, and when injected intravenously into mice, their organ biodistribution is similar to that observed with PC:Chol liposomes. AQ lipids demonstrate that modulating the headgroup charge orientation significantly alters the biophysical properties of liposomes. For the drug carrier field, these new materials provide a non-phosphate containing zwitterlipid for the production of lipid vesicles. PMID:22301334

  16. Betaine treatment of cystathionine β-synthase-deficient homocystinuria; does it work and can it be improved?

    OpenAIRE

    Maclean KN

    2012-01-01

    Kenneth N MacleanDepartment of Pediatrics, University of Colorado School of Medicine, Aurora, CO, USAAbstract: Inactivating mutations in cystathionine β-synthase result in classical homocystinuria (HCU) and are typically accompanied by severe elevations of plasma and tissue homocysteine, methionine, S-adenosylmethionine, S-adenosylhomocysteine and significantly decreased cysteine. HCU is usually accompanied by marfanoid skeletal abnormalities, osteoporosis, ectopia lentis and/or seve...

  17. Effects of hyperhomocysteinemia and betaine-homocysteine S-methyltransferase inhibition on hepatocyte metabolites and the proteome

    Czech Academy of Sciences Publication Activity Database

    Selicharová, Irena; Kořínek, M.; Demianova, Zuzana; Chrudinová, Martina; Mládková, Jana; Jiráček, Jiří

    2013-01-01

    Roč. 1834, č. 8 (2013), s. 1596-1606. ISSN 1570-9639 R&D Projects: GA ČR(CZ) GAP207/10/1277 Institutional support: RVO:61388963 Keywords : apolipoprotein * fibrinogen * one-carbon metabolism * S-Adenosylmethionine * two-dimensional electrophoresis Subject RIV: CE - Biochemistry Impact factor: 3.191, year: 2013

  18. Betaine treatment of cystathionine β-synthase-deficient homocystinuria; does it work and can it be improved?

    OpenAIRE

    Maclean KN

    2012-01-01

    Kenneth N MacleanDepartment of Pediatrics, University of Colorado School of Medicine, Aurora, CO, USAAbstract: Inactivating mutations in cystathionine β-synthase result in classical homocystinuria (HCU) and are typically accompanied by severe elevations of plasma and tissue homocysteine, methionine, S-adenosylmethionine, S-adenosylhomocysteine and significantly decreased cysteine. HCU is usually accompanied by marfanoid skeletal abnormalities, osteoporosis, ectopia lentis and/or severe m...

  19. The role of nearest neighbour anharmonic coupling in the phase diagram of betaine calcium chloride dihydrate (BCCD)

    Czech Academy of Sciences Publication Activity Database

    Etxebarria, I.; Hlinka, Jiří; Quilichini, M.

    1999-01-01

    Roč. 11, - (1999), s. 5497-5504. ISSN 0953-8984 Grant ostatní: Basque Government (ES) P197-71 Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.639, year: 1999

  20. Osmolality, temperature, and membrane lipid composition modulate the activity of betaine transporter BetP in Corynebacterium glutamicum

    DEFF Research Database (Denmark)

    Ozcan, Nuran; Ejsing, Christer S.; Shevchenko, Andrej; Lipski, Andrej; Morbach, Susanne; Krämer, Reinhard

    2007-01-01

    The gram-positive soil bacterium Corynebacterium glutamicum, a major amino acid-producing microorganism in biotechnology, is equipped with several osmoregulated uptake systems for compatible solutes, which is relevant for the physiological response to osmotic stress. The most significant carrier...

  1. NMR-based metabonomics reveals that plasma betaine increases upon intake of high-fiber rye buns in hypercholesterolemic pigs

    DEFF Research Database (Denmark)

    Bertram, Hanne Christine; Malmendal, Anders; Nielsen, Niels Christian;

    2009-01-01

    This study presents an NMR-based metabonomic approach to explore the overall endogenous biochemical effects of a rye versus wheat-based fiber-rich diet in hypercholesterolemic pigs. The pigs were fed high-fat, high-cholesterol rye- (n = 9) or wheat- (n = 8) based buns with similar levels of dietary...... fiber for 9-10 wk. Fasting plasma samples were collected 2 days before and after 8 and 12 days on the experimental diets, while postprandial samples taken after 58-67 days, and( 1)H NMR spectra were acquired on these. Principal component analysis on the obtained NMR spectra demonstrated clear effects of...

  2. Protein (Cyanobacteria): 121879 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available glycine betaine transport system, periplasmic component Moorea producens 3L MTIRKINQFICIILAAALCLSLIACEAQTPNG...SQSTAGKGVKVSSASSVSTYALFVSEIINIGLEKVGYKPAAIKQLSIPLAHISVRNGDVDFYSVHWQNIHKKFFLENGGDQKLEKVGVIIADGLQSYQIDKKTAEQYK

  3. Deletion of the betaine-GABA transporter (BGT1; slc6a12) gene does not affect seizure thresholds of adult mice

    DEFF Research Database (Denmark)

    Lehre, A C; Rowley, N M; Zhou, Y;

    2011-01-01

    the GAT1 by the clinically available anti-epileptic drug tiagabine has been an effective strategy for the treatment of some patients with partial seizures. Recently, the investigational drug EF1502, which inhibits both GAT1 and BGT1, was found to exert an anti-convulsant action synergistic to that of...... the control of seizure susceptibility and cannot provide a mechanistic understanding of the synergism that has been previously reported with tiagabine and EF1502....

  4. Growth and characterization of {beta}-In N films on Mg O: the key role of a {beta}-Ga N buffer layer in growing cubic In N

    Energy Technology Data Exchange (ETDEWEB)

    Navarro C, H.; Perez C, M.; Rodriguez, A. G.; Lopez L, E.; Vidal, M. A. [Universidad Autonoma de San Luis Potosi, Coordinacion para la Innovacion y la Aplicacion de la Ciencia y la Tecnologia, Alvaro Obregon 64, 78000 San Luis Potosi (Mexico)

    2012-07-01

    Cubic In N samples were grown on Mg O (001) substrates by gas source molecular beam epitaxy. In general, we find that In N directly deposited onto the Mg O substrate results in polycrystalline or columnar films of hexagonal symmetry. We find that adequate conditions to grow the cubic phase of this compound require the growth of an initial cubic Ga N buffer interlayer ({beta}-t Ga N) on the Mg O surface. Subsequently, the growth conditions were optimized to obtain good photoluminescence (Pl) emission. The resultant In N growth is mostly cubic, with very small hexagonal inclusions, as confirmed by X-ray diffraction and scanning electron microscopy studies. Good crystalline quality requires that the samples to be grown under rich Indium metal flux. The cubic {beta}-t In N/Ga N/Mg O samples exhibit a high signal to noise ratio for Pl at low temperatures (20 K). The Pl is centered at O.75 eV and persist at room temperature. (Author)

  5. Dissecting the Catalytic Mechanism of Betaine - Homocysteine S-Methyltransferase by Use of Intrinsic Tryptophan Fluorescence and Site-Directed Mutagenesis

    Czech Academy of Sciences Publication Activity Database

    Castro, C.; Gratson, A. A.; Evans, J. C.; Jiráček, Jiří; Collinsová, Michaela; Ludwig, M. L.; Garrow, T. A.

    2004-01-01

    Roč. 43, č. 18 (2004), s. 5341-5351. ISSN 0006-2960 R&D Projects: GA AV ČR IAA4055302 Grant ostatní: NIH(US) GM16429; NIH(US) DK52501; Illinois Agricultural Experimental Station(US) ILLU-698-352 Institutional research plan: CEZ:AV0Z4055905 Keywords : BHMT * CBHcy * fluorescence Subject RIV: CE - Biochemistry Impact factor: 4.008, year: 2004

  6. Quantification of homocysteine-related metabolites and the role of betaine-homocysteine S-methyltransferase in HepG2 cells

    Czech Academy of Sciences Publication Activity Database

    Kořínek, M.; Šístek, V.; Mládková, Jana; Mikeš, P.; Jiráček, Jiří; Selicharová, Irena

    2013-01-01

    Roč. 27, č. 1 (2013), s. 111-121. ISSN 0269-3879 R&D Projects: GA ČR(CZ) GAP207/10/1277 Institutional support: RVO:61388963 Keywords : homocysteine * BHMT * LC-MS/MS * HepG2 * metabolites Subject RIV: CE - Biochemistry Impact factor: 1.662, year: 2013

  7. Gclust Server: 83174 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available OTECTANT (GLYCINE BETAINE/CARNITINE/CHOLINE/L-PROLINE) TRANSPORT ATP-BINDING PROTEIN ABC TRANSPORTER PROV 1 ...nce length 376 Representative annotation POSSIBLE OSMOPROTECTANT (GLYCINE BETAINE/CARNITINE/CHOLINE/L-PROLIN

  8. Les dérivés tensioactifs de la glycine bétaïne : méthodes de synthèse et potentialités d'utilisation

    Directory of Open Access Journals (Sweden)

    Nsimba, ZF.

    2010-01-01

    Full Text Available Glycine betaine surfactant derivatives: synthesis methods and potentialities of use. The term "betaine" is used to refer to the glycine betaine, but also its derivatives and an organic compound carrying a quaternary nitrogen. Glycine betaine is an amphoteric small compound, very polar that acts as osmoprotectant in plants and protective agent of the liver, of the heart and of the vessels in human. In order to exploit its numerous effects, researchers synthesized surfactant derivatives including alkylbetaines, alkylamidobetaines, betainates (esters of glycine betaine monomers, geminis and bolaforms and betainamides (amides of glycine betaine. Alkylbetaines and alkylamidobetaines are produced on the industrial scale and are used as amphoteric surfactants in cosmetics. They are less irritating compared to sodium dodecylsulfate (SDS. Betainates and betainamides are produced on laboratory scale. Betainates monomers are more biodegradable than the current esters while betainates geminis and bolaforms present respectively surface and membrane activities more interesting compared to their analogous monomers. Only the chemical way is used until now for their synthesis.

  9. 应用甜菜碱及球虫疫苗防治肉鸡球虫病的效果试验%Effect of Betaine and Coccidian Vaccine on Prevention of Broiler Coccidiosis

    Institute of Scientific and Technical Information of China (English)

    张伟武; 谢正; 金明升; 刘国军; 吴利雯

    2006-01-01

    球虫病是危害养鸡生产的主要疫病之一。据报道,球虫疫苗作为一种有效的预防免疫手段,在国内外的养鸡生产中已大面积应用。但接种球虫疫苗有引起亚临床球虫病的危险,生产性能也会受到一定的影响。甜菜碱作为一种维生素原,在鸡体内可明显降低球虫的侵袭性,增强离子载体类抗球虫药的活性。为此,我们设计了以下试验,旨在研究防治肉鸡球虫病的组合新技术。

  10. Effect of Homocysteine-Lowering Nutrients on Blood Lipids: Result from Four Randomised, Placebo-Controlled Studies in Healthy Humans

    OpenAIRE

    Margreet R Olthof; Trinette van Vliet; Petra Verhoef; Peter L Zock; Katan, Martijn B.

    2005-01-01

    Background: Betaine (trimethylglycine) lowers plasma homocysteine, a possible risk factor for cardiovascular disease. However, studies in renal patients and in obese individuals who are on a weight-loss diet suggest that betaine supplementation raises blood cholesterol; data in healthy individuals are lacking. Such an effect on cholesterol would counteract any favourable effect on homocysteine. We therefore investigated the effect of betaine, of its precursor choline in the form of phosphatid...

  11. Effect of homocysteine-lowering nutrients on blood lipids: Results from four randomised, placebo-controlled studies in healthy humans

    NARCIS (Netherlands)

    Olthof, M.R.; Vliet, T. van; Verhoef, P.; Zock, P.L.; Katan, M.B.

    2005-01-01

    Background: Betaine (trimethylglycine) lowers plasma homocysteine, a possible risk factor for cardiovascular disease. However, studies in renal patients and in obese individuals who are on a weight-loss diet suggest that betaine supplementation raises blood cholesterol; data in healthy individuals a

  12. Effect of Homocysteine-Lowering Nutrients on Blood Lipids: Result from Four Randomised, Placebo-Controlled Studies in Healthy Humans

    NARCIS (Netherlands)

    Olthof, M.R.; Vliet, van T.; Verhoef, P.; Zock, P.L.; Katan, M.B.

    2005-01-01

    Background Betaine (trimethylglycine) lowers plasma homocysteine, a possible risk factor for cardiovascular disease. However, studies in renal patients and in obese individuals who are on a weight-loss diet suggest that betaine supplementation raises blood cholesterol; data in healthy individuals ar

  13. NCBI nr-aa BLAST: CBRC-XTRO-01-0203 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0203 ref|NP_692179.1| glycine betaine transporter [Oceanobacillus ihey...ensis HTE831] dbj|BAC13214.1| glycine betaine transporter [Oceanobacillus iheyensis HTE831] NP_692179.1 0.15 22% ...

  14. Luminescence of LaF3:Ln3+ Nanocrystal Dispersions in Ionic Liquids

    OpenAIRE

    Lunstroot, Kyra; Baeten, Linny; Nockemann, Peter; Martens, Johan; Verlooy, Pieter; Ye, Xingpu; Gorler-Walrand, Christiane; Binnemans, Koen; Driesen, Kris

    2009-01-01

    Ionic liquids were used as solvents for dispersing luminescent lanthanide-doped LaF3:Ln(3+) nanocrystals (Ln(3+) = Eu3+ and Nd3+). To increase the solubility of the inorganic nanoparticles in the ionic liquids, the nanocrystals were prepared with different stabilizing ligands, i.e., citrate, N,N,N-trimethylglycine (betaine), and lauryldimethylglycine (lauryl betaine). LaF3:5%Ln(3+) :betaine could successfully be dispersed in 1-butyl-1-methylpyrrolidinium bis(tiifluoromethylsulfonyl)imide [C(4...

  15. Protein (Cyanobacteria): 121733 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YP_007068626.1 1117:2364 1161:232 1185:8 1186:34 99598:5 ABC-type glycine betaine transport, peripl...asmic subunit Calothrix sp. PCC 7507 MFFTQYAPEILLHTGEHLVLVAIAMMVAIAIGIPLGILITRQPKLAQPILGLANA...IQTIPSLAIFGFLISVPFLGGIGKIPAIVALTLYALLPLIRNTYIGINSVDPAIREAGRGMGMTDWQLLLQVEIPLALGVILAGVRVATVISVGIATIAAAIGGGGLG

  16. Isolation of a choline monooxygenase cDNA clone from Amaranthus tricolor and its expressions under stress conditions

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Plants synthesize the osmoprotectant glycine betaine (GB) via choline→betaine aldehyde→glycine betaine[1]. Two enzymes are involved in the pathway, choline monooxygenase (CMO) and betaine aldehyde dehydrogenase (BADH). A full length CMO cDNA (1,643bp) was cloned from Amaranthus tricolor. The open reading frame encoded a 442-amino acid polypeptide, which showed 69% identity with CMOs in Spinacia oleracea L. And Beta vulgaris L. DNA gel blot analysis indicated the presence of one copy of CMO gene in the A. Tricolor genome. The expressions of CMO and BADH proteins in A.tricolor leaves significantly increased under salinization, drought and heat stress (42℃), as determined by immunoblot analysis, but did not respond to cold stress (4℃), or exogenous ABA application. The increase of GB content in leaves was parallel to CMO and BADH contents.

  17. Drug: D06709 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available amily) Lycium mature fruit Major component: Betaine [CPD:C00719] Traditional Chinese Medicine in Japan [BR:br08304] Crude Drugs Drugs... for replenishing Ying Drugs for replenishing Ying D06709 Lycium fruit Crude drugs

  18. The role of glycine betaine and molecular chaperone dnaK from Tetragenococcus halophilus on salinity adaptation%甘氨酸甜菜碱和分子伴侣dnaK在嗜盐四联球菌耐盐机制中的作用

    Institute of Scientific and Technical Information of China (English)

    卢良坤; 罗立新; 黎攀; 成丽丽

    2013-01-01

    能耐高盐的嗜盐四联球菌CICC 10469是从传统的酱料中分离得到.为研究耐盐特性与相容性溶质积累和分子伴侣dnaK特性的关系,使用核磁共振来检测其主要的相容性溶质.不同盐浓度对耐盐的嗜盐四联球菌和不耐盐的乳酸乳球菌MG 1363的生长的影响通过测量OD600来获得.盐浓度对分子伴侣dnaK表达的影响通过实时荧光定量RT-PCR来检测.相容性溶质和可溶性蛋白随盐浓度的变化通过HPLC和酶标仪来检测.结果显示嗜盐四联球菌以甘氨酸甜菜碱作为主要的相容性溶质.适合的盐浓度能够促进菌体的生长,在一定盐浓度范围内,甘氨酸甜菜碱,可溶性蛋白和分子伴侣dnaK随盐浓度的增加而升高,然而超过一定盐浓度范围后,表达量将会减少.这表明细菌能够根据外部环境做出适当的调整以维持细胞的正常生理功能.而乳酸乳球菌MG1363很少有相容性溶质和分子伴侣dnaK以耐受外部盐浓度.这表明相容性溶质和分子伴侣dnak在嗜盐四联球菌生长中起重要的作用.总之,中度嗜盐菌的主要耐盐机制是通过快速合成和释放甘氨酸甜菜碱及分子伴侣dnaK高活性表达来完成.

  19. Osmoprotectant-dependent expression of plcH, encoding the hemolytic phospholipase C, is subject to novel catabolite repression control in Pseudomonas aeruginosa PAO1.

    OpenAIRE

    Sage, A E; Vasil, M L

    1997-01-01

    Expression of the hemolytic phospholipase C (PlcH) of Pseudomonas aeruginosa is induced under phosphate starvation conditions or in the presence of the osmoprotectants choline and glycine betaine. Because choline and glycine betaine may serve as carbon and energy sources in addition to conferring osmoprotection to P. aeruginosa, it seemed possible that induction of plcH is subject to catabolite repression control (CRC) by tricarboxylic cycle intermediates such as succinate. Total phospholipas...

  20. Directory of Open Access Journals (Sweden)

    Mahmut Doğru

    2013-09-01

    Full Text Available Cocamidopropyl betaine (CAPB and coconut diethanolamide (CDEA, which are manufactured from coconut oil, are widely used as chemical substances with surfactant property in shampoo, liquid soap and skin cleaners. Allergic contact dermatitis (ACD may occur against these substances, especially cocamidopropyl betaine. ACD developing against these two substances is rarely seen in the literature. Here we reported a case of ACD caused by CABP and CDEA which admitted with complaints of redness,peeling and cracking of hands.

  1. Inhibition of insulin fibrillation by osmolytes: Mechanistic Insights

    OpenAIRE

    Sinjan Choudhary; Nand Kishore; Hosur, Ramakrishna V.

    2015-01-01

    We have studied here using a number of biophysical tools the effects of osmolytes, betaine, citrulline, proline and sorbitol which differ significantly in terms of their physical characteristics such as, charge distribution, polarity, H-bonding abilities etc, on the fibrillation of insulin. Among these, betaine, citrulline, and proline are very effective in decreasing the extent of fibrillation. Proline also causes a substantial delay in the onset of fibrillation in the concentration range (5...

  2. Oxygen-18 and deuterium labeling studies of choline oxidation by spinach and sugar beet

    International Nuclear Information System (INIS)

    Chenopods synthesize betaine by a two-step oxidation of choline: choline --> betaine aldehyde --> betaine. The pathway is chloroplastic; the first step has been shown in isolated spinach (Spinacia oleracea L.) chloroplasts to be O2- and light-dependent, the role of light being to provide reducing power (P Weigel, EA Weretilnyk, AD Hanson 1988 Plant Physiol 86: 54-60). Here, we report use of in vivo18O- and 2H-labeling in conjunction with fast atom bombardment mass spectrometry to test for two hypothetical choline-oxidizing reactions that would explain the observed requirements for O2 and reductant: a desaturase or an oxygenase. Simple syntheses for 2H3-choline, 2H3, 18O-choline, and 2H3, 18O-betaine are given. A desaturase mechanism was sought by giving choline deuterated at the 2-carbon, or choline unlabeled at this position together with 2H2O and by analyzing newly synthesized betaine. About 15% of the 2H at C-2 was lost during oxidation of choline to betaine, and about 10% of the betaine made in the presence of 50% 2H2O was monodeuterated. These small effects are more consistent with chemical exchange than with a desaturase, because 10 to 15% losses of 2H from the C-2 position also occurred if choline was converted to betaine by a purified bacterial choline oxidase. To test for an oxygenase, the incorporation of 18O from 18O2 into newly synthesized betaine was compared with that from 18O-labeled choline, in light and darkness. Incorporation of 18O from 18O-choline was readily detectable and varied from about 15 to 50% of the theoretical maximum value; the 18O losses were attributable to exchange of the intermediate betaine aldehyde with water. In darkness, incorporation of 18O from 18O2 approached that from 18O-choline, but in the light was severalfold lower, presumably due to isotopic dilution by photosynthetic 16O2. These data indicate that the chloroplast choline-oxidizing enzyme is an oxygenase. (author)

  3. Self-assembled nano structures of cationic ester-containing gemini surfactants: The surfactant structure and salt effects

    International Nuclear Information System (INIS)

    Highlights: • The aggregation behavior of ester-containing cationic gemini surfactants were studied. • The ester-containing gemini surfactants formed spherical aggregates at dilute concentration. • At higher concentration, dodecyl betainate gemini (s = 2) formed worm-like micelles. • Dodecyl betainate gemini (s = 3) formed large vesicles enclosing smaller ones. • The salt addition induced the growth of micelles and changed the morphology for betainate (s = 2). -- Abstract: The aggregation behavior of ester-containing cationic gemini surfactants, dodecyl esterquat and dodecyl betainate geminis was investigated using tensiometry, conductometry, viscometry, dynamic light scattering (DLS), transmission electron microscopy (TEM) and optical microscopy techniques in the absence and presence of NaBr electrolyte. The effect of chemical structure (i.e. the presence of ester bond in alkyl chain and the spacer length) on physicochemical properties and morphology of the surfactants was studied. The results showed that the ester-containing gemini surfactants formed spherical aggregates at dilute concentration (1.1 %wt). At higher concentration (∼3.7 %wt) the morphology is different depending on the position of ester bond in alkyl chain and the spacer length. Dodecyl betainate gemini with short spacer (s = 2) formed gel as a result of the formation of worm-like micelles in the aqueous solution. Dodecyl betainate gemini (s = 3) formed large vesicles enclosing smaller ones and dodecyl esterquat gemini (s = 3) formed both short cylindrical and spherical micelles. The salt addition induced the growth of micelles and in the case of dodecyl betainate (s = 2) gemini changed the morphology from worm-like micelles to lamellar phase

  4. Effect of homocysteine-lowering nutrients on blood lipids: results from four randomised, placebo-controlled studies in healthy humans.

    Directory of Open Access Journals (Sweden)

    Margreet R Olthof

    2005-05-01

    Full Text Available BACKGROUND: Betaine (trimethylglycine lowers plasma homocysteine, a possible risk factor for cardiovascular disease. However, studies in renal patients and in obese individuals who are on a weight-loss diet suggest that betaine supplementation raises blood cholesterol; data in healthy individuals are lacking. Such an effect on cholesterol would counteract any favourable effect on homocysteine. We therefore investigated the effect of betaine, of its precursor choline in the form of phosphatidylcholine, and of the classical homocysteine-lowering vitamin folic acid on blood lipid concentrations in healthy humans. METHODS AND FINDINGS: We measured blood lipids in four placebo-controlled, randomised intervention studies that examined the effect of betaine (three studies, n = 151, folic acid (two studies, n = 75, and phosphatidylcholine (one study, n = 26 on plasma homocysteine concentrations. We combined blood lipid data from the individual studies and calculated a weighted mean change in blood lipid concentrations relative to placebo. Betaine supplementation (6 g/d for 6 wk increased blood LDL cholesterol concentrations by 0.36 mmol/l (95% confidence interval: 0.25-0.46, and triacylglycerol concentrations by 0.14 mmol/l (0.04-0.23 relative to placebo. The ratio of total to HDL cholesterol increased by 0.23 (0.14-0.32. Concentrations of HDL cholesterol were not affected. Doses of betaine lower than 6 g/d also raised LDL cholesterol, but these changes were not statistically significant. Further, the effect of betaine on LDL cholesterol was already evident after 2 wk of intervention. Phosphatidylcholine supplementation (providing approximately 2.6 g/d of choline for 2 wk increased triacylglycerol concentrations by 0.14 mmol/l (0.06-0.21, but did not affect cholesterol concentrations. Folic acid supplementation (0.8 mg/d had no effect on lipid concentrations. CONCLUSIONS: Betaine supplementation increased blood LDL cholesterol and triacylglycerol

  5. Biodegradability and groundwater pollutant potential of organic anti-freeze liquids used in borehole heat exchangers

    Energy Technology Data Exchange (ETDEWEB)

    Klotzbuecher, Thimo; Kappler, Andreas; Straub, Kristina L.; Haderlein, Stefan B. [Center for Applied Geosciences, Institute for Geosciences, Eberhard-Karls-University Tuebingen, Sigwartstrasse 10, D-72076 Tuebingen (Germany)

    2007-08-15

    Ground source heat pump systems are increasingly being used to exploit the energy content of shallow geothermal resources for space heating and cooling. In this study we evaluate the potential for groundwater contamination of the different organic anti-freeze compounds (ethylene glycol, propylene glycol and betaine) used in these pumps, based on a literature review of their biodegradability and the results of our own laboratory experiments on aquifer material. Ethylene and propylene glycol were found to be readily biodegradable under both oxic and anoxic conditions, without formation of toxic or persistent intermediates. Long-term groundwater contamination by the glycols is therefore not expected. Betaine is also expected to be readily biodegradable in oxic and anoxic groundwater. The potential formation of trimethylamine, an intermediate of anaerobic betaine degradation, is, however, regarded as critical due to its unpleasant odor even at very low concentrations. Additionally, betaine has the potential to complex metal ions and thus may mobilize toxic metals in groundwater. We therefore recommend that betaine not be used in borehole heat exchanger fluids. In addition to organic anti-freeze compounds such as glycols, borehole heat exchanger fluids also contain additives such as corrosion inhibitors or biocides. We demonstrate that potentially toxic additives in these fluids inhibit biodegradation of the organic anti-freeze compounds. In order to ensure environmental compatibility of borehole heat exchanger fluids, further research should be conducted on the impact of additives on subsurface microbiological activity and on groundwater quality. (author)

  6. Oxoaporphine alkaloids: conversion of lysicamine into liriodendronine and its 2-O-methyl ether, and antifungal activity.

    Science.gov (United States)

    Pabuccuoglu, V; Rozwadowska, M D; Brossi, A; Clark, A; Hufford, C D; George, C; Flippen-Anderson, J L

    1991-01-01

    Pschorr reaction of diazonium salt 7 in aqueous methanolic sulfuric acid afforded, besides lysicamine 2, the orange colored sulfate of oxodibenzopyrrocoline (8). The structure is fully supported by an X-ray analysis of its picrate salt. Selective ether cleavage of lysicamine (2) with 48% HBr afforded a hydrobromide of 9, and free betaine 9 on treatment with pyridine-water. Both compounds methylated on treatment with etherial diazomethane on nitrogen to give the known 2-O,N-dimethylliriodendronine (11). Liriodendronine (10) was obtained from lysicamine (2) on heating with pyridine HBr at 189 degrees C, and treatment with pyridine-water, as a dark violet betaine. Betaine 12 was obtained by heating 11.HCl to 200 degrees C. The quaternary salts of lysicamine, lysicamine methiodide (3) and lysicamine methosulfate (4) were comparable in anticandidal activity to liriodenine (1), but were not as active as liriodenine methiodide (13). PMID:2043039

  7. A possible role of the non-GAT1 GABA transporters in transfer of GABA from GABAergic to glutamatergic neurons in mouse cerebellar neuronal cultures

    DEFF Research Database (Denmark)

    Suñol, C; Babot, Z; Cristòfol, R;

    2010-01-01

    Cultures of dissociated cerebellum from 7-day-old mice were used to investigate the mechanism involved in synthesis and cellular redistribution of GABA in these cultures consisting primarily of glutamatergic granule neurons and a smaller population of GABAergic Golgi and stellate neurons. The...... distribution of GAD, GABA and the vesicular glutamate transporter VGlut-1 was assessed using specific antibodies combined with immunofluorescence microscopy. Additionally, tiagabine, SKF 89976-A, betaine, beta-alanine, nipecotic acid and guvacine were used to inhibit the GAT1, betaine/GABA (BGT1), GAT2 and GAT...... neurons constituting the majority of the cells. GABA uptake exhibited the kinetics of high affinity transport and could be partly (20%) inhibited by betaine (IC(50) 142 microM), beta-alanine (30%) and almost fully (90%) inhibited by SKF 89976-A (IC(50) 0.8 microM) or nipecotic acid and guvacine at 1 m...

  8. Influence of heavy metals on the accumulation of trimethylglycine, putrescine and spermine in food plants.

    Science.gov (United States)

    Bergmann, H; Machelett, B; Lippmann, B; Friedrich, Y

    2001-01-01

    Increased contents of cadmium (Cd), lead (Pb), zinc (Zn) and other heavy metals in barley plants enhanced the accumulation of trimethylglycine (betaine), putrescine and spermine. Higher contents of heavy metals in barley were caused by soil enrichment with heavy metals and by soil salinity. The highest accumulation of spermine and betaine (increase 3-fold or 5-fold in comparison to untreated soil substrates) was obtained at the highest concentration of heavy metals in plants. Consequently the betaine-N/protein-N-ratio and the spermine-N/protein-N-quotient increased 3-fold in plants with high heavy metal contents. The biomass formation was not changed significantly by the different experimental treatments. PMID:11354608

  9. Hydrodynamical behavior of symmetric exclusion with slow bonds

    CERN Document Server

    Franco, Tertuliano; Neumann, Adriana

    2010-01-01

    We consider the exclusion process in the one-dimensional discrete torus with $N$ points, where all the bonds have conductance one, except a finite number of slow bonds, with conductance $N^{-\\beta}$, with $\\beta\\in[0,\\infty)$. We prove that the time evolution of the empirical density of particles, in the diffusive scaling, has a distinct behavior according to the range of the parameter $\\beta$. If $\\beta\\in [0,1)$, the hydrodynamic limit is given by the usual heat equation. If $\\beta=1$, it is given by a parabolic equation involving an operator $\\frac{d}{dx}\\frac{d}{dW}$, where $W$ is the Lebesgue measure on the torus plus the sum of the Dirac measure supported on each macroscopic point related to the slow bond. If $\\beta\\in(1,\\infty)$, it is given by the heat equation with Neumann's boundary conditions, meaning no passage through the slow bonds in the continuum.

  10. Quorum sensing regulates the osmotic stress response in Vibrio harveyi.

    Science.gov (United States)

    van Kessel, Julia C; Rutherford, Steven T; Cong, Jian-Ping; Quinodoz, Sofia; Healy, James; Bassler, Bonnie L

    2015-01-01

    Bacteria use a chemical communication process called quorum sensing to monitor cell density and to alter behavior in response to fluctuations in population numbers. Previous studies with Vibrio harveyi have shown that LuxR, the master quorum-sensing regulator, activates and represses >600 genes. These include six genes that encode homologs of the Escherichia coli Bet and ProU systems for synthesis and transport, respectively, of glycine betaine, an osmoprotectant used during osmotic stress. Here we show that LuxR activates expression of the glycine betaine operon betIBA-proXWV, which enhances growth recovery under osmotic stress conditions. BetI, an autorepressor of the V. harveyi betIBA-proXWV operon, activates the expression of genes encoding regulatory small RNAs that control quorum-sensing transitions. Connecting quorum-sensing and glycine betaine pathways presumably enables V. harveyi to tune its execution of collective behaviors to its tolerance to stress. PMID:25313392

  11. The role of sulfur in osmoregulation and salinity tolerance in cyanobacteria, algae, and plants

    Science.gov (United States)

    Yopp, J. H.

    1985-01-01

    Organosulfur compounds are involved in osmoregulation and salinity tolerance in some cyanobacteria and photosynthetic eukaryotes. Glycinebetaine, the osmolyte of the halotolerant cyanobacterium, Aphanothece halophytica, requires the sulfonium compound. S-adenosyl-methionine (SAM) for its synthesis. Glutamate is the nitrogen source, SAM is the methyl carbon and serine the carbon backbone source of this unique osmolyte. Inhibitor studies suggest that photorespiration interacts with sulfur metabolism to control betaine synthesis in cyanobacteria. The limiting factor for SAM synthesis is formate from photorespiration. SAM is, in turn, the methyl donor for betaine synthesis from serine. The nitrogen component of serine is from glutamate. Betaine synthesis is hypothesized to be regulated via potassium. The biosynthesis of dimethyl-B-propiothetin (DMPT, which is the same as beta-dimethyl sulfonioprpionate) and diacylsulfoquinovosylglycerol were elucidated as having their roles in osmoregulation and salinity tolerance. The relation between these sulfolipids and the sulfur cycle was discussed.

  12. The use of trimethylamine N-oxide as a primary precipitating agent and related methylamine osmolytes as cryoprotective agents for macromolecular crystallography

    International Nuclear Information System (INIS)

    The stabilizing osmolyte trimethylamine N-oxide (TMAO) is shown to be an efficient primary precipitant for protein crystal growth. In addition to TMAO, two other methylamine osmolytes, sarcosine and betaine, are shown to be effective cryoprotective agents for protein crystal cooling. Both crystallization and cryoprotection are often bottlenecks for high-resolution X-ray structure determination of macromolecules. Methylamine osmolytes are known stabilizers of protein structure. One such osmolyte, trimethylamine N-oxide (TMAO), has seen occasional use as an additive to improve macromolecular crystal quality and has recently been shown to be an effective cryoprotective agent for low-temperature data collection. Here, TMAO and the related osmolytes sarcosine and betaine are investigated as primary precipitating agents for protein crystal growth. Crystallization experiments were undertaken with 14 proteins. Using TMAO, seven proteins crystallized in a total of 13 crystal forms, including a new tetragonal crystal form of trypsin. The crystals diffracted well, and eight of the 13 crystal forms could be effectively cryocooled as grown with TMAO as an in situ cryoprotective agent. Sarcosine and betaine produced crystals of four and two of the 14 proteins, respectively. In addition to TMAO, sarcosine and betaine were effective post-crystallization cryoprotective agents for two different crystal forms of thermolysin. Precipitation reactions of TMAO with several transition-metal ions (Fe3+, Co2+, Cu2+ and Zn2+) did not occur with sarcosine or betaine and were inhibited for TMAO at lower pH. Structures of proteins from TMAO-grown crystals and from crystals soaked in TMAO, sarcosine or betaine were determined, showing osmolyte binding in five of the 12 crystals tested. When an osmolyte was shown to bind, it did so near the protein surface, interacting with water molecules, side chains and backbone atoms, often at crystal contacts

  13. Osmoregulation in Rhodobacter sphaeroides.

    Science.gov (United States)

    Abee, T; Palmen, R; Hellingwerf, K J; Konings, W N

    1990-01-01

    Betaine (N,N,N-trimethylglycine) functioned most effectively as an osmoprotectant in osmotically stressed Rhodobacter sphaeroides cells during aerobic growth in the dark and during anaerobic growth in the light. The presence of the amino acids L-glutamate, L-alanine, or L-proline in the growth medium did not result in a significant increase in the growth rate at increased osmotic strengths. The addition of choline to the medium stimulated growth at increased osmolarities but only under aerobic conditions. Under these conditions choline was converted via an oxygen-dependent pathway to betaine, which was not further metabolized. The initial rates of choline uptake by cells grown in media with low and high osmolarities were measured over a wide range of concentrations (1.9 microM to 2.0 mM). Only one kinetically distinguishable choline transport system could be detected. Kt values of 2.4 and 3.0 microM and maximal rates of choline uptake (Vmax) of 5.4 and 4.2 nmol of choline/min.mg of protein were found in cells grown in the minimal medium without or with 0.3 M NaCl, respectively. Choline transport was not inhibited by a 25-fold excess of L-proline or betaine. Only one kinetically distinguishable betaine transport system was found in cells grown in the low-osmolarity minimal medium as well as in a high-osmolarity medium containing 0.3 M NaCl. In cells grown and assayed in the absence of NaCl, betaine transport occurred with a Kt of 15.1 microM and a Vmax of 3.2 nmol/min . mg of protein, whereas in cells that were grown and assayed in the presence of 0.3 M NaCl, the corresponding values were 18.2 microM and 9.2 nmol of betaine/min . mg of protein. This system was also able to transport L-proline, but with a lower affinity than that for betaine. The addition of choline of betaine to the growth medium did not result in the induction of additional transport systems. PMID:2294084

  14. 1-Carboxymethyl-1′-carboxylatomethyl-3,3′-[p-phenylenebis(oxymethylene]dipyridinium bromide dihydrate

    Directory of Open Access Journals (Sweden)

    Wei-Cheng Pan

    2010-10-01

    Full Text Available In the crystal structure of the title salt, C22H21N2O6+·Br−·2H2O, pairs of betaine molecules are bridged by protons (the bridging proton is disordered, forming strong and symmetrical O—H...O hydrogen bonds, leading to an infinite chain along the b axis. The water molecules are linked to the betaine molecule and the bromide ion through O—H...O and O—H...Br interactions. The central ring, located on an inversion centre, makes dihedral angles of 1.2 (2° with the outer rings. One of the carboxylic acid groups is deprotonated.

  15. Dynamic light scattering study on vesicles of Netaine-Cholesterol system

    Energy Technology Data Exchange (ETDEWEB)

    Alenaizi, R.; Radiman, S.; Mohamed, F.; Rahman, I. Abdul [Nuclear Science Program, School of Applied Physics, Faculty of Science and Technology, University Kebangsaan Malaysia, 43600 UKM Bangi, Selangor (Malaysia)

    2014-09-03

    The morphology of vesicles system with defined particle size and shape is one of interest in our technical applications. Here we have used dynamic light scattering technique and transmission electron microscopy for structural characterization of N-dimethylglycine Betaine with 5-cholesten-3β-ol vesicles in aqueous solutions. An isotropic one phase region is found in the very diluted regions depending on Betaine/Cholesterol ratio. The isotropic region was stable for more than 3 months at room temperature, with monodispersed unilamellar vesicles ∼ 300nm.

  16. The Effects of Two Chemo-attractants and Different First Feeds on the Growth Performances of African Catfish (Clarias gariepinus, Burchell, 1822) at Different Larval Stages

    OpenAIRE

    Yilmaz, Erdal

    2005-01-01

    In this study, 4 days old African catfish larvae were fed with trout starter diet, minced beef liver and fresh water mussel, dried tubifex, DL-alanine and betaine supplemented trout starter, artemia nauplii and a combined diet consisting of boiled chicken egg yolk, minced mussel and dried tubifex as the first feed after yolk absorption for a week. At the end of the first period, it was observed that DL-alanine and betaine supplementation did not improve the larval growth and survival compared...

  17. Luminescent Surface Quaternized Carbon Dots

    KAUST Repository

    Bourlinos, Athanasios B.

    2012-01-10

    Thermal oxidation of a salt precursor made from the acid base combination of tris(hydroxymethyl)aminomethane and betaine hydrochloride results in light-emitting surface quaternized carbon dots that are water-dispersible, display anion exchange properties, and exhibit uniform size/surface charge. © 2011 American Chemical Society.

  18. 21 CFR 310.540 - Drug products containing active ingredients offered over-the-counter (OTC) for use as stomach...

    Science.gov (United States)

    2010-04-01

    ... offered over-the-counter (OTC) for use as stomach acidifiers. 310.540 Section 310.540 Food and Drugs FOOD... ingredients offered over-the-counter (OTC) for use as stomach acidifiers. (a) Betaine hydrochloride, glutamic...-counter (OTC) drug products for use as stomach acidifiers. Because of the lack of adequate data...

  19. Sequence Classification: 416901 [

    Lifescience Database Archive (English)

    Full Text Available Non-TMB TMH Non-TMB TMB TMB Non-TMB >gi|75676525|ref|YP_318946.1| Substrate-binding region and inner membran...e component of ABC-type glycine betaine transport system || http://www.ncbi.nlm.nih.gov/protein/75676525 ...

  20. Effects on antioxidant enzyme activities and osmolytes in Halocnemum strobilaceum under salt stress

    Institute of Scientific and Technical Information of China (English)

    TianPeng Gao; Rui Guo; XiangWen Fang; ZhiGang Zhao; GuoHua Chang; YinQuan Chen; Qing Zhang

    2016-01-01

    The seedlings ofHalocnermum strobilaceum were cultivated in 0.5% hoagland nutrient solution containing 0.0%, 0.9%, 2.7% and 5.4% of NaCl as well as composite salt (Na+, Ca2+, K+, Si4+) for 20 days; all the contents are in weight ratio. Succulent level, inorganic ions (Na+, K+), organics such as betaine, proline, malondialdehyde, and antioxidant enzyme activities including superoxide dismutase (SOD), catalase (CAT), peroxidase (POD), betaine aldehyde dehydrogenase (BADH) were measured to reveal its salt tolerance mechanism. When the composite salt concentration reaches 5.4%, SOD activity level, and MDA content is five times the control group; when it reaches 2.7%, the succulent level of seedlings, and the content of K+ in roots is nearly two times the NaCl treatment; the dry weight is more than three times the control group; with the NaCl treatment, MDA is three times the contrast; when the salt concentration is 2.7%, POD reaches the maximum. Results indicate that Si4+, K+, and Ca2+ from composite salt in the roots ofH. strobilaceum improved the water-holding capacity. The activities of antioxidant enzyme were raised by the accumulation of proline and betaine, which increased the salt tolerance. The absorption of K+ promoted the high ratio of K+/Na+ and alleviated the damage of cell membranes ofH. strobilaceum, which is associated with osmotic contents such as betaine and proline.

  1. Chemical chaperones improve protein secretion and rescue mutant factor VIII in mice with hemophilia A.

    Directory of Open Access Journals (Sweden)

    Stefanie D Roth

    Full Text Available Inefficient intracellular protein trafficking is a critical issue in the pathogenesis of a variety of diseases and in recombinant protein production. Here we investigated the trafficking of factor VIII (FVIII, which is affected in the coagulation disorder hemophilia A. We hypothesized that chemical chaperones may be useful to enhance folding and processing of FVIII in recombinant protein production, and as a therapeutic approach in patients with impaired FVIII secretion. A tagged B-domain-deleted version of human FVIII was expressed in cultured Chinese Hamster Ovary cells to mimic the industrial production of this important protein. Of several chemical chaperones tested, the addition of betaine resulted in increased secretion of FVIII, by increasing solubility of intracellular FVIII aggregates and improving transport from endoplasmic reticulum to Golgi. Similar results were obtained in experiments monitoring recombinant full-length FVIII. Oral betaine administration also increased FVIII and factor IX (FIX plasma levels in FVIII or FIX knockout mice following gene transfer. Moreover, in vitro and in vivo applications of betaine were also able to rescue a trafficking-defective FVIII mutant (FVIIIQ305P. We conclude that chemical chaperones such as betaine might represent a useful treatment concept for hemophilia and other diseases caused by deficient intracellular protein trafficking.

  2. Aqueous two-phase system based on natural quaternary ammonium compounds for the extraction of proteins.

    Science.gov (United States)

    Zeng, Chao-Xi; Xin, Rui-Pu; Qi, Sui-Jian; Yang, Bo; Wang, Yong-Hua

    2016-02-01

    Aqueous two-phase systems, based on the use of natural quaternary ammonium compounds, were developed to establish a benign biotechnological route for efficient protein separation. In this study, aqueous two-phase systems of two natural resources betaine and choline with polyethyleneglycol (PEG400/600) or inorganic salts (K2 HPO4 /K3 PO4 ) were formed. It was shown that in the K2 HPO4 -containing aqueous two-phase system, hydrophobic interactions were an important driving force of protein partitioning, while protein size played a vital role in aqueous two-phase systems that contained polyethylene glycol. An extraction efficiency of more than 90% for bovine serum albumin in the betaine/K2 HPO4 aqueous two-phase system can be obtained, and this betaine-based aqueous two-phase system provided a gentle and stable environment for the protein. In addition, after investigation of the cluster phenomenon in the betaine/K2 HPO4 aqueous two-phase systems, it was suggested that this phenomenon also played a significant role for protein extraction in this system. The development of aqueous two-phase systems based on natural quaternary ammonium compounds not only provided an effective and greener method of aqueous two-phase system to meet the requirements of green chemistry but also may help to solve the mystery of the compartmentalization of biomolecules in cells. PMID:26447826

  3. Domain Modeling: NP_003264.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_003264.2 chr11 CRYSTAL STRUCTURE OF THE SODIUM-COUPLED GLYCINE BETAINE SYMPORTER... BETP FROM CORYNEBACTERIUM GLUTAMICUM WITH BOUND SUBSTRATE p2wita_ chr11/NP_003264.2/NP_003264.2_holo_12-404.pdb swppa 110A,111L,113V,115L,130L,134A,135F,258M BET 0 ...

  4. In vivo screening of five phytochemicals/extracts and a fungal immunomodulatory protein against colibacillosis in broilers

    NARCIS (Netherlands)

    Peek, H.W.; Halkes, S.B.A.; Tomassen, M.M.M.; Mes, J.J.; Landman, W.J.M.

    2013-01-01

    Five phytochemicals/extracts (an extract from Echinacea purpurea, a ß-glucan-rich extract from Shiitake, betaine [Betain™], curcumin from Curcuma longa [turmeric] powder, carvacrol and also a recombinant fungal immunomodulatory protein [FIP] from Ganoderma lucidum) cloned and expressed in Escherichi

  5. Sequence Classification: 400201 [

    Lifescience Database Archive (English)

    Full Text Available ECTANT (GLYCINE BETAINE/CARNITINE/CHOLINE/L-PROLINE) TRANSPORT INTEGRAL MEMBRANE PROTEIN ABC TRANSPORTER PROZ || http://www.ncbi.nlm.nih.gov/protein/15610892 ... ...Non-TMB TMH Non-TMB TMB TMB Non-TMB >gi|15610892|ref|NP_218273.1| POSSIBLE OSMOPROT

  6. Sequence Classification: 390416 [

    Lifescience Database Archive (English)

    Full Text Available ECTANT (GLYCINE BETAINE/CARNITINE/CHOLINE/L-PROLINE) TRANSPORT INTEGRAL MEMBRANE PROTEIN ABC TRANSPORTER PROW || http://www.ncbi.nlm.nih.gov/protein/31794927 ... ...Non-TMB TMH Non-TMB TMB TMB Non-TMB >gi|31794927|ref|NP_857420.1| POSSIBLE OSMOPROT

  7. Sequence Classification: 400202 [

    Lifescience Database Archive (English)

    Full Text Available ECTANT (GLYCINE BETAINE/CARNITINE/CHOLINE/L-PROLINE) TRANSPORT INTEGRAL MEMBRANE PROTEIN ABC TRANSPORTER PROW || http://www.ncbi.nlm.nih.gov/protein/15610893 ... ...Non-TMB TMH Non-TMB TMB TMB Non-TMB >gi|15610893|ref|NP_218274.1| POSSIBLE OSMOPROT

  8. Sequence Classification: 390415 [

    Lifescience Database Archive (English)

    Full Text Available ECTANT (GLYCINE BETAINE/CARNITINE/CHOLINE/L-PROLINE) TRANSPORT INTEGRAL MEMBRANE PROTEIN ABC TRANSPORTER PROZ || http://www.ncbi.nlm.nih.gov/protein/31794926 ... ...Non-TMB TMH Non-TMB TMB TMB Non-TMB >gi|31794926|ref|NP_857419.1| POSSIBLE OSMOPROT

  9. Draft Genome Sequence of Halomonas sp. Strain HAL1, a Moderately Halophilic Arsenite-Oxidizing Bacterium Isolated from Gold-Mine Soil

    OpenAIRE

    Lin, Yanbing; Fan, Haoxin; Hao, Xiuli; Johnstone, Laurel; Hu, Yao; Wei, Gehong; Alwathnani, Hend A.; Wang, Gejiao; Rensing, Christopher

    2012-01-01

    We report the draft genome sequence of arsenite-oxidizing Halomonas sp. strain HAL1, isolated from the soil of a gold mine. Genes encoding proteins involved in arsenic resistance and transformation, phosphate utilization and uptake, and betaine biosynthesis were identified. Their identification might help in understanding how arsenic and phosphate metabolism are intertwined.

  10. Dietary intake of S-(alpha-carboxybutyl)-DL-homocysteine induces hyperhomocysteinemia in rats

    Czech Academy of Sciences Publication Activity Database

    Straková, J.; Williams, K. T.; Gupta, S.; Schalinske, K. L.; Kruger, W. D.; Rozen, R.; Jiráček, Jiří; Li, L.; Garrow, T. A.

    2010-01-01

    Roč. 30, č. 7 (2010), s. 492-500. ISSN 0271-5317 R&D Projects: GA ČR(CZ) GAP207/10/1277 Grant ostatní: NIH(US) DK52501 Institutional research plan: CEZ:AV0Z40550506 Keywords : BHMT * homocysteine * rat * betaine Subject RIV: CC - Organic Chemistry Impact factor: 2.092, year: 2010

  11. Search for a Small Chromophore with Efficient Singlet Fission: Biradicaloid Heterocycles

    Czech Academy of Sciences Publication Activity Database

    Akdag, Akin; Havlas, Zdeněk; Michl, Josef

    2012-01-01

    Roč. 134, č. 35 (2012), s. 14624-14631. ISSN 0002-7863 R&D Projects: GA ČR GBP208/12/G016 Institutional support: RVO:61388963 Keywords : molecular wave-functions * ANO basis-sets * exciton fission * pentacene * fluorescence * betaines Subject RIV: CC - Organic Chemistry Impact factor: 10.677, year: 2012

  12. Analysis of an SFP marker in the Rice fgr/BAD2 gene and fragrance in US rice germplasm

    Science.gov (United States)

    The fgr gene on rice chromosome 8 has been identified to control the presence of grain fragrance/aroma in rice. An eight base pair deletion in the fgr gene was found by Bradbury et al. (2005) in aromatic rice accessions, with this recessive mutation causing a loss in function of the betaine aldehyde...

  13. Trimethylglycine complexes with carboxylic acids and HF: solvation by a polar aprotic solvent.

    Science.gov (United States)

    Guo, Jing; Koeppe, Benjamin; Tolstoy, Peter M

    2011-02-14

    A series of strong H-bonded complexes of trimethylglycine, also known as betaine, with acetic, chloroacetic, dichloroacetic, trifluoroacetic and hydrofluoric acids as well as the homo-conjugated cation of betaine with trifluoroacetate as the counteranion were investigated by low-temperature (120-160 K) liquid-state NMR spectroscopy using CDF(3)/CDF(2)Cl mixture as the solvent. The temperature dependencies of (1)H NMR chemical shifts are analyzed in terms of the solvent-solute interactions. The experimental data are explained assuming the combined action of two main effects. Firstly, the solvent ordering around the negatively charged OHX region of the complex (X = O, F) at low temperatures, which leads to a contraction and symmetrisation of the H-bond; this effect dominates for the homo-conjugated cation of betaine. Secondly, at low temperatures structures with a larger dipole moment are preferentially stabilized, an effect which dominates for the neutral betaine-acid complexes. The way this second contribution affects the H-bond geometry seems to depend on the proton position. For the Be(+)COO(-)···HOOCCH(3) complex (Be = (CH(3))(3)NCH(2)-) the proton displaces towards the hydrogen bond center (H-bond symmetrisation, O···O contraction). In contrast, for the Be(+)COOH···(-)OOCCF(3) complex the proton shifts further away from the center, closer to the betaine moiety (H-bond asymmetrisation, O···O elongation). Hydrogen bond geometries and their changes upon lowering the temperature were estimated using previously published H-bond correlations. PMID:21132169

  14. Plasma 1-carbon metabolites and academic achievement in 15-yr-old adolescents

    DEFF Research Database (Denmark)

    Nilsson, Torbjörn K; Hurtig-Wennlöf, Anita; Sjöström, Michael; Herrmann, Wolfgang; Obeid, Rima; Owen, Jennifer R; Zeisel, Steven

    2016-01-01

    Academic achievement in adolescents is correlated with 1-carbon metabolism (1-CM), as folate intake is positively related and total plasma homocysteine (tHcy) negatively related to academic success. Because another 1-CM nutrient, choline is essential for fetal neurocognitive development, we...... hypothesized that choline and betaine could also be positively related to academic achievement in adolescents. In a sample of 15-yr-old children (n = 324), we measured plasma concentrations of homocysteine, choline, and betaine and genotyped them for 2 polymorphisms with effects on 1-CM......, methylenetetrahydrofolate reductase (MTHFR) 677C>T, rs1801133, and phosphatidylethanolamine N-methyltransferase (PEMT), rs12325817 (G>C). The sum of school grades in 17 major subjects was used as an outcome measure for academic achievement. Lifestyle and family socioeconomic status (SES) data were obtained from...

  15. Adsorption of foam-forming surfactants in Berea sandstone

    Energy Technology Data Exchange (ETDEWEB)

    Mannhardt, K.; Novasad, J.J. (Petroleum Recovery Inst., Calgary, AB (Canada)); Jha, K.N. (Canada Centre for Mineral and Energy Technology, Ottawa, ON (Canada))

    1994-02-01

    Adsorption measurements carried out with representativs of four classes of surfactant suitable for foam flooding (alpha olefin sulphonate, internal olefin sulphonate, linear xylene sulphonate, and betaine) on Berea sandstone at different conditions of temperature and salinity are described. Adsorption of the anionic surfactants from a low salinity brine is low, but increases substantially at moderate salinities. Limited solubility of the anionic surfactants in aqueous media tends to drive these surfactants to the solid/liquid interface and can also lead to increased surfactant loss through precipitation. The betaine is highly soluble, but adsorbs very strongly on sandstone. Adsorption of this surfactant can be reduced by mixing it with an anionic surfactant. 30 refs., 11 figs., 7 tabs.

  16. Effects of New Plant Growth Regulators on Growth and Quality in Potato

    Directory of Open Access Journals (Sweden)

    Chen Weiyan

    2015-04-01

    Full Text Available This experiment aimed to explore the effects of new plant growth regulators on the growth and quality of potato, we conduct potato tubers with different concentrations of the regulators and cultivated in the seedling pot, with water as the control treatment. The results showed that sorbic amide (5%, sorbic amide quaternary ammonium salt (5%, Cinnamamide (5%, betaine Cinnamamide (5%, naphthalene dicarboxamide (5%, betaine naphthalenedicarboxamide (5% these 6 new regulators have good activity in improving and enhancing the content of chlorophyll, soluble protein, soluble sugar and free amino acids with 400 times dilution and 800 times dilution on potato seedling. At the same time, we compared the changes of the physiological indexes in different periods. As can be seen from the experiment, these 6 compounds have a strong role in promoting growth and improving the quality of the potato so that they can be called plant growth regulators.

  17. Study on the Relationship between the Main Secondary Metabolites and Polysaccharide in Fruits of Lycium barbarum at Different Application Amounts of Nitrogen%不同施氮水平下枸杞主要次生代谢产物与多糖的关系研究

    Institute of Scientific and Technical Information of China (English)

    康建宏; 吴宏亮; 杨涓; 杨剑涛

    2008-01-01

    [Objective] The aim of this study is to investigate the optimum application amount of nitrogen in Lycium barbarum based on considering the re-lationship between main secondary metaholites and polysaccharide. [Method] Under field conditions, the effects of different application amounts of nitro-gen on main secondary metabolites of betaine, carotenoid and flavone of Lycium barbarum and the relationship between main secondary metabolites and pol-ysaccharide. [Result] The main secondary metabolites of betainc, carotenoid and flavone of Lycium barbarum varied under different application amounts of nitrogen. The proper application amuant of nitrogen (600 -900 kg/hm2) was beneficial to the formation and accumulation of secondary metabolites such as carotenoids. Correlation analysis results showed that polysaccharide were negatively correlated with betaine, carotenoid and flavone at significant probability level. [Conclusion] Considering the relationship between the output and quality of the fruits of Lycium barbarum, the optimum nitrogen application a-mount should be 600 -900 kg/hm2.

  18. Manual dishwashing detergent formulation%手洗餐具洗涤剂的配方研究

    Institute of Scientific and Technical Information of China (English)

    祝丽丽

    2012-01-01

    This paper uses creatively SLES,LAS,cocamidopropyl betaine,cocamide DEA,etc.to develop the optimum hand dishwashing liquid detergent formulations.%创造性地利用十二烷基聚氧乙烯醚硫酸钠(SLES)、烷基苯磺酸钠(LAS)椰油酰胺丙基甜菜碱和椰油酰胺DEA等来研发最佳餐洗洗涤剂的配方。

  19. Production and identification of salt_tolerant transgenic rice plants

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    @@To relieve the damage of salt to the cell, many plants accumulated some low_molecular weight organic compounds, which were called osmoprotectant, such as betaine, mannitol, and sorbitol. Therefore if the gene_encoding enzyme responsible for synthesizing the osmoprotectant was transformed into rice plants, the salt_tolerance capacity of the transgenic plants would be increased, and the enormous loss caused by salinization of soil would be reduced.

  20. Functional Genomics of Novel Secondary Metabolites from Diverse Cyanobacteria Using Untargeted Metabolomics

    OpenAIRE

    Muriel Gugger; Kyrpides, Nikos C.; Ferran Garcia-Pichel; Nick Jose; Ivanova, Natalia N.; Richard Baran; Northen, Trent R.

    2013-01-01

    Mass spectrometry-based metabolomics has become a powerful tool for the detection of metabolites in complex biological systems and for the identification of novel metabolites. We previously identified a number of unexpected metabolites in the cyanobacterium Synechococcus sp. PCC 7002, such as histidine betaine, its derivatives and several unusual oligosaccharides. To test for the presence of these compounds and to assess the diversity of small polar metabolites in other cyanobacteria, we prof...

  1. Domain Modeling: NP_110434.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_110434.2 chr22 CRYSTAL STRUCTURE OF THE SODIUM-COUPLED GLYCINE BETAINE SYMPORTER... BETP FROM CORYNEBACTERIUM GLUTAMICUM WITH BOUND SUBSTRATE p2wita_ chr22/NP_110434.2/NP_110434.2_holo_16-502.pdb swppa 109N,110I,112V,114S,115A,117I,118L,129E,131I,330L BET 0 ...

  2. Identification of genes required for Pseudomonas aeruginosa carnitine catabolism

    OpenAIRE

    Wargo, Matthew J.; Hogan, Deborah A.

    2009-01-01

    Carnitine is a quaternary amine compound prevalent in animal tissues, and a potential carbon, nitrogen and energy source for pathogens during infection. Characterization of activities in Pseudomonas aeruginosa cell lysates has previously shown that carnitine is converted to 3-dehydrocarnitine (3-dhc) which is in turn metabolized to glycine betaine (GB), an intermediate metabolite in the catabolism of carnitine to glycine. However, the identities of the enzymes required for carnitine catabolis...

  3. Osmoregulation in Rhodobacter sphaeroides.

    OpenAIRE

    Abee, T; Palmen, R; Hellingwerf, K J; Konings, W N

    1990-01-01

    Betaine (N,N,N-trimethylglycine) functioned most effectively as an osmoprotectant in osmotically stressed Rhodobacter sphaeroides cells during aerobic growth in the dark and during anaerobic growth in the light. The presence of the amino acids L-glutamate, L-alanine, or L-proline in the growth medium did not result in a significant increase in the growth rate at increased osmotic strengths. The addition of choline to the medium stimulated growth at increased osmolarities but only under aerobi...

  4. Exposure to the Proton Scavenger Glycine under Alkaline Conditions Induces Escherichia coli Viability Loss

    OpenAIRE

    Donna Vanhauteghem; Geert Paul Jules Janssens; Angelo Lauwaerts; Stanislas Sys; Filip Boyen; Eric Cox; Evelyne Meyer

    2013-01-01

    Our previous work described a clear loss of Escherichia coli (E. coli) membrane integrity after incubation with glycine or its N-methylated derivatives N-methylglycine (sarcosine) and N,N-dimethylglycine (DMG), but not N,N,N-trimethylglycine (betaine), under alkaline stress conditions. The current study offers a thorough viability analysis, based on a combination of real-time physiological techniques, of E. coli exposed to glycine and its N-methylated derivatives at alkaline pH. Flow cytometr...

  5. Whole genome sequencing of Halomonas sp. SUBG004 isolated from Little Rann of Kutch, a desert of India

    OpenAIRE

    Jigna H. Patel; Thaker, Vrinda S.

    2015-01-01

    A salt tolerant strain, designated as SUBG004, was isolated from the desert of India, Little Rann of Kutch. The organism is a Gram-negative, facultatively anaerobic and rod shaped bacterium. Chemotaxonomic and phylogenetic properties were consistent with its classification in the genus Halomonas. Here we report the whole genome sequence of Halomonas sp. SUBG004 deposited in DDBJ/EMBL/GenBank under accession number JPEU0100000 which provides insights for salt stress adaptation through betaine ...

  6. Whole genome sequencing of Halomonas sp. SUBG004 isolated from Little Rann of Kutch, a desert of India.

    Science.gov (United States)

    Patel, Jigna H; Thaker, Vrinda S

    2015-12-01

    A salt tolerant strain, designated as SUBG004, was isolated from the desert of India, Little Rann of Kutch. The organism is a Gram-negative, facultatively anaerobic and rod shaped bacterium. Chemotaxonomic and phylogenetic properties were consistent with its classification in the genus Halomonas. Here we report the whole genome sequence of Halomonas sp. SUBG004 deposited in DDBJ/EMBL/GenBank under accession number JPEU0100000 which provides insights for salt stress adaptation through betaine synthesis. PMID:26697321

  7. Whole genome sequencing of Halomonas sp. SUBG004 isolated from Little Rann of Kutch, a desert of India

    Directory of Open Access Journals (Sweden)

    Jigna H. Patel

    2015-12-01

    Full Text Available A salt tolerant strain, designated as SUBG004, was isolated from the desert of India, Little Rann of Kutch. The organism is a Gram-negative, facultatively anaerobic and rod shaped bacterium. Chemotaxonomic and phylogenetic properties were consistent with its classification in the genus Halomonas. Here we report the whole genome sequence of Halomonas sp. SUBG004 deposited in DDBJ/EMBL/GenBank under accession number JPEU0100000 which provides insights for salt stress adaptation through betaine synthesis.

  8. Maternal obesity disrupts the methionine cycle in baboon pregnancy

    OpenAIRE

    Nathanielsz, Peter W.; Yan, Jian; Green, Ralph; Nijland, Mark; Miller, Joshua W.; Wu, Guoyao; McDonald, Thomas J; Caudill, Marie A.

    2015-01-01

    Maternal intake of dietary methyl-micronutrients (e.g. folate, choline, betaine and vitamin B-12) during pregnancy is essential for normal maternal and fetal methionine metabolism, and is critical for important metabolic processes including those involved in developmental programming. Maternal obesity and nutrient excess during pregnancy influence developmental programming potentially predisposing adult offspring to a variety of chronic health problems. In the present study, we hypothesized t...

  9. The growth of Paracoccus halodenitrificans in a defined medium

    Science.gov (United States)

    Hochstein, L. I.; Tomlinson, G. A.

    1984-01-01

    A synthetic medium, consisting of inorganic salts and any of a number of carbon sources, supported the aerobic growth of Paracoccus halodenitrificans when supplemented with thiamine. The same medium plus a nitrogenous oxide supported anaerobic growth when additionally supplemented with methionine. The observation that vitamin B12 or betaine replaced methionine suggested that P. halodenitrificans had a defect in the cobalamin dependent pathway for methionine biosynthesis, as well as the inability to synthesize betanine when growing anaerobically.

  10. Osmoprotectants suppress the production and activity of matrix metalloproteinases induced by hyperosmolarity in primary human corneal epithelial cells

    OpenAIRE

    Deng, Ruzhi; Su, Zhitao; Hua, Xia; Zhang, Zongduan; Li, De-Quan; Pflugfelder, Stephen C.

    2014-01-01

    Purpose Hyperosmolarity has been recognized as a proinflammatory stress in the pathogenesis of dry eye disease. This study investigated the suppressive effect of osmoprotectants (L-carnitine, erythritol, and betaine) on the production and activity of matrix metalloproteinases (MMPs) in primary human corneal epithelial cells (HCECs) exposed to hyperosmotic stress. Methods Primary HCECs were established from fresh donor limbal tissue explants. The cultures in iso-osmolar medium (312 mOsM) were ...

  11. Association between BHMT gene rs3733890 polymorphism and cancer risk: evidence from a meta-analysis

    OpenAIRE

    Zhang, Li; Xu, Yue; Yan, Cunye; Hao, Zongyao; Zhou, Jun; Song, Fan; TAI, SHENG; Yang, Cheng; Liang, Chaozhao

    2016-01-01

    Yue Xu,1,* Cunye Yan,2,* Zongyao Hao,1 Jun Zhou,1 Song Fan,1 Sheng Tai,1 Cheng Yang,1 Li Zhang,1 Chaozhao Liang1 1Department of Urology, The First Affiliated Hospital of Anhui Medical University and Institute of Urology, 2First School of Clinical Medicine, Anhui Medical University, Hefei, Anhui, People’s Republic of China *These authors contributed equally to this work Background and objective: The gene betaine-homocysteine methyltransferase (BHMT) has drawn much attenti...

  12. The origin and evolution of fragrance in rice (Oryza sativa L.)

    OpenAIRE

    Kovach, Michael J.; Calingacion, Mariafe N.; Fitzgerald, Melissa A.; McCouch, Susan R

    2009-01-01

    Fragrance in the grain is one of the most highly valued grain quality traits in rice, yet the origin and evolution of the betaine aldehyde dehydrogenase gene (BADH2) underlying this trait remains unclear. In this study, we identify eight putatively nonfunctional alleles of the BADH2 gene and show that these alleles have distinct geographic and genetic origins. Despite multiple origins of the fragrance trait, a single allele, badh2.1, is the predominant allele in virtually all fragrant rice va...

  13. Hyperhomocysteinemia causes premature hearing loss in C57BL/6J mice

    OpenAIRE

    Martínez-Vega, Raquel; Varela, Gregorio; Partearroyo, Teresa; Pajares, María A.; Varela-Nieto, Isabel

    2012-01-01

    [Introduction]: Alterations in plasma homocysteine (pHcy) levels and betaine homocysteine methyltransferase (BHMT) expression have been reported in genetic mouse models of human deafness. BHMT is one of the enzymes responsible for Hcy remethylation leading to methionine synthesis, its changes being one of the causes of increased pHcy levels and indirectly altering production of glutathione (2). Nutritional factors modulate Hcy metabolism, and hence we have studied the impact of a dietary-indu...

  14. Effects of hypernatremia on organic brain osmoles.

    OpenAIRE

    Lien, Y H; Shapiro, J I; Chan, L

    1990-01-01

    We studied the effects of varying degrees and durations of hypernatremia on the brain concentrations of organic compounds believed to be important, so-called "idiogenic" osmoles in rats by means of conventional biochemical assays, nuclear magnetic resonance spectroscopy, and high-performance liquid chromatography. There were no changes in the concentrations of these osmoles (specifically myoinositol, sorbitol, betaine, glycerophosphorylcholine [GPC], phosphocreatine, glutamine, glutamate, and...

  15. Structural and functional characterization of plant aminoaldehyde dehydrogenase from Pisum sativum with a broad specificity for natural and synthetic aminoaldehydes

    Czech Academy of Sciences Publication Activity Database

    Tylichová, M.; Kopečný, D.; Moréra, S.; Briozzo, P.; Lenobel, René; Snégaroff, J.; Šebela, M.

    2010-01-01

    Roč. 396, č. 4 (2010), s. 870-882. ISSN 0022-2836 R&D Projects: GA ČR GA522/08/0555; GA ČR GA301/08/1649 Institutional research plan: CEZ:AV0Z50380511 Keywords : aminoaldehyde dehydrogenase * betaine aldehyde dehydrogenase * NAD+ complex Subject RIV: CE - Biochemistry Impact factor: 4.008, year: 2010

  16. Bridged 2,2'-biazole derivatives by 1,3-dipolar cycloaddition

    OpenAIRE

    Pablo, María S. de; Gandasegui Rodríguez, María Teresa; Vaquero López, Juan José; García Navío, José Luis; Álvarez-Builla Gómez, Julio

    1992-01-01

    Azomethine ylides derived from 3,4-dihydropyrrolo[1,2-a]pyrazinium salts undergo 1,3-dipolar cycloaddition reactions to yield 5,6-dihydrodipyrrolo[1,2-a:2',1'-c]-pyrazine and 5,6-dihydroimidazo[1,2-a]-pyrrolo[2,1-c]pyrazin-4-inium-2-olate and 2-thiolate derivatives. S-Methylation followed by nucleophilic displacement of methylthio group convened the 2-thiolate derivatives into new conjugated betaines.

  17. (5S*,6R*,7R*)-6-Formyl-5-phenyl-7-propylperhydropyrazolo[1,2-a]pyrazol-1-one

    OpenAIRE

    Jinlan Yu; Qingshan Zhang; Yanhong Liu; Yunzheng Li; Qinpei Wu

    2010-01-01

    The title compound, C16H20N2O2, was obtained by catalytic asymmetric cyclo­addition of trans-3-propyl­acrolein with 1-benzyl­idenepyrazolid-3-one betaine. There are two symmetry-independent mol­ecules in the asymmetric unit. In both mol­ecules, the two five-membered heterocyclic rings adopt envelope conformations.

  18. The product form for Debye relaxations

    International Nuclear Information System (INIS)

    From a phenomenological point of view, the dielectric dispersion function of a medium can be defined by the location of its zeros and poles in the complex-frequency plane. This general approach led to the use of a factorized form of the dielectric function to fit the experimental infrared reststrahlen data. Recently, such an approach has been generalized to the description of relaxation. At low frequency ranges, the factorized form for relaxation may be expressed as a product of Debye relaxors. This product form corresponds to the factorization of the conventional sum model and provides a way to describe the contribution of the different Debye relaxing units in a poly-dispersive system. It also allows us to estimate the importance of the interaction between the different relaxing units. The present work summarizes the fundamentals of the product model for relaxation and describes its application to the analysis of the dispersion observed in the vicinity of the paraelectric to antiferroelectric phase transition in the mixed crystal (betaine phosphate)0.75 (betaine arsenate)0.25 and at the structural phase transition of betaine potassium iodide dihydrate

  19. Effect of drought and abscisic acid application on the osmotic adjustment of four wheat cultivars

    International Nuclear Information System (INIS)

    The accumulation of osmolytes in leaf tissues and the abscisic acid-induced stomatal closure are well-recognized mechanisms associated with drought tolerance in crop plants. We determine the response in terms of osmotic potential and the contents of leaf proline, glycine betaine and soluble sugar at booting and grain filling stages of four wheat (Triticum aestivum L.) cultivars to drought and exogenously applied abscisic acid (ABA) in a pot study. Leaf sample were collected 3, 6 and 9 days after drought induction and at 48 and 72 h of re-watering (recovery). Marked decreases in osmotic potential associated with the accumulation of proline, glycine betaine and soluble sugars occurred under conditions of drought stress Accession 011320 was most sensitive to drought and showed the largest decrease in osmotic potential and least accumulation of proline, sugar and glycine betaine The inhibitory effects of drought stress were ameliorated by exogenous application of ABA. This ameliorating effect was more pronounced at the booting than at grain filling stage particularly in the sensitive accession 011320. Upon rewatering the recovery from drought stress was found to be greater in case of abscisic acid application. The leaf praline content is seen to be a suitable indicator for selecting drought-tolerant genotypes. (author)

  20. Biodegradation of beet molasses vinasse by a mixed culture of micro organisms: Effect of aeration conditions and pH control

    Institute of Scientific and Technical Information of China (English)

    Krzysztof Lutoslawski; Agnieszka Ryznar-Luty; Edmund Cibis; Malgorzata Krzywonos; Tadeusz Mi(s)kiewicz

    2011-01-01

    The effect of aeration conditions and pH control on the progress and efficiency of beet molasses vinasse biodegradation was investigated during four batch processes at 38℃ with the mixed microbial culture composed of Bifidobacterium,Lactobacillus,Lactococcus,Streptococcus,Bacillus,Rhodopseudomonas,and Saccharomyces.The four processes were carried out in a shake flask with no pH control,an aerobic bioreactor without mixing with no pH control,and a stirred-tank reactor (STR) with aeration with and without pH control,respectively.All experiments were started with an initial pH 8.0.The highest efficiency of biodegradation was achieved through the processes conducted in the STR,where betaine (an organic pollutant occurring in beet molasses in very large quantities) was completely degraded by the microorganisms.The process with no pH control carried out in the STR produced the highest reduction in the following pollution measures:organic matter expressed as chemical oxygen demand determined by the dichromatic method + theoretical COD of betaine (CODsum,85.5%),total organic carbon (TOC,78.8%) and five-day biological oxygen demand (BOD5,98.6%).The process conditions applied in the shake flask experiments,as well as those used in the aerobic bioreactor without mixing,failed to provide complete betaine assimilation.As a consequence,reduction in CODwum,TOC and BOD5 was approximately half that obtained with STR.

  1. Aracyl triflates for preparing fluorescent and UV absorbing derivatives of unreactive carboxylates, amines and other metabolites

    Energy Technology Data Exchange (ETDEWEB)

    Storer, Malina K. [Biochemistry Unit, Canterbury Health Laboratories, P.O. Box 151, Christchurch (New Zealand); Department of Pathology, Christchurch School of Medicine and Health Sciences, University of Otago, Christchurch (New Zealand); Lever, Michael [Biochemistry Unit, Canterbury Health Laboratories, P.O. Box 151, Christchurch (New Zealand) and Department of Pathology, Christchurch School of Medicine and Health Sciences, University of Otago, Christchurch (New Zealand)]. E-mail: michael.lever@chmeds.ac.nz

    2006-02-03

    Aracyl trifluoromethanesulfonate (triflate) reagents alkylate the unreactive carboxyl groups of betaines. The reagents also derivatise tertiary amines, amine oxides, phosphates and thioethers. A general derivatisation procedure is to dilute the sample with a polar aprotic organic solvent containing a trace of water, followed by adding an appropriate base and the aracyl triflate reagent. Limits of detection were 40 nM for glycine betaine (GB) and carnitine, 0.14 {mu}M for N,N-dimethylglycine, 70 nM for trimethylamine (TMA), and 5.9 {mu}M trimethylamine-N-oxide (TMAO). Limits of detection were improved when derivatisation yield was optimised for different analytes by changing solvent, base and water content of the reaction mixture. Solvents used include acetonitrile, acetone, butanone, dimethoxyethane and dimethoxyethyl ether, with the presence of some water or alcohol tolerated. Suitable bases include the inorganic bases magnesium hydroxide, silver oxide and lithium phosphate. These bases are sparingly soluble in the reaction solvent so sustain weakly basic conditions during derivatisation and can be removed by centrifugation to stop the reaction. This is particularly important for betaine assays since the derivatives are base-sensitive. The information presented here can be used to develop assays for many metabolites using these versatile reagents.

  2. Probing the connection of PBSs to the photosystems in Spirulina platensis by artificially induced fluorescence fluctuations

    International Nuclear Information System (INIS)

    The molecular architecture and the structural connections of phycobilisomes (PBSs) to the photosystems in the intact cells of Spirulina platensis were studied by taking advantage of glycerol- and betaine-induced fluorescence fluctuations. Generally, with a selective excitation of C-phycocyanin (C-PC), glycerol could induce not only decoupling of PBSs from the photosystems but also of C-PC rods from allophycocyanin (APC) cores, while betaine could strengthen the connection of PBSs to the thylakoid membrane but induce a partial dissociation of PBS. On the other hand, glycerol did not exert an influence on the fluorescence spectra of the photosystems in isolated thylakoid membrane. Therefore, it was deduced that glycerol could provide a molecular environment to weaken the hydrophobic interactions of not only the LCM with the membrane but also the linker polypeptides to the water-soluble phycobiliproteins (C-PC and APC), while the betaine could strengthen the hydrophobic interaction of LCM with the membrane but weaken the electrostatic interaction of linker polypeptides to C-PC and/or APC

  3. Glycine and its N-methylated analogues cause pH-dependent membrane damage to enterotoxigenic Escherichia coli.

    Science.gov (United States)

    Vanhauteghem, D; Janssens, G P J; Lauwaerts, A; Sys, S; Boyen, F; Kalmar, I D; Meyer, E

    2012-07-01

    The current study first investigates the emulsifying potential of glycine and its N-methylated derivatives N-methylglycine (sarcosine), N,N-dimethylglycine (DMG) and N,N,N-trimethylglycine (betaine) under varying pH conditions. Subsequently, the effect of these test compounds on the membrane integrity of enterotoxigenic Escherichia coli (ETEC) was evaluated. Oil in water emulsions containing each compound show that DMG is a more potent enhancer of emulsification than glycine, sarcosine and betaine under the conditions tested. Flow cytometry was used to investigate whether the emulsifying potential is associated with an effect on ETEC membrane integrity. The bacteria were exposed to each of the test compounds under varying pH conditions and membrane integrity was assessed using the LIVE/DEAD BacLight kit. Results show a membrane deteriorating effect caused by glycine, sarcosine and DMG, but not by betaine. This effect is pH- and time-dependent and has an apparent threshold at pH 9.0. Conventional plate counts confirmed concomitant changes in culturability of the membrane comprised bacteria. PMID:21912862

  4. Effect of pressure on methylated glycine derivatives: relative roles of hydrogen bonds and steric repulsion of methyl groups.

    Science.gov (United States)

    Kapustin, Eugene A; Minkov, Vasily S; Boldyreva, Elena V

    2014-06-01

    Infinite head-to-tail chains of zwitterions present in the crystals of all amino acids are known to be preserved even after structural phase transitions. In order to understand the role of the N-H...O hydrogen bonds linking zwitterions in these chains in structural rearrangements, the crystal structures of the N-methyl derivatives of glycine (N-methylglycine, or sarcosine, with two donors for hydrogen bonding; two polymorphs of N,N-dimethylglycine, DMG-I and DMG-II, with one donor for hydrogen bond; and N,N,N-trimethylglycine, or betaine, with no hydrogen bonds) were studied at different pressures. Methylation has not only excluded the formation of selected hydrogen bonds, but also introduced bulky mobile fragments into the structure. The effects of pressure on the systems of the series were compared with respect to distorting and switching over hydrogen bonds and inducing reorientation of the methylated fragments. Phase transitions with fragmentation of the single crystals into fine powder were observed for partially methylated N-methyl- and N,N-dimethylglycine, whereas the structural changes in betaine were continuous with some peculiar features in the 1.4-2.9 GPa pressure range and accompanied by splitting of the crystals into several large fragments. Structural rearrangements in sarcosine and betaine were strongly dependent on the rate of pressure variation: the higher the rate of increasing pressure, the lower the pressure at which the phase transition occurred. PMID:24892599

  5. Aracyl triflates for preparing fluorescent and UV absorbing derivatives of unreactive carboxylates, amines and other metabolites

    International Nuclear Information System (INIS)

    Aracyl trifluoromethanesulfonate (triflate) reagents alkylate the unreactive carboxyl groups of betaines. The reagents also derivatise tertiary amines, amine oxides, phosphates and thioethers. A general derivatisation procedure is to dilute the sample with a polar aprotic organic solvent containing a trace of water, followed by adding an appropriate base and the aracyl triflate reagent. Limits of detection were 40 nM for glycine betaine (GB) and carnitine, 0.14 μM for N,N-dimethylglycine, 70 nM for trimethylamine (TMA), and 5.9 μM trimethylamine-N-oxide (TMAO). Limits of detection were improved when derivatisation yield was optimised for different analytes by changing solvent, base and water content of the reaction mixture. Solvents used include acetonitrile, acetone, butanone, dimethoxyethane and dimethoxyethyl ether, with the presence of some water or alcohol tolerated. Suitable bases include the inorganic bases magnesium hydroxide, silver oxide and lithium phosphate. These bases are sparingly soluble in the reaction solvent so sustain weakly basic conditions during derivatisation and can be removed by centrifugation to stop the reaction. This is particularly important for betaine assays since the derivatives are base-sensitive. The information presented here can be used to develop assays for many metabolites using these versatile reagents

  6. Inhibition of insulin fibrillation by osmolytes: Mechanistic insights.

    Science.gov (United States)

    Choudhary, Sinjan; Kishore, Nand; Hosur, Ramakrishna V

    2015-01-01

    We have studied here using a number of biophysical tools the effects of osmolytes, betaine, citrulline, proline and sorbitol which differ significantly in terms of their physical characteristics such as, charge distribution, polarity, H-bonding abilities etc, on the fibrillation of insulin. Among these, betaine, citrulline, and proline are very effective in decreasing the extent of fibrillation. Proline also causes a substantial delay in the onset of fibrillation in the concentration range (50-250 mM) whereas such an effect is seen for citrulline only at 250 mM, and in case of betaine this effect is not seen at all in the whole concentration range. The enthalpies of interaction at various stages of fibrillation process have suggested that the preferential exclusion of the osmolyte and its polar interaction with the protein are important in inhibition. The results indicate that the osmolytes are most effective when added prior to the elongation stage of fibrillation. These observations have significant biological implications, since insulin fibrillation is known to cause injection amyloidosis and our data may help in designing lead drug molecules and development of potential therapeutic strategies. PMID:26616401

  7. Effect of fluid velocity, temperature, and concentration of non-ionic surfactants on drag reduction

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Sung-Hwan [Department of Mechanical and Automotive Engineering, Jeonju University, Jeonju 560-759 (Korea, Republic of); Tae, Choon-Seob [Building Energy Research Center, KIER, 71-2 Jang-Dong Yusong-Gu, Daejon 305-343 (Korea, Republic of); Zaheeruddin, M. [Building Civil and Environmental Engineering, Concordia University, Montreal, Que. H3G 1M8 (Canada)]. E-mail: zaheer@bcee.concordia.ca

    2007-03-15

    The drag reduction (DR) and heat transfer efficiency reduction (ER) of non-ionic surfactant as a function of fluid velocity, temperature, and surfactant concentration were investigated. Several types of new surfactants, which contain amine-oxide and betaine, were developed. An experimental apparatus consisting of two temperature controlled water storage tanks, pumps, test specimen pipe and the piping network, two flow meters, two pressure gauges, a heat exchanger, and data logging system was built. From the experimental results, it was concluded that existing alkyl ammonium surfactant (CTAC; cethyl trimethyl ammonium chloride) had DR of 0.6-0.8 at 1000-2000 ppm concentration with fluid temperature ranging between 50 and 60 {sup o}C. However, the DR was very low when the fluid temperature was 70-80 {sup o}C. The new amine oxide and betaine surfactant (SAOB; stearyl amine oxide + betaine) had lower DR at fluid temperatures ranging between 50 and 60 {sup o}C compared with CTAC. However, with fluid temperature ranging between 70 and 80 {sup o}C the DR was 0.6-0.8 when the concentration level was between 1000 and 2000 ppm.

  8. Probing the connection of PBSs to the photosystems in Spirulina platensis by artificially induced fluorescence fluctuations

    Energy Technology Data Exchange (ETDEWEB)

    Li Heng [Key Laboratory of Photochemistry, Center for Molecular Science, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100080 (China); Yang Shuzhen [Key Laboratory of Photochemistry, Center for Molecular Science, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100080 (China); Xie Jie [Key Laboratory of Photochemistry, Center for Molecular Science, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100080 (China); Zhao Jingquan [Key Laboratory of Photochemistry, Center for Molecular Science, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100080 (China)]. E-mail: zhaojq@iccas.ac.cn

    2007-01-15

    The molecular architecture and the structural connections of phycobilisomes (PBSs) to the photosystems in the intact cells of Spirulina platensis were studied by taking advantage of glycerol- and betaine-induced fluorescence fluctuations. Generally, with a selective excitation of C-phycocyanin (C-PC), glycerol could induce not only decoupling of PBSs from the photosystems but also of C-PC rods from allophycocyanin (APC) cores, while betaine could strengthen the connection of PBSs to the thylakoid membrane but induce a partial dissociation of PBS. On the other hand, glycerol did not exert an influence on the fluorescence spectra of the photosystems in isolated thylakoid membrane. Therefore, it was deduced that glycerol could provide a molecular environment to weaken the hydrophobic interactions of not only the L{sub CM} with the membrane but also the linker polypeptides to the water-soluble phycobiliproteins (C-PC and APC), while the betaine could strengthen the hydrophobic interaction of L{sub CM} with the membrane but weaken the electrostatic interaction of linker polypeptides to C-PC and/or APC.

  9. Diffusion Profiles of Health Beneficial Components from Goji Berry (Lyceum barbarum Marinated in Alcohol and Their Antioxidant Capacities as Affected by Alcohol Concentration and Steeping Time

    Directory of Open Access Journals (Sweden)

    Yang Song

    2013-01-01

    Full Text Available The fruit (goji berry of Lycium barbarum, a traditional Chinese medicine, has been widely used in health diets due to its potential role in the prevention of chronic diseases. One of the most popular applications of goji berry is to make goji wine in China by steeping goji berry in grain liquor. However, how the steeping process affects antioxidant capacities and phytochemicals of goji berry is not yet fully understood. Therefore, to provide scientific data for the utilization of goji berry in the nutraceutical industry, the diffusion rate of betaine, β-carotene, phenolic compounds in goji berry and their antioxidant capacities affected by alcohol concentration and steeping time were determined by UV-Visible spectrophotometer. The results showed that low alcohol concentration (15% or 25% would promote the diffusion of betaine and increase antioxidant activity, while high concentration (55% or 65% would generally increase the diffusion of flavonoids and reduce antioxidant activity. The steeping time had no significant effect on the diffusion of phenolic compounds and antioxidant activities. However, all goji berry wine steeped for 14 days with different alcohol concentrations exhibited the highest betaine concentration. Current findings provide useful information for the nutraceutical industries to choose proper steeping time and alcohol concentration to yield desired health promotion components from goji.

  10. Role of transmethylation reactions in alcoholic liver disease

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Alcoholic liver disease is a major health care problem worldwide. Findings from many laboratories, induding ours,have demonstrated that ethanol feeding impairs several of the many steps involved in methionine metabolism.Ethanol consumption predominantly results in a decrease in the hepatocyte level of S-adenosylmethionine and the increases in two toxic metabolites, homocysteine and S-adenosylhomocysteine. These changes, in turn,result in serious functional consequences which include decreases in essential methylation reactions via inhibition of various methyltransferases. Of particular interest to our laboratory is the inhibition of three important enzymes, phosphatidylethanolamine methyltransferase,isoprenylcysteine carboxyl methyltransferase and protein L-isoaspartate methyltransferase. Decreased activity of these enzymes results in increased fat deposition, increased apoptosis and increased accumulation of damaged proteinsall of which are hallmark features of alcoholic liver injury.Of all the therapeutic modalities available, betaine has been shown to be the safest, least expensive and most effective in attenuating ethanol-induced liver injury. Betaine, by virtue of aiding in the remethylation of homocysteine,removes both toxic metabolites (homocysteine and S-adenosylhomocysteine), restores S-adenosylmethionine level, and reverses steatosis, apoptosis and damaged proteins accumulation. In conclusion, betaine appears to be a promising therapeutic agent in relieving the methylation and other defects associated with alcoholic abuse.

  11. Effect of fluid velocity, temperature, and concentration of non-ionic surfactants on drag reduction

    International Nuclear Information System (INIS)

    The drag reduction (DR) and heat transfer efficiency reduction (ER) of non-ionic surfactant as a function of fluid velocity, temperature, and surfactant concentration were investigated. Several types of new surfactants, which contain amine-oxide and betaine, were developed. An experimental apparatus consisting of two temperature controlled water storage tanks, pumps, test specimen pipe and the piping network, two flow meters, two pressure gauges, a heat exchanger, and data logging system was built. From the experimental results, it was concluded that existing alkyl ammonium surfactant (CTAC; cethyl trimethyl ammonium chloride) had DR of 0.6-0.8 at 1000-2000 ppm concentration with fluid temperature ranging between 50 and 60 oC. However, the DR was very low when the fluid temperature was 70-80 oC. The new amine oxide and betaine surfactant (SAOB; stearyl amine oxide + betaine) had lower DR at fluid temperatures ranging between 50 and 60 oC compared with CTAC. However, with fluid temperature ranging between 70 and 80 oC the DR was 0.6-0.8 when the concentration level was between 1000 and 2000 ppm

  12. Inhibition of insulin fibrillation by osmolytes: Mechanistic Insights

    Science.gov (United States)

    Choudhary, Sinjan; Kishore, Nand; Hosur, Ramakrishna V.

    2015-11-01

    We have studied here using a number of biophysical tools the effects of osmolytes, betaine, citrulline, proline and sorbitol which differ significantly in terms of their physical characteristics such as, charge distribution, polarity, H-bonding abilities etc, on the fibrillation of insulin. Among these, betaine, citrulline, and proline are very effective in decreasing the extent of fibrillation. Proline also causes a substantial delay in the onset of fibrillation in the concentration range (50-250 mM) whereas such an effect is seen for citrulline only at 250 mM, and in case of betaine this effect is not seen at all in the whole concentration range. The enthalpies of interaction at various stages of fibrillation process have suggested that the preferential exclusion of the osmolyte and its polar interaction with the protein are important in inhibition. The results indicate that the osmolytes are most effective when added prior to the elongation stage of fibrillation. These observations have significant biological implications, since insulin fibrillation is known to cause injection amyloidosis and our data may help in designing lead drug molecules and development of potential therapeutic strategies.

  13. Nvar-epsilon-acetyl-β-lysine: An osmolyte synthesized by mothanogenic archaebacteria

    International Nuclear Information System (INIS)

    Methanosarcina thermophila, a nonmarine methanogenic archaebacterium, can grow in a range of saline concentrations. At less than 0.4 M NaCl, Ms. thermophila accumulated glutamate in response to increasing osmotic stress. At greater than 0.4 M NaCl, this organism synthesized a modified β-amino acid that was identified as Nvar-epsilon-acetyl-β-lysine by NMR spectroscopy and ion-exchange HPLC. This β-amino acid derivative accumulated to high intracellular concentrations (up to 0.6 M) in Ms. thermophila and in another methanogen examined - Methanogenium cariaci, a marine species. The compound has features that are characteristic of a compatible solute: it is neutrally charged at physiological pH and it is highly soluble. When the cells were grown in the presence of exogenous glycine betaine, a physiological pH and it is highly soluble. When the cells were grown in the presence of exogenous glycine betaine, a physiological compatible solute, Nvar-epsilon-acetyl-β-lysine synthesis was repressed and glycine betaine was accumulated. Nvar-epsilon-Acetyl-β-lysine was synthesized by species from three phylogenetic families when grown in high solute concentrations, suggesting that it may be ubiquitous among the methanogens. The ability to control the biosynthesis of Nvar-epsilon-acetyl-β-lysine in response to extracellular solute concentration indicates that the methanogenic archaebacteria have a unique β-amino acid biosynthetic pathway that is osmotically regulated

  14. Investigating multiple candidate genes and nutrients in the folate metabolism pathway to detect genetic and nutritional risk factors for lung cancer.

    Directory of Open Access Journals (Sweden)

    Michael D Swartz

    Full Text Available PURPOSE: Folate metabolism, with its importance to DNA repair, provides a promising region for genetic investigation of lung cancer risk. This project investigates genes (MTHFR, MTR, MTRR, CBS, SHMT1, TYMS, folate metabolism related nutrients (B vitamins, methionine, choline, and betaine and their gene-nutrient interactions. METHODS: We analyzed 115 tag single nucleotide polymorphisms (SNPs and 15 nutrients from 1239 and 1692 non-Hispanic white, histologically-confirmed lung cancer cases and controls, respectively, using stochastic search variable selection (a Bayesian model averaging approach. Analyses were stratified by current, former, and never smoking status. RESULTS: Rs6893114 in MTRR (odds ratio [OR] = 2.10; 95% credible interval [CI]: 1.20-3.48 and alcohol (drinkers vs. non-drinkers, OR = 0.48; 95% CI: 0.26-0.84 were associated with lung cancer risk in current smokers. Rs13170530 in MTRR (OR = 1.70; 95% CI: 1.10-2.87 and two SNP*nutrient interactions [betaine*rs2658161 (OR = 0.42; 95% CI: 0.19-0.88 and betaine*rs16948305 (OR = 0.54; 95% CI: 0.30-0.91] were associated with lung cancer risk in former smokers. SNPs in MTRR (rs13162612; OR = 0.25; 95% CI: 0.11-0.58; rs10512948; OR = 0.61; 95% CI: 0.41-0.90; rs2924471; OR = 3.31; 95% CI: 1.66-6.59, and MTHFR (rs9651118; OR = 0.63; 95% CI: 0.43-0.95 and three SNP*nutrient interactions (choline*rs10475407; OR = 1.62; 95% CI: 1.11-2.42; choline*rs11134290; OR = 0.51; 95% CI: 0.27-0.92; and riboflavin*rs8767412; OR = 0.40; 95% CI: 0.15-0.95 were associated with lung cancer risk in never smokers. CONCLUSIONS: This study identified possible nutrient and genetic factors related to folate metabolism associated with lung cancer risk, which could potentially lead to nutritional interventions tailored by smoking status to reduce lung cancer risk.

  15. The Influence of Osmolytes on the Antimicrobial Activity of Silver Nanoparticles

    Science.gov (United States)

    Reed-Jones, Neiunna L.

    Silver nanoparticles (Ag-NPs) are gaining popularity as antimicrobial agents due to their broad- spectrum activity and lower propensity to develop resistance in bacteria. However, with increased frequency of use, there remains a possibility for bacteria to develop resistance or adaptive mechanisms against Ag-NPs overtime. Mechanisms used by bacteria to resist antimicrobial agents include efflux pumps, heat shock proteins (Hsp) and accumulation of compatible solutes, generally referred to as osmolytes. The latter mechanism is typically employed when bacteria are under osmotic stress they accumulate osmolytes either through de novo synthesis or exogenously. Osmolytes act to stabilize the bacterial cell membrane by maintaining the native protein structure, while at the same time, ensuring compatibility with other cellular structures and functions. The most common osmolytes accumulated by bacteria are glycine betaine, proline, carnitine, choline, trehalose and glutamate. Since Ag-NPs target the cell membrane it is conceivable that osmolytes may suppress its bactericidal activity. In the present study, we assess the antimicrobial efficacy of Ag-NPs in the presence of glycine betaine and proline. Exponential phase cultures (106 cfu/ml) of Escherichia coli O157:H7, Listeria monocytogenes, Pseudomonas aeruginosa and Staphylococcus aureus were exposed to a predetermined the minimum inhibitory concentration (MIC) of 0.4 mM of citrate-stabilized Ag-NPs and incubated at 37°C for 48 h. This was replicated with the addition of 1 mM of either glycine betaine or proline. Growth was monitored by optical density, standard plate count, resazurin assay and LIVE/DEAD analyses. The result showed that Ag-NPs had no detectable effect on osmolyte treated cells. The average plate count of cultures supplemented with either glycine betaine or proline ranged from 108 to 109 cfu/ml after 48 h. Resazurin assay also showed that there was a significant increase in the cells supplemented with

  16. Plasma 1-carbon metabolites and academic achievement in 15-yr-old adolescents.

    Science.gov (United States)

    Nilsson, Torbjörn K; Hurtig-Wennlöf, Anita; Sjöström, Michael; Herrmann, Wolfgang; Obeid, Rima; Owen, Jennifer R; Zeisel, Steven

    2016-04-01

    Academic achievement in adolescents is correlated with 1-carbon metabolism (1-CM), as folate intake is positively related and total plasma homocysteine (tHcy) negatively related to academic success. Because another 1-CM nutrient, choline is essential for fetal neurocognitive development, we hypothesized that choline and betaine could also be positively related to academic achievement in adolescents. In a sample of 15-yr-old children (n= 324), we measured plasma concentrations of homocysteine, choline, and betaine and genotyped them for 2 polymorphisms with effects on 1-CM, methylenetetrahydrofolate reductase (MTHFR) 677C>T, rs1801133, and phosphatidylethanolamineN-methyltransferase (PEMT), rs12325817 (G>C). The sum of school grades in 17 major subjects was used as an outcome measure for academic achievement. Lifestyle and family socioeconomic status (SES) data were obtained from questionnaires. Plasma choline was significantly and positively associated with academic achievement independent of SES factors (paternal education and income, maternal education and income, smoking, school) and of folate intake (P= 0.009,R(2)= 0.285). With the addition of thePEMTrs12325817 polymorphism, the association value was only marginally changed. Plasma betaine concentration, tHcy, and theMTHFR677C>T polymorphism did not affect academic achievement in any tested model involving choline. Dietary intake of choline is marginal in many adolescents and may be a public health concern.-Nilsson, T. K., Hurtig-Wennlöf, A., Sjöström, M., Herrmann, W., Obeid, R., Owen, J. R., Zeisel, S. Plasma 1-carbon metabolites and academic achievement in 15-yr-old adolescents. PMID:26728177

  17. Maternal obesity disrupts the methionine cycle in baboon pregnancy.

    Science.gov (United States)

    Nathanielsz, Peter W; Yan, Jian; Green, Ralph; Nijland, Mark; Miller, Joshua W; Wu, Guoyao; McDonald, Thomas J; Caudill, Marie A

    2015-11-01

    Maternal intake of dietary methyl-micronutrients (e.g. folate, choline, betaine and vitamin B-12) during pregnancy is essential for normal maternal and fetal methionine metabolism, and is critical for important metabolic processes including those involved in developmental programming. Maternal obesity and nutrient excess during pregnancy influence developmental programming potentially predisposing adult offspring to a variety of chronic health problems. In the present study, we hypothesized that maternal obesity would dysregulate the maternal and fetal methionine cycle. To test this hypothesis, we developed a nulliparous baboon obesity model fed a high fat, high energy diet (HF-HED) prior to and during gestation, and examined methionine cycle biomarkers (e.g., circulating concentrations of homocysteine, methionine, choline, betaine, key amino acids, folate, and vitamin B-12). Animals were group housed allowing full physical activity and social interaction. Maternal prepregnancy percent body fat was 5% in controls and 19% in HF-HED mothers, while fetal weight was 16% lower in offspring of HF-HED mothers at term. Maternal and fetal homocysteine were higher, while maternal and fetal vitamin B-12 and betaine were lower in the HF-HED group. Elevations in circulating maternal folate were evident in the HF-HED group indicating impaired folate metabolism (methyl-trap) as a consequence of maternal vitamin B-12 depletion. Finally, fetal methionine, glycine, serine, and taurine were lower in the HF-HED fetuses. These data show that maternal obesity disturbs the methionine cycle in primate pregnancy, providing a mechanism for the epigenetic changes observed among obese pregnant women and suggesting diagnostic and therapeutic opportunities in human pregnancies complicated by obesity. PMID:26537341

  18. Reply to 'Some More Comments on Folate Deficiency in Chronic Pancreatitis'

    Directory of Open Access Journals (Sweden)

    Joan M Braganza

    2010-12-01

    Full Text Available Dear Sir, Dr Wagner’s erudite comments in the present issue of JOP. J Pancreas (Online [1] further illuminate the complex interactions between micronutrient deficiency, electrophilic stress, and disrupted methionine homeostasis, that together seem to precipitate chronic pancreatitis by impairing the exocytosis of zymogen granules from pancreatic acinar cells [2, 3]. Dr Wagner’s studies and arguments [1] underline the essentiality of methyl moieties for exocytosis. They act directly (by carboxymethylating small G proteins in the apical membrane, and indirectly by incorporation into phosphatidylcholine for granule membrane-apical membrane fusion during the exocytosis process. Dietary methionine is the main source of methyl groups, delivered via its first metabolite Sadenosylmethionine (SAM. Dietary folic acid - in concert with vitamin B12 and ascorbic acid (bioactive fraction of vitamin C - facilitates methionine regeneration from homocysteine. Dietary betaine and choline provide pre-formed methyl groups. The ancillary methyl sources (folic acid, betaine, choline could determine whether or not exocytosis can proceed when methionine intake falls short of need, as it does (along with insufficiency of vitamin C in chronic pancreatitis wherein demand increases due to cytochrome P450 induction [4], with increased release of reactive oxygen and xenobiotic species [2]. The vulnerability to the ensuing electrophilic stress of enzymes such as that which catalyses the conversion of methionine to SAM [5] rationalizes both the surge in circulating level of methionine and SAM in an acute exacerbation of chronic pancreatitis [6, 7], and evidence that the methionine metabolic pathway remains fractured thereafter [8]. A supplement of methionine (or SAM plus vitamin C curbs attacks, and additional choline (theoretically betaine alternatively [1] is helpful when treatment fails [2]. All these observations indicate the clinical relevance of methionine plus

  19. Pertinent plasma indicators of the ability of chickens to synthesize and store lipids.

    Science.gov (United States)

    Baéza, E; Jégou, M; Gondret, F; Lalande-Martin, J; Tea, I; Le Bihan-Duval, E; Berri, C; Collin, A; Métayer-Coustard, S; Louveau, I; Lagarrigue, S; Duclos, M J

    2015-01-01

    Excessive deposition of body fat is detrimental to production efficiency. The aim of this study was to provide plasma indicators of chickens' ability to store fat. From 3 to 9 wk of age, chickens from 2 experimental lines exhibiting a 2.5-fold difference in abdominal fat content and fed experimental diets with contrasted feed energy sources were compared. The diets contained 80 vs. 20 g of lipids and 379 vs. 514 g of starch per kg of feed, respectively, but had the same ME and total protein contents. Cellulose was used to dilute energy in the high-fat diet. At 9 wk of age, the body composition was analyzed and blood samples were collected. A metabolome-wide approach based on proton nuclear magnetic resonance spectroscopy was associated with conventional measurements of plasma parameters. A metabolomics approach showed that betaine, glutamine, and histidine were the most discriminating metabolites between groups. Betaine, uric acid, triglycerides, and phospholipids were positively correlated (r > 0.3; P glutamine, histidine, triiodothyronine, homocysteine, and β-hydroxybutyrate were negatively correlated (r glutamine, and methionine levels accounted for 74% of the variability of the relative weight of abdominal fat. On the other hand, the combination of plasma triglyceride and homocysteine levels accounted for 37% of the variability of fat situated at the top of external face of the thigh. The variations in plasma levels of betaine, homocysteine, uric acid, glutamine, and histidine suggest the implication of methyl donors in the control of hepatic lipid synthesis and illustrate the interplay between AA, glucose, and lipid metabolisms in growing chickens. PMID:25568361

  20. The Reactivity of 2,4,6-Tirphenylpyridinium Ylids

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    Triphenylpyridinium ylid 2, generated by the decarboxylation of betaine 1, were noted to react with acetyl chloride, chloroform or acetone to form addition-elimination product and proton extraction - carbanion addition products, respectively. The reaction with chloroform was determined as pseudo first order from kinetic experiments. The values of kobsd and t1/2 for decarboxylation at 20, 40 and 50°C were calculated to be 4.6 x 10-4, 8.8 x 10-3, 2.8 x 10-2 min-1 and 1.5 x 103, 78, 24 minutes, respectively.

  1. Analysis of the role of OpuC, an osmolyte transport system, in salt tolerance and virulence potential of Listeria monocytogenes

    OpenAIRE

    Sleator, R.D.; Wouters, J.; Gahan, C.G.M.; Abee, T; Hill, C.

    2001-01-01

    The success of Listeria monocytogenes as a food-borne pathogen owes much to its ability to survive a variety of stresses, both in the external environment prior to ingestion and subsequently within the animal host. Growth at high salt concentrations and low temperatures is attributed mainly to the accumulation of organic solutes such as glycine betaine and carnitine. We utilized a novel system for generating chromosomal mutations (based on a lactococcal pWVO1-derived Ori+ RepA− vector, pORI19...

  2. Multiple deletions of the osmolyte transporters BetL, Gbu, and OpuC of Listeria monocytogenes affect virulence and growth at high osmolarity

    OpenAIRE

    Wemekamp-Kamphuis, H.H.; Wouters, J.A.; Sleator, R.D.; Gahan, C.G.M.; Hill, C.; Abee, T

    2002-01-01

    The success of Listeria monocytogenes as a food-borne pathogen owes much to its ability to survive a variety of stresses, both in the food environment and, after ingestion, within the animal host. Growth at high salt concentrations is attributed mainly to the accumulation of organic solutes such as glycine betaine and carnitine. We characterized L. monocytogenes LO28 strains with single, double, and triple deletions in the osmolyte transport systems BetL, Gbu, and OpuC. When single deletion m...

  3. Osmoregulation Mechanism of Drought Stress and Genetic Engineering Strategies for Improving Drought Resistance in Plants

    Institute of Scientific and Technical Information of China (English)

    Du Jinyou; Chen Xiaoyang; Li Wei; Gao Qiong

    2004-01-01

    Drought, one of the main adverse environmental factors, obviously affected plant growth and development. Many adaptive strategies have been developed in plants for coping with drought or water stress, among which osmoregulation is one of the important factors of plant drought tolerance. Many substances play important roles in plant osmoregulation for drought resistance, including proline, glycine betaine, Lea proteins and soluble sugars such as levan, trehalose, sucrose, etc. The osmoregulation mechanism and the genetic engineering of plant drought-tolerance are reviewed in this paper.

  4. Methanogenesis from Methylated Amines in a Hypersaline Algal Mat †

    OpenAIRE

    King, Gary M.

    1988-01-01

    Methane ebullition and high rates of methane production were observed in sediments of a hypersaline pond (180‰) which contained sulfate in excess of 100 mM. The highest rates of methane production were observed in surface sediments associated with an algal mat dominated by a Spirulina sp. The mat contained a methylated amine, glycine betaine (GBT), at levels which accounted for up to 20% of the total mat nitrogen. GBT was apparently the source of trimethylamine (TMA), which was also present i...

  5. Slow desiccation improves dehydration tolerance and accumulation of compatible osmolytes in earthworm cocoons (Dendrobaena octaedra Savigny)

    DEFF Research Database (Denmark)

    Petersen, Christina Rask; Holmstrup, Martin; Malmendal, Anders;

    2008-01-01

    clearly demonstrate that gradually dehydrated cocoons show an increased tolerance of extreme drought compared with acutely dehydrated cocoons. NMR spectroscopic analysis of compatible osmolytes revealed the presence of sorbitol, glucose, betaine, alanine and mannitol in dehydrated embryos. The superior...... accumulation, the gradually desiccated cocoons also tolerated a higher degree of water loss, demonstrating that gradually dehydrated D. octaedra cocoons are able to survive loss of approximately 95% of the original water content. Although D. octaedra embryos can probably not be categorized as a truly...

  6. Povećanje proizvodnje metabolita vitamina K2 dodatkom surfaktanta pri uzgoju mutanta bakterije Escherichia sp. FM3-1709 na tresilici

    OpenAIRE

    Yan LIU; Zheng, Zhi-Ming; Qiu, Hong-Wei; Zhao, Gen-Hai; WANG, PENG; Liu, Hui; Wang, Li; Li, Zhe-Min; Wu, He-Fang; Liu, Hong-Xia; Tan, Mu

    2014-01-01

    Ispitan je utjecaj dodatka različitih surfaktanata na rast stanica i proizvodnju metabolita vitamina K2, poput unutarstaničnih i izvanstaničnih menakinona MK-4 i MK-6, pri submerznom uzgoju bakterije Escherichia sp. Svi su surfaktanti produljili eksponencijalnu fazu rasta bakterije. Betain, polioksietilen oleil eter i Tween-80 povoljno su djelovali na rast stanica mutanta bakterije Escherichia sp. FM3-1709. Najveći je rast stanica bio Xmax=(12,6±0,2) g/L, najveća stopa proizvodnje biomase ...

  7. Limit theorems for one and two-dimensional random walks in random scenery

    CERN Document Server

    Castell, Fabienne; Pène, Françoise

    2011-01-01

    Random walks in random scenery are processes defined by $Z_n:=\\sum_{k=1}^n\\xi_{X_1+...+X_k}$, where $(X_k,k\\ge 1)$ and $(\\xi_y,y\\in{\\mathbb Z}^d)$ are two independent sequences of i.i.d. random variables with values in ${\\mathbb Z}^d$ and $\\mathbb R$ respectively. We suppose that the distributions of $X_1$ and $\\xi_0$ belong to the normal basin of attraction of stable distribution of index $\\alpha\\in(0,2]$ and $\\beta\\in(0,2]$. When $d=1$ and $\\alpha\

  8. A local limit theorem for random walks in random scenery and on randomly oriented lattices

    CERN Document Server

    Castell, Fabienne; Pène, Françoise; Schapira, Bruno

    2010-01-01

    Random walks in random scenery are processes defined by $Z_n:=\\sum_{k=1}^n\\xi_{X_1+...+X_k}$, where $(X_k,k\\ge 1)$ and $(\\xi_y,y\\in\\mathbb Z)$ are two independent sequences of i.i.d. random variables. We assume here that their distributions belong to the normal domain of attraction of stable laws with index $\\alpha\\in (0,2]$ and $\\beta\\in (0,2]$ respectively. These processes were first studied by H. Kesten and F. Spitzer, who proved the convergence in distribution when $\\alpha\

  9. Osmotically Regulated Transport of Proline by Lactobacillus acidophilus IFO 3532

    OpenAIRE

    Jewell, J. B.; Kashket, E R

    1991-01-01

    We reported previously that, when exposed to high osmotic pressure, Lactobacillus acidophilus IFO 3532 cells accumulated N,N,N-trimethylglycine (glycine betaine), which serves as a compatible intracellular solute. When grown in medium with high osmotic pressure, these cells also accumulated one amino acid, proline. The uptake of [3H]proline by resting, glucose-energized cells was stimulated by increasing the osmotic pressure of the assay medium with 0.5 to 1.0 M KCl, 1.0 M NaCl, or 0.5 M sucr...

  10. Metal-mediated aminocatalysis provides mild conditions: Enantioselective Michael addition mediated by primary amino catalysts and alkali-metal ions

    Directory of Open Access Journals (Sweden)

    Matthias Leven

    2013-01-01

    Full Text Available Four catalysts based on new amides of chiral 1,2-diamines and 2-sulfobenzoic acid have been developed. The alkali-metal salts of these betaine-like amides are able to form imines with enones, which are activated by Lewis acid interaction for nucleophilic attack by 4-hydroxycoumarin. The addition of 4-hydroxycoumarin to enones gives ee’s up to 83% and almost quantitative yields in many cases. This novel type of catalysis provides an effective alternative to conventional primary amino catalysis were strong acid additives are essential components.

  11. Methylmalonic aciduria with homocystinuria: biochemical studies, treatment, and clinical course of a Cbl-C patient.

    Science.gov (United States)

    Ribes, A; Briones, P; Vilaseca, M A; Lluch, M; Rodes, M; Maya, A; Campistol, J; Pascual, P; Suormala, T; Baumgartner, R

    1990-03-01

    A patient with infantile onset methylmalonic aciduria and homocystinuria (Cbl-C mutant) is described. Therapy with hydroxycobalamin, folate and vitamin B6 improved his condition. As hypomethioninaemia and homocystinaemia persisted, he was treated with intramuscular methylcobalamin, but without success. Treatment with betaine started at 25 months of age, normalized plasma methionine and elicited disappearance of homocystinaemia. Results of biochemical studies in cultured fibroblasts paralleled those described for other Cbl-C patients except that methylmalonyl-coenzyme A mutase activity in disrupted fibroblasts was in the normal range. PMID:2332011

  12. Identification of feeding stimulants for shrimp%摄食促进剂对对虾生长的影响

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Two experiments were conducted to screen 5'-inosine- monophosphate,betaine,fish hydrolysate,TMA-O and DMPT as feeding stimulants for shrimp.Feeding stimulants carrier was non-attractive diet.The first experiment was conducted to observe the attractant response.The maximum attractant response was attained when the diet contained DMPT.The second experiment was to observe the effect of attractant on growth and FCR of shrimp.The maximum weight gain rate and the minimum FCR was attained when the diet contained DMPT.

  13. Integrating existing cone-shaped and projection-based cardinal direction relations and a TCSP-like decidable generalisation

    OpenAIRE

    Isli, Amar

    2003-01-01

    We consider the integration of existing cone-shaped and projection-based calculi of cardinal direction relations, well-known in QSR. The more general, integrating language we consider is based on convex constraints of the qualitative form $r(x,y)$, $r$ being a cone-shaped or projection-based cardinal direction atomic relation, or of the quantitative form $(\\alpha ,\\beta)(x,y)$, with $\\alpha ,\\beta\\in [0,2\\pi)$ and $(\\beta -\\alpha)\\in [0,\\pi ]$: the meaning of the quantitative constraint, in p...

  14. Effects of a Pre-workout Supplement on Lean Mass, Muscular Performance, Subjective Workout Experience and Biomarkers of Safety

    OpenAIRE

    Kedia, A. William; Hofheins, Jennifer E; Habowski, Scott M; Ferrando, Arny A.; Gothard, M. David; Lopez, Hector L

    2014-01-01

    In this prospective, randomized, double-blind, trial conducted in two parts, we examined the effects of a multi-ingredient pre-exercise workout supplement blend of creatine, betaine and a dendrobium extract (MMP) on safety, performance, and body composition in healthy men and women undergoing a supervised program of resistance exercise. Part 1 was an acute hemodynamic safety study wherein forty young, healthy men and women (26.2 ± 5.3 years, 70.4 ± 3.3 inches, 83.7 ± 14.9 kg, 26.0 ± 3.2 kg●m-...

  15. Distribution of terfenadine and its metabolites in locusts studied by desorption electrospray ionization mass spectrometry imaging

    DEFF Research Database (Denmark)

    Olsen, Line Rørbæk; Hansen, Steen Honoré; Janfelt, Christian

    2015-01-01

    imaging studies on insects, a method for cryosectioning of whole locusts was developed, and the distributions of a number of endogenous compounds are reported, including betaine and a number of amino acids and phospholipids. Terfenadine was detected in the stomach region and the intestine walls, whereas...... three different metabolites—terfenadine acid (fexofenadine), terfenadine glucoside, and terfenadine phosphate—were detected in significantly smaller amounts and only in the unexcreted feces in the lower part of the intestine. The use of MS/MS imaging was necessary in order to detect the metabolites...

  16. Task-specific ionic liquid for solubilizing metal oxides

    OpenAIRE

    Nockemann, Peter; Thijs, Ben; Pittois, Stijn; Thoen, Jan; Glorieux, Christ; Van Hecke, Kristof; Van Meervelt, Luc; Kirchner, Barbara; Binnemans, Koen

    2006-01-01

    Protonated betaine bis(trifluoromethylsulfonyl) imide is an ionic liquid with the ability to dissolve large quantities of metal oxides. This metal-solubilizing power is selective. Soluble are oxides of the trivalent rare earths, uranium(VI) oxide, zinc(II) oxide, cadmium(II) oxide, mercury(II) oxide, nickel( II) oxide, copper(II) oxide, palladium(II) oxide, lead(II) oxide, manganese(II) oxide, and silver(I) oxide. Insoluble or very poorly soluble are iron(III), manganese(IV), and cobalt oxide...

  17. A Protein Extract from Chicken Reduces Plasma Homocysteine in Rats

    Science.gov (United States)

    Lysne, Vegard; Bjørndal, Bodil; Vik, Rita; Nordrehaug, Jan Erik; Skorve, Jon; Nygård, Ottar; Berge, Rolf K.

    2015-01-01

    The present study aimed to evaluate effects of a water-soluble protein fraction of chicken (CP), with a low methionine/glycine ratio, on plasma homocysteine and metabolites related to homocysteine metabolism. Male Wistar rats were fed either a control diet with 20% w/w casein as the protein source, or an experimental diet where 6, 14 or 20% w/w of the casein was replaced with the same amount of CP for four weeks. Rats fed CP had reduced plasma total homocysteine level and markedly increased levels of the choline pathway metabolites betaine, dimethylglycine, sarcosine, glycine and serine, as well as the transsulfuration pathway metabolites cystathionine and cysteine. Hepatic mRNA level of enzymes involved in homocysteine remethylation, methionine synthase and betaine-homocysteine S-methyltransferase, were unchanged, whereas cystathionine gamma-lyase of the transsulfuration pathway was increased in the CP treated rats. Plasma concentrations of vitamin B2, folate, cobalamin, and the B-6 catabolite pyridoxic acid were increased in the 20% CP-treated rats. In conclusion, the CP diet was associated with lower plasma homocysteine concentration and higher levels of serine, choline oxidation and transsulfuration metabolites compared to a casein diet. The status of related B-vitamins was also affected by CP. PMID:26053618

  18. Response of Osmotic Adjustment of Lactobacillus bulgaricus to NaCl Stress

    Institute of Scientific and Technical Information of China (English)

    Li Chun; Liu Li-bo; Sun Di; Chen Jing; Liu Ning

    2012-01-01

    Growth and osmotic response of Lactobacillus bulgaricus ATCC 11842 under hyperosmotic constraint were investigated in a chemically defined medium (CDM) and MRS medium. NaCl could inhibit the growth of L. bulgaricus which decreased with increasing NaCl concentration. In the MRS, NaCl of 1.0 mol·L-1 was the biggest salt stress concentration; in the CDM, 0.8 mol·L-1 was the biggest inhibition concentration. In contrast to what was observed in other lactic acid bacteria, proline, glycine betaine and related molecules were unable to relieve inhibition of growth of L. bulgaricus under osmotic constraint. This was correlated to the absence of sequences homologous to the genes coding for glycine-betaine and/or proline transporters described in Lactococcus lactis and Bacillus subtilis. The amino acid aspartate and alanine were proved to be osmoprotective under NaCl stress. Addition of peptone (0.25% w/v) in the presence of salt led to a stimulation of the growth, as the decrease of the lag time and generation time, and the final biomass increased from 0.31 to 0.64.

  19. Functional Genomics of Novel Secondary Metabolites from Diverse Cyanobacteria Using Untargeted Metabolomics

    Directory of Open Access Journals (Sweden)

    Muriel Gugger

    2013-09-01

    Full Text Available Mass spectrometry-based metabolomics has become a powerful tool for the detection of metabolites in complex biological systems and for the identification of novel metabolites. We previously identified a number of unexpected metabolites in the cyanobacterium Synechococcus sp. PCC 7002, such as histidine betaine, its derivatives and several unusual oligosaccharides. To test for the presence of these compounds and to assess the diversity of small polar metabolites in other cyanobacteria, we profiled cell extracts of nine strains representing much of the morphological and evolutionary diversification of this phylum. Spectral features in raw metabolite profiles obtained by normal phase liquid chromatography coupled to mass spectrometry (MS were manually curated so that chemical formulae of metabolites could be assigned. For putative identification, retention times and MS/MS spectra were cross-referenced with those of standards or available sprectral library records. Overall, we detected 264 distinct metabolites. These included indeed different betaines, oligosaccharides as well as additional unidentified metabolites with chemical formulae not present in databases of metabolism. Some of these metabolites were detected only in a single strain, but some were present in more than one. Genomic interrogation of the strains revealed that generally, presence of a given metabolite corresponded well with the presence of its biosynthetic genes, if known. Our results show the potential of combining metabolite profiling and genomics for the identification of novel biosynthetic genes.

  20. Characterization of Cichopeptins, New Phytotoxic Cyclic Lipodepsipeptides Produced by Pseudomonas cichorii SF1-54 and Their Role in Bacterial Midrib Rot Disease of Lettuce.

    Science.gov (United States)

    Huang, Chien-Jui; Pauwelyn, Ellen; Ongena, Marc; Debois, Delphine; Leclère, Valerie; Jacques, Philippe; Bleyaert, Peter; Höfte, Monica

    2015-09-01

    The lettuce midrib rot pathogen Pseudomonas cichorii SF1-54 produces seven bioactive compounds with biosurfactant properties. Two compounds exhibited necrosis-inducing activity on chicory leaves. The structure of the two phytotoxic compounds, named cichopeptin A and B, was tentatively characterized. They are related cyclic lipopeptides composed of an unsaturated C12-fatty acid chain linked to the N-terminus of a 22-amino acid peptide moiety. Cichopeptin B differs from cichopeptin A only in the last C-terminal amino acid residue, which is probably Val instead of Leu/Ile. Based on peptide sequence similarity, cichopeptins are new cyclic lipopeptides related to corpeptin, produced by the tomato pathogen Pseudomonas corrugata. Production of cichopeptin is stimulated by glycine betaine but not by choline, an upstream precursor of glycine betaine. Furthermore, a gene cluster encoding cichopeptin synthethases, cipABCDEF, is responsible for cichopeptin biosynthesis. A cipA-deletion mutant exhibited significantly less virulence and rotten midribs than the parental strain upon spray inoculation on lettuce. However, the parental and mutant strains multiplied in lettuce leaves at a similar rate. These results demonstrate that cichopeptins contribute to virulence of P. cichorii SF1-54 on lettuce. PMID:25961750

  1. 枸杞活性成分提取分离方法研究进展%Progress on Active Constituents in Fruit of Lycium Barbarum L.

    Institute of Scientific and Technical Information of China (English)

    周艳华; 李涛; 覃世民; 胡元斌

    2014-01-01

    Lycium barbarum L. has very high nutritional value and medicinal health benefits. It is an important economic plant and medicine&food. Its main chemical composition and function of factor is lycium barbarum polysaccharides (LBP), carotenoids, and betaine. LBP was reported in many papers at home and abroad, but few studies on betaine and carotenoids. The nature, extraction, separation and purification of Lycium barbarum L were summarized in this paper which designed to provide the scientific reference for the comprehensive development and utilization of Lycium barbarum L.%枸杞具有极高的营养价值和药用保健功效,是我国重要的经济植物及药食兼用的佳品,其主要活性成分为枸杞多糖、类胡萝卜素、甜菜碱等。目前国内外有关枸杞多糖的研究报道较多,但有关甜菜碱和类胡萝卜素的研究较少。本文主要对枸杞中的枸杞多糖、类胡萝卜素和甜菜碱的性质、提取、分离纯化等方面进行了概述,旨在为枸杞的综合开发利用提供科学的参考。

  2. Induction of Osmoregulation and Modulation of Salt Stress in Acacia gerrardii Benth. by Arbuscular Mycorrhizal Fungi and Bacillus subtilis (BERA 71).

    Science.gov (United States)

    Hashem, Abeer; Abd Allah, E F; Alqarawi, A A; Al-Huqail, A A; Shah, M A

    2016-01-01

    The role of soil microbiota in plant stress management, though speculated a lot, is still far from being completely understood. We conducted a greenhouse experiment to examine synergistic impact of plant growth promoting rhizobacterium, Bacillus subtilis (BERA 71), and arbuscular mycorrhizal fungi (AMF) (Claroideoglomus etunicatum; Rhizophagus intraradices; and Funneliformis mosseae) to induce acquired systemic resistance in Talh tree (Acacia gerrardii Benth.) against adverse impact of salt stress. Compared to the control, the BERA 71 treatment significantly enhanced root colonization intensity by AMF, in both presence and absence of salt. We also found positive synergistic interaction between B. subtilis and AMF vis-a-vis improvement in the nutritional value in terms of increase in total lipids, phenols, and fiber content. The AMF and BERA 71 inoculated plants showed increased content of osmoprotectants such as glycine, betaine, and proline, though lipid peroxidation was reduced probably as a mechanism of salt tolerance. Furthermore, the application of bioinoculants to Talh tree turned out to be potentially beneficial in ameliorating the deleterious impact of salinity on plant metabolism, probably by modulating the osmoregulatory system (glycine betaine, proline, and phenols) and antioxidant enzymes system (SOD, CAT, POD, GR, APX, DHAR, MDAHR, and GSNOR). PMID:27597969

  3. Induction of Osmoregulation and Modulation of Salt Stress in Acacia gerrardii Benth. by Arbuscular Mycorrhizal Fungi and Bacillus subtilis (BERA 71

    Directory of Open Access Journals (Sweden)

    Abeer Hashem

    2016-01-01

    Full Text Available The role of soil microbiota in plant stress management, though speculated a lot, is still far from being completely understood. We conducted a greenhouse experiment to examine synergistic impact of plant growth promoting rhizobacterium, Bacillus subtilis (BERA 71, and arbuscular mycorrhizal fungi (AMF (Claroideoglomus etunicatum; Rhizophagus intraradices; and Funneliformis mosseae to induce acquired systemic resistance in Talh tree (Acacia gerrardii Benth. against adverse impact of salt stress. Compared to the control, the BERA 71 treatment significantly enhanced root colonization intensity by AMF, in both presence and absence of salt. We also found positive synergistic interaction between B. subtilis and AMF vis-a-vis improvement in the nutritional value in terms of increase in total lipids, phenols, and fiber content. The AMF and BERA 71 inoculated plants showed increased content of osmoprotectants such as glycine, betaine, and proline, though lipid peroxidation was reduced probably as a mechanism of salt tolerance. Furthermore, the application of bioinoculants to Talh tree turned out to be potentially beneficial in ameliorating the deleterious impact of salinity on plant metabolism, probably by modulating the osmoregulatory system (glycine betaine, proline, and phenols and antioxidant enzymes system (SOD, CAT, POD, GR, APX, DHAR, MDAHR, and GSNOR.

  4. Synthesis of [methyl-{sup 14}C]crotonobetaine from DL-[methyl-{sup 14}C]carnitine

    Energy Technology Data Exchange (ETDEWEB)

    Loester, H.; Seim, H. [Leipzig Univ. (Germany). Inst. of Clinical Chemistry and Pathobiochemistry

    1996-02-01

    The causes of carnitine deficiency syndromes are not completely understood, but decomposition of L-carnitine in vivo is likely to be involved. Carnitine is metabolized to {gamma}-butyrobetaine, and crotonobetaine is probably an intermediate in this pathway. To validate experimentally the precursor-product relationship between the three physiologically occuring {gamma}-betaines - L-carnitine, crotonobetaine, {gamma}-butyrobetaine - labelling with stable or radioactive isotopes became necessary. Methyl-labelled carnitine isomers (L(-)-, D(+)- or DL-) or {gamma}-butyrobetaine can be easily synthesized by methylation of 4-amino-3-hydroxybutyric acid isomers or 4-aminobutyric acid, respectively. Because of problems with the 4-aminocrotonic acid, we synthesized labelled crotonbetaine from labelled carnitine. Thus, DL-[methyl-{sup 14}C]carnitine was dehydrated by reaction with concentrated sulfuric acid. After removal of the latter the products were separated and purified by ion exchange chromatography on DOWEX 50 WX8 (200 - 400 mesh) and gradient elution with hydrochloric acid. In addition to the labelled main product [methyl-{sup 14}C]crotonobetaine (yield about 50 %), [methyl-{sup 14}C]glycine betaine and [methyl-{sup 14}C]acetonyl-trimethylammonium (ATMA) were formed. The end products were identified by combined thin layer chromatography/autoradiography and quantified by liquid scintillation counting. (Author).

  5. Synthesis of [methyl-14C]crotonobetaine from DL-[methyl-14C]carnitine

    International Nuclear Information System (INIS)

    The causes of carnitine deficiency syndromes are not completely understood, but decomposition of L-carnitine in vivo is likely to be involved. Carnitine is metabolized to γ-butyrobetaine, and crotonobetaine is probably an intermediate in this pathway. To validate experimentally the precursor-product relationship between the three physiologically occuring γ-betaines - L-carnitine, crotonobetaine, γ-butyrobetaine - labelling with stable or radioactive isotopes became necessary. Methyl-labelled carnitine isomers (L(-)-, D(+)- or DL-) or γ-butyrobetaine can be easily synthesized by methylation of 4-amino-3-hydroxybutyric acid isomers or 4-aminobutyric acid, respectively. Because of problems with the 4-aminocrotonic acid, we synthesized labelled crotonbetaine from labelled carnitine. Thus, DL-[methyl-14C]carnitine was dehydrated by reaction with concentrated sulfuric acid. After removal of the latter the products were separated and purified by ion exchange chromatography on DOWEX 50 WX8 (200 - 400 mesh) and gradient elution with hydrochloric acid. In addition to the labelled main product [methyl-14C]crotonobetaine (yield about 50 %), [methyl-14C]glycine betaine and [methyl-14C]acetonyl-trimethylammonium (ATMA) were formed. The end products were identified by combined thin layer chromatography/autoradiography and quantified by liquid scintillation counting. (Author)

  6. Exposure to the proton scavenger glycine under alkaline conditions induces Escherichia coli viability loss.

    Science.gov (United States)

    Vanhauteghem, Donna; Janssens, Geert Paul Jules; Lauwaerts, Angelo; Sys, Stanislas; Boyen, Filip; Cox, Eric; Meyer, Evelyne

    2013-01-01

    Our previous work described a clear loss of Escherichia coli (E. coli) membrane integrity after incubation with glycine or its N-methylated derivatives N-methylglycine (sarcosine) and N,N-dimethylglycine (DMG), but not N,N,N-trimethylglycine (betaine), under alkaline stress conditions. The current study offers a thorough viability analysis, based on a combination of real-time physiological techniques, of E. coli exposed to glycine and its N-methylated derivatives at alkaline pH. Flow cytometry was applied to assess various physiological parameters such as membrane permeability, esterase activity, respiratory activity and membrane potential. ATP and inorganic phosphate concentrations were also determined. Membrane damage was confirmed through the measurement of nucleic acid leakage. Results further showed no loss of esterase or respiratory activity, while an instant and significant decrease in the ATP concentration occurred upon exposure to either glycine, sarcosine or DMG, but not betaine. There was a clear membrane hyperpolarization as well as a significant increase in cellular inorganic phosphate concentration. Based on these results, we suggest that the inability to sustain an adequate level of ATP combined with a decrease in membrane functionality leads to the loss of bacterial viability when exposed to the proton scavengers glycine, sarcosine and DMG at alkaline pH. PMID:23544135

  7. Exposure to the proton scavenger glycine under alkaline conditions induces Escherichia coli viability loss.

    Directory of Open Access Journals (Sweden)

    Donna Vanhauteghem

    Full Text Available Our previous work described a clear loss of Escherichia coli (E. coli membrane integrity after incubation with glycine or its N-methylated derivatives N-methylglycine (sarcosine and N,N-dimethylglycine (DMG, but not N,N,N-trimethylglycine (betaine, under alkaline stress conditions. The current study offers a thorough viability analysis, based on a combination of real-time physiological techniques, of E. coli exposed to glycine and its N-methylated derivatives at alkaline pH. Flow cytometry was applied to assess various physiological parameters such as membrane permeability, esterase activity, respiratory activity and membrane potential. ATP and inorganic phosphate concentrations were also determined. Membrane damage was confirmed through the measurement of nucleic acid leakage. Results further showed no loss of esterase or respiratory activity, while an instant and significant decrease in the ATP concentration occurred upon exposure to either glycine, sarcosine or DMG, but not betaine. There was a clear membrane hyperpolarization as well as a significant increase in cellular inorganic phosphate concentration. Based on these results, we suggest that the inability to sustain an adequate level of ATP combined with a decrease in membrane functionality leads to the loss of bacterial viability when exposed to the proton scavengers glycine, sarcosine and DMG at alkaline pH.

  8. Bacterial biodegradation of melamine-contaminated aged soil: influence of different pre-culture media or addition of activation material.

    Science.gov (United States)

    Hatakeyama, Takashi; Takagi, Kazuhiro

    2016-08-01

    This study aimed to investigate the biodegrading potential of Arthrobacter sp. MCO, Arthrobacter sp. CSP, and Nocardioides sp. ATD6 in melamine-contaminated upland soil (melamine: approx. 10.5 mg/kg dry weight) after 30 days of incubation. The soil sample used in this study had undergone annual treatment of lime nitrogen, which included melamine; it was aged for more than 10 years in field. When R2A broth was used as the pre-culture medium, Arthrobacter sp. MCO could degrade 55 % of melamine after 30 days of incubation, but the other strains could hardly degrade melamine (approximately 25 %). The addition of trimethylglycine (betaine) in soil as an activation material enhanced the degradation rate of melamine by each strain; more than 50 % of melamine was degraded by all strains after 30 days of incubation. In particular, strain MCO could degrade 72 % of melamine. When the strains were pre-cultured in R2A broth containing melamine, the degradation rate of melamine in soil increased remarkably. The highest (72 %) melamine degradation rate was noted when strain MCO was used with betaine addition. PMID:27080407

  9. Early pregnancy B vitamin status, one carbon metabolism, pregnancy outcome and child development.

    Science.gov (United States)

    Solé-Navais, Pol; Cavallé-Busquets, Pere; Fernandez-Ballart, Joan D; Murphy, Michelle M

    2016-07-01

    Periconception supplementation with folic acid is recommended until 12 gestational weeks to prevent neural tube defects. Doses of folic acid contained in supplements and timing and length of use during pregnancy vary. The effects of status in periconception and pregnancy folate, cobalamin, betaine and their interactions on one carbon metabolism (1C), as well as the global effect of 1C on foetal growth and pregnancy outcome, are reviewed. Results from prospective studies are reviewed. Cessation of folic acid supplement use after the first trimester is associated with a sharp drop in plasma folate status and enhanced conversion of betaine to dimethylglycine. Dimethylglycine production is also higher in mothers with low folate status than in those with normal-high folate status. The effects of high doses of folic acid on one carbon metabolism in mothers with low early pregnancy cobalamin status and on foetal growth are also reviewed. Several studies report that moderately elevated early pregnancy fasting plasma total homocysteine (tHcy) is inversely associated with birth weight and a predictor of intrauterine growth retardation. There is also evidence for increased risk of preterm birth when maternal folate status is low. PMID:26700149

  10. A Protein Extract from Chicken Reduces Plasma Homocysteine in Rats

    Directory of Open Access Journals (Sweden)

    Vegard Lysne

    2015-06-01

    Full Text Available The present study aimed to evaluate effects of a water-soluble protein fraction of chicken (CP, with a low methionine/glycine ratio, on plasma homocysteine and metabolites related to homocysteine metabolism. Male Wistar rats were fed either a control diet with 20% w/w casein as the protein source, or an experimental diet where 6, 14 or 20% w/w of the casein was replaced with the same amount of CP for four weeks. Rats fed CP had reduced plasma total homocysteine level and markedly increased levels of the choline pathway metabolites betaine, dimethylglycine, sarcosine, glycine and serine, as well as the transsulfuration pathway metabolites cystathionine and cysteine. Hepatic mRNA level of enzymes involved in homocysteine remethylation, methionine synthase and betaine-homocysteine S-methyltransferase, were unchanged, whereas cystathionine gamma-lyase of the transsulfuration pathway was increased in the CP treated rats. Plasma concentrations of vitamin B2, folate, cobalamin, and the B-6 catabolite pyridoxic acid were increased in the 20% CP-treated rats. In conclusion, the CP diet was associated with lower plasma homocysteine concentration and higher levels of serine, choline oxidation and transsulfuration metabolites compared to a casein diet. The status of related B-vitamins was also affected by CP.

  11. Controlled immobilization of palladium nanoparticles in two different fluorinated polymeric aggregate cores and their application in catalysis

    DEFF Research Database (Denmark)

    Kijima, Tetsushi; Javakhishvili, Irakli; Jankova Atanasova, Katja; Hvilsted, Søren; Kodama, Shun; Sugiya, Masashi; Sawada, Hideo

    2012-01-01

    Fluoroalkyl end-capped betaine-type cooligomeric nanocomposites-immobilized palladium nanoparticles were prepared by the reactions of palladium chloride with sodium acetate in the presence of sodium chloride and the corresponding fluorinated cooligomers. Outer blocks of poly(2,3,4,5,6-pentafluoro......Fluoroalkyl end-capped betaine-type cooligomeric nanocomposites-immobilized palladium nanoparticles were prepared by the reactions of palladium chloride with sodium acetate in the presence of sodium chloride and the corresponding fluorinated cooligomers. Outer blocks of poly(2......,3,4,5,6-pentafluorostyrene)-containing ABA-triblock copolymeric nanocomposites-immobilized palladium nanoparticles were prepared by the use of the corresponding block copolymers under similar conditions. TEM images showed that palladium nanoparticles can be immobilized outside the fluorinated cooligomeric nanocomposite...... cores; in contrast, palladium nanoparticles can be effectively immobilized inside these fluorinated ABA-triblock copolymeric nanocomposite cores. Thus, these two different fluorinated copolymers enabled the controlled immobilization of palladium nanoparticles in the fluorinated nanocomposite cores...

  12. 1H NMR metabolic profiling of cod (Gadus morhua larvae: potential effects of temperature and diet composition during early developmental stages

    Directory of Open Access Journals (Sweden)

    Matilde Skogen Chauton

    2015-12-01

    Full Text Available Marine aquaculture offers a great source of protein for the increasing human population, and farming of, for example, Atlantic salmon is a global industry. Atlantic cod farming however, is an example of a promising industry where the potential is not yet realized. Research has revealed that a major bottleneck to successful farming of cod is poor quality of the larvae and juveniles. A large research program was designed to increase our understanding of how environmental factors such as temperature and nutrition affects cod larvae development. Data on larvae growth and development were used together with nuclear magnetic resonance. The NMR data indicated that the temperature influenced the metabolome of the larvae; differences were related to osmolytes such as betaine/TMAO, the amino acid taurine, and creatine and lactate which reflect muscle activity. The larvae were fed Artemia from stage 2, and this was probably reflected in a high taurine content of older larvae. Larvae fed with copepods in the nutrition experiment also displayed a high taurine content, together with higher creatine and betaine/TMAO content. Data on the cod larvae metabolome should be coupled to data on gene expression, in order to identify events which are regulated on the genetic level versus regulation resulting from temperature or nutrition during development, to fully understand how the environment affects larval development.

  13. Task-specific ionic liquid for solubilizing metal oxides.

    Science.gov (United States)

    Nockemann, Peter; Thijs, Ben; Pittois, Stijn; Thoen, Jan; Glorieux, Christ; Van Hecke, Kristof; Van Meervelt, Luc; Kirchner, Barbara; Binnemans, Koen

    2006-10-26

    Protonated betaine bis(trifluoromethylsulfonyl)imide is an ionic liquid with the ability to dissolve large quantities of metal oxides. This metal-solubilizing power is selective. Soluble are oxides of the trivalent rare earths, uranium(VI) oxide, zinc(II) oxide, cadmium(II) oxide, mercury(II) oxide, nickel(II) oxide, copper(II) oxide, palladium(II) oxide, lead(II) oxide, manganese(II) oxide, and silver(I) oxide. Insoluble or very poorly soluble are iron(III), manganese(IV), and cobalt oxides, as well as aluminum oxide and silicon dioxide. The metals can be stripped from the ionic liquid by treatment of the ionic liquid with an acidic aqueous solution. After transfer of the metal ions to the aqueous phase, the ionic liquid can be recycled for reuse. Betainium bis(trifluoromethylsulfonyl)imide forms one phase with water at high temperatures, whereas phase separation occurs below 55.5 degrees C (temperature switch behavior). The mixtures of the ionic liquid with water also show a pH-dependent phase behavior: two phases occur at low pH, whereas one phase is present under neutral or alkaline conditions. The structures, the energetics, and the charge distribution of the betaine cation and the bis(trifluoromethylsulfonyl)imide anion, as well as the cation-anion pairs, were studied by density functional theory calculations. PMID:17048916

  14. Biochemical effects of gadolinium chloride in rats liver and kidney studied by 1H NMR metabolomics

    Institute of Scientific and Technical Information of China (English)

    LIAO Peiqiu; WEI Lai; Wu Huifeng; LI Weisheng; WU Yijie; LI Xiaojing; NI Jiazuan; PEI Fengkui

    2009-01-01

    The biochemical effects of gadolinium chloride were studied using high-resolution IH nuclear magnetic resonance (NMR) spec-troscopy to investigate the biochemical composition of tissue (liver and kidney) aqueous extracts obtained from control and gadolinium chlo-ride (GdCl3) (10 and 50 mg/kg body weight, intraperitoneal injection, i.p.) treated rats. Tissue samples were collected at 48, 96 and 168 h p.d. after exposure to GdCl3, and extracted using methanol/chloroform solvent system. 1H NMR spectra of tissue extracts were analyzed by pat-tern recognition using principal components analysis. The liver damages caused by GdCl3 were characterized by increased succinate and de-creased glycogen level and elevated lactate, alanine and betaine concentration in liver. Furthermore, the increase of creatine and lactate, and decrease of glutamate, alanine, phosphocholine, glycophosphocholine (GPC), betaine, myo-inositoi and trimethylamine N-oxide (TMAO)levels in kidney illustrated kidney disturbance induced by GdCl3.

  15. Using NMR-Based Metabolomics to Evaluate Postprandial Urinary Responses Following Consumption of Minimally Processed Wheat Bran or Wheat Aleurone by Men and Women

    Directory of Open Access Journals (Sweden)

    Ramandeep Garg

    2016-02-01

    Full Text Available Wheat bran, and especially wheat aleurone fraction, are concentrated sources of a wide range of components which may contribute to the health benefits associated with higher consumption of whole-grain foods. This study used NMR metabolomics to evaluate urine samples from baseline at one and two hours postprandially, following the consumption of minimally processed bran, aleurone or control by 14 participants (7 Females; 7 Males in a randomized crossover trial. The methodology discriminated between the urinary responses of control, and bran and aleurone, but not between the two fractions. Compared to control, consumption of aleurone or bran led to significantly and substantially higher urinary concentrations of lactate, alanine, N-acetylaspartate acid and N-acetylaspartylglutamate and significantly and substantially lower urinary betaine concentrations at one and two hours postprandially. There were sex related differences in urinary metabolite profiles with generally higher hippurate and citrate and lower betaine in females compared to males. Overall, this postprandial study suggests that acute consumption of bran or aleurone is associated with a number of physiological effects that may impact on energy metabolism and which are consistent with longer term human and animal metabolomic studies that used whole-grain wheat diets or wheat fractions.

  16. Investigating alcohol-induced congenital heart defects using optical coherence tomography (Conference Presentation)

    Science.gov (United States)

    Gu, Shi; Peterson, Lindsy M.; Ma, Pei; Karunamuni, Ganga; Watanabe, Michiko; Jenkins, Michael W.; Rollins, Andrew M.

    2016-03-01

    Fetal alcohol syndrome commonly results in neurological and craniofacial defects, additionally, as high as 54% of live-born children with this syndrome also possess cardiac abnormalities. We have previously shown that CNCC-ablated embryos exhibit similar structural and functional phenotypes as ethanol-exposed embryos. Here, we present progress on two fronts toward understanding the association between CNCC dysfunction and FAS-related CHDs. We have developed a technique for measuring the thickness of the cardiac cushions throughout the heart. These values were then mapped onto a surface mesh of the myocardial wall for 3-D visualization. The cushions were observed to be significantly reduced in the outflow tract of CNCC-ablated embryos. We also observed a correlation between abnormal pulsed Doppler waveforms and increased separation of the atrioventricular inferior and superior cushions. This correlation between function and structure will enable rapid phenotyping of perturbed embryos. Finally, we present our preliminary results using methyl donors to rescue ethanol-exposed embryonic CHDs. Betaine was administered along with the ethanol injection to embryos at 21 hours of development. The embryos were then analyzed at day 8 for survival and heart morphology. The administration of betaine resulted in a significant increase in survival and normalization of atrioventricular valve leaflet volume and interventricular septum thickness.

  17. Enzymatic selective synthesis of 1,3-DAG based on deep eutectic solvent acting as substrate and solvent.

    Science.gov (United States)

    Zeng, Chao-Xi; Qi, Sui-Jian; Xin, Rui-Pu; Yang, Bo; Wang, Yong-Hua

    2015-11-01

    In this study, enzymatic selective esterification of oleic acid with glycerol based on deep eutectic solvent acting as substrate and solvent was studied. As choline chloride (ChCl) or betaine can effectively change the chemical reaction characteristics of glycerol when they are mixed with a certain molar ratio of glycerol, several factors crucial to the lipase catalytic esterification of glycerol with oleic acid was investigated. Results showed that, betaine had more moderate effects than ChCl on the lipase, and water content had an important influence of the esterification and the enzyme selectivity. Significant changes of the glyceride compositions and enzyme selectivity were found in ChCl adding system compared with pure glycerol system; optimum accumulation of DAG especially 1,3-DAG because of the eutectic effect of ChCl was found in this system. Furthermore, in a model 1,3-DAG esterification synthesis system catalyzed by Novozym 435, high content (42.9 mol%) of the 1,3-DAG could be obtained in ChCl adding system within 1 h. PMID:26210852

  18. Radiation-induced in vitro mutagenesis system for salt tolerance and other agronomic characters in sugarcane(Saccharum officinarum L.)

    Institute of Scientific and Technical Information of China (English)

    Ashok; A.Nikam; Rachayya; M.; Devarumath; Akash; Ahuja; Harinath; Babu; Mahadeo; G.Shitole; Penna; Suprasanna

    2015-01-01

    Gamma ray-induced in vitro mutagenesis and selection for salt(NaC l) tolerance were investigated in sugarcane(Saccharum officinarum L.). Embryogenic callus cultures were irradiated(10 to 80 Gy) and subjected to in vitro selection by exposure of irradiated callus to NaC l(0, 50, 100,150, 200, and 250 mmol L-1). Increasing NaC l concentrations resulted in growth reduction and increased membrane damage. Salt-selected callus lines were characterized by the accumulation of proline, glycine betaine, and Na+and K+concentration. Higher accumulation of proline and glycine betaine was observed in NaC l stressed callus irradiated at 20 Gy. Na+concentration increased and K+concentration decreased with increasing salt level. Irradiated callus showed50–60% regeneration under NaC l stress, and in vitro-regenerated plants were acclimatized in the greenhouse, with 80–85% survival. A total of 138 irradiated and salt-selected selections were grown to maturity and their agronomic performance was evaluated under normal and saline conditions. Of these, 18 mutant clones were characterized for different agro-morphological characters and some of the mutant clones exhibited improved sugar yield with increased Brix%,number of millable canes, and yield. The result suggest that radiation-induced mutagenesis offers an effective way to enhance genetic variation in sugarcane.

  19. Estimulantes alimentares para larvas de pacu Feeding stimulants for pacu lavae

    Directory of Open Access Journals (Sweden)

    Marcelo Borges Tesser

    2011-09-01

    Full Text Available Este estudo foi realizado com o objetivo de investigar o efeito estimulante de cinco aminoácidos (alanina, arginina, glicina, histidina e lisina da betaína e de suas misturas sobre a taxa de ingestão de dieta microencapsulada durante o desenvolvimento larval de pacu Piaractus mesopotamicus. Os resultados da análise estatística comprovaram a existência de efeito significativo, tanto da idade das larvas como dos aminoácidos, sobre a taxa de ingestão. No entanto, não houve significância estatística para a interação dos dois fatores. A glicina, a lisina e a beta��na foram considerados bons estimuladores do comportamento alimentar de larvas de pacu.The present study aimed to investigate the stimulant effect of five amino acids (alanine, arginine, glycine, histidine and lysine from betaine and their mixtures on the ingestion rates of formulated diet during the larval development of pacu Piaractus mesopotamicus. The statistical results showed significant effect of age and treatment. However, no significant effect was observed for the interaction of both factors. Glycine, lysine and betaine are considered good stimulants of the pacu feeding behavior.

  20. Environmentally Benign and Permanent Modifications to Prevent Biofouling on Marine and Hydrokinetic Devices

    Energy Technology Data Exchange (ETDEWEB)

    Zheng Zhang

    2012-04-19

    Semprus Biosciences is developing environmentally benign and permanent modifications to prevent biofouling on Marine and Hydrokinetic (MHK) devices. Biofouling, including growth on external surfaces by bacteria, algae, barnacles, mussels, and other marine organisms, accumulate quickly on MHK devices, causing mechanical wear and changes in performance. Biofouling on crucial components of hydrokinetic devices, such as rotors, generators, and turbines, imposes substantial mass and hydrodynamic loading with associated efficiency loss and maintenance costs. Most antifouling coatings leach toxic ingredients, such as copper and tributyltin, through an eroding process, but increasingly stringent regulation of biocides has led to interest in the development of non-biocidal technologies to control fouling. Semprus Biosciences research team is developing modifications to prevent fouling from a broad spectrum of organisms on devices of all shapes, sizes, and materials for the life of the product. The research team designed and developed betaine-based polymers as novel underwater coatings to resist the attachment of marine organisms. Different betaine-based monomers and polymers were synthesized and incorporated within various coating formulations. The formulations and application methods were developed on aluminum panels with required adhesion strength and mechanical properties. The coating polymers were chemically stable under UV, hydrolytic and oxidative environments. The sulfobetaine formulations are applicable as nonleaching and stable underwater coatings. For the first time, coating formulations modified with highly packed sulfobetaine polymers were prepared and demonstrated resistance to a broad spectrum of marine organisms. Assays for comparing nonfouling performance were developed to evaluate protein adsorption and bacteria attachment. Barnacle settlement and removal were evaluated and a 60-day field test was performed. Silicone substrates including a commercial

  1. Tissue factor pathway inhibitor levels in patients with homocystinuria.

    Science.gov (United States)

    Cella, G; Burlina, A; Sbarai, A; Motta, G; Girolami, A; Berrettini, M; Strauss, W

    2000-06-01

    Thrombotic events are a well-recognized complication of homocystinuria. However, the mechanisms involved in the atherogenic and thrombotic effects of homocyst(e)ine remain incompletely understood. The objective of this study was to determine the role of endothelial cell activation/damage as indicated by levels of thrombomodulin, tissue factor and tissue factor pathway inhibitor, and factor VII activity in patients with homocystinuria. Six patients with homocystinuria, nonresponsive to pyridoxine, treated only with trimethylglycine (betaine) were injected with a bolus of 20 IU/kg body weight of unfractionated commercial heparin to induce the release of tissue factor pathway inhibitor from the vascular endothelium. Tissue factor, thrombomodulin, and factor VII activity were measured by enzyme-linked immunosorbent assay and clotting assay before heparin administration. Tissue factor pathway inhibitor antigen and activity were measured before and 5 minutes after the bolus of heparin. Levels of homocyst(e)ine were elevated (patients: 144.2+/-19.2 micromol/L; controls: 10.2+/-0.9 micromol/L); however, levels of thrombomodulin, tissue factor, and tissue factor pathway inhibitor antigen were not statistically different from the control group. In contrast, tissue factor pathway inhibitor activity showed a significantly increased level (patients: 2.09+/-0.34 U/L; controls: 1.14+/-0.20 U/L; p<0.05) that was correlated with homocyst(e)ine. Factor VII activity was significantly decreased (patients: 64.7+/-5.1%; controls: 91.4+/-4.7%; p<0.05) and inversely correlated with homocyst(e)ine. After heparin the patients released higher amounts of tissue factor pathway inhibitor antigen and activity compared with the control group; however, the difference was not statistically significant. Although not treated with antithrombotic drugs, none of the patients had any thromboembolic complications after starting betaine. In addition to betaine treatment, the enhanced factor pathway

  2. 丙二醇单月桂酸酯的增稠性能%The thickening properties of propylene glycol monolaurate

    Institute of Scientific and Technical Information of China (English)

    徐春涛

    2015-01-01

    丙二醇单月桂酸酯(简称PGM)是一种亲酯性非离子型表面活性剂。通过对PGM在洗涤剂和化妆品的增稠性能研究发现,PGM在甜菜碱和硫酸酯盐表面活性剂体系的洗涤剂中有良好的增稠性能,并且其增稠性能在相同条件下要好于椰子油脂肪酸单乙醇酰胺(CME)增稠剂。在甜菜碱表面活性剂体系和硫酸酯盐表面活性剂体系的洗涤剂中PGM具有良好起泡性能。在甜菜碱、AES-Na和AES-TEA表面活性剂体系的洗涤剂中PGM在低温条件下,体系稳定不会变浑浊。PGM在洁肤类、液洗类和护肤类化妆品中也有良好的增稠性能。%Propylene glycol monolaurate ( PGM) is a kind of dear ester nonionic surface activeagent.Through the study of thickening performance of detergent andcosmetics wo found that PGM had good thickeni- -ng properties in betaine and salt sulfate surfactant system in detergent, and Its thickening properties in the same condition was better than that of coconut oil fatty acid monoethanolamide (CME) thickener. In the betaine surfactant system and salt sulfate surfactant system in the detergent had good foaming performance of PGM. In AES-Na, AES-TEA, and betaine surfactant system in the detergent PGM under the condition of low temperature, stable system would not became turbid. PGM also had good thickening properties in the cleansing, liquid washing and skin care cosmetics.

  3. A novel potassium deficiency-induced stimulon in Anabaena torulosa

    Indian Academy of Sciences (India)

    Anuradha Alahari; Shree Kumar Apte

    2004-06-01

    Potassium deficiency enhanced the synthesis of fifteen proteins in the nitrogen-fixing cyanobacterium Anabaena torulosa and of nine proteins in Escherichia coli. These were termed potassium deficiency-induced proteins or PDPs and constitute hitherto unknown potassium deficiency–induced stimulons. Potassium deficiency also enhanced the synthesis of certain osmotic stress-induced proteins. Addition of K+ repressed the synthesis of a majority of the osmotic stress-induced proteins and of PDPs in these bacteria. These proteins contrast with the dinitrogenase reductase of A. torulosa and the glycine betaine-binding protein of E. coli, both of which were osmo-induced to a higher level in potassium-supplemented conditions. The data demonstrate the occurrence of novel potassium deficiency-induced stimulons and a wider role of K+ in regulation of gene expression and stress responses in bacteria.

  4. NMR-Based Metabolomic Analysis of Huanglongbing-Asymptomatic and -Symptomatic Citrus Trees.

    Science.gov (United States)

    Freitas, Deisy dos Santos; Carlos, Eduardo Fermino; Gil, Márcia Cristina Soares de Souza; Vieira, Luiz Gonzaga Esteves; Alcantara, Glaucia Braz

    2015-09-01

    Huanglongbing (HLB) is one of the most severe diseases that affects citrus trees worldwide and is associated with the yet uncultured bacteria Candidatus Liberibacter spp. To assess the metabolomic differences between HLB-asymptomatic and -symptomatic tissues, extracts from leaf and root samples taken from a uniform 6-year-old commercial orchard of Valencia trees were subjected to nuclear magnetic resonance (NMR) and chemometrics. The results show that the symptomatic trees had higher sucrose content in their leaves and no variation in their roots. In addition, proline betaine and malate were detected in smaller amounts in the HLB-affected symptomatic leaves. The changes in metabolic processes of the plant in response to HLB are corroborated by the relationship between the bacterial levels and the metabolic profiles. PMID:26285838

  5. A thermolabile aldolase A mutant causes fever-induced recurrent rhabdomyolysis without hemolytic anemia.

    Directory of Open Access Journals (Sweden)

    Asmaa Mamoune

    2014-11-01

    Full Text Available Aldolase A deficiency has been reported as a rare cause of hemolytic anemia occasionally associated with myopathy. We identified a deleterious homozygous mutation in the ALDOA gene in 3 siblings with episodic rhabdomyolysis without hemolytic anemia. Myoglobinuria was always triggered by febrile illnesses. We show that the underlying mechanism involves an exacerbation of aldolase A deficiency at high temperatures that affected myoblasts but not erythrocytes. The aldolase A deficiency was rescued by arginine supplementation in vitro but not by glycerol, betaine or benzylhydantoin, three other known chaperones, suggesting that arginine-mediated rescue operated by a mechanism other than protein chaperoning. Lipid droplets accumulated in patient myoblasts relative to control and this was increased by cytokines, and reduced by dexamethasone. Our results expand the clinical spectrum of aldolase A deficiency to isolated temperature-dependent rhabdomyolysis, and suggest that thermolability may be tissue specific. We also propose a treatment for this severe disease.

  6. Phylogeography, Salinity Adaptations and Metabolic Potential of the Candidate Division KB1 Bacteria Based on a Partial Single Cell Genome.

    Science.gov (United States)

    Nigro, Lisa M; Hyde, Andrew S; MacGregor, Barbara J; Teske, Andreas

    2016-01-01

    Deep-sea hypersaline anoxic basins and other hypersaline environments contain abundant and diverse microbial life that has adapted to these extreme conditions. The bacterial Candidate Division KB1 represents one of several uncultured groups that have been consistently observed in hypersaline microbial diversity studies. Here we report the phylogeography of KB1, its phylogenetic relationships to Candidate Division OP1 Bacteria, and its potential metabolic and osmotic stress adaptations based on a partial single cell amplified genome of KB1 from Orca Basin, the largest hypersaline seafloor brine basin in the Gulf of Mexico. Our results are consistent with the hypothesis - previously developed based on (14)C incorporation experiments with mixed-species enrichments from Mediterranean seafloor brines - that KB1 has adapted its proteins to elevated intracellular salinity, but at the same time KB1 apparently imports glycine betaine; this compatible solute is potentially not limited to osmoregulation but could also serve as a carbon and energy source. PMID:27597842

  7. The effectiveness of a course of the drug " Alakton " in the preparation of skilled wrestlers

    Directory of Open Access Journals (Sweden)

    Sazonov V.V.

    2013-12-01

    Full Text Available Purpose . The influence of the new domestic preparation on the performance of functional readiness and psychophysiological performance athletes. Material and methods . The study involved 12 qualified wrestlers (age 17-19 years with the written consent. The drug contains chelated magnesium glycinate cocarboxylase and betaine. Course reception - within seven days of shock microcycle. Results . Found that course reception has a positive impact on health and the special recovery processes athletes. Also found a positive effect on physiological indicators. The authentic reduction in travel time distance shuttle run 4 x 9 m, increase in the coefficient of special endurance, increase the number of repetitions in the test. Showed a reduction in the coefficient of restitution and increasing the number of shots (mill in this test. Conclusions . The data obtained suggest appropriate use of the drug in the practice of preparing skilled fighters.

  8. Chernobyl seed project. Advances in the identification of differentially abundant proteins in a radio-contaminated environment

    Directory of Open Access Journals (Sweden)

    Namik Mammad Oglu Rashydov

    2015-07-01

    Full Text Available Plants have the ability to grow and successfully reproduce in radio-contaminated environments, which has been highlighted by nuclear accidents at Chernobyl (1986 and Fukushima (2011. The main aim of this article is to summarize the advances of the Chernobyl seed project which has the purpose to provide proteomic characterization of plants grown in the Chernobyl area. We present a summary of comparative proteomic studies on soybean and flax seeds harvested from radio-contaminated Chernobyl areas during two successive generations. Using experimental design developed for radio-contaminated areas, altered abundances of glycine betaine, seed storage proteins, and proteins associated with carbon assimilation into fatty acids were detected. Similar studies in Fukushima radio-contaminated areas might complement these data. The results from these Chernobyl experiments can be viewed in a user-friendly format at a dedicated web-based database freely available at www.chernobylproteomics.sav.sk.

  9. Thermodynamics of interactions between organic ammonium ions and sulfonatocalixarenes

    International Nuclear Information System (INIS)

    Calorimetric titration and NMR experiments in aqueous phosphate buffer (pH 7.2) at 298.15 K have been done to determine the binding mode, complex stability constants and thermodynamics (ΔGo, ΔHo, and TΔSo) for 1:1 inclusion complexation of water-soluble calix[n]arenesulfonates (CnAS, n = 4 and 6) and thiacalix[4]arene tetrasulfonate (TCAS) with acethylcholine, carnitine, betaine and benzyltrimethylammonium ion. The results show the inclusion complexations are driven by enthalpy (ΔHo o C6AS > TCAS) are discussed from the viewpoint of CH-π/π-π interactions, electrostatic interactions and size/shape-fit relationship between host and guest

  10. A review of chemistry and biological activities of the genus Aerva--a desert plant.

    Science.gov (United States)

    Chawla, Payal; Chawla, Amit; Vasudeva, Neeru; Sharma, Surendra Kumar

    2012-01-01

    There are approximately 28 species of Aerva genus, but only a few species are medicinal of which A. persica, A. lanata and A. javanica are of great value. A number of flavonol glycosides (e.g., aervanone, kaempferol-3-galactoside, isorhamnetin-3-O-β-D-glucoside) have been reported from Aerva persica as major phytoconstituents and the minor constituents are β-cyanins (glycine betaine and trigonelline), sterols and carbohydrates. This plant is used as medicinal herb in several traditional systems of medicine all over the world, like diuretic, demulcent, purgative, emetic and tinder. Aerva plants are used to cure ulcer, lithiasis, dropsical affections, eye affection, toothache, headache, in disorders of abdomen and inflammation of internal organs. Roots and flowers are reported to possess hypoglycemic, antioxidant, anthelmintic, analgesic, antimalarial, antivenin activities and medicinal properties against rheumatism and kidney troubles. PMID:22568031

  11. Designing a new strategy for the formation of IL-in-oil microemulsions.

    Science.gov (United States)

    Rao, Vishal Govind; Ghosh, Surajit; Ghatak, Chiranjib; Mandal, Sarthak; Brahmachari, Udita; Sarkar, Nilmoni

    2012-03-01

    Due to the increasing applicability of ionic liquids (ILs) as different components of microemulsions (as the polar liquid, the oil phase, and the surfactant), it would be advantageous to devise a strategy by which we can formulate a microemulsion of our own interest. In this paper, we have shown how we can replace water from water-in-oil microemulsions by ILs to produce IL-in-oil microemulsions. We have synthesized AOT-derived surface-active ionic liquids (SAILs) which can be used to produce a large number of IL-in-oil microemulsions. In particular, we have characterized the phase diagram of the [C(4)mim][BF(4)]/[C(4)mim][AOT]/benzene ternary system at 298 K. We have shown the formation of IL-in-oil microemulsions using the dynamic light scattering (DLS) technique and using methyl orange (MO), betaine 30, and coumarin-480 (C-480) as probe molecules. PMID:22329703

  12. Radiolysis of D(+)-carnitine by /sup 60/Co-. gamma. -radiation and formation of L(+)-. beta. -methylcholine

    Energy Technology Data Exchange (ETDEWEB)

    Loester, Heinz; Strack, Erich; Seim, Hermann

    1986-06-01

    The radiolysis of D(+)-carnitine by /sup 60/Co-..gamma..-radiation was examined to obtain optically active ..beta..-methylcholine. It was found that the radiolysis leads to a number of trimethylammonium bases but to no other betaines. (+)-..beta..-Methylcholine and acetonyltrimethylammonium could be identified by means of common analytical methods. The amounts of methylamines formed by irradiation were very small. Racemization of the D(+)-carnitine did not occur during irradiation, L(-)-carnitine was not found when an enzymatical determination method was used. The fact that (+)-..beta..-methylcholine was formed from D(+)-carnitine is pharmacologically important, because acetyl-L(+)-..beta..-methylcholine has a strong interaction with muscarinic receptors.

  13. The study on Buthus martensii Karsch

    Directory of Open Access Journals (Sweden)

    Ki-Rok, Kwon

    2002-02-01

    Full Text Available Objective: Through the literatures on the effects of Buthus martensii Karsch, we are finding out the clinical possibility and revealing the more effctive to intractable diseases. Method: We investigated the literatures of Oriental Medicine and experimental reports about Buthus martensii Karsch. Results: 1. The taste of Buthus martensii Karsch is salty, hot and toxic, and the effect of this is tetanus, headache, facial palsy and convulsion. 2. The venom of Buthus martensii Karsch is anaesthetic and toxic protein, composed of buthotoxin, lecithin, trimethylamine, betaine, taurine, cholesterol, stearic acid and palmitic acid and similar to the snake venom. 3. The pharmacological effects ofButhus martensii Karsch are anti-convulsion, depressor, anesthesia, anti-thrombosis and anti-cancer. 4. Symptoms of Buthotoxin poisoning are local pain, vomiting, fever, hypertension and palpitaion, and critical condition to Dyspnea, coma and death.

  14. Sugar beet molasses as an ingredient to enhance the nutritional and functional properties of gluten-free cookies.

    Science.gov (United States)

    Filipčev, Bojana; Mišan, Aleksandra; Šarić, Bojana; Šimurina, Olivera

    2016-01-01

    Sugar beet molasses is a raw material with high potential to be a functional ingredient in baked goods. This paper investigated the nutritional and functional properties of gluten-free cookies enriched with sugar beet molasses. At all enrichment levels and forms tested (liquid and dry), the addition of beet molasses improved the micronutrient pattern and antioxidative status of gluten-free cookies. The cookies prepared with molasses were significantly higher in potassium, magnesium, calcium, iron, betaine, total phenolics and DPPH radical scavenging abilities. Molasses contributed to wider spectra of phenolic compounds. The dominating phenolic compounds in the molasses-enriched cookies were catechin, ferulic, syringic and vanillic acid. Molasses also contributed to the presence of p-hydroxybenzoic acid in the cookies. Addition of molasses increased the content of hydroxymethyfurfural in the cookies, but not above values commonly reported for this product type. Molasses addition improved the overall acceptance of gluten-free cookies up to 30% enrichment level. PMID:26947667

  15. A perturbative study on the analytic continuation for generalized gravitational entropy

    CERN Document Server

    Prudenziati, Andrea

    2014-01-01

    We study the analytic continuation used by Lewkowycz and Maldacena to prove the Ryu-Takayanagi formula for entanglement entropy, which is the holographic dual of the trace of the $\\beta$-power of the time evolution operator when $\\beta\\in \\mathbb{R}$. This will be done perturbatively by using a weakly time dependent Hamiltonian, corresponding to a small shift of the dual static background. Depending on the periodicity we impose on the gravitational solution, we consider two different possibilities and compare the associated entropies with the results obtained through a minimal area computation. To our surprise we discover that, at first order, both choices correctly reproduce the associated entanglement entropy. Furthermore we find unexpected divergent contributions that we have to discard in order to fit the minimal area computation, and an additional requirement that needs to be imposed on the $\\beta$ dependence on the metric.

  16. Growth, osmolyte concentration and antioxidant enzymes in the leaves of Sesuvium portulacastrum L. under salinity stress.

    Science.gov (United States)

    Kannan, P Ramesh; Deepa, S; Kanth, Swarna V; Rengasamy, R

    2013-12-01

    In this study, growth and osmolyte concentration in the leaves of halophyte, Sesuvium portulacastrum, were studied with respect to salinity. Therefore, the changes in shoot growth, leaf tissue water content, osmolyte concentration (proline content, glycine betaine) and antioxidant enzymes [polyphenol oxidase (PPO), superoxide dismutase (SOD) and catalase (CAT)] were investigated. The 30-day old S. portulacastrum plants were subjected to 100, 200, 300, 400, 500 and 600 mM NaCl for 28 days. The plant growth was steadily increased up to 500 mM NaCl stress at 28 days. TWC was higher in 300 mM NaCl treated leaves than that of 600 mM NaCl. Salinity stress induced the accumulation of osmolyte concentration when compared to control during the study period. The antioxidant enzymes PPO, CAT and SOD were increased under salinity. PMID:24013859

  17. REVERSIBLE CLINICAL AND MAGNETIC RESONANCE IMAGING FINDINGS IN LATE-ONSET COBALAMIN C DEFECT.

    Science.gov (United States)

    Gurkas, E; Kartal, A; Aydin, K; Kucukçongar, A; Dilber, C; Ceylaner, S

    2015-01-01

    Cobalamin C (Cbl C) disease is an inborn error of intracellular cobalamin metabolism. Two distinct clinical types are defined according to the age of onset. We describe an 8 year old girl with late-onset Cbl C disease presenting with neuropsychiatric symptoms. Mutation analysis revealed homozygous c.394C>T (p.R132X) mutation in the MMACHC gene. Serial magnetic resonance imaging (MRI) before and after the treatment are provided. MRI of the brain before treatment showed bilateral patchy focal hyperintensities in the white matter and cortical atrophy. After treatment with intramuscular hydroxycobalamin, oral folinic acid, oral betaine, normalization of MRI findings can be achieved in addition to clinical improvement. We present this case to draw attention to the reversibility of clinical and MRI findings in the late onset Cbl C disease after treatment. PMID:26852513

  18. Renewal theorems for random walks in random scenery

    CERN Document Server

    Guillotin-Plantard, Nadine

    2011-01-01

    Random walks in random scenery are processes defined by $Z_n:=\\sum_{k=1}^n\\xi_{X_1+...+X_k}$, where $(X_k,k\\ge 1)$ and $(\\xi_y,y\\in\\mathbb Z)$ are two independent sequences of i.i.d. random variables. We suppose that the distributions of $X_1$ and $\\xi_0$ belong to the normal domain of attraction of strictly stable distributions with index $\\alpha\\in[1,2]$ and $\\beta\\in(0,2)$ respectively. We are interested in the asymptotic behaviour as $|a|$ goes to infinity of quantities of the form $\\sum_{n\\ge 1}{\\mathbb E}[h(Z_n-a)]$ (when $(Z_n)_n$ is transient) or $\\sum_{n\\ge 1}{\\mathbb E}[h(Z_n)-h(Z_n-a)]$ (when $(Z_n)_n$ is recurrent) where $h$ is some complex-valued function defined on $\\mathbb{R}$ or $\\mathbb{Z}$.

  19. Thermodynamics of interactions between organic ammonium ions and sulfonatocalixarenes

    Energy Technology Data Exchange (ETDEWEB)

    Wang Lihua [Department of Chemistry, State Key Laboratory of Elemento-Organic Chemistry, Nankai University, Tianjin 300071 (China); Guo Dongsheng [Department of Chemistry, State Key Laboratory of Elemento-Organic Chemistry, Nankai University, Tianjin 300071 (China); Chen Yong [Department of Chemistry, State Key Laboratory of Elemento-Organic Chemistry, Nankai University, Tianjin 300071 (China); Liu Yu [Department of Chemistry, State Key Laboratory of Elemento-Organic Chemistry, Nankai University, Tianjin 300071 (China)]. E-mail: yuliu@nankai.edu.cn

    2006-04-01

    Calorimetric titration and NMR experiments in aqueous phosphate buffer (pH 7.2) at 298.15 K have been done to determine the binding mode, complex stability constants and thermodynamics ({delta}G{sup o}, {delta}H{sup o}, and T{delta}S{sup o}) for 1:1 inclusion complexation of water-soluble calix[n]arenesulfonates (CnAS, n = 4 and 6) and thiacalix[4]arene tetrasulfonate (TCAS) with acethylcholine, carnitine, betaine and benzyltrimethylammonium ion. The results show the inclusion complexations are driven by enthalpy ({delta}H{sup o} < 0), accompanied by negative entropic changes ({delta}S{sup o} < 0). The binding affinities (C4AS > C6AS > TCAS) are discussed from the viewpoint of CH-{pi}/{pi}-{pi} interactions, electrostatic interactions and size/shape-fit relationship between host and guest.

  20. Beskrivelse af næringsstofomsætning med metabolomics

    DEFF Research Database (Denmark)

    Hedemann, Mette Skou

    I et forsøg med mink med lav eller høj foderkonvertering er der blevet taget blodprøver på tre tidspunkter. Blodprøverne er blevet taget i en periode, hvor minkene er blevet fodret restriktivt (en prøve) og i en periode med ad libitum fodring (to prøver). Blodprøverne blev analyseret ved hjælp af...... fra restriktivt fodrede mink end i plasma fra ad libitum fodrede mink - betain og carnitin. Derudover er der en lang række andre metabolitter, som også findes i forskellig koncentration som endnu ikke er identificeret....

  1. Radiolysis of D(+)-carnitine by 60Co-γ-radiation and formation of L(+)-β-methylcholine

    International Nuclear Information System (INIS)

    The radiolysis of D(+)-carnitine by 60Co-γ-radiation was examined to obtain optically active β-methylcholine. It was found that the radiolysis leads to a number of trimethylammonium bases but to no other betaines. (+)-β-Methylcholine and acetonyltrimethylammonium could be identified by means of common analytical methods. The amounts of methylamines formed by irradiation were very small. Racemization of the D(+)-carnitine did not occur during irradiation, L(-)-carnitine was not found when an enzymatical determination method was used. The fact that (+)-β-methylcholine was formed from D(+)-carnitine is pharmacologically important, because acetyl-L(+)-β-methylcholine has a strong interaction with muscarinic receptors. (author)

  2. Influence of substrates on roughness of self-supporting Ni films

    International Nuclear Information System (INIS)

    Self-supporting Ni foils were obtained by floating of Ni films from water soluble substrates. Ni films were prepared by metal vapor vacuum arc (MEVVA) ion deposition. The following release agents were applied on Si wafer substrates: betaine monohydrate with sucrose, potassium oleate, potassium oleate with sucrose. In addition polished NaCl crystals and self-supporting collodion foils were used as soluble substrates, respectively. Field emission scanning electron microscopy (FESEM) and atomic force microscope (AFM) were employed to analyze the surface morphology and the roughness of the Ni films and the substrates. The results indicate that the mean roughness of the self-supporting Ni foils depends on their substrates. Self-supporting collodion foils seem to be one of the most suitable candidates for preparing self-supporting Ni foils with low roughness. Mean roughness of the best self-supporting Ni foils is about 3.8 nm

  3. Consequences of dietary methyl donor supplements: Is more always better?

    Science.gov (United States)

    Shorter, Kimberly R; Felder, Michael R; Vrana, Paul B

    2015-07-01

    Epigenetic mechanisms are now recognized to play roles in disease etiology. Several diseases increasing in frequency are associated with altered DNA methylation. DNA methylation is accomplished through metabolism of methyl donors such as folate, vitamin B12, methionine, betaine (trimethylglycine), and choline. Increased intake of these compounds correlates with decreased neural tube defects, although this mechanism is not well understood. Consumption of these methyl donor pathway components has increased in recent years due to fortification of grains and high supplemental levels of these compounds (e.g. vitamins, energy drinks). Additionally, people with mutations in one of the enzymes that assists in the methyl donor pathway (5-MTHFR) are directed to consume higher amounts of methyl donors to compensate. Recent evidence suggests that high levels of methyl donor intake may also have detrimental effects. Individualized medicine may be necessary to determine the appropriate amounts of methyl donors to be consumed, particularly in women of child bearing age. PMID:25841986

  4. Betainium trifluoroacetate.

    Science.gov (United States)

    Rodrigues, V H; Paixão, J A; Costa, M M; Matos Beja, A

    2001-06-01

    The title compound, C5H12NO2+*C2F3O2- or BET+*CF3COO- [BET is trimethylglycine (betaine); IUPAC: 1-carboxy-N,N,N-trimethylmethanaminium inner salt], contains pairs of betainium and trifluoroacetate ions forming a dimer bridged by a strong hydrogen bond between the carboxyl and carboxylate groups of the two ions. The molecular symmetry of the cation is close to Cs, with protonation occurring at the carboxy O atom positioned anti to the N atom. The trifluoroacetate anions are disordered over two positions. In one, the conformation of the CF3 group is staggered with respect to the carboxylate group, in the other, it is close to an eclipsed conformation. The sole hydrogen bond present in the structure is the strong O-H...O bond between the anion and the cation. PMID:11408698

  5. On the reality of spectra of $\\boldsymbol{U_q(sl_2)}$-invariant XXZ Hamiltonians

    CERN Document Server

    Morin-Duchesne, Alexi; Ruelle, Philippe; Saint-Aubin, Yvan

    2015-01-01

    A new inner product is constructed on each standard module over the Temperley-Lieb algebra $\\mathsf{TL}_n(\\beta)$ for $\\beta\\in \\mathbb R$ and $n \\ge 2$. On these modules, the Hamiltonian $h = -\\sum_i e_i$ is shown to be self-adjoint with respect to this inner product. This implies that its action on these modules is diagonalisable with real eigenvalues. A representation theoretic argument shows that the reality of spectra of the Hamiltonian extends to all other Temperley-Lieb representations. In particular, this result applies to the celebrated $U_q(sl_2)$-invariant XXZ Hamiltonian, for all $q+q^{-1}\\in \\mathbb R$.

  6. Metabolomics analysis of shucked mussels' freshness.

    Science.gov (United States)

    Aru, Violetta; Pisano, Maria Barbara; Savorani, Francesco; Engelsen, Søren Balling; Cosentino, Sofia; Cesare Marincola, Flaminia

    2016-08-15

    In this work a NMR metabolomics approach was applied to analyze changes in the metabolic profile of the bivalve mollusk Mytilus galloprovincialis upon storage at 0°C and 4°C for 10 and 6 days, respectively. The most significant microbial groups involved in spoilage of mussels were also investigated. The time-related metabolic signature of mussels was analysed by Orthogonal Partial Least Squares Discriminant Analysis (OPLS-DA) which revealed a clear discrimination between the fresh samples and those stored at 0°C and 4°C. The results evidenced a noticeable increase in acetate, lactate, succinate, alanine, branched chain amino acids, trimethylamine and a progressive decline of osmolytes like betaine, homarine and taurine during storage. Exploration of the correlations of these metabolites with microbial counts suggested their use as potential biomarkers of spoilage. The results support the use of NMR metabolomics as a valuable tool to provide information on seafood freshness. PMID:27006214

  7. Comparison of RNA extraction methods in Thai aromatic coconut water

    Directory of Open Access Journals (Sweden)

    Nopporn Jaroonchon

    2015-10-01

    Full Text Available Many researches have reported that nucleic acid in coconut water is in free form and at very low yields which makes it difficult to process in molecular studies. Our research attempted to compare two extraction methods to obtain a higher yield of total RNA in aromatic coconut water and monitor its change at various fruit stages. The first method used ethanol and sodium acetate as reagents; the second method used lithium chloride. We found that extraction using only lithium chloride gave a higher total RNA yield than the method using ethanol to precipitate nucleic acid. In addition, the total RNA from both methods could be used in amplification of betaine aldehyde dehydrogenase2 (Badh2 genes, which is involved in coconut aroma biosynthesis, and could be used to perform further study as we expected. From the molecular study, the nucleic acid found in coconut water increased with fruit age.

  8. (1)H NMR metabolomic profiling of the blue crab (Callinectes sapidus) from the Adriatic Sea (SE Italy): A comparison with warty crab (Eriphia verrucosa), and edible crab (Cancer pagurus).

    Science.gov (United States)

    Zotti, Maurizio; De Pascali, Sandra Angelica; Del Coco, Laura; Migoni, Danilo; Carrozzo, Leonardo; Mancinelli, Giorgio; Fanizzi, Francesco Paolo

    2016-04-01

    The metabolomic profile of blue crab (Callinectes sapidus) captured in the Acquatina lagoon (SE Italy) was compared to an autochthonous (Eriphia verrucosa) and to a commercial crab species (Cancer pagurus). Both lipid and aqueous extracts of raw claw muscle were analyzed by (1)H NMR spectroscopy and MVA (multivariate data analysis). Aqueous extracts were characterized by a higher inter-specific discriminating power compared to lipid fractions. Specifically, higher levels of glutamate, alanine and glycine characterized the aqueous extract of C. sapidus, while homarine, lactate, betaine and taurine characterized E. verrucosa and C. pagurus. On the other hand, only the signals of monounsaturated fatty acids distinguished the lipid profiles of the three crab species. These results support the commercial exploitation and the integration of the blue crab in human diet of European countries as an healthy and valuable seafood. PMID:26593533

  9. Adducts of rare earth hexafluoroacetylacetonates with amino acids. [Eu, Tb, Dy, La, Lu

    Energy Technology Data Exchange (ETDEWEB)

    Karasev, V.E.; Steblevskaya, N.I.; Shchelokov, R.N. (AN SSSR, Vladivostok. Inst. Khimii)

    1983-01-01

    Crystal different-ligand rare earth complexes with hexafluoroacetylacetone and amino acids of m(GFAA)/sub 3/ 2A composition, where m=La, Eu, Tb, Dy, Lu, A-glycine, ..cap alpha..-alanine, ..beta..-alanine, valine, norvaline, asparagine, proline, are extracted for the first time. IR spectroscopic and luminescent methods have been used to characterize compound composition. Amino acid is shown to be a neutral ligand coordinating through oxygen atom of carboxyl group with conservation of betaine structure. Analysis of Stark structure of /sup 5/D/sub 0/-/sup 7/F/sub 1/-transition in luminescence spectra of europium adducts points out monotonous decrease of ..delta..F/sub 1/ parameter from glycine to asparagine: gly > pro > ..cap alpha..-ala > hys > val > ..beta..-ala > Nsub(val) > ast.

  10. Preparation of Beryllium Targets by Vacuum Evaporation

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The apparatus is shown in Fig.1, which is mounted within a conventional metal bell jar 45 cm in diameter and 70 cm high. The boat source could be seen through the windows of the appratus and the bell jar.There was no straight-line exit from the apparatus to the interor of the bell jar for Be vapor originating at the boat.Tantalum boat, 13 mm wide, 28 mm long, and 0.1 mm thick, was used as evaporation source. The distance from the boat to the substrate was 15 cm. Microscope glass slide coated with betaine as substrate.The Be foils produced by resistance heating were removed from the glass by dissolving the

  11. Investigation on Acute Biochemical Effects of Ce(NO3)3 on Liver and Kidney Tissues by MAS 1H NMR Spectroscopic-Based Metabonomic Approach

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    High resolution magic angle spinning (MAS)-1 H nuclear magnetic resonance (NMR) spectroscopic-based metabonomic approach was applied to the investigation on the acute biochemical effects of Ce(NO3)3. Male Wistar rats were liver and kidney tissues were analyzed using principal component analysis to extract toxicity information. The biochemical effects of Ce(NO3)3 were characterized by the increase of triglycerides and lactate and the decrease of glycogen in rat liver tissue, together with an elevation of the triglyceride level and a depletion of glycerophosphocholine and betaine in kidney tissues. The target lesions of Ce(NO3)3 on liver and kidney were found by MAS NMR-based metabonomic method. This study demonstrates that the combination of MAS 1H NMR and pattern recognition analysis can be an effective method for studies of biochemical effects of rare earths.

  12. NMR-based metabonomic studies reveal changes in the biochemical profile of plasma and urine from pigs fed high-fibre rye bread

    DEFF Research Database (Denmark)

    Bertram, Hanne C; Bach Knudsen, Knud E; Serena, Anja;

    2006-01-01

    This study presents an NMR-based metabonomic approach to elucidate the overall endogenous biochemical effects of a wholegrain diet. Two diets with similar levels of dietary fibre and macronutrients, but with contrasting levels of wholegrain ingredients, were prepared from wholegrain rye (wholegrain...... diet (WGD)) and non-wholegrain wheat (non-wholegrain diet (NWD)) and fed to four pigs in a crossover design. Plasma samples were collected after 7 d on each diet, and 1H NMR spectra were acquired on these. Partial least squares regression discriminant analysis (PLS-DA) on spectra obtained for plasma...... a significantly higher content of betaine in WGD plasma samples compared with NWD samples. In an identical study with the same diets, urine samples were collected, and 1H NMR spectra were acquired on these. PLS-DA on spectra obtained for urine samples revealed changes in the intensities of spectral...

  13. NMR-based metabonomic studies reveal changes in the biochemical profile of plasma and urine from pigs fed high fibre rye bread

    DEFF Research Database (Denmark)

    Bertram, Hanne C.; Bach Knudsen, Knud E.; Serena, Anja;

    2006-01-01

    This study presents an NMR-based metabonomic approach to elucidate the overall endogenous biochemical effects of a wholegrain diet. Two diets with similar levels of dietary fibre and macronutrients, but with contrasting levels of wholegrain ingredients, were prepared from wholegrain rye (wholegrain...... diet (WGD)) and non-wholegrain wheat (non-wholegrain diet (NWD)) and fed to four pigs in a crossover design. Plasma samples were collected after 7 d on each diet, and 1H NMR spectra were acquired on these. Partial least squares regression discriminant analysis (PLS-DA) on spectra obtained for plasma...... a significantly higher content of betaine in WGD plasma samples compared with NWD samples. In an identical study with the same diets, urine samples were collected, and 1H NMR spectra were acquired on these. PLS-DA on spectra obtained for urine samples revealed changes in the intensities of spectral...

  14. Homocystinuria: Therapeutic approach.

    Science.gov (United States)

    Kumar, Tarun; Sharma, Gurumayum Suraj; Singh, Laishram Rajendrakumar

    2016-07-01

    Homocystinuria is a disorder of sulfur metabolism pathway caused by deficiency of cystathionine β-synthase (CBS). It is characterized by increased accumulation of homocysteine (Hcy) in the cells and plasma. Increased homocysteine results in various vascular and neurological complications. Present strategies to lower cellular and plasma homocysteine levels include vitamin B6 intake, dietary methionine restriction, betaine supplementation, folate and vitamin B12 administration. However, these strategies are inefficient for treatment of homocystinuria. In recent years, advances have been made towards developing new strategies to treat homocystinuria. These mainly include functional restoration to mutant CBS, enhanced clearance of Hcy from the body, prevention of N-homocysteinylation-induced toxicity and inhibition of homocysteine-induced oxidative stress. In this review, we have exclusively discussed the recent advances that have been achieved towards the treatment of homocystinuria. The review is an attempt to help clinicians in developing effective therapeutic strategies and designing novel drugs against homocystinuria. PMID:27059523

  15. A QM/MM Approach Using the AMOEBA Polarizable Embedding: From Ground State Energies to Electronic Excitations.

    Science.gov (United States)

    Loco, Daniele; Polack, Étienne; Caprasecca, Stefano; Lagardère, Louis; Lipparini, Filippo; Piquemal, Jean-Philip; Mennucci, Benedetta

    2016-08-01

    A fully polarizable implementation of the hybrid quantum mechanics/molecular mechanics approach is presented, where the classical environment is described through the AMOEBA polarizable force field. A variational formalism, offering a self-consistent relaxation of both the MM induced dipoles and the QM electronic density, is used for ground state energies and extended to electronic excitations in the framework of time-dependent density functional theory combined with a state specific response of the classical part. An application to the calculation of the solvatochromism of the pyridinium N-phenolate betaine dye used to define the solvent ET(30) scale is presented. The results show that the QM/AMOEBA model not only properly describes specific and bulk effects in the ground state but it also correctly responds to the large change in the solute electronic charge distribution upon excitation. PMID:27340904

  16. What Have Metabolomics Approaches Taught Us About Type 2 Diabetes?

    Science.gov (United States)

    Gonzalez-Franquesa, Alba; Burkart, Alison M; Isganaitis, Elvira; Patti, Mary-Elizabeth

    2016-08-01

    Type 2 diabetes (T2D) is increasing worldwide, making identification of biomarkers for detection, staging, and effective prevention strategies an especially critical scientific and medical goal. Fortunately, advances in metabolomics techniques, together with improvements in bioinformatics and mathematical modeling approaches, have provided the scientific community with new tools to describe the T2D metabolome. The metabolomics signatures associated with T2D and obesity include increased levels of lactate, glycolytic intermediates, branched-chain and aromatic amino acids, and long-chain fatty acids. Conversely, tricarboxylic acid cycle intermediates, betaine, and other metabolites decrease. Future studies will be required to fully integrate these and other findings into our understanding of diabetes pathophysiology and to identify biomarkers of disease risk, stage, and responsiveness to specific treatments. PMID:27319324

  17. Using UCST ionic liquid as a draw solute in forward osmosis to treat high-salinity water

    KAUST Repository

    Zhong, Yujiang

    2015-12-09

    The concept of using a thermo-responsive ionic liquid (IL) with an upper critical solution temperature (UCST) as a draw solute in forward osmosis (FO) was successfully demonstrated here experimentally. A 3.2 M solution of protonated betaine bis(trifluoromethylsulfonyl)imide ([Hbet][Tf2N]) was obtained by heating and maintaining the temperature above 56°C. This solution successfully drew water from high-salinity water up to 3.0 M through FO. When the IL solution cooled to room temperature, it spontaneously separated into a water-rich phase and an IL-rich phase: the water-rich phase was the produced water that contained a low IL concentration, and the IL-rich phase could be used directly as the draw solution in the next cycle of the FO process. The thermal stability, thermal-responsive solubility and UV-vis absorption spectra of the IL were also studied in detail.

  18. Metabonomic studies of pancreatic cancer response to radiotherapy in a mouse xenograft model using magnetic resonance spectroscopy and principal components analysis

    Directory of Open Access Journals (Sweden)

    Xin-Hong He

    2013-01-01

    Full Text Available AIM: To investigate the metabolic profiles of xenograft pancreatic cancer before and after radiotherapy by high-resolution magic angle spinning proton magnetic resonance spectroscopy (HRMAS 1H NMR combined with principal components analysis (PCA and evaluate the radiotherapeutic effect. METHODS: The nude mouse xenograft model of human pancreatic cancer was established by injecting human pancreatic cancer cell SW1990 subcutaneously into the nude mice. When the tumors volume reached 800 mm3, the mice received various radiation doses. Two weeks later, tumor tissue sections were prepared for running the NMR measurements. 1H NMR and PCA were used to determine the changes in the metabolic profiles of tumor tissues after radiotherapy. Metabolic profiles of normal pancreas, pancreatic tumor tissues, and radiation- treated pancreatic tumor tissues were compared. RESULTS: Compared with 1H NMR spectra of the normal nude mouse pancreas, the levels of choline, taurine, alanine, isoleucine, leucine, valine, lactate, and glutamic acid of the pancreatic cancer group were increased, whereas an opposite trend for phosphocholine, glycerophosphocholine, and betaine was observed. The ratio of phosphocholine to creatine, and glycerophosphocholine to creatine showed noticeable decrease in the pancreatic cancer group. After further evaluation of the tissue metabolic profile after treatment with three different radiation doses, no significant change in metabolites was observed in the 1H NMR spectra, while the inhibition of tumor growth was in proportion to the radiation doses. However, PCA results showed that the levels of choline and betaine were decreased with the increased radiation dose, and conversely, the level of acetic acid was dramatically increased. CONCLUSION: The combined methods were demonstrated to have the potential for allowing early diagnosis and assessment of pancreatic cancer response to radiotherapy.

  19. Hepatic Methionine Homeostasis Is Conserved in C57BL/6N Mice on High-Fat Diet Despite Major Changes in Hepatic One-Carbon Metabolism

    Science.gov (United States)

    Dahlhoff, Christoph; Desmarchelier, Charles; Sailer, Manuela; Fürst, Rainer W.; Haag, Alexander; Ulbrich, Susanne E.; Hummel, Björn; Obeid, Rima; Geisel, Jürgen; Bader, Bernhard L.; Daniel, Hannelore

    2013-01-01

    Obesity is an underlying risk factor in the development of cardiovascular disease, dyslipidemia and non-alcoholic fatty liver disease (NAFLD). Increased hepatic lipid accumulation is a hallmark in the progression of NAFLD and impairments in liver phosphatidylcholine (PC) metabolism may be central to the pathogenesis. Hepatic PC biosynthesis, which is linked to the one-carbon (C1) metabolism by phosphatidylethanolamine N-methyltransferase, is known to be important for hepatic lipid export by VLDL particles. Here, we assessed the influence of a high-fat (HF) diet and NAFLD status in mice on hepatic methyl-group expenditure and C1-metabolism by analyzing changes in gene expression, protein levels, metabolite concentrations, and nuclear epigenetic processes. In livers from HF diet induced obese mice a significant downregulation of cystathionine β-synthase (CBS) and an increased betaine-homocysteine methyltransferase (BHMT) expression were observed. Experiments in vitro, using hepatoma cells stimulated with peroxisome proliferator activated receptor alpha (PPARα) agonist WY14,643, revealed a significantly reduced Cbs mRNA expression. Moreover, metabolite measurements identified decreased hepatic cystathionine and L-α-amino-n-butyrate concentrations as part of the transsulfuration pathway and reduced hepatic betaine concentrations, but no metabolite changes in the methionine cycle in HF diet fed mice compared to controls. Furthermore, we detected diminished hepatic gene expression of de novo DNA methyltransferase 3b but no effects on hepatic global genomic DNA methylation or hepatic DNA methylation in the Cbs promoter region upon HF diet. Our data suggest that HF diet induces a PPARα-mediated downregulation of key enzymes in the hepatic transsulfuration pathway and upregulates BHMT expression in mice to accommodate to enhanced dietary fat processing while preserving the essential amino acid methionine. PMID:23472083

  20. Mass spectrometric imaging of metabolites in kidney tissues from rats treated with furosemide.

    Science.gov (United States)

    Jung, Jin Woo; Lee, Mi Suk; Choi, Hyo-Jung; Jung, Sunhee; Lee, Yu-Jung; Hwang, Geum-Sook; Kwon, Tae-Hwan

    2016-06-01

    In the kidney, metabolic processes are different among the cortex (COR), outer medulla (OM), and inner medulla (IM). Using matrix-assisted laser desorption/ionization (MALDI) and imaging mass spectrometry (IMS), we examined the change of metabolites in the COR, OM, and IM of the rat kidney after furosemide treatment compared with vehicle-treated controls. Osmotic minipumps were implanted in male Sprague-Dawley rats to deliver 12 mg·day(-1)·rat(-1) of furosemide. Vehicle-treated (n = 14) and furosemide-treated (furosemide rats, n = 15) rats in metabolic cages received a fixed amount of rat chow (15 g·220 g body wt(-1)·day(-1) for each rat) with free access to water intake for 6 days. At day 6, higher urine output (32 ± 4 vs. 9 ± 1 ml/day) and lower urine osmolality (546 ± 44 vs. 1,677 ± 104 mosmol/kgH2O) were observed in furosemide rats. Extracts of COR, OM, and IM were analyzed by ultraperformance liquid chromatography coupled with quadrupole time-of-flight (TOF) mass spectrometry, where multivariate analysis revealed significant differences between the two groups. Several metabolites, including acetylcarnitine, betaine, carnitine, choline, and glycerophosphorylcholine (GPC), were significantly changed. The changes of metabolites were further identified by MALDI-TOF/TOF and IMS. Their spatial distribution and relative quantitation in the kidneys were analyzed by IMS. Carnitine compounds were increased in COR and IM, whereas carnitine and acetylcarnitine were decreased in OM. Choline compounds were increased in COR and OM but decreased in IM from furosemide rats. Betaine and GPC were decreased in OM and IM. Taken together, MALDI-TOF/TOF and IMS successfully provide the spatial distribution and relative quantitation of metabolites in the kidney. PMID:26962105

  1. The involvement of homocysteine in stress-induced Aβ precursor protein misprocessing and related cognitive decline in rats.

    Science.gov (United States)

    Xie, Fang; Zhao, Yun; Ma, Jing; Gong, Jing-Bo; Wang, Shi-Da; Zhang, Liang; Gao, Xiu-Jie; Qian, Ling-Jia

    2016-09-01

    Chronic stress is a risk factor in the development of cognitive decline and even Alzheimer's disease (AD), although its underlying mechanism is not fully understood. Our previous data demonstrated that the level of homocysteine (Hcy) was significantly elevated in the plasma of stressed animals, which suggests the possibility that Hcy is a link between stress and cognitive decline. To test this hypothesis, we compared the cognitive function, plasma concentrations of Hcy, and the brain beta-amyloid (Aβ) level between rats with or without chronic unexpected mild stress (CUMS). A lower performance by rats in behavioral tests indicated that a significant cognitive decline was induced by CUMS. Stress also disturbed the normal processing of Aβ precursor protein (APP) and resulted in the accumulation of Aβ in the brains of rats, which showed a positive correlation with the hyperhomocysteinemia (HHcy) that appeared in stressed rats. Hcy-targeting intervention experiments were used to verify further the involvement of Hcy in stress-induced APP misprocessing and related cognitive decline. The results showed that diet-induced HHcy could mimic the cognitive impairment and APP misprocessing in the same manner as CUMS, while Hcy reduction by means of vitamin B complex supplements and betaine could alleviate the cognitive deficits and dysregulation of Aβ metabolism in CUMS rats. Taken together, the novel evidence from our present study suggests that Hcy is likely to be involved in chronic stress-evoked APP misprocessing and related cognitive deficits. Our results also suggested the possibility of Hcy as a target for therapy and the potential value of vitamin B and betaine intake in the prevention of stress-induced cognitive decline. PMID:27435080

  2. Zebrafish as a Model for Systems Medicine R&D: Rethinking the Metabolic Effects of Carrier Solvents and Culture Buffers Determined by (1)H NMR Metabolomics.

    Science.gov (United States)

    Akhtar, Muhammad T; Mushtaq, Mian Y; Verpoorte, Robert; Richardson, Michael K; Choi, Young H

    2016-01-01

    Zebrafish is a frequently employed model organism in systems medicine and biomarker discovery. A crosscutting fundamental question, and one that has been overlooked in the field, is the "system-wide" (omics) effects induced in zebrafish by metabolic solvents and culture buffers. Indeed, any bioactivity or toxicity test requires that the target compounds are dissolved in an appropriate nonpolar solvent or aqueous media. It is important to know whether the solvent or the buffer itself has an effect on the zebrafish model organism. We evaluated the effects of two organic carrier solvents used in research with zebrafish, as well as in drug screening: dimethyl sulfoxide (DMSO) and ethanol, and two commonly used aqueous buffers (egg water and Hank's balanced salt solution). The effects of three concentrations (0.01, 0.1, and 1%) of DMSO and ethanol were tested in the 5-day-old zebrafish embryo using proton nuclear magnetic resonance ((1)H NMR) based metabolomics. DMSO (1% and 0.1%, but not 0.01%) exposure significantly decreased the levels of adenosine triphosphate (ATP), betaine, alanine, histidine, lactate, acetate, and creatine (p acetate, betaine, glycine, glutamate, adenosine triphosphate, and histidine. These results show that DMSO has greater effects on the embryo metabolome than ethanol, and thus is used with caution as a carrier solvent in zebrafish biomarker research and oral medicine. Moreover, the DMSO concentration should not be higher than 0.01%. Careful attention is also warranted for the use of the buffers egg water and Hank's balanced salt solution in zebrafish. In conclusion, as zebrafish is widely used as a model organism in life sciences, metabolome changes induced by solvents and culture buffers warrant further attention for robust systems science, and precision biomarkers that will stand the test of time. PMID:26669610

  3. 不同促摄食物质对哲罗鲑生长、体成分、消化酶和血液生化指标的影响%=Effects of feeding attractants on growth and body composition, digestive enzyme and serum indices of Hucho taimen

    Institute of Scientific and Technical Information of China (English)

    王常安; 徐奇友; 畅雅萍; 许红; 尹家胜

    2011-01-01

    研究二甲基-β-丙酸噻亭(DMPT)、氧化三甲胺(TMAO)、甜菜碱和肌苷酸钠(IMP)对初重 9.39±0.26 g 哲罗鲑(Hucho taimen)摄食、生长、体成分、消化酶和血清生化指标的影响.哲罗鲑在室内玻璃钢水族箱中流水饲养,试验设1个对照组,4个处理组,每处理组3个重复,每重复50 尾,养殖周期56 d.试验期间水温9.3~14.2℃,溶氧>8.0 mg·L-1.试验结果表明,在低鱼粉饲料中添加0.2% DMPT、0.2% TMAO和0.2%甜菜碱后,哲罗鲑增重率和特定生长率显著提高(P0.05);添加0.2% DMPT后哲罗鲑鱼体粗蛋白水平升高(P0.05);添加0.2% DMPT和0.2% TMAO后消化道消化酶活性提高(P<0.05);添加0.2%甜菜碱后,消化道脂肪酶活性显著升高(P<0.05);添加0.2% DMPT后血清总蛋白、白蛋白和球蛋白水平显著升高(P<0.05);添加0.2% TMAO和0.2%甜菜碱后,高密度脂蛋白含量显著升高(P<0.05),胆固醇、甘油三酯、低密度脂蛋白含量显著下降(P<0.05);添加0.05% IMP后,血清补体C3和C4水平显著提高(P<0.05).结论是饲料中添加0.2% DMPT、0.2% TMAO和0.2%甜菜碱对哲罗鲑具有促摄食和生长效果,有利于改善体成分和提高机体消化能力;饲料添加0.05% IMP对哲罗鲑促摄食和生长效果不明显,但有益于改善鱼体免疫状况.%The taimen with initial body weight of 9.39±0.26 g were used to conducted a 56 days growth ex-periment for studying the effects of four feeding attractants (dimethyl-β-propiothetin, trimethylamine oxide,betaine and sodium-5'-inosinate) on feed intake, growth performance, body composition, digestive enzyme ac-tivities and serum indices. Fishes were raised in water flow system. There were 5 diets, and each diet was ran-domly assigned to triplicate groups of 50 fishes. During the experiment, the water temperature fluctuated from 9.3 ℃ to 14.2℃ and the dissolved oxygen was above 8.0 mg·L-1. The results showed that the weight gain rate and specific growth rate of the taimen

  4. NaCl胁迫对6种纤维亚麻幼苗生化特性的影响%Effects of NaCl Stress on the Biochemical Characteristics in Six Species Fiber Flax Seeding

    Institute of Scientific and Technical Information of China (English)

    王伟; 邓倩; 计巧灵

    2013-01-01

      旨在为筛选、培育耐盐的纤维亚麻突变体奠定前期基础。NaCl胁迫亚麻幼苗,测定幼苗的叶绿素组成及含量、脯氨酸、可溶性糖、可溶性蛋白和甜菜碱含量,经统计学分析和比较,确定它们的耐盐特性。结果表明,经250 mmol/L NaCl 胁迫后,HIZ019和‘天鑫3号’幼苗的脯氨酸含量显著高于其他品种;YOI303和YOI254幼苗的可溶性糖含量显著高于其他品种;YOI254幼苗的可溶性蛋白含量显著高于其他品种;HIZ019、‘天鑫3号’幼苗的甜菜碱含量显著高于其他品种。总体上看,YOI254、‘天鑫3号’和HIZ019纤维亚麻幼苗耐盐性较好。%The aim was to lay the preliminary foundation for screen and breed somatic salt tolerant mutants of flax. Seedlings were stressed with NaCl (0, 100, 150, 250 mmol/L), biochemical characteristics (composition and content of chlorophylls, proline, soluble sugar, soluble protein, betain contents) of the seedling were detected; their salt tolerances were determined by data analysis and comparison. From biochemical characteristics of the seedlings, after treated with 250 mmol/L NaCl, proline contents of HIZ019 and‘Tianxin 3’were significantly higher than that of others. Soluble sugar contents of YOI303 and YOI254 were significantly higher than that of others. Soluble protein content of YOI254 was significantly higher than that of others. Betain contents of HIZ019 and‘Tianxin3’were significantly higher than that of others. In a word, flax seedlings of YOI254,‘Tianxin3’, HIZ019 species were more salt tolerant than that of others.

  5. Difference in yield and physiological features in response to drought and salinity combined stress during anthesis in Tibetan wild and cultivated barleys.

    Directory of Open Access Journals (Sweden)

    Imrul Mosaddek Ahmed

    Full Text Available Soil salinity and drought are the two most common and frequently co-occurring abiotic stresses constraining crop growth and productivity. Greenhouse pot experiments were conducted to investigate the tolerance potential and mechanisms of Tibetan wild barley genotypes (XZ5, drought-tolerant; XZ16, salinity/aluminum tolerant during anthesis compared with salinity-tolerant cv CM72 in response to separate and combined stresses (D+S of drought (4% soil moisture, D and salinity (S. Under salinity stress alone, plants had higher Na(+ concentrations in leaves than in roots and stems. Importantly, XZ5 and XZ16 had substantially increased leaf K(+ concentrations; XZ16 was more efficient in restricting Na(+ loading in leaf and maintained a lower leaf Na(+/K(+ ratio. Moreover, a significant decrease in cell membrane stability index (CMSI and an increase in malondialdehyde (MDA were accompanied by a dramatic decrease in total biomass under D+S treatment. We demonstrated that glycine-betaine and soluble sugars increased significantly in XZ5 and XZ16 under all stress conditions, along with increases in protease activity and soluble protein contents. Significant increases were seen in reduced ascorbate (ASA and reduced glutathione (GSH contents, and in activities of H(+K(+-, Na(+K(+-, Ca(++Mg(++-, total- ATPase, and antioxidant enzymes under D+S treatment in XZ5 and XZ16 compared to CM72. Compared with control, all stress treatments significantly reduced grain yield and 1000-grain weight; however, XZ5 and XZ16 were less affected than CM72. Our results suggest that high tolerance to D+S stress in XZ5 and XZ16 is closely related to the lower Na(+/K(+ ratio, and enhanced glycine-betaine and soluble protein and sugar contents, improved protease, ATPase activities and antioxidative capacity for scavenging reactive oxygen species during anthesis. These results may provide novel insight into the potential responses associated with increasing D+S stress in wild barley

  6. Combinatorial Reactive Sputtering of In2S3 as an Alternative Contact Layer for Thin Film Solar Cells

    Energy Technology Data Exchange (ETDEWEB)

    Siol, Sebastian; Dhakal, Tara P.; Gudavalli, Ganesh S.; Rajbhandari, Pravakar P.; DeHart, Clay; Baranowski, Lauryn L.; Zakutayev, Andriy

    2016-06-08

    High-throughput computational and experimental techniques have been used in the past to accelerate the discovery of new promising solar cell materials. An important part of the development of novel thin film solar cell technologies, that is still considered a bottleneck for both theory and experiment, is the search for alternative interfacial contact (buffer) layers. The research and development of contact materials is difficult due to the inherent complexity that arises from its interactions at the interface with the absorber. A promising alternative to the commonly used CdS buffer layer in thin film solar cells that contain absorbers with lower electron affinity can be found in ..beta..-In2S3. However, the synthesis conditions for the sputter deposition of this material are not well-established. Here, In2S3 is investigated as a solar cell contact material utilizing a high-throughput combinatorial screening of the temperature-flux parameter space, followed by a number of spatially resolved characterization techniques. It is demonstrated that, by tuning the sulfur partial pressure, phase pure ..beta..-In2S3 could be deposited using a broad range of substrate temperatures between 500 degrees C and ambient temperature. Combinatorial photovoltaic device libraries with Al/ZnO/In2S3/Cu2ZnSnS4/Mo/SiO2 structure were built at optimal processing conditions to investigate the feasibility of the sputtered In2S3 buffer layers and of an accelerated optimization of the device structure. The performance of the resulting In2S3/Cu2ZnSnS4 photovoltaic devices is on par with CdS/Cu2ZnSnS4 reference solar cells with similar values for short circuit currents and open circuit voltages, despite the overall quite low efficiency of the devices (-2%). Overall, these results demonstrate how a high-throughput experimental approach can be used to accelerate the development of contact materials and facilitate the optimization of thin film solar cell devices.

  7. Surface modification of medical implant materials with hydrophilic polymers for enhanced biocompatibility and delivery of therapeutic agents

    Science.gov (United States)

    Urbaniak, Daniel J.

    2004-11-01

    In the research reported here, the surface modification of medical grade poly(dimethyl siloxane), polyetherurethane, and stainless steel through gamma-radiation grafting of hydrophilic polymers was investigated. Emphasis was placed on developing improved and simplified surface modification methods that produce more stable and more bioacceptible hydrophilic graft surfaces. As a result of this research, new surface modification techniques were developed that yield significantly improved surface stability unachievable using previous surface modification techniques. The surface modification of poly(dimethyl siloxane) with hydrophilic polymers was carried out using gamma radiation initiated graft polymerization. The addition of alkali metal hydroxides afforded a unique way to enhance the grafting of N-vinyl-2 pyrrolidone, dimethylacryamide, 2-methacryloyloxyethyl phosphoryl choline, N,N-dimethyl-N-(methacryloyloxyethyl)-N-(3-sulfopropyl)-ammonium-betaine, N,N-dimethyl-N-(methacrylamidopropyl)-N-(3-sulfopropyl)-ammonium-betaine, and copolymers thereof to silicones. Ethanolamine was found to further enhance the grafting of some hydrophilic polymers to silicone. The resulting hydrophilic surface grafts were resistant to hydrophobic surface rearrangement. This process overcomes previous problems inherent in silicone surface modification. The technique was also found to moderately enhance the grafting of hydrophilic monomers to polyetherurethane and to 316-L stainless steel. The surface modification of 316-L stainless steel was further enhanced by treating the substrates with a chromium III methacrylate bonding agent prior to irradiation. The coatings were evaluated for their potential use as depots for delivering therapeutic agents. The release of ofloxacin from surface-modified poly(dimethyl siloxane) and dexamethasone from surface-modified 316-L stainless steel was evaluated by in-vitro experiments. Therapeutic levels of drugs were released from surface-modified specimens

  8. Methionine metabolism in Yucatan miniature swine.

    Science.gov (United States)

    McBreairty, Laura E

    2016-06-01

    Methionine is an essential amino acid which when not incorporated into protein, can be converted to S-adenosylmethionine, the universal methyl donor in over 200 transmethylation reactions, which include creatine and phosphatidylcholine (PC) synthesis, as well as deoxyribonucleic acid (DNA) methylation. Following transmethylation, homocysteine is formed, which can be converted to cysteine via transsulfuration or remethylated to methionine by receiving a methyl group from folate or betaine. Changes to methyl group availability in utero can lead to permanent changes in epigenetic patterns of DNA methylation, which has been implicated in "fetal programming", a phenomenon associated with poor nutrition during fetal development that results in low birth weight and disease in later life. It has been shown that programming can also occur in the neonate. Our global objective was to understand how the variability of nutrients involved in methionine metabolism can affect methionine and methyl group availability. We hypothesize that nutrients that converge on methionine metabolism can affect methionine availability for its various functions. In this thesis, we used intrauterine growth restricted (IUGR) piglets to investigate whether a global nutritional insult in utero can lead to a perturbed methionine metabolism. Our results demonstrate that IUGR piglets have a lower capacity to dispose of homocysteine via both transsulfuration and remethylation pathways, as well as a lower incorporation of methyl groups into PC. The second objective of this thesis was to determine whether variation in methionine supply and demand can affect methionine availability. We demonstrated that stimulating either acute or chronic creatine synthesis leads to lower methyl incorporation into protein and PC in pigs. Furthermore, when methionine is limiting, supplementation with either folate or betaine leads to higher methionine availability for protein synthesis. Finally, because creatine is

  9. The accumulation of glutamate is necessary for optimal growth of Salmonella typhimurium in media of high osmolality but not induction of the proU operon.

    Science.gov (United States)

    Csonka, L N; Ikeda, T P; Fletcher, S A; Kustu, S

    1994-10-01

    Synthesis of glutamate can be limited in bacterial strains carrying mutations to loss of function of glutamate synthase (2-oxoglutarate:glutamine aminotransferase) by using low concentrations of NH4+ in the growth medium. By using such gltB/D mutant strains of Salmonella typhimurium, we demonstrated that: (i) a large glutamate pool, previously observed to correlate with growth at high external osmolality, is actually required for optimal growth under these conditions; (ii) the osmoprotectant glycine betaine (N,N,N-trimethylglycine) apparently cannot substitute for glutamate; and (iii) accumulation of glutamate is not necessary for high levels of induction of the proU operon in vivo. Expression of the proU operon, which encodes a transport system for the osmoprotectants proline and glycine betaine, is induced > 100-fold in the wild-type strain under conditions of high external osmolality. Ramirez et al. (R. M. Ramirez, W. S. Prince, E. Bremer, and M. Villarejo, Proc. Natl. Acad. Sci. USA 86:1153-1157, 1989) observed and we confirmed that in vitro expression of the lacZ gene from the wild-type proU promoter is stimulated by 0.2 to 0.3 M K glutamate. However, we observed a very similar stimulation for lacZ expressed from the lacUV5 promoter and from the proU promoter when an important negative regulatory element downstream of this promoter (the silencer) was deleted. Since the lacUV5 promoter is not osmotically regulated in vivo and osmotic regulation of the proU promoter is largely lost as a result of deletion of the silencer, we conclude that stimulation of proU expression by K glutamate in vitro is not a specific osmoregulatory response but probably a manifestation of the optimization of in vitro transcription-translation at high concentrations of this solute. Our in vitro and in vivo results demonstrate that glutamate is not an obligatory component of the transcriptional regulation of the proU operon. PMID:7929004

  10. Metabolic profiling in Maturity-onset diabetes of the young (MODY and young onset type 2 diabetes fails to detect robust urinary biomarkers.

    Directory of Open Access Journals (Sweden)

    Anna L Gloyn

    Full Text Available It is important to identify patients with Maturity-onset diabetes of the young (MODY as a molecular diagnosis determines both treatment and prognosis. Genetic testing is currently expensive and many patients are therefore not assessed and are misclassified as having either type 1 or type 2 diabetes. Biomarkers could facilitate the prioritisation of patients for genetic testing. We hypothesised that patients with different underlying genetic aetiologies for their diabetes could have distinct metabolic profiles which may uncover novel biomarkers. The aim of this study was to perform metabolic profiling in urine from patients with MODY due to mutations in the genes encoding glucokinase (GCK or hepatocyte nuclear factor 1 alpha (HNF1A, type 2 diabetes (T2D and normoglycaemic control subjects. Urinary metabolic profiling by Nuclear Magnetic Resonance (NMR and ultra performance liquid chromatography hyphenated to Q-TOF mass spectrometry (UPLC-MS was performed in a Discovery set of subjects with HNF1A-MODY (n = 14, GCK-MODY (n = 17, T2D (n = 14 and normoglycaemic controls (n = 34. Data were used to build a valid partial least squares discriminate analysis (PLS-DA model where HNF1A-MODY subjects could be separated from the other diabetes subtypes. No single metabolite contributed significantly to the separation of the patient groups. However, betaine, valine, glycine and glucose were elevated in the urine of HNF1A-MODY subjects compared to the other subgroups. Direct measurements of urinary amino acids and betaine in an extended dataset did not support differences between patients groups. Elevated urinary glucose in HNF1A-MODY is consistent with the previously reported low renal threshold for glucose in this genetic subtype. In conclusion, we report the first metabolic profiling study in monogenic diabetes and show that, despite the distinct biochemical pathways affected, there are unlikely to be robust urinary biomarkers which distinguish monogenic

  11. Growth stage-based modulation in physiological and biochemical attributes of two genetically diverse wheat (Triticum aestivum L.) cultivars grown in salinized hydroponic culture.

    Science.gov (United States)

    Ashraf, Muhammad Arslan; Ashraf, Muhammad

    2016-04-01

    Hydroponic experiment was conducted to appraise variation in the salt tolerance potential of two wheat cultivars (salt tolerant, S-24, and moderately salt sensitive, MH-97) at different growth stages. These two wheat cultivars are not genetically related as evident from randomized polymorphic DNA analysis (random amplified polymorphic DNA (RAPD)) which revealed 28% genetic diversity. Salinity stress caused a marked reduction in grain yield of both wheat cultivars. However, cv. S-24 was superior to cv. MH-97 in maintaining grain yield under saline stress. Furthermore, salinity caused a significant variation in different physiological attributes measured at different growth stages. Salt stress caused considerable reduction in different water relation attributes of wheat plants. A significant reduction in leaf water, osmotic, and turgor potentials was recorded in both wheat cultivars at different growth stages. Maximal reduction in leaf water potential was recorded at the reproductive stage in both wheat cultivars. In contrast, maximal turgor potential was observed at the boot stage. Salt-induced adverse effects of salinity on different water relation attributes were more prominent in cv. MH-97 as compared to those in cv. S-24. Salt stress caused a substantial decrease in glycine betaine and alpha tocopherols. These biochemical attributes exhibited significant salt-induced variation at different growth stages in both wheat cultivars. For example, maximal accumulation of glycine betaine was evident at the early growth stages (vegetative and boot). However, cv. S-24 showed higher accumulation of this organic osmolyte, and this could be the reason for maintenance of higher turgor than that of cv. MH-97 under stress conditions. Salt stress significantly increased the endogenous levels of toxic ions (Na(+) and Cl(-)) and decreased essential cations (K(+) and Ca(2+)) in both wheat cultivars at different growth stages. Furthermore, K(+)/Na(+) and Ca(2+)/Na(+) ratios

  12. Progress in the effect of vitamin B6 on human genome health%维生素B6与人类基因组健康研究进展

    Institute of Scientific and Technical Information of China (English)

    吴暇玉; 汪旭

    2011-01-01

    Vitamin B6 is a cofactor for the serine hydroxymethyltransferase ( SHMT ), cystathionine β-synthase (CBS) and betaine hydroxymethyltransferase (BHMT) in folate metabolism. SHMT catalyzes the reversible interconversion of serine and tetrahydrofolate ( THF ) to glycine and 5,10- methylene THF. The metabolism of homocysteine to methionine and cysteine is initiated by the enzymes CBS and BHMT. So the evidence indicates that vitamin B6 plays an important role in the maintenance of genome,epigenetics stability and homocysteine metabolism, suggesting vitamin B6' s critical role in the prevention of tumour, cancer and cardiovascular disease. This article will review and discuss the metabolic functions of vitamin B6, some associated diseases due to vitamin B6 deficiency, and new insights from recently published studies regarding prevention and treatment potentials.%维生素B6作为叶酸代谢途径中丝氨酸羟甲基转移酶(serine hydroxymethyltransferase,SHMT)、胱硫醚β-合成酶(cystathionineβ-synthase,CBS)、甜菜碱羟甲基转移酶(betaine hydroxymethyltransferase,BHMT)等酶的辅酶,一方面涉及丝氨酸、四氢叶酸到甘氨酸、5,10-甲基四氢叶酸的可逆转化,另一方面协助完成同型半胱氨酸到甲硫氨酸和胱硫醚的代谢.因此维生素B6对于维持基因组、表基因组稳定性以及促进同型半胱氨酸代谢可能具有一定作用,从而在肿瘤、癌症、心脑血管疾病的防范上可能起到积极作用.本文综述了维生素B6代谢功能研究进展、维生素B6缺乏临床表征及引发的并发症和营养缺陷症,为人类基因组健康、公共卫生健康和饮食供给提供参考.

  13. A new rapid amplification of cDNA ends method for extremely guanine plus cytosine-rich genes.

    Science.gov (United States)

    Shi, Xianzong; Jarvis, Donald L

    2006-09-15

    Rapid amplification of cDNA ends (RACE) is widely used to determine the 5'- and 3'-terminal nucleotide sequences of genes. Many different RACE methods have been developed to meet various requirements, but none addresses the difficult problems that arise when trying to isolate the ends of extremely guanine plus cytosine (GC)-rich genes. In this study, we found that we were unable to isolate the correct 5' or 3' end of an insect gene, which appeared to include extremely GC-rich sequences, using current RACE methods. Thus, we developed a new RACE method that can be used for this purpose. This new method entails first-strand cDNA synthesis at 70 degrees C with Thermo-X reverse transcriptase in the presence of homoectoine, followed by a polymerase chain reaction with 98 degrees C denaturation steps and Phusion DNA polymerase in the presence of 1M betaine and 5% dimethyl sulfoxide (DMSO). The use of these conditions yielded 5'- and 3'-RACE products that were approximately 80% GC over 213 and 162bp, respectively, and included shorter internal regions of 82 to 89% GC. PMID:16875657

  14. Excess of methyl donor in the perinatal period reduces postnatal leptin secretion in rat and interacts with the effect of protein content in diet.

    Directory of Open Access Journals (Sweden)

    Fanny Giudicelli

    Full Text Available Methionine, folic acid, betaine and choline interact in the one-carbon metabolism which provides methyl groups for methylation reactions. An optimal intake of these nutrients during pregnancy is required for successful completion of fetal development and evidence is growing that they could be involved in metabolic long-term programming. However, the biological pathways involved in the action of these nutrients are still poorly known. This study investigated the interaction between methyl donors and protein content in maternal diet during the preconceptual, pregnancy and lactation periods and the consequences on the rat offspring in the short and long term. Methyl donor supplementation reduced leptin secretion in offspring, whereas insulin levels were mostly affected by protein restriction. The joint effect of protein restriction and methyl donor excess strongly impaired postnatal growth in both gender and long term weight gain in male offspring only, without affecting food intake. In addition, rats born from protein restricted and methyl donor supplemented dams gained less weight when fed a hypercaloric diet. Methylation of the leptin gene promoter in adipose tissue was increased in methyl donor supplemented groups but not affected by protein restriction only. These results suggest that maternal methyl donor supplementation may influence energy homeostasis in a gender-dependent manner, without affecting food intake. Moreover, we showed that macronutrients and micronutrients in maternal diet interact to influence the programming of the offspring.

  15. Phosphorus starvation induces membrane remodeling and recycling in Emiliania huxleyi.

    Science.gov (United States)

    Shemi, Adva; Schatz, Daniella; Fredricks, Helen F; Van Mooy, Benjamin A S; Porat, Ziv; Vardi, Assaf

    2016-08-01

    Nutrient availability is an important factor controlling phytoplankton productivity. Phytoplankton contribute c. 50% of the global photosynthesis and possess efficient acclimation mechanisms to cope with nutrient stress. We investigate the cellular response of the bloom-forming coccolithophore Emiliania huxleyi to phosphorus (P) scarcity, which is often a limiting factor in marine ecosystems. We combined mass spectrometry, fluorescence microscopy, transmission electron microscopy (TEM) and gene expression analyses in order to assess diverse cellular features in cells exposed to P limitation and recovery. Early starvation-induced substitution of phospholipids in the cells' membranes with galacto- and betaine lipids. Lipid remodeling was rapid and reversible upon P resupply. The PI3K inhibitor wortmannin reduced phospholipid substitution, suggesting a possible involvement of PI3K- signaling in this process. In addition, P limitation enhanced the formation and acidification of membrane vesicles in the cytoplasm. Intracellular vesicles may facilitate the recycling of cytoplasmic content, which is engulfed in the vesicles and delivered to the main vacuole. Long-term starvation was characterized by a profound increase in cell size and morphological alterations in cellular ultrastructure. This study provides cellular and molecular basis for future ecophysiological assessment of natural E. huxleyi populations in oligotrophic regions. PMID:27111716

  16. Development of Pre-Industrial Processes for the Preparation of Thin Film Coatings for Energy Applications; Desarrollo de Procesos Pre-Industriales para la Preparacion de Recubrimientos en Pelicula Delgada para Aplicaciones Energeticas

    Energy Technology Data Exchange (ETDEWEB)

    Sanz, C.; Guillen, C.; Gutierrez, M.T.

    2005-07-01

    Indium sulfide (In2S3) is an interesting candidate as buffer layer in heterojunction solar cells based on a Cu(In,Ga)Se2 absorbent layer. Modulated Flux Deposition (MFD) is a physical evaporation-type synthesis technique, specific for thin film synthesis, in which the substrate is exposed to the deposition of each element and heating in a sequential and cyclic way. This vacuum process allows a fine adjustment of the elemental vapor fluxes. In2S3 polycrystalline thin films were deposited on glass substrates by MFD. The influence of different deposition parameters (substrate temperature, both evaporation source temperatures, substrate angular velocity) on the composition, structure and optical properties were studied. All the obtained samples consisted in tetragonal Beta-In2S3 with high or total (103) preferential orientation. Quite thin layers (50-100 nm thick) have been achieved, with smoothed small grained microstructures. Respect to the sulfur supply, its reduction improved the crystallinity and decreased very slightly the bandgap energy. As conclusion, thin films with morphological and optical properties adequate to the mentioned application were archived decreasing the substrate temperature up to 310 C. (Author) 42 refs.

  17. Testing the dependence of stabilizing effect of osmolytes on the fractional increase in the accessible surface area on thermal and chemical denaturations of proteins.

    Science.gov (United States)

    Rahman, Safikur; Ali, Syed Ausaf; Islam, Asimul; Hassan, Md Imtaiyaz; Ahmad, Faizan

    2016-02-01

    Here we have generated two different denatured states using heat- and guanidinium chloride (GdmCl)-induced denaturations of three disulfide bond free proteins (barstar, cytochrome-c and myoglobin). We have observed that these two denatured states of barstar and myoglobin are structurally and energetically different, for, heat-induced denatured state contains many un-melted residual structure that has a significant amount of secondary and tertiary interactions. We show that structural properties of the denatured state determine the magnitude of the protein stabilization in terms of Gibbs free energy change (ΔGD°) induced by an osmolyte, i.e., the greater the exposed surface area, the greater is the stabilization. Furthermore, we predicted the m-values (ability of osmolyte to fold or unfold proteins) using Tanford's transfer-free energy model for the transfer of proteins to osmolyte solutions. We observed that, for each protein, m-value is comparable with our experimental data in cases of TMAO (trimethylamine-N-oxide) and sarcosine. However, a significant discrepancy between predicted and experimental m-values were observed in the case of glycine-betaine. PMID:26686265

  18. Viscosity and stability of ultra-high internal phase CO2-in-water foams stabilized with surfactants and nanoparticles with or without polyelectrolytes.

    Science.gov (United States)

    Xue, Zheng; Worthen, Andrew; Qajar, Ali; Robert, Isaiah; Bryant, Steven L; Huh, Chun; Prodanović, Maša; Johnston, Keith P

    2016-01-01

    To date, relatively few examples of ultra-high internal phase supercritical CO2-in-water foams (also referred to as macroemulsions) have been observed, despite interest in applications including "waterless" hydraulic fracturing in energy production. The viscosities and stabilities of foams up to 0.98 CO2 volume fraction were investigated in terms of foam bubble size, interfacial tension, and bulk and surface viscosity. The foams were stabilized with laurylamidopropyl betaine (LAPB) surfactant and silica nanoparticles (NPs), with and without partially hydrolyzed polyacrylamide (HPAM). For foams stabilized with mixture of LAPB and NPs, fine ∼70 μm bubbles and high viscosities on the order of 100 cP at>0.90 internal phase fraction were stabilized for hours to days. The surfactant reduces interfacial tension, and thus facilitates bubble generation and decreases the capillary pressure to reduce the drainage rate of the lamella. The LAPB, which is in the cationic protonated form, also attracts anionic NPs (and anionic HPAM in systems containing polymer) to the interface. The adsorbed NPs at the interface are shown to slow down Ostwald ripening (with or without polymer added) and increase foam stability. In systems with added HPAM, the increase in the bulk and surface viscosity of the aqueous phase further decreases the lamella drainage rate and inhibits coalescence of foams. Thus, the added polymer increases the foam viscosity by threefold. Scaling law analysis shows the viscosity of 0.90 volume fraction foams is inversely proportional to the bubble size. PMID:26414421

  19. In vitro hyperthermia with improved colloidal stability and enhanced SAR of magnetic core/shell nanostructures.

    Science.gov (United States)

    Patil, R M; Thorat, N D; Shete, P B; Otari, S V; Tiwale, B M; Pawar, S H

    2016-02-01

    Magnetic core/shell nanostructures of Fe3O4 nanoparticles coated with oleic acid and betaine-HCl were studied for their possible use in magnetic fluid hyperthermia (MFH). Their colloidal stability and heat induction ability were studied in different media viz. phosphate buffer solution (PBS), saline solution and glucose solution with different physiological conditions and in human serum. The results showed enhanced colloidal stability in these media owing to their high zeta potential values. Heat induction studies showed that specific absorption rates (SAR) of core/shells were 82-94W/g at different pH of PBS and concentrations of NaCl and glucose. Interestingly, core/shells showed 78.45±3.90W/g SAR in human serum. The cytotoxicity of core/shells done on L929 and HeLa cell lines using 3-(4,5-dimethylthiazol-2-yl)2,5-diphenyl tetrazolium bromide and trypan blue dye exclusion assays showed >89% and >80% cell viability for 24 and 48h respectively. Core/shell structures were also found to be very efficient for in vitro MFH on cancer cell line. About 95% cell death was occurred in 90min after hyperthermia treatment. The mechanism of cell death was found to be elevated ROS generation in cells after exposure to core/shells in external magnetic field. This study showed that these core/shells have a great potential to be used in in vivo MFH. PMID:26652424

  20. Methyl donor supplementation in rats reverses the deleterious effect of maternal separation on depression-like behaviour.

    Science.gov (United States)

    Paternain, Laura; Martisova, Eva; Campión, Javier; Martínez, J Alfredo; Ramírez, Maria J; Milagro, Fermin I

    2016-02-15

    Adverse early life events are associated with altered stress responsiveness and metabolic disturbances in the adult life. Dietary methyl donor supplementation could be able to reverse the negative effects of maternal separation by affecting DNA methylation in the brain. In this study, maternal separation during lactation reduced body weight gain in the female adult offspring without affecting food intake, and altered total and HDL-cholesterol levels. Also, maternal separation induced a cognitive deficit as measured by NORT and an increase in the immobility time in the Porsolt forced swimming test, consistent with increased depression-like behaviour. An 18-week dietary supplementation with methyl donors (choline, betaine, folate and vitamin B12) from postnatal day 60 also reduced body weight without affecting food intake. Some of the deleterious effects induced by maternal separation, such as the abnormal levels of total and HDL-cholesterol, but especially the depression-like behaviour as measured by the Porsolt test, were reversed by methyl donor supplementation. Also, the administration of methyl donors increased total DNA methylation (measured by immunohistochemistry) and affected the expression of insulin receptor in the hippocampus of the adult offspring. However, no changes were observed in the DNA methylation status of insulin receptor and corticotropin-releasing hormone (CRH) promoter regions in the hypothalamus. In summary, methyl donor supplementation reversed some of the deleterious effects of an early life-induced model of depression in rats and altered the DNA methylation profile in the brain. PMID:26628207

  1. Phase Transition in Limiting Distributions of Coherence of High-Dimensional Random Matrices

    CERN Document Server

    Cai, Tony

    2011-01-01

    The coherence of a random matrix, which is defined to be the largest magnitude of the Pearson correlation coefficients between the columns of the random matrix, is an important quantity for a wide range of applications including high-dimensional statistics and signal processing. Inspired by these applications, this paper studies the limiting laws of the coherence of $n\\times p$ random matrices for a full range of the dimension $p$ with a special focus on the ultra high-dimensional setting. Assuming the columns of the random matrix are independent random vectors with a common spherical distribution, we give a complete characterization of the behavior of the limiting distributions of the coherence. More specifically, the limiting distributions of the coherence are derived separately for three regimes: $\\frac{1}{n}\\log p \\to 0$, $\\frac{1}{n}\\log p \\to \\beta\\in (0, \\infty)$, and $\\frac{1}{n}\\log p \\to\\infty$. The results show that the limiting behavior of the coherence differs significantly in different regimes a...

  2. Metabolic product response profiles of Cherax quadricarinatus towards white spot syndrome virus infection.

    Science.gov (United States)

    Fan, Weiwei; Ye, Yangfang; Chen, Zhen; Shao, Yina; Xie, Xiaolu; Zhang, Weiwei; Liu, Hai-Peng; Li, Chenghua

    2016-08-01

    White spot syndrome virus (WSSV) is one of the most devastating viral pathogens in both shrimp and crayfish farms, which often causes disease outbreak and leads to massive moralities with significant economic losses of aquaculture. However, limited research has been carried out on the intrinsic mechanisms toward WSSV challenge at the metabolic level. To gain comprehensive insight into metabolic responses induced by WSSV, we applied an NMR approach to investigate metabolic changes of crayfish gill and hepatopancreas infected by WSSV for 1, 6 and 12 h. In gill, an enhanced energy metabolism was observed in WSSV-challenged crayfish samples at 1 h, as marked by increased glucose, alanine, methionine, glutamate and uracil. Afterwards, energy metabolism, lipid metabolism as well as osmoregulation were markedly increased at 6 hpi, as shown by elevated glucose, alanine, methionine, fumarate, tyrosine, tryptophan, histidine, phosphorylcholine, betaine and uracil, whereas no obvious metabolites change was detected at 12 hpi. As for hepatopancreas, disturbed lipid metabolism and induced osmotic regulation was found at 6 hpi based on the metabolic biomarkers such as branched chain amino acids, threonine, alanine, methionine, glutamate, glutamine, tyrosine, phenylalanine, lactate and lipid. However, no obvious metabolic change was shown in hepatopancreas at both 1 hpi and 12 hpi. Taken together, our present results provided essential metabolic information about host-pathogen interactions in crayfish, which shed new light on our understanding of WSSV infection at metabolic level. PMID:27068762

  3. A metabonomic evaluation of the monocrotaline-induced sinusoidal obstruction syndrome (SOS) in rats

    Energy Technology Data Exchange (ETDEWEB)

    Conotte, R.; Colet, J.-M., E-mail: jean-marie.colet@umons.ac.be

    2014-04-15

    The main curative treatment of colorectal cancer remains the surgery. However, when metastases are suspected, surgery is followed by a preventive chemotherapy using oxaliplatin which, unfortunately, may cause liver sinusoidal obstruction syndrome (SOS). Such hepatic damage is barely detected during or after chemotherapy due to a lack of effective diagnostic procedures, but liver biopsy. The primary objective of the present study was to identify potential early diagnosis biomarkers of SOS using a metabonomic approach. SOS was induced in rats by monocrotaline, a prototypical toxic substance. {sup 1}H NMR spectroscopy analysis of urine samples collected from rats treated with monocrotaline showed significant metabolic changes as compared to controls. During a first phase, cellular protective mechanisms such as an increased synthesis of GSH (reduced taurine) and the recruitment of cell osmolytes in the liver (betaine) were seen. In the second phase, the disturbance of the urea cycle (increased ornithine and urea reduction) leading to the depletion of NO, the alteration in the GSH synthesis (increased creatine and GSH precursors (glutamate, dimethylglycine and sarcosine)), and the liver necrosis (decrease taurine and increase creatine) all indicate the development of SOS. - Highlights: • Urine metabonomic profiles of SOS have been identified. • Urine osmoprotectants and anti-oxidants indicated an initial liver protection. • Liver necrosis was demonstrated by increased urine levels of taurine and creatine. • NO depletion was suggested by changes in ornithine and urea.

  4. Choline uptake in Agrobacterium tumefaciens by the high-affinity ChoXWV transporter.

    Science.gov (United States)

    Aktas, Meriyem; Jost, Kathinka A; Fritz, Christiane; Narberhaus, Franz

    2011-10-01

    Agrobacterium tumefaciens is a facultative phytopathogen that causes crown gall disease. For successful plant transformation A. tumefaciens requires the membrane lipid phosphatidylcholine (PC), which is produced via the methylation and the PC synthase (Pcs) pathways. The latter route is dependent on choline. Although choline uptake has been demonstrated in A. tumefaciens, the responsible transporter(s) remained elusive. In this study, we identified the first choline transport system in A. tumefaciens. The ABC-type choline transporter is encoded by the chromosomally located choXWV operon (ChoX, binding protein; ChoW, permease; and ChoV, ATPase). The Cho system is not critical for growth and PC synthesis. However, [14C]choline uptake is severely reduced in A. tumefaciens choX mutants. Recombinant ChoX is able to bind choline with high affinity (equilibrium dissociation constant [KD] of ≈2 μM). Since other quaternary amines are bound by ChoX with much lower affinities (acetylcholine, KD of ≈80 μM; betaine, KD of ≈470 μM), the ChoXWV system functions as a high-affinity transporter with a preference for choline. Two tryptophan residues (W40 and W87) located in the predicted ligand-binding pocket are essential for choline binding. The structural model of ChoX built on Sinorhizobium meliloti ChoX resembles the typical structure of substrate binding proteins with a so-called "Venus flytrap mechanism" of substrate binding. PMID:21803998

  5. Lipidomic and transcriptomic analyses of Chlamydomonas reinhardtii under heat stress unveil a direct route for the conversion of membrane lipids into storage lipids.

    Science.gov (United States)

    Légeret, B; Schulz-Raffelt, M; Nguyen, H M; Auroy, P; Beisson, F; Peltier, G; Blanc, G; Li-Beisson, Y

    2016-04-01

    Studying how photosynthetic cells modify membrane lipids in response to heat stress is important to understand how plants and microalgae adapt to daily fluctuations in temperature and to investigate new lipid pathways. Here, we investigate changes occurring in lipid molecular species and lipid metabolism genes during early response to heat stress in the model photosynthetic microorganism Chlamydomonas reinhardtii. Lipid molecular species analyses revealed that, after 60 min at 42 °C, a strong decrease in specific polyunsaturated membrane lipids was observed together with an increase in polyunsaturated triacylglycerols (TAGs) and diacylglycerols (DAGs). The fact that decrease in the major chloroplastic monogalactosyldiacylglycerol sn1-18:3/sn2-16:4 was mirrored by an accumulation of DAG sn1-18:3/sn2-16:4 and TAG sn1-18:3/sn2-16:4/sn3-18:3 indicated that newly accumulated TAGs were formed via direct conversion of monogalactosyldiacylglycerols to DAGs then TAGs. Lipidomic analyses showed that the third fatty acid of a TAG likely originated from a phosphatidylethanolamine or a diacylglyceryl-O-4'-(N,N,N,-trimethyl)-homoserine betaine lipid species. Candidate genes for this TAG synthesis pathway were provided through comparative transcriptomic analysis and included a phospholipase A2 homolog and the DAG acyltransferase DGTT1. This study gives insights into the molecular events underlying changes in membrane lipids during heat stress and reveals an alternative route for TAG synthesis. PMID:26477535

  6. Hydrogen Sulfide-Mediated Polyamines and Sugar Changes Are Involved in Hydrogen Sulfide-Induced Drought Tolerance in Spinacia oleracea Seedlings

    Science.gov (United States)

    Chen, Juan; Shang, Yu-Ting; Wang, Wen-Hua; Chen, Xi-Yan; He, En-Ming; Zheng, Hai-Lei; Shangguan, Zhouping

    2016-01-01

    Hydrogen sulfide (H2S) is a newly appreciated participant in physiological and biochemical regulation in plants. However, whether H2S is involved in the regulation of plant responses to drought stress remains unclear. Here, the role of H2S in the regulation of drought stress response in Spinacia oleracea seedlings is reported. First, drought stress dramatically decreased the relative water content (RWC) of leaves, photosynthesis, and the efficiency of PSII. Moreover, drought caused the accumulation of ROS and increased the MDA content. However, the application of NaHS counteracted the drought-induced changes in these parameters. Second, NaHS application increased the water and osmotic potential of leaves. Additionally, osmoprotectants such as proline and glycinebetaine (GB) content were altered by NaHS application under drought conditions, suggesting that osmoprotectant contributes to H2S-induced drought resistance. Third, the levels of soluble sugars and polyamines (PAs) were increased differentially by NaHS application in S. oleracea seedlings. Moreover, several genes related to PA and soluble sugar biosynthesis, as well as betaine aldehyde dehydrogenase (SoBADH), choline monooxygenase (SoCMO), and aquaporin (SoPIP1;2), were up-regulated by H2S under drought stress. These results suggest that H2S contributes to drought tolerance in S. oleracea through its effect on the biosynthesis of PAs and soluble sugars. Additionally, GB and trehalose also play key roles in enhancing S. oleracea drought resistance. PMID:27540388

  7. The Pediatric Methionine Requirement Should Incorporate Remethylation Potential and Transmethylation Demands.

    Science.gov (United States)

    Robinson, Jason L; Bertolo, Robert F

    2016-05-01

    The metabolic demand for methionine is great in neonates. Indeed, methionine is the only indispensable sulfur amino acid and is required not only for protein synthesis and growth but is also partitioned to a greater extent to transsulfuration for cysteine and taurine synthesis and to >50 transmethylation reactions that serve to methylate DNA and synthesize metabolites, including creatine and phosphatidylcholine. Therefore, the pediatric methionine requirement must accommodate the demands of rapid protein turnover as well as vast nonprotein demands. Because cysteine spares the methionine requirement, it is likely that the dietary provision of transmethylation products can also feasibly spare methionine. However, understanding the requirement of methionine is further complicated because demethylated methionine can be remethylated by the dietary methyl donors folate and betaine (derived from choline). Intakes of dietary methyl donors are highly variable, which is of particular concern for newborns. It has been demonstrated that many populations have enhanced requirements for these nutrients, and nutrient fortification may exacerbate this phenomenon by selecting phenotypes that increase methyl requirements. Moreover, higher transmethylation rates can limit methyl supply and affect other transmethylation reactions as well as protein synthesis. Therefore, careful investigations are needed to determine how remethylation and transmethylation contribute to the methionine requirement. The purpose of this review is to support our hypothesis that dietary methyl donors and consumers can drive methionine availability for protein synthesis and transmethylation reactions. We argue that nutritional strategies in neonates need to ensure that methionine is available to meet requirements for growth as well as for transmethylation products. PMID:27184279

  8. Response of Halomonas campisalis to saline stress: changes in growth kinetics, compatible solute production and membrane phospholipid fatty acid composition.

    Science.gov (United States)

    Aston, John E; Peyton, Brent M

    2007-09-01

    The haloalkaliphile Halomonas campisalis, isolated near Soap Lake, Washington, was grown under both aerobic and denitrifying conditions from 0 to 260 g L(-1) NaCl, with optimal growth occurring at 20 and 30 g L(-1) NaCl, respectively. Halomonas campisalis was observed to produce high concentrations of compatible solutes, most notably ectoine (up to 500 mM within the cytoplasm), but hydroxyectoine and glycine betaine were also detected. The types and amounts of compatible solutes produced depended on salinity and specific growth rate, as well as on the terminal electron acceptor available (O(2) or NO(3) (-)). A decrease in ectoine production was observed with NO(3) (-) as compared with O(2) as the terminal electron acceptor. In addition, changes in the phospholipid fatty acid composition were measured with changing salinity. An increase in trans fatty acids was observed in the absence of salinity, and may be a response to membrane instability. Cyclic fatty acids were also observed to increase, both in the absence of salinity, and at very high salinities, indicating cell stress at these conditions. PMID:17651393

  9. 1H NMR-Based Metabolomic Analysis of Sub-Lethal Perfluorooctane Sulfonate Exposure to the Earthworm, Eisenia fetida, in Soil

    Directory of Open Access Journals (Sweden)

    Myrna J. Simpson

    2013-08-01

    Full Text Available 1H NMR-based metabolomics was used to measure the response of Eisenia fetida earthworms after exposure to sub-lethal concentrations of perfluorooctane sulfonate (PFOS in soil. Earthworms were exposed to a range of PFOS concentrations (five, 10, 25, 50, 100 or 150 mg/kg for two, seven and fourteen days. Earthworm tissues were extracted and analyzed by 1H NMR. Multivariate statistical analysis of the metabolic response of E. fetida to PFOS exposure identified time-dependent responses that were comprised of two separate modes of action: a non-polar narcosis type mechanism after two days of exposure and increased fatty acid oxidation after seven and fourteen days of exposure. Univariate statistical analysis revealed that 2-hexyl-5-ethyl-3-furansulfonate (HEFS, betaine, leucine, arginine, glutamate, maltose and ATP are potential indicators of PFOS exposure, as the concentrations of these metabolites fluctuated significantly. Overall, NMR-based metabolomic analysis suggests elevated fatty acid oxidation, disruption in energy metabolism and biological membrane structure and a possible interruption of ATP synthesis. These conclusions obtained from analysis of the metabolic profile in response to sub-lethal PFOS exposure indicates that NMR-based metabolomics is an excellent discovery tool when the mode of action (MOA of contaminants is not clearly defined.

  10. 1H NMR-Based Metabolomic Analysis of Sub-Lethal Perfluorooctane Sulfonate Exposure to the Earthworm, Eisenia fetida, in Soil.

    Science.gov (United States)

    Lankadurai, Brian P; Furdui, Vasile I; Reiner, Eric J; Simpson, André J; Simpson, Myrna J

    2013-01-01

    1H NMR-based metabolomics was used to measure the response of Eisenia fetida earthworms after exposure to sub-lethal concentrations of perfluorooctane sulfonate (PFOS) in soil. Earthworms were exposed to a range of PFOS concentrations (five, 10, 25, 50, 100 or 150 mg/kg) for two, seven and fourteen days. Earthworm tissues were extracted and analyzed by 1H NMR. Multivariate statistical analysis of the metabolic response of E. fetida to PFOS exposure identified time-dependent responses that were comprised of two separate modes of action: a non-polar narcosis type mechanism after two days of exposure and increased fatty acid oxidation after seven and fourteen days of exposure. Univariate statistical analysis revealed that 2-hexyl-5-ethyl-3-furansulfonate (HEFS), betaine, leucine, arginine, glutamate, maltose and ATP are potential indicators of PFOS exposure, as the concentrations of these metabolites fluctuated significantly. Overall, NMR-based metabolomic analysis suggests elevated fatty acid oxidation, disruption in energy metabolism and biological membrane structure and a possible interruption of ATP synthesis. These conclusions obtained from analysis of the metabolic profile in response to sub-lethal PFOS exposure indicates that NMR-based metabolomics is an excellent discovery tool when the mode of action (MOA) of contaminants is not clearly defined. PMID:24958147

  11. Beetroot juice and exercise performance

    Directory of Open Access Journals (Sweden)

    Ormsbee MJ

    2013-11-01

    Full Text Available Michael J Ormsbee,1 Jon Lox,1 Paul J Arciero2 1Department of Nutrition, Food, and Exercise Sciences, Human Performance Lab, Florida State University, Tallahassee, FL, USA; 2Department of Health and Exercise Sciences, Human Nutrition and Metabolism Lab, Skidmore College, Saratoga Springs, NY, USA Abstract: Increased sales and consumption of organic and natural foods reflect consumers heightened interest in promoting health and improving athletic performance. Of these products, beetroot and its constituents have become increasingly popular in the arena of exercise performance, mainly due to the high concentrations of nitrate. Studies have indicated beetroot juice (BRJ may improve exercise time to exhaustion, running performance, and increase muscular efficiency during moderate intensity exercise. The purpose of this review is to examine the efficacy of BRJ to serve as an ergogenic aid in athletic performance. It appears that BRJ may provide modest performance enhancement; however, more research is needed to clearly identify mechanisms of action and proper dosing patterns to maximize the performance benefits of BRJ. Keywords: beetroot, nitrate, betaine, sports nutrition

  12. Experiments on one-stage and two-stage anaerobic treatment of beetroot slop. Versuche zur ein- und zweistufigen anaeroben Behandlung von Ruebenmelasseschlempe

    Energy Technology Data Exchange (ETDEWEB)

    Fiebig, R.

    1987-12-17

    The experiments in this work, particularly in the sludge-bed process, confirm how extremely difficult anaerobic treatment of beetroot slop is. Use of the undiluted slop for the one-phase treatment in a sludge bed reactor mostly resulted only in the acidification of the biologically degradable materials, even if the retention time was more than 20 days. The high content of nitrogenous compounds, especially betaine, proved to be one of the biggest problems in the anaerobic treatment, probably along with the high content of salt and the presence of inhibiting Maillard products. Owing to concentrations of ammonia of, in part, more than 4 grams/litre resulting from the degradation of the nitrogenous compounds, firstly no properly grained, sedimentable sludge flakes were formed, and secondly, with a pH going up simultaneously to the range of 8.0, methane formation was considerably inhibited. In the two-phase process, again, a chemical oxygen consumption of more than 70% was achieved only if the slop was diluted in a ratio of at least 0.7 to 1; at the same time, a rise of the pH to over 7.5 had to be avoided. Since the acidification and the methane stages could not be optimized separately, the two-stage process, given a constant composition of the water, practically proved of no advantage.

  13. Manila clam Venerupis philippinarum as a biomonitor to metal pollution

    Science.gov (United States)

    Wu, Huifeng; Ji, Chenglong; Wang, Qing; Liu, Xiaoli; Zhao, Jianmin; Feng, Jianghua

    2013-01-01

    The Manila clam Venerupis philippinarum is a good biomonitor/bioindicator to marine metal pollution and is frequently used in aquatic toxicology. Two dominant pedigrees (white and zebra) of clam are distributed in the Bohai Sea; however, little attention has been paid to potential biological differences between these two pedigrees. In this study, we tested the sensitivity of both pedigrees to marine metal (cadmium and zinc) pollution biomonitoring and marine environmental toxicology. Results demonstrate significant biological differences in gills of white and zebra clams based on metabolic profiles and antioxidant enzyme activities. In addition, we found that hypotaurine, malonate and homarine were relatively high in white clam gills, while alanine, arginine, glutamate, succinate, 4-aminobutyrate, taurine and betaine were high in zebra clam gills. Zebra clam gills were also more sensitive to a mixture of Cd and Zn, as shown by antioxidant enzyme activities and metabolic profiles, but white clam gills could accumulate more Zn. Therefore, we suggest that the white pedigree can be used as a biomonitor to marine Zn pollution, whereas the zebra pedigree can be used for toxicology studies on Cd and Zn mixed pollution.

  14. Hyperhomocysteinemia,endoplasmic reticulum stress,and alcoholic liver injury

    Institute of Scientific and Technical Information of China (English)

    Cheng Ji; Neil Kaplowitz

    2004-01-01

    Deficiencies in vitamins or other factors (B6, B12, folic acid,betaine) and genetic disorders for the metabolism of the non-protein amino acid-homocysteine (Hcy) lead to hyperhomocysteinemia (Hhcy). Hhcy is an integral component of several disorders including cardiovascular disease, neurodegeneration, diabetes and alcoholic liver disease. Hhcy unleashes mediators of inflammation such as NFκB, IL-1β, IL-6, and IL-8, increases production of intracellular superoxide anion causing oxidative stress and reducing intracellular level of nitric oxide (NO), and induces endoplasmic reticulum (ER) stress which can explain many processes of Hcy-promoted cell injury such as apoptosis,fat accumulation, and inflammation. Animal models have played an important role in determining the biological effects of Hhcy. ER stress may also be involved in other liver diseases such as α1-antitrypsin (α1-AT) deficiency and hepatitis C and/or B virus infection. Future research should evaluate the possible potentiative effects of alcohol and hepatic virus infection on ER stress-induced liver injury, study potentially beneficial effects of lowering Hcy and preventing ER stress in alcoholic humans,and examine polymorphism of Hcy metabolizing enzymes as potential risk-factors for the development of Hhcy and liver disease.

  15. Inventory of Fatty Acid Desaturases in the Pennate Diatom Phaeodactylum tricornutum

    Directory of Open Access Journals (Sweden)

    Lina-Juana Dolch

    2015-03-01

    Full Text Available The diatom Phaeodactylum is rich in very long chain polyunsaturated fatty acids (PUFAs. Fatty acid (FA synthesis, elongation, and desaturation have been studied in depth in plants including Arabidopsis, but for secondary endosymbionts the full picture remains unclear. FAs are synthesized up to a chain length of 18 carbons inside chloroplasts, where they can be incorporated into glycerolipids. They are also exported to the ER for phospho- and betaine lipid syntheses. Elongation of FAs up to 22 carbons occurs in the ER. PUFAs can be reimported into plastids to serve as precursors for glycerolipids. In both organelles, FA desaturases are present, introducing double bonds between carbon atoms and giving rise to a variety of molecular species. In addition to the four desaturases characterized in Phaeodactylum (FAD2, FAD6, PtD5, PtD6, we identified eight putative desaturase genes. Combining subcellular localization predictions and comparisons with desaturases from other organisms like Arabidopsis, we propose a scheme at the whole cell level, including features that are likely specific to secondary endosymbionts.

  16. Bioprospecting of Marine Macrophytes Using MS-Based Lipidomics as a New Approach

    Directory of Open Access Journals (Sweden)

    Elisabete Maciel

    2016-03-01

    Full Text Available The marine environment supports a remarkable diversity of organisms which are a potential source of natural products with biological activities. These organisms include a wide variety of marine plants (from micro- to macrophytes, which have been used in the food and pharmaceutical industry. However, the biochemistry and biological activities of many of these macrophytes (namely macroalgae and halophytes, including seagrasses are still far from being fully explored. Most popular bioactive components include polysaccharides, peptides, phenolics and fatty acids (FAs. Polar lipids (glycolipids, phospholipids and betaine lipids are emerging as novel value-added bioactive phytochemicals, rich in n-3 FA, with high nutritional value and health beneficial effects for the prevention of chronic diseases. Polar lipids account various combinations of polar groups, fatty acyl chains and backbone structures. The polar lipidome of macrophytes is remarkably diverse, and its screening represents a significant analytical challenge. Modern research platforms, particularly mass spectrometry (MS-based lipidomic approaches, have been recently used to address this challenge and are here reviewed. The application of lipidomics to address lipid composition of marine macrophytes will contribute to the stimulation of further research on this group and foster the exploration of novel applications.

  17. Nanoscale Control Over Interfacial Properties in Mixed Reverse Micelles Formulated by Using Sodium 1,4-bis-2-ethylhexylsulfosuccinate and Tri-n-octyl Phosphine Oxide Surfactants.

    Science.gov (United States)

    Odella, Emmanuel; Falcone, R Darío; Silber, Juana J; Correa, N Mariano

    2016-08-01

    The interfacial properties of pure reverse micelles (RMs) are a consequence of the magnitude and nature of noncovalent interactions between confined water and the surfactant polar head. Addition of a second surfactant to form mixed RMs is expected to influence these interactions and thus affect these properties at the nanoscale level. Herein, pure and mixed RMs stabilized by sodium 1,4-bis-2-ethylhexylsulfosuccinate and tri-n-octyl phosphine oxide (TOPO) surfactants in n-heptane were formulated and studied by varying both the water content and the TOPO mole fraction. The microenvironment generated was sensed by following the solvatochromic behavior of the 1-methyl-8-oxyquinolinium betaine probe and (31) P NMR spectroscopy. The results reveal unique properties of mixed RMs and we give experimental evidence that free water can be detected in the polar core of the mixed RMs at very low water content. We anticipate that these findings will have an impact on the use of such media as nanoreactors for many types of chemical reactions, such as enzymatic reactions and nanoparticle synthesis. PMID:27128745

  18. Decrease in toxic potential of mixed tensides maintained below the critical micelle concentration: an in vitro study.

    Science.gov (United States)

    Benassi, L; Bertazzoni, G; Magnoni, C; Rinaldi, M; Fontanesi, C; Seidenari, S

    2003-01-01

    Sodium lauryl sulphate (SLS) is an anionic tenside widely utilized in commercial topical preparations that may cause skin irritation. It has been shown that the barrier damage caused by SLS in vivo is lower when SLS is used in combination with other tensides which are able to reduce the critical micelle concentration (CMC). The aim of our study was to evaluate if the cytotoxic effect of SLS is reduced by the association with different tensides also at concentrations well below the CMC. Normal human keratinocytes from plastic surgery were grown in serum-free medium. At subconfluency, the cells were treated with SLS at a dose of 0.0025% in combination with cocamidopropyl betaine, Tween 20 and Tween 80 at the minimum toxic dose. Following tenside treatment, the culture medium was changed, and after 24 h the cells were collected for (3)H-thymidine incorporation, the MTT (3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyl tetrazolium bromide) assay and neutral red (NR) uptake. The cytotoxic effect on normal human keratinocytes, as evaluated by (3)H-thymidine incorporation, MTT assay and NR uptake, was significantly decreased by the combination with all the tested tensides. The correlation between cytotoxicity and physical properties was also studied by a conductimetric assay to investigate the mechanism involved in this toxicity reduction. PMID:12677096

  19. An Investigation into the Antiobesity Effects of Morinda citrifolia L. Leaf Extract in High Fat Diet Induced Obese Rats Using a 1H NMR Metabolomics Approach

    Directory of Open Access Journals (Sweden)

    Najla Gooda Sahib Jambocus

    2016-01-01

    Full Text Available The prevalence of obesity is increasing worldwide, with high fat diet (HFD as one of the main contributing factors. Obesity increases the predisposition to other diseases such as diabetes through various metabolic pathways. Limited availability of antiobesity drugs and the popularity of complementary medicine have encouraged research in finding phytochemical strategies to this multifaceted disease. HFD induced obese Sprague-Dawley rats were treated with an extract of Morinda citrifolia L. leaves (MLE 60. After 9 weeks of treatment, positive effects were observed on adiposity, fecal fat content, plasma lipids, and insulin and leptin levels. The inducement of obesity and treatment with MLE 60 on metabolic alterations were then further elucidated using a 1H NMR based metabolomics approach. Discriminating metabolites involved were products of various metabolic pathways, including glucose metabolism and TCA cycle (lactate, 2-oxoglutarate, citrate, succinate, pyruvate, and acetate, amino acid metabolism (alanine, 2-hydroxybutyrate, choline metabolism (betaine, creatinine metabolism (creatinine, and gut microbiome metabolism (hippurate, phenylacetylglycine, dimethylamine, and trigonelline. Treatment with MLE 60 resulted in significant improvement in the metabolic perturbations caused obesity as demonstrated by the proximity of the treated group to the normal group in the OPLS-DA score plot and the change in trajectory movement of the diseased group towards the healthy group upon treatment.

  20. An Investigation into the Antiobesity Effects of Morinda citrifolia L. Leaf Extract in High Fat Diet Induced Obese Rats Using a 1H NMR Metabolomics Approach

    Science.gov (United States)

    Gooda Sahib Jambocus, Najla; Saari, Nazamid; Ismail, Amin; Mahomoodally, Mohamad Fawzi; Abdul Hamid, Azizah

    2016-01-01

    The prevalence of obesity is increasing worldwide, with high fat diet (HFD) as one of the main contributing factors. Obesity increases the predisposition to other diseases such as diabetes through various metabolic pathways. Limited availability of antiobesity drugs and the popularity of complementary medicine have encouraged research in finding phytochemical strategies to this multifaceted disease. HFD induced obese Sprague-Dawley rats were treated with an extract of Morinda citrifolia L. leaves (MLE 60). After 9 weeks of treatment, positive effects were observed on adiposity, fecal fat content, plasma lipids, and insulin and leptin levels. The inducement of obesity and treatment with MLE 60 on metabolic alterations were then further elucidated using a 1H NMR based metabolomics approach. Discriminating metabolites involved were products of various metabolic pathways, including glucose metabolism and TCA cycle (lactate, 2-oxoglutarate, citrate, succinate, pyruvate, and acetate), amino acid metabolism (alanine, 2-hydroxybutyrate), choline metabolism (betaine), creatinine metabolism (creatinine), and gut microbiome metabolism (hippurate, phenylacetylglycine, dimethylamine, and trigonelline). Treatment with MLE 60 resulted in significant improvement in the metabolic perturbations caused obesity as demonstrated by the proximity of the treated group to the normal group in the OPLS-DA score plot and the change in trajectory movement of the diseased group towards the healthy group upon treatment. PMID:26798649

  1. An Investigation into the Antiobesity Effects of Morinda citrifolia L. Leaf Extract in High Fat Diet Induced Obese Rats Using a (1)H NMR Metabolomics Approach.

    Science.gov (United States)

    Gooda Sahib Jambocus, Najla; Saari, Nazamid; Ismail, Amin; Khatib, Alfi; Mahomoodally, Mohamad Fawzi; Abdul Hamid, Azizah

    2016-01-01

    The prevalence of obesity is increasing worldwide, with high fat diet (HFD) as one of the main contributing factors. Obesity increases the predisposition to other diseases such as diabetes through various metabolic pathways. Limited availability of antiobesity drugs and the popularity of complementary medicine have encouraged research in finding phytochemical strategies to this multifaceted disease. HFD induced obese Sprague-Dawley rats were treated with an extract of Morinda citrifolia L. leaves (MLE 60). After 9 weeks of treatment, positive effects were observed on adiposity, fecal fat content, plasma lipids, and insulin and leptin levels. The inducement of obesity and treatment with MLE 60 on metabolic alterations were then further elucidated using a (1)H NMR based metabolomics approach. Discriminating metabolites involved were products of various metabolic pathways, including glucose metabolism and TCA cycle (lactate, 2-oxoglutarate, citrate, succinate, pyruvate, and acetate), amino acid metabolism (alanine, 2-hydroxybutyrate), choline metabolism (betaine), creatinine metabolism (creatinine), and gut microbiome metabolism (hippurate, phenylacetylglycine, dimethylamine, and trigonelline). Treatment with MLE 60 resulted in significant improvement in the metabolic perturbations caused obesity as demonstrated by the proximity of the treated group to the normal group in the OPLS-DA score plot and the change in trajectory movement of the diseased group towards the healthy group upon treatment. PMID:26798649

  2. A multiplexed targeted assay for high-throughput quantitative analysis of serum methylamines by ultra performance liquid chromatography coupled to high resolution mass spectrometry.

    Science.gov (United States)

    Kadar, Hanane; Dubus, Justine; Dutot, Jérémie; Hedjazi, Lyamine; Srinivasa, Suman; Fitch, Kathleen V; Grinspoon, Steven K; Nicholson, Jeremy K; Dumas, Marc-Emmanuel; Gauguier, Dominique

    2016-05-01

    Methylamines are biologically-active metabolites present in serum and urine samples, which play complex roles in metabolic diseases. Methylamines can be detected by proton nuclear magnetic resonance (NMR), but specific methods remain to be developed for their routine assay in human serum in clinical settings. Here we developed and validated a novel reliable "methylamine panel" method for simultaneous quantitative analysis of trimethylamine (TMA), its major detoxification metabolite trimethylamine-N-oxide (TMAO), and precursors choline, betaine and l-carnitine in human serum using Ultra Performance Liquid Chromatography (UPLC) coupled to High Resolution Mass Spectrometry (HRMS). Metabolite separation was carried out on a HILIC stationary phase. For all metabolites, the assay was linear in the range of 0.25-12.5 μmol/L and enabled to reach limit of detection of about 0.10 μmol/L. Relative standard deviations were below 16% for the three levels of concentrations. We demonstrated the strong reliability and robustness of the method, which was applied to serum samples from healthy individuals to establish the range of concentrations of the metabolites and their correlation relationships and detect gender differences. Our data provide original information for implementing in a clinical environment a MS-based diagnostic method with potential for targeted metabolic screening of patients at risk of cardiometabolic diseases. PMID:27036856

  3. Cobalamin C deficiency in an adolescent with altered mental status and anorexia.

    Science.gov (United States)

    Rahmandar, Maria H; Bawcom, Amanda; Romano, Mary E; Hamid, Rizwan

    2014-12-01

    Although cobalamin (cbl) C deficiency is the most common inherited disorder of vitamin B12 metabolism, the late-onset form of the disease can be difficult to recognize because it has a broad phenotypic spectrum. In this report, we describe an adolescent female exposed to unknown illicit substances and sexual abuse who presented with psychosis, anorexia, seizures, and ataxia. The patient's diagnosis was delayed until a metabolic workup was initiated, revealing hyperhomocysteinemia, low normal plasma methionine, and methylmalonic aciduria. Ultimately, cblC deficiency was confirmed when molecular testing showed compound heterozygosity for mutations (c.271dupA and c.482G>A) in the MMACHC gene. This diagnosis led to appropriate treatment with hydroxocobalamin, betaine, and folate, which resulted in improvement of her clinical symptoms and laboratory values. This patient demonstrates a previously unrecognized presentation of late-onset cblC deficiency. Although neuropsychiatric symptoms are common in late-onset disease, seizures and cerebellar involvement are not. Furthermore, anorexia has not been previously described in these patients. This case emphasizes that inborn errors of metabolism should be part of the differential diagnosis for a teenager presenting with altered mental status, especially when the diagnosis is challenging or neurologic symptoms are unexplained. Correct diagnosis of this condition is important because treatment is available and can result in clinical improvement.(1.) PMID:25367534

  4. Facile Synthesis of Calcium Carbonate Nanoparticles from Cockle Shells

    Directory of Open Access Journals (Sweden)

    Kh. Nurul Islam

    2012-01-01

    Full Text Available A simple and low-cost method for the synthesis of calcium carbonate nanoparticles from cockle shells was described. Polymorphically, the synthesized nanoparticles were aragonites which are biocompatible and thus frequently used in the repair of fractured bone and development of advanced drug delivery systems, tissue scaffolds and anticarcinogenic drugs. The rod-shaped and pure aragonite particles of 30±5 nm in diameter were reproducibly synthesized when micron-sized cockle shells powders were mechanically stirred for 90 min at room temperature in presence of a nontoxic and nonhazardous biomineralization catalyst, dodecyl dimethyl betaine (BS-12. The findings were verified using a combination of analytical techniques such as variable pressure scanning electron microscopy (VPSEM, transmission electron microscopy (TEM, Fourier transmission infrared spectroscopy (FT-IR, X-ray diffraction spectroscopy (XRD, and energy dispersive X-ray analyser (EDX. The reproducibility and low cost of the method suggested that it could be used in industry for the large scale synthesis of aragonite nanoparticles from cockle shells, a low cost and easily available natural resource.

  5. The effect of triazole induced photosynthetic pigments and biochemical constituents of Zea mays L. (Maize) under drought stress

    Science.gov (United States)

    Rajasekar, Mahalingam; Rabert, Gabriel Amalan; Manivannan, Paramasivam

    2016-06-01

    In this investigation, pot culture experiment was carried out to estimate the ameliorating effect of triazole compounds, namely Triadimefon (TDM), Tebuconazole (TBZ), and Propiconazole (PCZ) on drought stress, photosynthetic pigments, and biochemical constituents of Zea mays L. (Maize). From 30 days after sowing (DAS), the plants were subjected to 4 days interval drought (DID) stress and drought with TDM at 15 mg l-1, TBZ at 10 mg l-1, and PCZ at 15 mg l-1. Irrigation at 1-day interval was kept as control. Irrigation performed on alternative day. The plant samples were collected on 40, 50, and 60 DAS and separated into root, stem, and leaf for estimating the photosynthetic pigments and biochemical constituents. Drought and drought with triazole compounds treatment increased the biochemical glycine betaine content, whereas the protein and the pigments contents chlorophyll-a, chlorophyll-b, total chlorophyll, carotenoid, and anthocyanin decreased when compared to control. The triazole treatment mitigated the adverse effects of drought stress by increasing the biochemical potentials and paved the way to overcome drought stress in corn plant.

  6. Manila clam Venerupis philippinarum as a biomonitor to metal pollution

    Institute of Scientific and Technical Information of China (English)

    WU Huifeng; JI Chenglong; WANG Qing; LIU Xiaoli; ZHAO Jianmin; FENG Jianghua

    2013-01-01

    The Manila clam Venerupis philippinarum is a good biomonitor/bioindicator to marine metal pollution and is frequently used in aquatic toxicology.Two dominant pedigrees (white and zebra) of clam are distributed in the Bohai Sea; however,little attention has been paid to potential biological differences between these two pedigrees.In this study,we tested the sensitivity of both pedigrees to marine metal (cadmium and zinc) pollution biomonitoring and marine environmental toxicology.Results demonstrate significant biological differences in gills of white and zebra clams based on metabolic profiles and antioxidant enzyme activities.In addition,we found that hypotaurine,malonate and homarine were relatively high in white clam gills,while alanine,arginine,glutamate,succinate,4-aminobutyrate,taurine and betaine were high in zebra clam gills.Zebra clam gills were also more sensitive to a mixture of Cd and Zn,as shown by antioxidant enzyme activities and metabolic profiles,but white clam gills could accumulate more Zn.Therefore,we suggest that the white pedigree can be used as a biomonitor to marine Zn pollution,whereas the zebra pedigree can be used for toxicology studies on Cd and Zn mixed pollution.

  7. Feed palatability and the alternative protein sources in shrimp feed

    Directory of Open Access Journals (Sweden)

    Chutima Tantikitti

    2014-02-01

    Full Text Available Feed palatability in carnivorous aquaculture species, shrimps in particular, has been crucially related to the presence of compounds acting as attractants that are commonly associated with the prey components under wild conditions. Thus a nutritionally adequate and organoleptically-pleasing diet is essential to achieve satisfactory intake and growth in shrimps. Historically, fishmeal has been an essential dietary component of intensive shrimp cultures because of its nutrient composition and compounds of high attractability. However, in recent years the fishmeal supplies have been dwindling due to over hunting, a diminishing natural fish-stock, elevating prices and market volatility. This has led to search for cheaper sources of suitable protein as fishmeal substitutes. To improve the palatability of diets, various substances have been investigated for their effectiveness in aqua-feed including natural feed ingredients and synthetic flavor substances. For crustacean, attractants characteristically are of low molecular weight, water and ethanol soluble, and amphoteric or basic compounds that are released from potential prey items. Compounds such as free amino acids, especially taurine, hydroxyproline, glycine, arginine, glutamic acid and alanine have been identified to stimulate feeding in shrimps. The same has been identified with organic acids, nucleotides and nucleosides, betaine, and some small peptides. Palatability also has been associated with animal’s past experience with the feed. Understanding the factors that regulate feed palatability is therefore primary for successful shrimp culture.

  8. An insight into the binding between ester-functionalized cationic Gemini surfactant and lysozyme

    Energy Technology Data Exchange (ETDEWEB)

    Patel, Rajan, E-mail: rpatel@jmi.ac.in; Maurya, Jitendra Kumar; Mir, Muzaffar Ul Hassan; Kumari, Meena; Maurya, Neha

    2014-10-15

    The interactions of cationic dodecyl betainate gemini (DBG) surfactant with lysozyme was studied by fluorescence, time resolved fluorescence, UV–visible, circular dichroism, and molecular docking methods. The results showed that the DBG quenched the fluorescence of lysozyme through static quenching mechanism as confirmed by time resolved spectroscopy. The Stern–Volmer quenching constant (K{sub sv}) and relevant thermodynamic parameters such as enthalpy change (ΔH), Gibbs free energy change (ΔG) and entropy change (ΔS) for interaction system were calculated at different temperatures. The results revealed that hydrophobic forces played a major role in the interactions process. The results of synchronous fluorescence, UV–visible and CD spectra demonstrated that the binding of DBG with lysozyme induces conformational changes in lysozyme. Moreover, the molecular modeling results shows the possible binding sites in the interaction system. - Highlights: • DBG quenches the fluorescence intensity of lysozyme and changes its conformation. • Quenching follows the static mechanism. • DBG are first used to investigate their effects on lysozyme. • Hydrophobic interactions played a major role in the binding process.

  9. Whole genome analysis of halotolerant and alkalotolerant plant growth-promoting rhizobacterium Klebsiella sp. D5A.

    Science.gov (United States)

    Liu, Wuxing; Wang, Qingling; Hou, Jinyu; Tu, Chen; Luo, Yongming; Christie, Peter

    2016-01-01

    This research undertook the systematic analysis of the Klebsiella sp. D5A genome and identification of genes that contribute to plant growth-promoting (PGP) traits, especially genes related to salt tolerance and wide pH adaptability. The genome sequence of isolate D5A was obtained using an Illumina HiSeq 2000 sequencing system with average coverages of 174.7× and 200.1× using the paired-end and mate-pair sequencing, respectively. Predicted and annotated gene sequences were analyzed for similarity with the Kyoto Encyclopedia of Genes and Genomes (KEGG) enzyme database followed by assignment of each gene into the KEGG pathway charts. The results show that the Klebsiella sp. D5A genome has a total of 5,540,009 bp with 57.15% G + C content. PGP conferring genes such as indole-3-acetic acid (IAA) biosynthesis, phosphate solubilization, siderophore production, acetoin and 2,3-butanediol synthesis, and N2 fixation were determined. Moreover, genes putatively responsible for resistance to high salinity including glycine-betaine synthesis, trehalose synthesis and a number of osmoregulation receptors and transport systems were also observed in the D5A genome together with numerous genes that contribute to pH homeostasis. These genes reveal the genetic adaptation of D5A to versatile environmental conditions and the effectiveness of the isolate to serve as a plant growth stimulator. PMID:27216548

  10. Acquisition of intact polar lipids from the Prymnesiophyte Phaeocystis globosa by its lytic virus PgV-07T

    Directory of Open Access Journals (Sweden)

    D. S. Maat

    2013-07-01

    Full Text Available Recent studies showed changes in phytoplankton lipid composition during viral infection and have indicated roles for specific lipids in the mechanisms of algal virus-host interaction. To investigate the generality of these findings and obtain a better understanding of the allocation of specific lipids to viruses, we studied the intact polar lipid (IPL composition of virally infected and non-infected cultures of the Prymnesiophyte Phaeocystis globosa G(A and its lytic virus PgV-07T. The P. globosa IPL composition was relatively stable over a diel cycle and not strongly affected by viral infection. Glycolipids, phospholipids and betaine lipids were present in both the host and virus, although specific groups such as the diacylglyceryl-hydroxymethyltrimethyl-β-alanines and the sulfoquinovosyldiacylglycerols, were present in a lower proportion or were not detected in the virus. Viral glycosphingolipids (vGSLs, which have been shown to play a role in the infection strategy of the virus EhV-86, infecting the Prymnesiophyte Emiliania huxleyi CCMP374, were not encountered. Our results show that the involvement of lipids in virus-algal host interactions can be very different amongst virus-algal host systems.

  11. Serum metabolomics study of Traditional Chinese medicine formula intervention to polycystic ovary syndrome.

    Science.gov (United States)

    Lu, Caixia; Zhao, Xinjie; Li, Yan; Li, Yanjie; Yuan, Chengkun; Xu, Fang; Meng, Xiaoyu; Hou, Lihui; Xu, Guowang

    2016-02-20

    Polycystic ovary syndrome (PCOS) is a most common, heterogeneous, complex endocrinopathy disease. Traditional Chinese medicine (TCM) has been used in the treatment of PCOS for many years. However, the mechanism underlying TCM remains obscure and challenging. In this study, 30 PCOS subjects were separated into normoinsulinemic group (NI=13) and hyperinsulinemic group (HI=17), and treated for three menstrual cycles with TCM Formula, Bushen Huatan Formula (BHF). A metabolomics approach based on ultra-high-performance liquid chromatography (UPLC) coupled with linear ion trap Orbi-trap mass spectrometer (LTQ Orbi-trap MS) is used to investigate serum metabolic changes of TCM intervention to PCOS. After BHF intervention for three menstrual cycles, the serum levels of glycerophosphorylethanolamine (GPEA), creatine, creatinine decreased in both NI and HI groups. Furthermore, in NI group, the main manifestation was the changes of phospholipid metabolism. While in HI group, lysine, phenol sulfate, phe-phe etc. decreased, and ornithine, proline, betaine, acetylcholine etc. increased. Combined with clinical biochemical data, BHF was proved effective to PCOS by reducing the inflammatory reaction and oxidative stress. This study also illustrates that the LC-MS based metabolomic approach is a helpful tool to evaluate curative effect and to understand the mechanisms of TCM. PMID:26730509

  12. Mass spectrometric dereplication of nitrogen-containing constituents of black cohosh (Cimicifuga racemosa L.).

    Science.gov (United States)

    Nikolić, Dejan; Gödecke, Tanja; Chen, Shao-Nong; White, Jerry; Lankin, David C; Pauli, Guido F; van Breemen, Richard B

    2012-04-01

    Black cohosh preparations are popular dietary supplements among women seeking alternative treatments for menopausal complaints. For decades, triterpene glycosides and phenolic acids have dominated the phytochemical and biomedical research on this plant. In this study, we provide evidence that black cohosh contains an unexpected and highly diverse group of secondary nitrogenous metabolites previously unknown to exist in this plant. Using a dereplication approach that combines accurate mass measurements, database searches and general knowledge of biosynthetic pathways of natural products, we identified or tentatively identified 73 nitrogen-containing metabolites, many of which are new natural products. The identified compounds belong to several structural groups including alkaloids, amides or esters of hydroxycinnamic acids and betains. Among the alkaloids, several classes such as guanidino alkaloids, isoquinolines and β-carbolines were identified. Fragmentation patterns for major compound classes are discussed, which provides a framework for the discovery of these compounds from other sources. Identification of alkaloids as a well-known group of bioactive natural products represents an important advance in better understanding of the pharmacological profile of black cohosh. PMID:22178683

  13. Effects of remediation amendments on vadose zone microorganisms

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Hannah M.; Tilton, Fred A.

    2012-08-10

    Surfactant-based foam delivery technology has been studied to remediate Hanford 200 area deep vadose zone sediment. However, the surfactants and remediation amendments have an unknown effect on indigenous subsurface microorganisms. Microbial populations are important factors to consider in remediation efforts due to their potential to alter soil geochemistry. This project focuses on measuring microbial metabolic responses to remediation amendments in batch and column studies using Deep Vadose Zone Sediments. Initial studies of the microbes from Hanford 200 area deep vadose zone sediment showed surfactants sodium dodecyl sulfate (SDS) and cocamidopropyl betaine (CAPB) and remediation amendment calcium polysulfide (CPS) had no affect on microbial growth using BiologTM Ecoplates. To move towards a more realistic field analog, soil columns were packed with Hanford 200 Area sediment. Once microbial growth in the column was verified by observing growth of the effluent solution on tryptic soy agar plates, remedial surfactants were injected into the columns, and the resulting metabolic diversity was measured. Results suggest surfactant sodium dodecyl sulfate (SDS) stimulates microbial growth. The soil columns were also visualized using X-ray microtomography to inspect soil packing and possibly probe for evidence of biofilms. Overall, BiologTM Ecoplates provide a rapid assay to predict effects of remediation amendments on Hanford 200 area deep vadose zone microorganisms.

  14. In vivo NMR metabolic profiling of Fabrea salina reveals sequential defense mechanisms against ultraviolet radiation.

    Science.gov (United States)

    Marangoni, Roberto; Paris, Debora; Melck, Dominique; Fulgentini, Lorenzo; Colombetti, Giuliano; Motta, Andrea

    2011-01-01

    Fabrea salina is a hypersaline ciliate that is known to be among the strongest ultraviolet (UV)-resistant microorganisms; however, the molecular mechanisms of this resistance are almost unknown. By means of in vivo NMR spectroscopy, we determined the metabolic profile of living F. salina cells exposed to visible light and to polychromatic UV-B + UV-A + Vis radiation for several different exposure times. We used unsupervised pattern-recognition analysis to compare these profiles and discovered some metabolites whose concentration changed specifically upon UV exposure and in a dose-dependent manner. This variation was interpreted in terms of a two-phase cell reaction involving at least two different pathways: an early response consisting of degradation processes, followed by a late response activating osmoprotection mechanisms. The first step alters the concentration of formate, acetate, and saturated fatty-acid metabolites, whereas the osmoprotection modifies the activity of betaine moieties and other functionally related metabolites. In the latter pathway, alanine, proline, and sugars suggest a possible incipient protein synthesis as defense and/or degeneration mechanisms. We conclude that NMR spectroscopy on in vivo cells is an optimal approach for investigating the effect of UV-induced stress on the whole metabolome of F. salina because it minimizes the invasiveness of the measurement. PMID:21190674

  15. Physiological and biochemical response to drought stress in the leaves of Aegiceras corniculatum and Kandelia obovata.

    Science.gov (United States)

    Guan, Gui-Fang; Wang, You-Shao; Cheng, Hao; Jiang, Zhao-Yu; Fei, Jiao

    2015-10-01

    Drought stress is one of the major abiotic stresses that affects plant growth and metabolism adversely around the world. According to this research, the effect of drought stress on the activity of antioxidative enzymes, soluble sugar, protein and lipid peroxidation were studied in leaves of two mangrove plants, Kandelia obovata and Aegiceras corniculatum. The result showed that superoxide dismutase (SOD) and peroxidase (POD) varied significantly between the leaves and roots studied. The activities increased in different stress levels. The production rate of O 2 (-·) changed with the activity of SOD and POD. Lipid peroxidation was enhanced and Glycine betaine (GB) could decrease the level of malonaldehyde in order to reduce the damage of membrane system. The content of soluble sugar and protein also increased under drought stress and GB helped to eliminate the accumulation of them which somehow enhance the ability of defensing the plants under drought stress. These results indicated that antioxidative activity may play an important role in A. corniculatum and K. obovata and that cell membrane in leaves of K. obovata had greater stability than those of A. corniculatum. Exogenous application of GB had positive effects on A. corniculatum and K. obovata under drought stress which could be products exogenously applied to mangrove plants in order to alleviates the adverse effects. PMID:25956979

  16. Spectroscopic Investigation of H Atom Transfer in a Gas-phase Dissociation Reaction: McLafferty Rearrangement of Model Gas-phase Peptide Ions

    Energy Technology Data Exchange (ETDEWEB)

    Michael J. Van Stipdonk; Dale R. Kersetter; Christopher M. Leavitt; Gary S. Groenewold; Jeffrey Steill; Jos Oomens

    2008-07-01

    Wavelength-selective infrared multiple-photon photodissociation (WS-IRMPD) was used to study isotopically-labeled ions generated by McLafferty rearrangement of nicotinyl-glycine-tert-butyl ester and betaine-glycine-tert-butyl ester. The tert-butyl esters were incubated in a mixture of D2O and CH3OD to induce solution-phase hydrogen-deuterium exchange and then converted to gas-phase ions using electrospray ionization. McLafferty rearrangement was used to generate the free-acid forms of the respective model peptides through transfer of an H atom and elimination of butene. The specific aim was to use vibrational spectra generated by WS-IRMPD technique to determine whether the H atom remains at the acid group, or migrates to one or more of the other exchangeable sites. Comparison of the IRMPD results in the region from 1200-1900 cm-1 to theoretical spectra for different isotopically-labeled isomers clearly shows that the H atom is situated at the C-terminal acid group and migration to amide positions is negligible on the time scale of the experiment. The results of this study suggest that use of the McLafferty rearrangement for peptide esters could be an effective approach for generation of H-atom isotope tracers, in-situ, for subsequent investigation of intra-molecular proton migration during peptide fragmentation studies.

  17. Spectroscopic Investigation of H Atom Transfer in a Gas-phase Dissociation Reaction: McLafferty Rearrangement of Model Gas-phase Peptide Ions

    International Nuclear Information System (INIS)

    Wavelength-selective infrared multiple-photon photodissociation (WS-IRMPD) was used to study isotopically-labeled ions generated by McLafferty rearrangement of nicotinyl-glycine-tert-butyl ester and betaine-glycine-tert-butyl ester. The tert-butyl esters were incubated in a mixture of D2O and CH3OD to induce solution-phase hydrogen-deuterium exchange and then converted to gas-phase ions using electrospray ionization. McLafferty rearrangement was used to generate the free-acid forms of the respective model peptides through transfer of an H atom and elimination of butene. The specific aim was to use vibrational spectra generated by WS-IRMPD technique to determine whether the H atom remains at the acid group, or migrates to one or more of the other exchangeable sites. Comparison of the IRMPD results in the region from 1200-1900 cm-1 to theoretical spectra for different isotopically-labeled isomers clearly shows that the H atom is situated at the C-terminal acid group and migration to amide positions is negligible on the time scale of the experiment. The results of this study suggest that use of the McLafferty rearrangement for peptide esters could be an effective approach for generation of H-atom isotope tracers, in-situ, for subsequent investigation of intra-molecular proton migration during peptide fragmentation studies

  18. SpBADH of the halophyte Sesuvium portulacastrum strongly confers drought tolerance through ROS scavenging in transgenic Arabidopsis.

    Science.gov (United States)

    Yang, Chenglong; Zhou, Yang; Fan, Jie; Fu, Yuhua; Shen, Longbin; Yao, Yuan; Li, Ruimei; Fu, Shaoping; Duan, Ruijun; Hu, Xinwen; Guo, Jianchun

    2015-11-01

    Glycine betaine (GB) accumulation is involved in abiotic stress. However, it is not known whether BADH, the key enzyme of GB synthesis, utilizes the antioxidant system to confer drought stress tolerance. In this study, a novel member of the ALDH10 gene family, SpBADH, was isolated from Sesuvium portulacastrum. The expression of this gene was up-regulated by NaCl, PEG6000, H2O2, ABA and high temperature in S. portulacastrum. SpBADH overexpression in Arabidopsis resulted in higher BADH activity and GB content and might increase tolerance to drought/osmotic stresses, specifically strong tolerance to drought stress. Transgenic lines exhibited lower MDA and H2O2 contents but higher proline, POD, SOD and CAT contents than the wild type under drought and osmotic stresses. SpBADH overexpression in Arabidopsis also enhanced the expression of ROS-related genes including AtSOD, AtPOD, AtCAT, AtAPX and Atpsb under drought and osmotic stresses. Thus, SpBADH increases plant tolerance to drought or osmotic stresses by reducing H2O2, increasing proline, and activating antioxidative enzymes to improve ROS scavenging. PMID:26368017

  19. Identification of Biochemical Pathways Associated with Lead Tolerance and Detoxification in Chrysopogon zizanioides L. Nash (Vetiver) by Metabolic Profiling.

    Science.gov (United States)

    Pidatala, Venkataramana R; Li, Kefeng; Sarkar, Dibyendu; Ramakrishna, Wusirika; Datta, Rupali

    2016-03-01

    Lead (Pb) is a major urban pollutant, due to deteriorating lead-based paint in houses built before 1978. Phytoremediation is an inexpensive and effective technique for remediation of Pb-contaminated homes. Vetiver (Chrysopogon zizanioides), a noninvasive, fast-growing grass with high biomass, can tolerate and accumulate large quantities of Pb in its tissues. Lead is known to induce phytochelatins and antioxidative enzymes in vetiver; however, the overall impact of Pb stress on metabolic pathways of vetiver is unknown. In the current study, vetiver plants were treated with different concentrations of Pb in a hydroponic setup. Metabolites were extracted and analyzed using LC/MS/MS. Multivariate analysis of metabolites in both root and shoot tissue showed tremendous induction in key metabolic pathways including sugar metabolism, amino acid metabolism, and an increase in production of osmoprotectants, such as betaine and polyols, and metal-chelating organic acids. The data obtained provide a comprehensive insight into the overall stress response mechanisms in vetiver. PMID:26843403

  20. Overexpression of GmDREB1 improves salt tolerance in transgenic wheat and leaf protein response to high salinity

    Institute of Scientific and Technical Information of China (English)

    Qiyan; Jiang; Zheng; Hu; Hui; Zhang; Youzhi; Ma

    2014-01-01

    The transcription factor dehydration-responsive element binding protein(DREB)is able to improve tolerance to abiotic stress in plants by regulating the expression of downstream genes involved in environmental stress resistance.The objectives of this study were to evaluate the salt tolerance of GmDREB1 transgenic wheat(Triticum aestivum L.)and to evaluate its physiological and protein responses to salt stress.Compared with the wild type,the transgenic lines overexpressing GmDREB1 showed longer coleoptiles and radicles and a greater radicle number at the germination stage,as well as greater root length,fresh weight,and tiller number per plant at the seedling stage.The yield-related traits of transgenic lines were also improved compared with the wild type,indicating enhanced salt tolerance in transgenic lines overexpressing GmDREB1.Proteomics analysis revealed that osmotic-and oxidative-stressrelated proteins were up-regulated in transgenic wheat leaves under salt stress conditions.Transgenic wheat had higher levels of proline and betaine and lower levels of malondialdehyde and relative electrolyte leakage than the wild type.These results suggest that GmDREB1 regulates the expression of osmotic-and oxidative-stress-related proteins that reduce the occurrence of cell injury caused by high salinity,thus improving the salt tolerance of transgenic wheat.

  1. Unravelling the adaptation responses to osmotic and temperature stress in Chromohalobacter salexigens, a bacterium with broad salinity tolerance.

    Science.gov (United States)

    Vargas, Carmen; Argandoña, Montserrat; Reina-Bueno, Mercedes; Rodríguez-Moya, Javier; Fernández-Aunión, Cristina; Nieto, Joaquín J

    2008-01-01

    Chromohalobacter salexigens, a Gammaproteobacterium belonging to the family Halomonadaceae, shows a broad salinity range for growth. Osmoprotection is achieved by the accumulation of compatible solutes either by transport (betaine, choline) or synthesis (mainly ectoine and hydroxyectoine). Ectoines can play additional roles as nutrients and, in the case of hydroxyectoine, in thermotolerance. A supplementary solute, trehalose, not present in cells grown at 37 degrees C, is accumulated at higher temperatures, suggesting its involvement in the response to heat stress. Trehalose is also accumulated at 37 degrees C in ectoine-deficient mutants, indicating that ectoines suppress trehalose synthesis in the wild-type strain. The genes for ectoine (ectABC) and hydroxyectoine (ectD, ectE) production are arranged in three different clusters within the C. salexigens chromosome. In order to cope with changing environment, C. salexigens regulates its cytoplasmic pool of ectoines by a number of mechanisms that we have started to elucidate. This is a highly complex process because (i) hydroxyectoine can be synthesized by other enzymes different to EctD (ii) ectoines can be catabolized to serve as nutrients, (iii) the involvement of several transcriptional regulators (sigmaS, sigma32, Fur, EctR) and hence different signal transduction pathways, and (iv) the existence of post-trancriptional control mechanisms. In this review we summarize our present knowledge on the physiology and genetics of the processes allowing C. salexigens to cope with osmotic stress and high temperature, with emphasis on the transcriptional regulation. PMID:18793408

  2. The -35 sequence location and the Fis-sigma factor interface determine sigmas selectivity of the proP (P2) promoter in Escherichia coli.

    Science.gov (United States)

    Typas, Athanasios; Stella, Stefano; Johnson, Reid C; Hengge, Regine

    2007-02-01

    The P2 promoter of proP, encoding a transporter for proline and glycine betaine in Escherichia coli, is a unique paradigm, where master regulators of different growth stages, Fis and sigma(S) (RpoS), collaborate to achieve promoter activation. It is also the only case described where Fis functions as class II transcriptional activator (centred at -41). Here we show that the degenerate -35 sequence, and the location of the Fis binding site, which forces a suboptimal 16 bp spacing between the -35 and -10 elements, allow only sigma(S) but not sigma(70) to function at proP (P2). Moreover, the interface between Fis and sigma(S) seems better suited to sigma(S), due to a single residue difference between sigma(S) and sigma(70). Nevertheless, Fis can activate RNA polymerase containing sigma(70) at a proP (P2) promoter variant, in which a typical sigma(70)-35 recognition sequence has been introduced at a 17 bp distance from the -10 hexamer. In summary, we elucidate the rules that govern sigma factor selectivity in the presence of a class II activator, provide new insight into transcriptional activation by Fis from this position, and clarify, why the proP (P2) promoter is precisely activated during a short time window of the growth cycle, when Fis and sigma(S) are both present. PMID:17302803

  3. Rapid induction of lipid droplets in Chlamydomonas reinhardtii and Chlorella vulgaris by Brefeldin A.

    Directory of Open Access Journals (Sweden)

    Sangwoo Kim

    Full Text Available Algal lipids are the focus of intensive research because they are potential sources of biodiesel. However, most algae produce neutral lipids only under stress conditions. Here, we report that treatment with Brefeldin A (BFA, a chemical inducer of ER stress, rapidly triggers lipid droplet (LD formation in two different microalgal species, Chlamydomonas reinhardtii and Chlorella vulgaris. LD staining using Nile red revealed that BFA-treated algal cells exhibited many more fluorescent bodies than control cells. Lipid analyses based on thin layer chromatography and gas chromatography revealed that the additional lipids formed upon BFA treatment were mainly triacylglycerols (TAGs. The increase in TAG accumulation was accompanied by a decrease in the betaine lipid diacylglyceryl N,N,N-trimethylhomoserine (DGTS, a major component of the extraplastidic membrane lipids in Chlamydomonas, suggesting that at least some of the TAGs were assembled from the degradation products of membrane lipids. Interestingly, BFA induced TAG accumulation in the Chlamydomonas cells regardless of the presence or absence of an acetate or nitrogen source in the medium. This effect of BFA in Chlamydomonas cells seems to be due to BFA-induced ER stress, as supported by the induction of three homologs of ER stress marker genes by the drug. Together, these results suggest that ER stress rapidly triggers TAG accumulation in two green microalgae, C. reinhardtii and C. vulgaris. A further investigation of the link between ER stress and TAG synthesis may yield an efficient means of producing biofuel from algae.

  4. Metabolic crosstalk between choline/1-carbon metabolism and energy homeostasis.

    Science.gov (United States)

    Zeisel, Steven H

    2013-03-01

    There are multiple identified mechanisms involved in energy metabolism, insulin resistance and adiposity, but there are here-to-fore unsuspected metabolic factors that also influence these processes. Studies in animal models suggest important links between choline/1-carbon metabolism and energy homeostasis. Rodents fed choline deficient diets become hypermetabolic. Mice with deletions in one of several different genes of choline metabolism have phenotypes that include increased metabolic rate, decreased body fat/lean mass ratio, increased insulin sensitivity, decreased ATP production by mitochondria, or decreased weight gain on a high fat diet. In addition, farmers have recognized that the addition of a metabolite of choline (betaine) to cattle and swine feed reduces body fat/lean mass ratio. Choline dietary intake in humans varies over a > three-fold range, and genetic variation exists that modifies individual requirements for this nutrient. Although there are some epidemiologic studies in humans suggesting a link between choline/1-carbon metabolism and energy metabolism, there have been no controlled studies in humans that were specifically designed to examine this relationship. PMID:23072856

  5. Radiation stability of some room temperature ionic liquids

    International Nuclear Information System (INIS)

    Radiation stability of some room temperature ionic liquids (RTILs) that find useful electrochemical applications in nuclear fuel cycle has been evaluated. The ionic liquids such as protonated betaine bis(trifluoromethylsulfonyl)imide (HbetNTf2), aliquat 336 (tri-n-octlymethylammonium chloride), 1-butyl-3-methylimidazolium chloride (bmimCl), 1-hexyl-3-methylimidazolium chloride (hmimCl), N-butyl-N-methylpyrrolidinium bis(trifluoromethylsulfonyl)imide (BMPyNTf2) and N-methyl-N-propylpiperidinium bis(trifluoromethylsulfonyl)imide (MPPiNTf2) have been irradiated to various absorbed dose levels, up to 700 kGy. The effect of gamma radiation on these ionic liquids has been evaluated by determining the variations in the physical properties such as color, density, viscosity, refractive index and electrochemical window. The changes in density, viscosity and refractive index of these ionic liquids upon irradiation were insignificant; however, the color and electrochemical window varied significantly with increase of absorbed dose. -- Research highlights: → Room temperature ionic liquids (RTILs). → Gamma irradiation. → Determination of physical and electrochemical properties. → Minimal change in physical properties. → Large variation in electrochemical window.

  6. Gradation of proteins and cells attached to the surface of bio-inert zwitterionic polymer brush.

    Science.gov (United States)

    Li, Lifu; Nakaji-Hirabayashi, Tadashi; Kitano, Hiromi; Ohno, Kohji; Kishioka, Takahiro; Usui, Yuki

    2016-08-01

    A self-assembled monolayer (SAM) of a 2-bromoisobutyryl end group-carrying initiator for atom transfer radical polymerization (ATRP) was constructed on the surface of silicon wafer or glass substrates via a silane-coupling reaction. When the initiator SAM was irradiated with UV light at 254nm, the surface density of bromine atoms was reduced by the scission of CBr bonds as observed by XPS. With the surface-initiated ATRP of the zwitterionic vinyl monomer, carboxymethyl betaine (CMB), the surface density of PCMB brushes could be easily varied by changing the irradiation period of UV light prior to the polymerization. Furthermore, by using a UV-cut shutter sliding above the initiator SAM-modified substrate at a constant speed, the degree of bromine atom removal could be linearly varied along the direction of movement of the shutter. Consequently, the amount of both proteins adsorbed and cells adhered to the PCMB brush-covered substrate could easily be controlled by the gradation of the surface density of PCMB brushes, which suppressed protein adsorption and cell adhesion. Such a technique is very simple and useful for the regulation of the surface density of adsorbed proteins and adhered cells on an originally bio-inert surface. PMID:27085477

  7. Comparative genomics of an endophytic Pseudomonas putida isolated from mango orchard

    Science.gov (United States)

    Asif, Huma; Studholme, David J.; Khan, Asifullah; Aurongzeb, M.; Khan, Ishtiaq A.; Azim, M. Kamran

    2016-01-01

    Abstract We analyzed the genome sequence of an endophytic bacterial strain Pseudomonas putida TJI51 isolated from mango bark tissues. Next generation DNA sequencing and short read de novo assembly generated the 5,805,096 bp draft genome of P. putida TJI51. Out of 6,036 protein coding genes in P. putida TJI51 sequences, 4,367 (72%) were annotated with functional specifications, while the remaining encoded hypothetical proteins. Comparative genome sequence analysis revealed that the P. putida TJI51genome contains several regions, not identified in so far sequenced P. putida genomes. Some of these regions were predicted to encode enzymes, including acetylornithine deacetylase, betaine aldehyde dehydrogenase, aldehyde dehydrogenase, benzoylformate decarboxylase, hydroxyacylglutathione hydrolase, and uroporphyrinogen decarboxylase. The genome of P. putida TJI51 contained three nonribosomal peptide synthetase gene clusters. Genome sequence analysis of P. putidaTJI51 identified this bacterium as an endophytic resident. The endophytic fitness might be linked with alginate, which facilitates bacterial colonization in plant tissues. Genome sequence analysis shed light on the presence of a diverse spectrum of metabolic activities and adaptation of this isolate to various niches. PMID:27560648

  8. On (2,3)-agreeable Box Societies

    CERN Document Server

    Abrahams, Michael; Zell, Thierry

    2009-01-01

    The notion of $(k,m)$-agreeable society was introduced by Deborah Berg et al.: a family of convex subsets of $\\R^d$ is called $(k,m)$-agreeable if any subfamily of size $m$ contains at least one non-empty $k$-fold intersection. In that paper, the $(k,m)$-agreeability of a convex family was shown to imply the existence of a subfamily of size $\\beta n$ with non-empty intersection, where $n$ is the size of the original family and $\\beta\\in[0,1]$ is an explicit constant depending only on $k,m$ and $d$. The quantity $\\beta(k,m,d)$ is called the minimal \\emph{agreement proportion} for a $(k,m)$-agreeable family in $\\R^d$. If we only assume that the sets are convex, simple examples show that $\\beta=0$ for $(k,m)$-agreeable families in $\\R^d$ where $k

  9. Salt Stress Induced Changes in the Exoproteome of the Halotolerant Bacterium Tistlia consotensis Deciphered by Proteogenomics

    Science.gov (United States)

    Rubiano-Labrador, Carolina; Bland, Céline; Miotello, Guylaine; Armengaud, Jean; Baena, Sandra

    2015-01-01

    The ability of bacteria to adapt to external osmotic changes is fundamental for their survival. Halotolerant microorganisms, such as Tistlia consotensis, have to cope with continuous fluctuations in the salinity of their natural environments which require effective adaptation strategies against salt stress. Changes of extracellular protein profiles from Tistlia consotensis in conditions of low and high salinities were monitored by proteogenomics using a bacterial draft genome. At low salinity, we detected greater amounts of the HpnM protein which is involved in the biosynthesis of hopanoids. This may represent a novel, and previously unreported, strategy by halotolerant microorganisms to prevent the entry of water into the cell under conditions of low salinity. At high salinity, proteins associated with osmosensing, exclusion of Na+ and transport of compatible solutes, such as glycine betaine or proline are abundant. We also found that, probably in response to the high salt concentration, T. consotensis activated the synthesis of flagella and triggered a chemotactic response neither of which were observed at the salt concentration which is optimal for growth. Our study demonstrates that the exoproteome is an appropriate indicator of adaptive response of T. consotensis to changes in salinity because it allowed the identification of key proteins within its osmoadaptive mechanism that had not previously been detected in its cell proteome. PMID:26287734

  10. Reduced classes and curve counting on surfaces II: calculations

    CERN Document Server

    Kool, M

    2011-01-01

    We calculate the "surface part" of the reduced residue stable pair theory on the canonical bundle $K_S$ of a projective surface $S$. For fixed curve class $\\beta\\in H^2(S)$ the results are entirely topological, depending on $\\beta^2, \\beta.c_1(S), c_1(S)^2, c_2(S), b_1(S)$ and invariants of the ring structure on $H^*(S)$ such as the Pfaffian of $\\beta$ considered as an element of $\\Lambda^2 H^1(S)^*$. We also give conditions under which this calculates the full 3-fold reduced residue theory of $K_S$. This is related to the reduced residue Gromov-Witten theory of $S$ via the MNOP conjecture. When the surface has no holomorphic 2-forms this can be expressed as saying that certain Gromov-Witten invariants of $S$ are topological. Our method uses the results of \\cite{KT1} to express the reduced virtual cycle in terms of Euler classes of bundles over a natural smooth ambient space.

  11. Influence of osmolytes on protein and water structure: a step to understanding the mechanism of protein stabilization.

    Science.gov (United States)

    Bruździak, Piotr; Panuszko, Aneta; Stangret, Janusz

    2013-10-01

    Results concerning the thermostability of hen egg white lysozyme in aqueous solutions with stabilizing osmolytes, trimethylamine-N-oxide (TMAO), glycine (Gly), and its N-methyl derivatives, N-methylglycine (NMG), N,N-dimethylglycine (DMG), and N,N,N-trimethylglycine (betaine, TMG), have been presented. The combination of spectroscopic (IR) and calorimetric (DSC) data allowed us to establish a link between osmolytes' influence on water structure and their ability to thermally stabilize protein molecule. Structural and energetic characteristics of stabilizing osmolytes' and lysozyme's hydration water appear to be very similar. The osmolytes increase lysozyme stabilization in the order bulk water < TMAO < TMG < Gly < DMG < NMG, which is consistent with the order corresponding to the value of the most probable oxygen-oxygen distance of water molecules affected by osmolytes in their surrounding. Obtained results verified the hypothesis concerning the role of water molecules in protein stabilization, explained the osmophobic effect, and finally helped to bring us nearer to the exact mechanism of protein stabilization by osmolytes. PMID:23992436

  12. Osmotically regulated transport of proline by Lactobacillus acidophilus IFO 3532.

    Science.gov (United States)

    Jewell, J B; Kashket, E R

    1991-10-01

    We reported previously that, when exposed to high osmotic pressure, Lactobacillus acidophilus IFO 3532 cells accumulated N,N,N-trimethylglycine (glycine betaine), which serves as a compatible intracellular solute. When grown in medium with high osmotic pressure, these cells also accumulated one amino acid, proline. The uptake of [3H]proline by resting, glucose-energized cells was stimulated by increasing the osmotic pressure of the assay medium with 0.5 to 1.0 M KCl, 1.0 M NaCl, or 0.5 M sucrose. The accumulated [3H]proline was not metabolized further. In contrast, there was no osmotic stimulation of [3H]leucine uptake. The uptake of proline was activated rather than induced by exposure of the cells to high osmotic pressure. Only one proline transport system could be discerned from kinetics plots. The affinity of the carrier for proline remained constant over a range of osmotic pressures from 650 to 1,910 mosM (Kt, 7.8 to 15.5 mM). The Vmax, however, increased from 15 nmol/min/mg of dry weight in 0.5 M sucrose to 27 and 40 nmol/min/mg of dry weight in 0.5 M KCl and in 1.0 M KCl or NaCl, respectively. The efflux of proline from preloaded cells occurred rapidly when the osmotic pressure of the suspending buffer was lowered. PMID:1786048

  13. Local and bulk hydration of zwitterionic glycine and its analogues through molecular simulations.

    Science.gov (United States)

    White, Andrew; Jiang, Shaoyi

    2011-02-01

    Molecular dynamics simulations were used to characterize the differences in hydration between glycine and two of its zwitterionic analogues: N,N-dimethylglycine and N,N,N-trimethylglycine (glycine betaine). The hydration of dodecane and oligo(ethylene glycol) was studied for reference. Both structuring and dynamics of bulk and bound water were examined using a variety of properties and at multiple concentrations. Metrics, such as radial distribution functions and residence times, were used to characterize hydration. Also, we used more specialized metrics that can discriminate between subtle differences in hydration, such as condensed phase order parameters, Voronoi tessellations, and multidimensional pair-pair correlation functions. Trimethylglycine was found to have a unique hydration shell that extends across the entire molecule and has no specific interactions between solute molecules. Also, we found that dimethylglycine has a similar hydration structure to that of trimethylglycine despite its hydrogen-bond donor. Glycine was found to aggregate and have a more disjoint hydration shell. All three zwitterions were found to structurally affect water within 1.5-2.0 coordination shells. Lastly, trimethylglycine is disperse in solution even at very high concentrations, and water rapidly moves between trimethylglycine amine groups. This work has meaningful implications for protein stability where trimethylglycine is known to prevent protein aggregation and nonfouling interfaces where trimethylglycine prevents nonspecific protein adsorption. PMID:21174438

  14. Blast neurotrauma impairs working memory and disrupts prefrontal myo-inositol levels in rats.

    Science.gov (United States)

    Sajja, Venkata Siva Sai Sujith; Perrine, Shane A; Ghoddoussi, Farhad; Hall, Christina S; Galloway, Matthew P; VandeVord, Pamela J

    2014-03-01

    Working memory, which is dependent on higher-order executive function in the prefrontal cortex, is often disrupted in patients exposed to blast overpressure. In this study, we evaluated working memory and medial prefrontal neurochemical status in a rat model of blast neurotrauma. Adult male Sprague-Dawley rats were anesthetized with 3% isoflurane and exposed to calibrated blast overpressure (17 psi, 117 kPa) while sham animals received only anesthesia. Early neurochemical effects in the prefrontal cortex included a significant decrease in betaine (trimethylglycine) and an increase in GABA at 24 h, and significant increases in glycerophosphorylcholine, phosphorylethanolamine, as well as glutamate/creatine and lactate/creatine ratios at 48 h. Seven days after blast, only myo-inositol levels were altered showing a 15% increase. Compared to controls, short-term memory in the novel object recognition task was significantly impaired in animals exposed to blast overpressure. Working memory in control animals was negatively correlated with myo-inositol levels (r=-.759, p<0.05), an association that was absent in blast exposed animals. Increased myo-inositol may represent tardive glial scarring in the prefrontal cortex, a notion supported by GFAP changes in this region after blast overexposure as well as clinical reports of increased myo-inositol in disorders of memory. PMID:24534010

  15. Dimethylglycine and chemically related amines tested for mutagenicity under potential nitrosation conditions.

    Science.gov (United States)

    Hoorn, A J

    1989-04-01

    Dimethylglycine (DMG) and the chemically related amino acids glycine, sarcosine (monomethylglycine) and betaine (trimethylglycine) were tested in Salmonella typhimurium strain TA100 after treatment with sodium nitrite under acidic conditions using a modified Ames Salmonella/microsome assay as reported by Colman et al. (1980). The increase in the number of revertants observed both with and without metabolic activation was also induced in the control mixtures without adding the amines. From the subsequent testing of the individual components of the mixtures, we concluded that non-consumed nitrite was responsible for the mutagenic responses observed in the different reaction mixtures, and not the amines themselves. There were no consistent indications of mutagenic activity of the DMG test mixture as compared to the control mixture which exhibited both consistent mutagenic activity and a toxic effect which was not increased by the addition of DMG. In fact, DMG seemed to decrease the toxicity of the control reaction solution to the Salmonella which was clearly observed at the higher doses. DMG cannot be considered mutagenic under the test conditions employed. The same can be said of the other amino acids as well. PMID:2468082

  16. Enteric bacteria and osmotic stress: intracellular potassium glutamate as a secondary signal of osmotic stress?

    Science.gov (United States)

    Booth, I R; Higgins, C F

    1990-06-01

    Enteric bacteria have evolved an impressive array of mechanisms that allow the cell to grow at widely different external osmotic pressures. These serve two linked functions; firstly, they allow the cell to maintain a relatively constant turgor pressure which is essential for cell growth; and secondly they permit changes in cytoplasmic composition such that the accumulation of intracellular osmolytes required to restore turgor pressure does not impair enzyme function. The primary event in turgor regulation is the controlled accumulation of potassium and its counterion glutamate. At high external osmolarities the cytoplasmic levels of potassium glutamate can impair enzyme function. Rapid growth is therefore dependent upon secondary responses, principally the accumulation of compatible solutes, betaine (N-trimethylglycine), proline and trehalose. The accumulation of these solutes is achieved by the controlled activity of transport systems and enzymes in response to changes in external osmotic pressure. It has been proposed that the accumulation of potassium glutamate during turgor regulation acts as a signal for the activation of these systems [1,2]. This brief review will examine the evidence that control over the balance of cytoplasmic osmolytes is achieved by sensing of the intracellular potassium (and glutamate) concentration. PMID:1974769

  17. The effect of selected supercritical CO2 plant extract addition on user properties of shower gels

    Directory of Open Access Journals (Sweden)

    Vogt Otmar

    2014-12-01

    Full Text Available The formulations of washing cosmetics i.e. shower gels, containing extracts obtained during supercritical CO2 extraction process as active ingredient, were developed. The subject of the study was the analysis of the physicochemical and user properties of the obtained products. In the work supercritical CO2 extracts of black currant seeds, strawberry seeds, hop cones and mint leafs were used. The formulation contains a mixture of surfactants (disodium cocoamphodiacetate, disodium laureth sulfosuccinate, cocoamide DEA, cocoamidepropyl betaine, Sodium Laureth Sulfate. Various thickener agents were applied to the obtained desired rheological properties of the cosmetics. Among others, sorbitol acetal derivatives, methylhydroxypropylcellulose and C10-30 alkyl acrylate crosspolymer were used. For stable products, the effect of extracts addition (black currants seeds, strawberries seeds, mint and hops, obtained from supercritical CO2 extraction process on the cosmetics properties, such as pH, viscosity, detergency and foam ability, were determined. The obtained results showed that the extracts could be used as components of shower gels.

  18. Ergothioneine, histidine, and two naturally occurring histidine dipeptides as radioprotectors against gamma-irradiation inactivation of bacteriophages T4 and P22

    International Nuclear Information System (INIS)

    Bacteriophages P22, T4+, and T4os (osmotic shock-resistant mutant with altered capsids) were diluted in 0.85% NaCl and exposed to gamma irradiation (2.79 Gy/min) at room temperature (24 degrees C). T4+ was more sensitive to inactivation than was P22, and the T4os mutant was even more sensitive than T4+. Catalase exhibited a strong protective effect and superoxide dismutase a weaker protection, indicating that H2O2 or some product derived therefrom was predominant in causing inactivation of plaque formation. Low but significant (0.1-0.3 mM) reduced glutathione (GSH) enhanced phage inactivation, but a higher (1 mM) GSH concentration protected. A similar effect was found for the polyamine, spermidine. In contrast, 0.1 mM L-ergothioneine (2-thiol-L-histidine betaine) exhibited strong protection and 1 mM afforded essentially complete protection. L-Ergothioneine is present in millimolar concentrations in some fungi and is conserved up to millimolar concentrations in critical tissues when consumed by man. L-Histidine and two histidine-containing dipeptides, carnosine and anserine, protected at a concentration of 1 mM, a level at which they are present in striated muscles of various animals

  19. Genome-scale reconstruction of metabolic network for a halophilic extremophile, Chromohalobacter salexigens DSM 3043

    Directory of Open Access Journals (Sweden)

    Oner Ebru

    2011-01-01

    Full Text Available Abstract Background Chromohalobacter salexigens (formerly Halomonas elongata DSM 3043 is a halophilic extremophile with a very broad salinity range and is used as a model organism to elucidate prokaryotic osmoadaptation due to its strong euryhaline phenotype. Results C. salexigens DSM 3043's metabolism was reconstructed based on genomic, biochemical and physiological information via a non-automated but iterative process. This manually-curated reconstruction accounts for 584 genes, 1386 reactions, and 1411 metabolites. By using flux balance analysis, the model was extensively validated against literature data on the C. salexigens phenotypic features, the transport and use of different substrates for growth as well as against experimental observations on the uptake and accumulation of industrially important organic osmolytes, ectoine, betaine, and its precursor choline, which play important roles in the adaptive response to osmotic stress. Conclusions This work presents the first comprehensive genome-scale metabolic model of a halophilic bacterium. Being a useful guide for identification and filling of knowledge gaps, the reconstructed metabolic network iOA584 will accelerate the research on halophilic bacteria towards application of systems biology approaches and design of metabolic engineering strategies.

  20. The Effect of Gestational and Lactational Age on the Human Milk Metabolome

    Directory of Open Access Journals (Sweden)

    Ulrik K. Sundekilde

    2016-05-01

    Full Text Available Human milk is the ideal nutrition source for healthy infants during the first six months of life and a detailed characterisation of the composition of milk from mothers that deliver prematurely (<37 weeks gestation, and of how human milk changes during lactation, would benefit our understanding of the nutritional requirements of premature infants. Individual milk samples from mothers delivering prematurely and at term were collected. The human milk metabolome, established by nuclear magnetic resonance (NMR spectroscopy, was influenced by gestational and lactation age. Metabolite profiling identified that levels of valine, leucine, betaine, and creatinine were increased in colostrum from term mothers compared with mature milk, while those of glutamate, caprylate, and caprate were increased in mature term milk compared with colostrum. Levels of oligosaccharides, citrate, and creatinine were increased in pre-term colostrum, while those of caprylate, caprate, valine, leucine, glutamate, and pantothenate increased with time postpartum. There were differences between pre-term and full-term milk in the levels of carnitine, caprylate, caprate, pantothenate, urea, lactose, oligosaccharides, citrate, phosphocholine, choline, and formate. These findings suggest that the metabolome of pre-term milk changes within 5–7 weeks postpartum to resemble that of term milk, independent of time of gestation at pre-mature delivery.

  1. The complex metabolism of trimethylamine in humans: endogenous and exogenous sources.

    Science.gov (United States)

    Chhibber-Goel, Jyoti; Gaur, Anamika; Singhal, Varsha; Parakh, Neeraj; Bhargava, Balram; Sharma, Amit

    2016-01-01

    Trimethylamine (TMA) is a tertiary amine with a characteristic fishy odour. It is synthesised from dietary constituents, including choline, L-carnitine, betaine and lecithin by the action of microbial enzymes during both healthy and diseased conditions in humans. Trimethylaminuria (TMAU) is a disease typified by its association with the characteristic fishy odour because of decreased TMA metabolism and excessive TMA excretion. Besides TMAU, a number of other diseases are associated with abnormal levels of TMA, including renal disorders, cancer, obesity, diabetes, cardiovascular diseases and neuropsychiatric disorders. Aside from its role in pathobiology, TMA is a precursor of trimethylamine-N-oxide that has been associated with an increased risk of athero-thrombogenesis. Additionally, TMA is a major air pollutant originating from vehicular exhaust, food waste and animal husbandry industry. The adverse effects of TMA need to be monitored given its ubiquitous presence in air and easy absorption through human skin. In this review, we highlight multifaceted attributes of TMA with an emphasis on its physiological, pathological and environmental impacts. We propose a clinical surveillance of human TMA levels that can fully assess its role as a potential marker of microbial dysbiosis-based diseases. PMID:27126549

  2. Screening for drought tolerance in cultivars of the ornamental genus Tagetes (Asteraceae)

    Science.gov (United States)

    Sestras, Adriana F.; Prohens, Jaime; Vicente, Oscar; Sestras, Radu E.

    2016-01-01

    Drought tolerance was evaluated in twelve cultivars of three ornamental Tagetes species (T. patula, T. tenuifolia and T. erecta). A stress treatment was performed by completely stopping watering of plants maintained in controlled greenhouse conditions. After three weeks, several plant growth parameters (stem length (SL), fresh weight (FW) and water content (WC)), photosynthetic pigments (chlorophylls and carotenoids (Car)), osmolytes (proline (Pro), glycine betaine (GB) and total soluble sugars (TSS)), an oxidative stress maker (malondialdehyde (MDA)) and antioxidants (total phenolic compounds (TPC) and total flavonoids (TF)) were measured. Considerable differences in the evaluated traits were found among the control and drought-stressed plants. Drought stress generally caused a marked reduction in plant growth and carotenoid pigments, and an increase in soluble solutes and oxidative stress. For most cultivars, proline levels in stressed plants increased between 30 and 70-fold compared to the corresponding controls. According to the different measured parameters, on average T. erecta proved to be more tolerant to drought than T. patula and T. tenuifolia. However, a considerable variation in the tolerance to drought was found within each species. The traits with greater association to drought tolerance as well as the most tolerant cultivars could be clearly identified in a principal components analysis (PCA). Overall, our results indicate that drought tolerant cultivars of Tagetes can be identified at early stages using a combination of plant growth and biochemical markers. PMID:27326384

  3. Evaulation of irritation potential of surfactant mixtures.

    Science.gov (United States)

    Turkoglu, M; Sakr, A

    1999-12-01

    Irritation potential of sodium laureth sulfate (SLES) alone, and in combination with lauryl glucoside (LG), polysorbate 20 (PS) and cocoamidopropyl betaine (CAPB) was tested in 13 human subjects. Four main and six sub-formulations were prepared and evaluated. Formulations were applied to the forearm as a 24 h close patch study. Irritation was scored by two different methods using an in vivo clinical protocol based on visual scoring and on the stratum corneum capacitance measurement. Irritation was found to be dose dependent. At 2 mg/patch level ten subjects did not show any skin reaction. At 20 mg/patch level eleven subjects showed a broad range of skin irritation. The highest irritation was observed with the formula that contained SLES, LG, and cocamide DEA together. Among the sub-formulations, cocamide DEA showed the highest irritation grade. A statistically significant correlation was observed between visual, clinical and corneometer scores. It was concluded that the irritation potential of surfactants was related to the total surfactant concentration, application mode, and the thermodynamic activity of molecules in the solution as well as the chemical structure of the surfactant molecules. PMID:18503452

  4. On the formation of new reverse micelles: a comparative study of benzene/surfactants/ionic liquids systems using UV-visible absorption spectroscopy and dynamic light scattering.

    Science.gov (United States)

    Falcone, R Darío; Correa, N Mariano; Silber, Juana J

    2009-09-15

    The microenvironment of the polar core generated in different ionic liquid reverse micelle (IL RM) systems were investigated using the solvatochromic behavior of 1-methyl-8-oxyquinolinium betaine (QB) as an absorption probe and dynamic light scattering (DLS) technique. The novel RM systems consist of two different ILs--1-butyl-3-methylimidazolium tetrafluoroborate (bmimBF4) and 1-butyl-3-methylimidazolium bis(trifluoromethylsulfonyl)imide (bmimTf2N)--sequestrated by two different surfactants--Triton X-100 (TX-100) and benzyl-n-hexadecyldimethylammonium chloride (BHDC)--in order to make IL/surfactant/benzene RMs. The effect of the variation of Ws (Ws=[IL]/[surfactant]) on the QB spectroscopy was used to characterize these nonaqueous RMs. DLS results confirm the formation of these IL RM systems because increasing Ws increases the droplet sizes. Moreover it is demonstrated that the structure of the sequestrated ILs depends strongly on the type of surfactant use to create the RMs. PMID:19678620

  5. Neural Tube Defects, Folic Acid and Methylation

    Directory of Open Access Journals (Sweden)

    Henk J. Blom

    2013-09-01

    Full Text Available Neural tube defects (NTDs are common complex congenital malformations resulting from failure of the neural tube closure during embryogenesis. It is established that folic acid supplementation decreases the prevalence of NTDs, which has led to national public health policies regarding folic acid. To date, animal studies have not provided sufficient information to establish the metabolic and/or genomic mechanism(s underlying human folic acid responsiveness in NTDs. However, several lines of evidence suggest that not only folates but also choline, B12 and methylation metabolisms are involved in NTDs. Decreased B12 vitamin and increased total choline or homocysteine in maternal blood have been shown to be associated with increased NTDs risk. Several polymorphisms of genes involved in these pathways have also been implicated in risk of development of NTDs. This raises the question whether supplementation with B12 vitamin, betaine or other methylation donors in addition to folic acid periconceptional supplementation will further reduce NTD risk. The objective of this article is to review the role of methylation metabolism in the onset of neural tube defects.

  6. Methane production and simultaneous sulphate reduction in anoxic, salt marsh sediments

    Science.gov (United States)

    Oremland, R.S.; Marsh, L.M.; Polcin, S.

    1982-01-01

    It has been generally believed that sulphate reduction precludes methane generation during diagenesis of anoxic sediments1,2. Because most biogenic methane formed in nature is thought to derive either from acetate cleavage or by hydrogen reduction of carbon dioxide3-6, the removal of these compounds by the energetically more efficient sulphate-reducing bacteria can impose a substrate limitation on methanogenic bacteria 7-9. However, two known species of methanogens, Methanosarcina barkeri and Methanococcus mazei, can grow on and produce methane from methanol and methylated amines10-13. In addition, these compounds stimulate methane production by bacterial enrichments from the rumen11,14 and aquatic muds13,14. Methanol can enter anaerobic food webs through bacterial degradation of lignins15 or pectin16, and methylated amines can be produced either from decomposition of substances like choline, creatine and betaine13,14 or by bacterial reduction of trimethylamine oxide17, a common metabolite and excretory product of marine animals. However, the relative importance of methanol and methylated amines as precursors of methane in sediments has not been previously examined. We now report that methanol and trimethylamine are important substrates for methanogenic bacteria in salt marsh sediments and that these compounds may account for the bulk of methane produced therein. Furthermore, because these compounds do not stimulate sulphate reduction, methanogenesis and sulphate reduction can operate concurrently in sulphate-containing anoxic sediments. ?? 1982 Nature Publishing Group.

  7. Testing the ability of non-methylamine osmolytes present in kidney cells to counteract the deleterious effects of urea on structure, stability and function of proteins.

    Directory of Open Access Journals (Sweden)

    Sheeza Khan

    Full Text Available Human kidney cells are under constant urea stress due to its urine concentrating mechanism. It is believed that the deleterious effect of urea is counteracted by methylamine osmolytes (glycine betaine and glycerophosphocholine present in kidney cells. A question arises: Do the stabilizing osmolytes, non-methylamines (myo-inositol, sorbitol and taurine present in the kidney cells also counteract the deleterious effects of urea? To answer this question, we have measured structure, thermodynamic stability (ΔG D (o and functional activity parameters (K m and k cat of different model proteins in the presence of various concentrations of urea and each non-methylamine osmolyte alone and in combination. We observed that (i for each protein myo-inositol provides perfect counteraction at 1∶2 ([myo-inositol]:[urea] ratio, (ii any concentration of sorbitol fails to refold urea denatured proteins if it is six times less than that of urea, and (iii taurine regulates perfect counteraction in a protein specific manner; 1.5∶2.0, 1.2∶2.0 and 1.0∶2.0 ([taurine]:[urea] ratios for RNase-A, lysozyme and α-lactalbumin, respectively.

  8. Metazoan Remaining Genes for Essential Amino Acid Biosynthesis: Sequence Conservation and Evolutionary Analyses

    Directory of Open Access Journals (Sweden)

    Igor R. Costa

    2014-12-01

    Full Text Available Essential amino acids (EAA consist of a group of nine amino acids that animals are unable to synthesize via de novo pathways. Recently, it has been found that most metazoans lack the same set of enzymes responsible for the de novo EAA biosynthesis. Here we investigate the sequence conservation and evolution of all the metazoan remaining genes for EAA pathways. Initially, the set of all 49 enzymes responsible for the EAA de novo biosynthesis in yeast was retrieved. These enzymes were used as BLAST queries to search for similar sequences in a database containing 10 complete metazoan genomes. Eight enzymes typically attributed to EAA pathways were found to be ubiquitous in metazoan genomes, suggesting a conserved functional role. In this study, we address the question of how these genes evolved after losing their pathway partners. To do this, we compared metazoan genes with their fungal and plant orthologs. Using phylogenetic analysis with maximum likelihood, we found that acetolactate synthase (ALS and betaine-homocysteine S-methyltransferase (BHMT diverged from the expected Tree of Life (ToL relationships. High sequence conservation in the paraphyletic group Plant-Fungi was identified for these two genes using a newly developed Python algorithm. Selective pressure analysis of ALS and BHMT protein sequences showed higher non-synonymous mutation ratios in comparisons between metazoans/fungi and metazoans/plants, supporting the hypothesis that these two genes have undergone non-ToL evolution in animals.

  9. Peculiarities of One-Carbon Metabolism in the Strict Carnivorous Cat and the Role in Feline Hepatic Lipidosis

    Directory of Open Access Journals (Sweden)

    Marica Bakovic

    2013-07-01

    Full Text Available Research in various species has indicated that diets deficient in labile methyl groups (methionine, choline, betaine, folate produce fatty liver and links to steatosis and metabolic syndrome, but also provides evidence of the importance of labile methyl group balance to maintain normal liver function. Cats, being obligate carnivores, rely on nutrients in animal tissues and have, due to evolutionary pressure, developed several physiological and metabolic adaptations, including a number of peculiarities in protein and fat metabolism. This has led to specific and unique nutritional requirements. Adult cats require more dietary protein than omnivorous species, maintain a consistently high rate of protein oxidation and gluconeogenesis and are unable to adapt to reduced protein intake. Furthermore, cats have a higher requirement for essential amino acids and essential fatty acids. Hastened use coupled with an inability to conserve certain amino acids, including methionine, cysteine, taurine and arginine, necessitates a higher dietary intake for cats compared to most other species. Cats also seemingly require higher amounts of several B-vitamins compared to other species and are predisposed to depletion during prolonged inappetance. This carnivorous uniqueness makes cats more susceptible to hepatic lipidosis.

  10. Real-time quantitative nicking endonuclease-mediated isothermal amplification with small molecular beacons.

    Science.gov (United States)

    Xu, Wentao; Wang, Chenguang; Zhu, Pengyu; Guo, Tianxiao; Xu, Yuancong; Huang, Kunlun; Luo, Yunbo

    2016-04-21

    Techniques of isothermal amplification have recently made great strides, and have generated significant interest in the field of point-of-care detection. Nicking endonuclease-mediated isothermal amplification (NEMA) is an example of simple isothermal technology. In this paper, a real-time quantitative nicking endonuclease-mediated isothermal amplification with small molecular beacons (SMB-NEMA) of improved specificity and sensitivity is described. First, we optimized the prohibition of de novo synthesis by choosing Nt·BstNBI endonuclease. Second, the whole genome was successfully amplified with Nt·BstNBI (6 U), betaine (1 M) and trehalose (60 mM) for the first time. Third, we achieved 10 pg sensitivity for the first time after adding a small molecular beacon that spontaneously undergoes a conformational change when hybridizing to target, and the practical test validated the assay's application. The small molecular beacon has a similar melting temperature to the reaction temperature, but is approximately 10 bp shorter than the length of a traditional molecular beacon. A new threshold regulation was also established for isothermal conditions. Finally, we established a thermodynamic model for designing small molecular beacons. This multistate model is more correct than the traditional algorithm. This theoretical and practical basis will help us to monitor SMB-NEMA in a quantitative way. In summary, our SMB-NEMA method allows the simple, specific and sensitive assessment of isothermal DNA quantification. PMID:27027375

  11. Highly efficient gene transfer into hepatocyte-like HepaRG cells: new means for drug metabolism and toxicity studies.

    Science.gov (United States)

    Laurent, Veronique; Fraix, Aurore; Montier, Tristan; Cammas-Marion, Sandrine; Ribault, Catherine; Benvegnu, Thierry; Jaffres, Paul-Alain; Loyer, Pascal

    2010-03-01

    HepaRG progenitor cells are capable of differentiating into hepatocyte-like cells that express a large set of liver-specific functions. These cells, however, only express small amounts of an important cytochrome P450, the CYP2E1, which limits their use for toxicological studies of drugs metabolized by this pathway. Our aim was to establish an efficient transfection protocol to increase CYP2E1 expression in HepaRG cells. Transfection protocols of the green fluorescent protein (GFP) reporter gene were evaluated using electroporation and cationic lipids belonging to the lipophosphonates, lipophosphoramidates and lipids derived from glycine betaine. Following optimization of the charge ratios, plasmid DNA and formulations with neutral co-lipids, the lipophosphoramidate compounds KLN47 and BSV10, allowed expression of the GFP in approximately 50% of adherent progenitor HepaRG cells, while electroporation targeted GFP expression in approximately 85% of both progenitor and differentiated cells in suspension. Transient enforced expression of active CYP2E1 was also achieved in progenitors and/or differentiated HepaRG cells using the electroporation and the lipophosphoramidate compound BSV10. Importantly, in electroporated cells, CYP2E1 expression level was correlated with a significant increase in CYP2E1-specific enzymatic activity, which opens new perspectives for this CYP-dependent drug metabolism and toxicity studies using HepaRG cells. PMID:20213646

  12. Metabolic profiling of the tissue-specific responses in mussel Mytilus galloprovincialis towards Vibrio harveyi challenge.

    Science.gov (United States)

    Liu, Xiaoli; Ji, Chenglong; Zhao, Jianmin; Wang, Qing; Li, Fei; Wu, Huifeng

    2014-08-01

    Mussel Mytilus galloprovincialis is a marine aquaculture shellfish distributing widely along the coast in north China. In this work, we studied the differential metabolic responses induced by Vibrio harveyi in digestive gland and gill tissues from M. galloprovincialis using NMR-based metabolomics. The differential metabolic responses in the two tissue types were detected, except the similarly altered taurine and betaine. These metabolic responses suggested that V. harveyi mainly induced osmotic disruption and reduced energy demand via the metabolic pathways of glucose synthesis and ATP/AMP conversion in mussel digestive gland. In mussel gill tissues, V. harveyi basically caused osmotic stress and possible reduced energy demand as shown by the elevated phosphocholine that is involved in one of the metabolic pathways of ATP synthesis from ADP and phosphocholine. The altered mRNA expression levels of related genes (superoxide dismutase with copper and zinc, heat shock protein 90, defensin and lysozyme) suggested that V. harveyi induced clear oxidative and immune stresses in both digestive gland and gill tissues. However, the mRNA expression levels of both lysozyme and defensin in digestive gland were more significantly up-regulated than those in gill from V. harveyi-challenged mussel M. galloprovincialis, meaning that the immune organ, digestive gland, was more sensitive than gill. Overall, our results indicated that V. harveyi could induce tissue-specific metabolic responses in mussel M. galloprovincialis. PMID:24911264

  13. Application of (1)H NMR-based serum metabolomic studies for monitoring female patients with rheumatoid arthritis.

    Science.gov (United States)

    Zabek, Adam; Swierkot, Jerzy; Malak, Anna; Zawadzka, Iga; Deja, Stanisław; Bogunia-Kubik, Katarzyna; Mlynarz, Piotr

    2016-01-01

    Rheumatoid arthritis is a chronic autoimmune-based inflammatory disease that leads to progressive joint degeneration, disability, and an increased risk of cardiovascular complications, which is the main cause of mortality in this population of patients. Although several biomarkers are routinely used in the management of rheumatoid arthritis, there is a high demand for novel biomarkers to further improve the early diagnosis of rheumatoid arthritis, stratification of patients, and the prediction of a better response to a specific therapy. In this study, the metabolomics approach was used to provide relevant biomarkers to improve diagnostic accuracy, define prognosis and predict and monitor treatment efficacy. The results indicated that twelve metabolites were important for the discrimination of healthy control and rheumatoid arthritis. Notably, valine, isoleucine, lactate, alanine, creatinine, GPC  APC and histidine relative levels were lower in rheumatoid arthritis, whereas 3-hydroxyisobutyrate, acetate, NAC, acetoacetate and acetone relative levels were higher. Simultaneously, the analysis of the concentration of metabolites in rheumatoid arthritis and 3 months after induction treatment revealed that L1, 3-hydroxyisobutyrate, lysine, L5, acetoacetate, creatine, GPC+APC, histidine and phenylalanine were elevated in RA, whereas leucine, acetate, betaine and formate were lower. Additionally, metabolomics tools were employed to discriminate between patients with different IL-17A genotypes. Metabolomics may provide relevant biomarkers to improve diagnostic accuracy, define prognosis and predict and monitor treatment efficacy in rheumatoid arthritis. PMID:26476882

  14. Proteomic and metabolomic analysis on the toxicological effects of As (III) and As (V) in juvenile mussel Mytilus galloprovincialis.

    Science.gov (United States)

    Yu, Deliang; Ji, Chenglong; Zhao, Jianmin; Wu, Huifeng

    2016-05-01

    Inorganic arsenic (As) is a known pollutant including two chemical forms (arsenite (As III) and arsenate (As V)), in marine and coastal environment. Marine mussel Mytilus galloprovincialis is an important environmental monitoring species around the world. In this study, we focused on valence-specific responses of As in juvenile mussel M. galloprovincialis using a combined proteomic and metabolomic approach. Metabolic responses indicated that As (III) mainly caused disturbance in osmotic regulation in juvenile mussels. As (V) caused disturbances in both osmotic regulation and energy metabolism marked by different metabolic responses, including betaine, taurine, glucose and glycogen. Proteomic responses exhibited that As (III) had a significant negative effect on cytoskeleton and cell structure (actin and collagen alpha-6(VI) chain). As (V) affected some key enzymes involved in energy metabolism (cytosolic malate dehydrogenase, cMDH) and cell development (ornithine aminotransferase and astacin). Overall, all these results confirmed the valence-specific responses in juvenile mussels to As exposures. These findings demonstrate that a combined metabolomic and proteomic approach could provide an important insight into the toxicological effects of environmental pollutants in organisms. PMID:26901476

  15. The dynamics of methionine supply and demand during early development.

    Science.gov (United States)

    McBreairty, Laura E; Bertolo, Robert F

    2016-06-01

    Methionine is an indispensable amino acid that, when not incorporated into protein, is converted into the methyl donor S-adenosylmethionine as entry into the methionine cycle. Following transmethylation, homocysteine is either remethylated to reform methionine or irreversibly trans-sulfurated to form cysteine. Methionine flux to transmethylation and to protein synthesis are both high in the neonate and this review focuses on the dynamics of methionine supply and demand during early development, when growth requires expansion of pools of protein and transmethylation products such as creatine and phosphatidylcholine (PC). The nutrients folate and betaine (derived from choline) donate a methyl group during remethylation, providing an endogenous supply of methionine to meet the methionine demand. During early development, variability in the dietary supply of these methionine cycle-related nutrients can affect both the supply and the demand of methionine. For example, a greater need for creatine synthesis can limit methionine availability for protein and PC synthesis, whereas increased availability of remethylation nutrients can increase protein synthesis if dietary methionine is limiting. Moreover, changes to methyl group availability early in life can lead to permanent changes in epigenetic patterns of DNA methylation, which have been implicated in the early origins of adult disease phenomena. This review aims to summarize how changes in methyl supply and demand can affect the availability of methionine for various functions and highlights the importance of variability in methionine-related nutrients in the infant diet. PMID:27177124

  16. Production of biomass and lipids by the oleaginous microalgae Monoraphidium sp. QLY-1 through heterotrophic cultivation and photo-chemical modulator induction.

    Science.gov (United States)

    Zhao, Yongteng; Li, Dafei; Ding, Ke; Che, Raoqiong; Xu, Jun-Wei; Zhao, Peng; Li, Tao; Ma, Huixian; Yu, Xuya

    2016-07-01

    A two-step strategy comprising heterotrophic cultivation and photo-chemical modulator induction was developed to enhance biomass and lipid accumulation in the oleaginous Monoraphidium sp. QLY-1, which was isolated from Qilu Lake in Yunnan Plateau. The algae were first cultivated heterotrophically to achieve high biomass concentration (5.54gL(-1)) with a lipid content of 22.47%. The cultivated algae were diluted, transferred to light environment, and treated with different chemical elicitors. Results showed that the lipid content increased to 36.68% after 3-day of photoinduction. The lipid content was further enhanced by 1.21, 1.32, and 1.29 folds in algal cells treated with nitrogen deficiency, 20gL(-1) NaCl, and 5mM glycine betaine, respectively. The maximum lipid content (48.54%) and lipid productivity (121.27mgL(-1)d(-1)) were obtained in treatments with 20gL(-1) NaCl and 5mM GB, respectively. This study proposes a strategy to efficiently produce lipids by using microalgae. PMID:27058402

  17. Impact of exogenous GABA treatments on endogenous GABA metabolism in anthurium cut flowers in response to postharvest chilling temperature.

    Science.gov (United States)

    Aghdam, Morteza Soleimani; Naderi, Roohangiz; Jannatizadeh, Abbasali; Babalar, Mesbah; Sarcheshmeh, Mohammad Ali Askari; Faradonbe, Mojtaba Zamani

    2016-09-01

    Anthurium flowers are susceptible to chilling injury, and the optimum storage temperature is 12.5-20 °C. The γ-aminobutyric acid (GABA) shunt pathway may alleviate chilling stress in horticultural commodities by providing energy (ATP), reducing molecules (NADH), and minimizing accumulation of reactive oxygen species (ROS). In this experiment, the impact of a preharvest spray treatment with 1 mM GABA and postharvest treatment of 5 mM GABA stem-end dipping on GABA shunt pathway activity of anthurium cut flowers (cv. Sirion) in response to cold storage (4 °C for 21 days) was investigated. GABA treatments resulted in lower glutamate decarboxylase (GAD) and higher GABA transaminase (GABA-T) activities in flowers during cold storage, which was associated with lower GABA content and coincided with higher ATP content. GABA treatments also enhanced accumulation of endogenous glycine betaine (GB) in flowers during cold storage, as well as higher spathe relative water content (RWC). These findings suggest that GABA treatments may alleviate chilling injury of anthurium cut flowers by enhancing GABA shunt pathway activity leading to provide sufficient ATP and promoting endogenous GB accumulation. PMID:27135813

  18. Mutagenesis and selection in vitro for salinity tolerance and molecular characterization in sugarcane

    International Nuclear Information System (INIS)

    can greatly facilitate the selection and isolation of useful tolerant lines. In the present study, in vitro mutagenesis was employed in the selection of salt tolerant lines in popular sugarcane (Saccharum officinarum L.) cv. CoC-671. Embryogenic cultures were gamma irradiated (10-50 Gy) and challenged with different levels of NaCl (42.8 - 256.7 mM). Salt stressed calli exhibited lower relative growth rate, decreased cell viability and higher levels of free proline and glycine betaine. The membrane stability (electrolyte leakage) was 3-fold more under salt stress compared to control. The ion levels were drastically affected under salt stress as leached out Na+ and K+ was much more than that of retained in tissue in both adapted and unadapted callus cultures. The tolerance could also be related to the maintenance of an ample water status and a high to low level of K+ to Na+ under salinity stress indicating that sugarcane can be a Na+ excluder. Plant regeneration was observed in 10 and 20 Gy irradiated calli up to 171.1 mM NaCl selection. A total of 147 plantlets were selected on different salt levels and the tolerant lines are being evaluated at field level. Molecular characterization using RAPD markers revealed genetic polymorphism among selected putative salt tolerant lines and control plants. The proper evaluation of these variants for salinity tolerance may be useful for economic cultivation under the stress regime. (author)

  19. Pulsed-Laser-Induced Simple Synthetic Route for Tb(3)Al(5)O(12):Ce Colloidal Nanocrystals and Their Luminescent Properties.

    Science.gov (United States)

    Mhin, Sung Wook; Ryu, Jeong Ho; Kim, Kang Min; Park, Gyeong Seon; Ryu, Han Wool; Shim, Kwang Bo; Sasaki, Takeshi; Koshizaki, Naoto

    2009-01-01

    Cerium-doped Tb(3)Al(5)O(12) (TAG:Ce(3+)) colloidal nanocrystals were synthesized by pulsed laser ablation (PLA) in de-ionized water and lauryl dimethylaminoacetic acid betain (LDA) aqueous solution for luminescent bio-labeling application. The influence of LDA molecules on the crystallinity, crystal morphology, crystallite size, and luminescent properties of the prepared TAG:Ce(3+) colloidal nanocrystals was investigated in detail. When the LDA solution was used, smaller average crystallite size, narrower size distribution, and enhanced luminescence were observed. These characteristics were explained by the effective role of occupying the oxygen defects on the surface of TAG:Ce(3+) colloidal nanocrystal because the amphoteric LDA molecules were attached by positively charged TAG:Ce(3+) colloidal nanocrystals. The blue-shifted phenomena found in luminescent spectra of the TAG:Ce(3+) colloidal nanocrystals could not be explained by previous crystal field theory. We discuss the 5d energy level of Ce(3+) with decreased crystal size with a phenomenological model that explains the relationship between bond distance with 5d energy level of Ce(3+) based on the concept of crystal field theory modified by covalency contribution. PMID:20596420

  20. Transgenic poplar expressing codA exhibits enhanced growth and abiotic stress tolerance.

    Science.gov (United States)

    Ke, Qingbo; Wang, Zhi; Ji, Chang Yoon; Jeong, Jae Cheol; Lee, Haeng-Soon; Li, Hongbing; Xu, Bingcheng; Deng, Xiping; Kwak, Sang-Soo

    2016-03-01

    Glycine betaine (GB), a compatible solute, effectively stabilizes the structure and function of macromolecules and enhances abiotic stress tolerance in plants. We generated transgenic poplar plants (Populus alba × Populus glandulosa) expressing a bacterial choline oxidase (codA) gene under the control of the oxidative stress-inducible SWPA2 promoter (referred to as SC plants). Among the 13 SC plants generated, three lines (SC4, SC14 and SC21) were established based on codA transcript levels, tolerance to methyl viologen-mediated oxidative stress and Southern blot analysis. Growth was better in SC plants than in non-transgenic (NT) plants, which was related to elevated transcript levels of auxin-response genes. SC plants accumulated higher levels of GB under oxidative stress compared to the NT plants. In addition, SC plants exhibited increased tolerance to drought and salt stress, which was associated with increased efficiency of photosystem II activity. Finally, SC plants maintained lower levels of ion leakage and reactive oxygen species under cold stress compared to the NT plants. These observations suggest that SC plants might be useful for reforestation on global marginal lands, including desertification and reclaimed areas. PMID:26795732