WorldWideScience

Sample records for berries vitis vinifera

  1. Glyphosate impacts on polyphenolic composition in grapevine (Vitis vinifera L.) berries and wine.

    Science.gov (United States)

    Donnini, Silvia; Tessarin, Paola; Ribera-Fonseca, Alejandra; Di Foggia, Michele; Parpinello, Giuseppina Paola; Rombolà, Adamo Domenico

    2016-12-15

    Glyphosate is the most widespread herbicide for weed management, being extensively used in viticulture. In this study we tested, under field conditions, the effects of glyphosate applications on the quality of berry and wine, from cv. Ancellotta (Vitis vinifera L.), with particular regard to anthocyanin concentration and composition. Ripening and growth were monitored by analyzing berry technological parameters and weight. Additionally, microvinifications were performed, in order to analyze the concentration of anthocyanins, other flavonoids and phenolic acids in wine. Our findings indicated that, at harvest, both pH and anthocyanin concentration were significantly lower and titratable acidity higher in berries collected from vines of plots under glyphosate-treatment compared with those of non-treated parcels. Data suggest that treatment with glyphosate did not change the concentration of anthocyanins, other flavonoids and phenolic acids in the wine. Our results indicate that treatment with glyphosate may affect fruit metabolism and nutritional value in non-target plants. PMID:27451151

  2. Distribution of rare earth elements in soil and grape berries of Vitis vinifera cv. "Glera".

    Science.gov (United States)

    Pepi, Salvatore; Sansone, Luigi; Chicca, Milvia; Marrocchino, Elena; Vaccaro, Carmela

    2016-08-01

    The renowned Vitis vinifera L. cultivar "Glera" (Magnoliopsida Vitaceae) has been grown for hundreds of years in the Italian regions of Veneto and Friuli to produce the sparkling Prosecco wine, with controlled designation of origin (DOC). We evaluated the relationship among the concentrations of rare earth elements (REE) in soil and in "Glera" grape berries in vineyards belonging to five different localities in the Veneto alluvial plain, all included in the DOC area of Prosecco. The concentration of REE in samples of soil and juice or solid residues of grape berries was determined by inductively coupled plasma mass spectrometry (ICP-MS), and the index of bioaccumulation was calculated to define the specific assimilation of these elements from soil to grape berries. The concentration of REE in soil samples allowed an identification of each locality examined, and REE were mostly detected in solid grape berry residues in comparison to juice. These data may be useful to associate REE distribution in soil and grape berries to a specific geographical origin, in order to prevent fraudulent use of wine denomination labels. PMID:27447714

  3. Patterns of sequence polymorphism in the fleshless berry locus in cultivated and wild Vitis vinifera accessions

    Directory of Open Access Journals (Sweden)

    Coriton Olivier

    2010-12-01

    Full Text Available Abstract Background Unlike in tomato, little is known about the genetic and molecular control of fleshy fruit development of perennial fruit trees like grapevine (Vitis vinifera L.. Here we present the study of the sequence polymorphism in a 1 Mb grapevine genome region at the top of chromosome 18 carrying the fleshless berry mutation (flb in order, first to identify SNP markers closely linked to the gene and second to search for possible signatures of domestication. Results In total, 62 regions (17 SSR, 3 SNP, 1 CAPS and 41 re-sequenced gene fragments were scanned for polymorphism along a 3.4 Mb interval (85,127-3,506,060 bp at the top of the chromosome 18, in both V. vinifera cv. Chardonnay and a genotype carrying the flb mutation, V. vinifera cv. Ugni Blanc mutant. A nearly complete homozygosity in Ugni Blanc (wild and mutant forms and an expected high level of heterozygosity in Chardonnay were revealed. Experiments using qPCR and BAC FISH confirmed the observed homozygosity. Under the assumption that flb could be one of the genes involved into the domestication syndrome of grapevine, we sequenced 69 gene fragments, spread over the flb region, representing 48,874 bp in a highly diverse set of cultivated and wild V. vinifera genotypes, to identify possible signatures of domestication in the cultivated V. vinifera compartment. We identified eight gene fragments presenting a significant deviation from neutrality of the Tajima's D parameter in the cultivated pool. One of these also showed higher nucleotide diversity in the wild compartments than in the cultivated compartments. In addition, SNPs significantly associated to berry weight variation were identified in the flb region. Conclusions We observed the occurrence of a large homozygous region in a non-repetitive region of the grapevine otherwise highly-heterozygous genome and propose a hypothesis for its formation. We demonstrated the feasibility to apply BAC FISH on the very small grapevine

  4. A candidate-gene association study for berry colour and anthocyanin content in Vitis vinifera L.

    Directory of Open Access Journals (Sweden)

    Silvana Cardoso

    Full Text Available Anthocyanin content is a trait of major interest in Vitis vinifera L. These compounds affect grape and wine quality, and have beneficial effects on human health. A candidate-gene approach was used to identify genetic variants associated with anthocyanin content in grape berries. A total of 445 polymorphisms were identified in 5 genes encoding transcription factors and 10 genes involved in either the biosynthetic pathway or transport of anthocyanins. A total of 124 SNPs were selected to examine association with a wide range of phenotypes based on RP-HPLC analysis and visual characterization. The phenotypes were total skin anthocyanin (TSA concentration but also specific types of anthocyanins and relative abundance. The visual assessment was based on OIV (Organisation Internationale de la Vigne et du Vin descriptors for berry and skin colour. The genes encoding the transcription factors MYB11, MYBCC and MYC(B were significantly associated with TSA concentration. UFGT and MRP were associated with several different types of anthocyanins. Skin and pulp colour were associated with nine genes (MYB11, MYBCC, MYC(B, UFGT, MRP, DFR, LDOX, CHI and GST. Pulp colour was associated with a similar group of 11 genes (MYB11, MYBCC, MYC(B, MYC(A, UFGT, MRP, GST, DFR, LDOX, CHI and CHS(A. Statistical interactions were observed between SNPs within the transcription factors MYB11, MYBCC and MYC(B. SNPs within LDOX interacted with MYB11 and MYC(B, while SNPs within CHI interacted with MYB11 only. Together, these findings suggest the involvement of these genes in anthocyanin content and on the regulation of anthocyanin biosynthesis. This work forms a benchmark for replication and functional studies.

  5. Transcriptome analysis at four developmental stages of grape berry (Vitis vinifera cv. Shiraz) provides insights into regulated and coordinated gene expression

    OpenAIRE

    Sweetman Crystal; Wong Darren CJ; Ford Christopher M; Drew Damian P

    2012-01-01

    Abstract Background Vitis vinifera berry development is characterised by an initial phase where the fruit is small, hard and acidic, followed by a lag phase known as veraison. In the final phase, berries become larger, softer and sweeter and accumulate an array of organoleptic compounds. Since the physiological and biochemical makeup of grape berries at harvest has a profound impact on the characteristics of wine, there is great interest in characterising the molecular and biophysical changes...

  6. Comparative expression profiling in grape (Vitis vinifera berries derived from frequency analysis of ESTs and MPSS signatures

    Directory of Open Access Journals (Sweden)

    Cook Douglas R

    2008-05-01

    Full Text Available Abstract Background Vitis vinifera (V. vinifera is the primary grape species cultivated for wine production, with an industry valued annually in the billions of dollars worldwide. In order to sustain and increase grape production, it is necessary to understand the genetic makeup of grape species. Here we performed mRNA profiling using Massively Parallel Signature Sequencing (MPSS and combined it with available Expressed Sequence Tag (EST data. These tag-based technologies, which do not require a priori knowledge of genomic sequence, are well-suited for transcriptional profiling. The sequence depth of MPSS allowed us to capture and quantify almost all the transcripts at a specific stage in the development of the grape berry. Results The number and relative abundance of transcripts from stage II grape berries was defined using Massively Parallel Signature Sequencing (MPSS. A total of 2,635,293 17-base and 2,259,286 20-base signatures were obtained, representing at least 30,737 and 26,878 distinct sequences. The average normalized abundance per signature was ~49 TPM (Transcripts Per Million. Comparisons of the MPSS signatures with available Vitis species' ESTs and a unigene set demonstrated that 6,430 distinct contigs and 2,190 singletons have a perfect match to at least one MPSS signature. Among the matched sequences, ESTs were identified from tissues other than berries or from berries at different developmental stages. Additional MPSS signatures not matching to known grape ESTs can extend our knowledge of the V. vinifera transcriptome, particularly when these data are used to assist in annotation of whole genome sequences from Vitis vinifera. Conclusion The MPSS data presented here not only achieved a higher level of saturation than previous EST based analyses, but in doing so, expand the known set of transcripts of grape berries during the unique stage in development that immediately precedes the onset of ripening. The MPSS dataset also revealed

  7. Oviposition preference and larval performance of Epiphyas postvittana (Lepidoptera: Tortricidae) on Botrytis cinerea (Helotiales: Sclerotiniaceae) infected berries of Vitis vinifera (Vitales: Vitaceae).

    Science.gov (United States)

    Rizvi, Syed Z M; Raman, Anantanarayanan; Wheatley, Warwick M; Cook, Geoffrey

    2016-04-01

    In this paper we tested the behavior of gravid Epiphyas postvittana in selecting the most-appropriate site for oviposition thus benefitting offspring performance. Our hypothesis was built on Jaenike's preference-performance hypothesis (also referred to as the "mother-knows-the-best" hypothesis). To test this, we used the interacting Epiphyas postvittana, its host Vitis vinifera, and the pathogenic microbe Botrytis cinerea system. Populations of E. postvittana and B. cinerea often exist concurrently on V. vinifera in Australasia and their interaction and mutual influence are currently being explored, although the suggestion presently is that the relationship between E. postvittana and B. cinerea is mutualistic. We tested the effect of volatiles from B. cinerea-infected berries and uninfected (control) berries of V. vinifera on the oviposition behavior of E. postvittana. We also characterized the effects of B. cinerea infection on the berries of V. vinifera on the growth and development of E. postvittana. Contrary to the preference-performance hypothesis, oviposition choices made by gravid E. postvittana did not result in the best offspring survival, development, and performance. The preference for oviposition by E. postvittana was strongly influenced by the olfactory and tactile cues. She laid fewer eggs on B. cinerea-infected berries compared to uninfected berries of V. vinifera. The larvae of E. postvittana showed no preference to uninfected berries of V. vinifera. The larvae fed on B. cinerea-infected berries of V. vinifera showing greater survival rate, shorter time to pupation, greater pupal mass, and on becoming adults they laid more numbers of eggs than the larvae that were enabled to feed on uninfected berries. The larvae of E. postvittana transport the conidia of B. cinerea and transmit grey-mould disease to uninfected berries of V. vinifera. PMID:25420720

  8. Brassinosteroids are involved in controlling sugar unloading in Vitis vinifera 'Cabernet Sauvignon' berries during véraison.

    Science.gov (United States)

    Xu, Fan; Xi, Zhu-Mei; Zhang, Hui; Zhang, Cheng-Jun; Zhang, Zhen-Wen

    2015-09-01

    Sugar unloading in grape berries is a crucial step in the long-distance transport of carbohydrates from grapevine leaves to berries. Brassinosteroids (BRs) mediate many physiological processes in plants including carbohydrate metabolism. Here, 'Cabernet Sauvignon' (Vitis vinifera L.) grape berries cultivated in clay loam fields were treated with an exogenous BR (24-epibrassinolide; EBR), a BR synthesis inhibitor (brassinazole; Brz), Brz + EBR (sprayed with EBR 24 h after a Brz treatment), and deionized water (control) at the onset of véraison. The EBR treatment sharply increased the soluble sugars content in the berries, but decreased it in the skins. The EBR and Brz + EBR treatments significantly promoted the activities of both invertases (acidic and neutral) and sucrose synthase (sucrolytic) at various stages of ripening. The mRNA levels of genes encoding sucrose metabolic invertase (VvcwINV), and monosaccharide (VvHT3, 4, 5 and 6) and disaccharide (VvSUC12 and 27) transporters were increased by the EBR and/or Brz + EBR treatments. Generally, the effects of the Brz treatment on the measured targets contrasted with the effects of the EBR treatments. The EBR and Brz treatments inhibited the biosynthesis of the endogenous BRs 6-deoxocastastarone and castasterone. Both EBR and Brz + EBR treatments increased the brassinolide contents, down-regulated the expression of genes encoding BRs biosynthetic enzymes BRASSINOSTEROID-6-OXIDASE and DWARF1, (VvBR6OX1 and VvDWF1) and induced BR receptor gene BRASSINOSTEROID INSENSITIVE 1 (VvBRI1) expression in deseeded berries. Together, these results show that BRs are involved in controlling sugar unloading in grape berries during véraison. PMID:26113159

  9. Effect of Rain-Shelter Cultivation of Vitis vinifera cv. Cabernet Gernischet on the Phenolic Profile of Berry Skins and the Incidence of Grape Diseases

    OpenAIRE

    Teng-Fei Xu; Jiang-Fei Meng; Peng-Fei Ning; Zhen-Wen Zhang

    2012-01-01

    Rain-shelter cultivation is an effective cultural method to prevent rainfall damage during grape harvest and widely applied in the Chinese rainy regions. In this study we investigated the effect of rain-shelter cultivation on grape diseases and phenolic composition in the skins of Vitis vinifera cv. Cabernet Gernischet grape berries through the comparison with open-field cultivation at two vintages (2010 and 2011). The results showed that rain-shelter cultivation reduced the incidence of grap...

  10. Berry and phenology-related traits in grapevine (Vitis vinifera L.: From Quantitative Trait Loci to underlying genes

    Directory of Open Access Journals (Sweden)

    Fanizza Girolamo

    2008-04-01

    Full Text Available Abstract Background The timing of grape ripening initiation, length of maturation period, berry size and seed content are target traits in viticulture. The availability of early and late ripening varieties is desirable for staggering harvest along growing season, expanding production towards periods when the fruit gets a higher value in the market and ensuring an optimal plant adaptation to climatic and geographic conditions. Berry size determines grape productivity; seedlessness is especially demanded in the table grape market and is negatively correlated to fruit size. These traits result from complex developmental processes modified by genetic, physiological and environmental factors. In order to elucidate their genetic determinism we carried out a quantitative analysis in a 163 individuals-F1 segregating progeny obtained by crossing two table grape cultivars. Results Molecular linkage maps covering most of the genome (2n = 38 for Vitis vinifera were generated for each parent. Eighteen pairs of homologous groups were integrated into a consensus map spanning over 1426 cM with 341 markers (mainly microsatellite, AFLP and EST-derived markers and an average map distance between loci of 4.2 cM. Segregating traits were evaluated in three growing seasons by recording flowering, veraison and ripening dates and by measuring berry size, seed number and weight. QTL (Quantitative Trait Loci analysis was carried out based on single marker and interval mapping methods. QTLs were identified for all but one of the studied traits, a number of them steadily over more than one year. Clusters of QTLs for different characters were detected, suggesting linkage or pleiotropic effects of loci, as well as regions affecting specific traits. The most interesting QTLs were investigated at the gene level through a bioinformatic analysis of the underlying Pinot noir genomic sequence. Conclusion Our results revealed novel insights into the genetic control of relevant

  11. Promoting Effect of Foliage Sprayed Zinc Sulfate on Accumulation of Sugar and Phenolics in Berries of Vitis vinifera cv. Merlot Growing on Zinc Deficient Soil

    Directory of Open Access Journals (Sweden)

    Chang-Zheng Song

    2015-02-01

    Full Text Available The effect of foliage sprayed zinc sulfate on berry development of Vitis vinifera cv. Merlot growing on arid zone Zn-deficient soils was investigated over two consecutive seasons, 2013 and 2014. Initial zinc concentration in soil and vines, photosynthesis at three berry developmental stages, berry weight, content of total soluble solids, titratable acidity, phenolics and expression of phenolics biosynthetic pathway genes throughout the stages were measured. Foliage sprayed zinc sulfate showed promoting effects on photosynthesis and berry development of vines and the promotion mainly occurred from veraison to maturation. Zn treatments enhanced the accumulation of total soluble solids, total phenols, flavonoids, flavanols, tannins and anthocyanins in berry skin, decreasing the concentration of titratable acidity. Furthermore, foliage sprayed zinc sulfate could significantly influence the expression of phenolics biosynthetic pathway genes throughout berry development, and the results of expression analysis supported the promotion of Zn treatments on phenolics accumulation. This research is the first comprehensive and detailed study about the effect of foliage sprayed Zn fertilizer on grape berry development, phenolics accumulation and gene expression in berry skin, providing a basis for improving the quality of grape and wine in Zn-deficient areas.

  12. Transcriptome analysis at four developmental stages of grape berry (Vitis vinifera cv. Shiraz provides insights into regulated and coordinated gene expression

    Directory of Open Access Journals (Sweden)

    Sweetman Crystal

    2012-12-01

    Full Text Available Abstract Background Vitis vinifera berry development is characterised by an initial phase where the fruit is small, hard and acidic, followed by a lag phase known as veraison. In the final phase, berries become larger, softer and sweeter and accumulate an array of organoleptic compounds. Since the physiological and biochemical makeup of grape berries at harvest has a profound impact on the characteristics of wine, there is great interest in characterising the molecular and biophysical changes that occur from flowering through veraison and ripening, including the coordination and temporal regulation of metabolic gene pathways. Advances in deep-sequencing technologies, combined with the availability of increasingly accurate V. vinifera genomic and transcriptomic data, have enabled us to carry out RNA-transcript expression analysis on a global scale at key points during berry development. Results A total of 162 million 100-base pair reads were generated from pooled Vitis vinifera (cv. Shiraz berries sampled at 3-weeks post-anthesis, 10- and 11-weeks post-anthesis (corresponding to early and late veraison and at 17-weeks post-anthesis (harvest. Mapping reads from each developmental stage (36-45 million onto the NCBI RefSeq transcriptome of 23,720 V. vinifera mRNAs revealed that at least 75% of these transcripts were detected in each sample. RNA-Seq analysis uncovered 4,185 transcripts that were significantly upregulated at a single developmental stage, including 161 transcription factors. Clustering transcripts according to distinct patterns of transcription revealed coordination in metabolic pathways such as organic acid, stilbene and terpenoid metabolism. From the phenylpropanoid/stilbene biosynthetic pathway at least 46 transcripts were upregulated in ripe berries when compared to veraison and immature berries, and 12 terpene synthases were predominantly detected only in a single sample. Quantitative real-time PCR was used to validate the

  13. Mass spectrometric and enzymatic evidence confirm the existence of anthocyanidin 3,5-O-diglucosides in cabernet sauvignon (Vitis vinifera L.) grape berries.

    Science.gov (United States)

    Xing, Ran-Ran; Li, Si-Yu; He, Fei; Yang, Zhe; Duan, Chang-Qing; Li, Zheng; Wang, Jun; Pan, Qiu-Hong

    2015-04-01

    It has been widely accepted that anthocyanidin 3,5-O-diglucosides do not exist in Vitis vinifera L. Cabernet Sauvignon (CS) berries. However, our anthocyanin analyses using HPLC-ESI-MS/MS detected the existence of a low level of anthocyanidin 3,5-O-diglucosides in the Cabernet Sauvignon grape berries grown in China. The authenticity of these samples was confirmed with microsatellite markers. The existence of anthocyanidin 3,5-O-diglucoside was further verified by the enzymatic evidence for the first time. Four putative 5-O-glucosyltransferase (5GT) genes were isolated from the Cabernet Sauvignon berries. The enzymatic analysis showed that a recombinant protein (designated as Vv5GT3) glucosylated the 3-O- and 5-O-positions of anthocyanidins and flavonols. A phylogenetic analysis revealed that this bifunctional enzyme belongs to the 5GT subfamily of UDP-glycosyltransferases. This finding brought a new understanding of the anthocyanins' profile and their biosynthesis in V. vinifera and would be helpful for further investigations of the mechanism of accumulation of anthocyanidin diglucosides in Cabernet Sauvignon berries in China's wine-producing regions. PMID:25771698

  14. Polyphenolic profiles detected in the ripe berries of Vitis vinifera germplasm

    Science.gov (United States)

    Polyphenols are an important class of secondary metabolites with significant benefits to human nutrition and health. As a part of our effort to assess grape germplasm for its potential health and nutrition value, we evaluated the polyphenolic profiles in the ripe berry samples of 344 European grape ...

  15. Influence of Berry Heterogeneity on Phenolics and Antioxidant Activity of Grapes and Wines: A Primary Study of the New Winegrape Cultivar Meili (Vitis vinifera L.).

    Science.gov (United States)

    Liu, Xu; Li, Jinlu; Tian, Yuping; Liao, Mingan; Zhang, Zhenwen

    2016-01-01

    Wine grapes are usually harvested in vineyards when they ripen. However, not all of the berries in a vineyard ripen homogeneously because of different microclimates around the clusters and berries. In this study, the influence of berry heterogeneity on the phenolic content and antioxidant capacity of grapes and wines under a continental monsoon climate was evaluated for a new wine grape cultivar Meili (Vitis vinifera L.). The total phenolic, flavonoid, flavanol, and monomeric anthocyanin contents in the skin and wine significantly increased with grape density; however, there was no significant difference in the seeds between the two lower densities. The highest values of DPPH free radical-scavenging activity, cupric-reducing antioxidant capacity, and hydroxyl radical-scavenging activity in the skin, seed and wine were detected for the densest berries. The sum of individual phenolic compounds in skin, seed and wine increased with berry density, though no significant difference for skin was observed between the two higher density classes. Hence, the chemical components of Meili grapes and wines were positively associated with the berry density at harvest under the continental monsoon climate. PMID:26974974

  16. Influence of Berry Heterogeneity on Phenolics and Antioxidant Activity of Grapes and Wines: A Primary Study of the New Winegrape Cultivar Meili (Vitis vinifera L.)

    Science.gov (United States)

    Liu, Xu; Li, Jinlu; Tian, Yuping; Liao, Mingan; Zhang, Zhenwen

    2016-01-01

    Wine grapes are usually harvested in vineyards when they ripen. However, not all of the berries in a vineyard ripen homogeneously because of different microclimates around the clusters and berries. In this study, the influence of berry heterogeneity on the phenolic content and antioxidant capacity of grapes and wines under a continental monsoon climate was evaluated for a new wine grape cultivar Meili (Vitis vinifera L.). The total phenolic, flavonoid, flavanol, and monomeric anthocyanin contents in the skin and wine significantly increased with grape density; however, there was no significant difference in the seeds between the two lower densities. The highest values of DPPH free radical-scavenging activity, cupric-reducing antioxidant capacity, and hydroxyl radical-scavenging activity in the skin, seed and wine were detected for the densest berries. The sum of individual phenolic compounds in skin, seed and wine increased with berry density, though no significant difference for skin was observed between the two higher density classes. Hence, the chemical components of Meili grapes and wines were positively associated with the berry density at harvest under the continental monsoon climate. PMID:26974974

  17. Berry Flesh and Skin Ripening Features in Vitis vinifera as Assessed by Transcriptional Profiling

    OpenAIRE

    Lijavetzky, Diego; Carbonell-Bejerano, Pablo; Grimplet, Jérôme; Bravo, Gema; Flores, Pilar; Fenoll, José; Hellín, Pilar; Oliveros, Juan C.; Martínez-Zapater, José M.

    2012-01-01

    Background Ripening of fleshy fruit is a complex developmental process involving the differentiation of tissues with separate functions. During grapevine berry ripening important processes contributing to table and wine grape quality take place, some of them flesh- or skin-specific. In this study, transcriptional profiles throughout flesh and skin ripening were followed during two different seasons in a table grape cultivar ‘Muscat Hamburg’ to determine tissue-specific as well as common de...

  18. Metabolic responses to sulfur dioxide in grapevine (Vitis vinifera L.): photosynthetic tissues and berries

    OpenAIRE

    Michael James Considine; Christine Helen Foyer

    2015-01-01

    Research on sulfite metabolism in plants has historically been undertaken within the context of industrial pollution. Resolution of the problem of sulfur pollution has led to sulfur deficiency in many soils and questions remain concerning how different plant organs deal with reactive and potentially toxic sulfur metabolites. In this review, we discuss sulfur dioxide/ sulfite assimilation in grape berries in relation to gene expression and quality traits, features that remain significant to th...

  19. Identification of Vitis vinifera L. grape berry skin color mutants and polyphenolic profile.

    Science.gov (United States)

    Ferreira, Vanessa; Fernandes, Fátima; Pinto-Carnide, Olinda; Valentão, Patrícia; Falco, Virgílio; Martín, Juan Pedro; Ortiz, Jesús María; Arroyo-García, Rosa; Andrade, Paula B; Castro, Isaura

    2016-03-01

    A germplasm set of twenty-five grapevine accessions, forming eleven groups of possible berry skin color mutants, were genotyped with twelve microsatellite loci, being eleven of them identified as true color mutants. The polyphenolic profiling of the confirmed mutant cultivars revealed a total of twenty-four polyphenols, comprising non-colored compounds (phenolic acids, flavan-3-ols, flavonols and a stilbene) and anthocyanins. Results showed differences in the contribution of malvidin-3-O-glucoside to the characteristic Pinot Noir anthocyanins profile. Regarding the two Pique-Poul colored variants, the lighter variant was richer than the darker one in all classes of compounds, excepting anthocyanins. In Moscatel Galego Roxo the F3'H pathway seems to be more active than F3'5'H, resulting in higher amounts of cyanidin, precursor of the cyanidin derivatives. As far as we are aware, this is the first time that a relationship between the content of polyphenolic compounds is established in groups of grape berry skin color mutant cultivars. PMID:26471534

  20. Grapevine (Vitis vinifera L.).

    Science.gov (United States)

    Torregrosa, Laurent; Vialet, Sandrine; Adivèze, Angélique; Iocco-Corena, Pat; Thomas, Mark R

    2015-01-01

    Grapevine (Vitis) is considered to be one of the major fruit crops in the world based on hectares cultivated and economic value. Grapes are used not only for wine but also for fresh fruit, dried fruit, and juice production. Wine is by far the major product of grapes, and the focus of this chapter is on wine grape cultivars. Grapevine cultivars of Vitis vinifera L. have a reputation for producing premium quality wines. These premium quality wines are produced from a small number of cultivars that enjoy a high level of consumer acceptance and are firmly entrenched in the market place because of varietal name branding and the association of certain wine styles and regions with specific cultivars. In light of this situation, grapevine improvement by a transgenic approach is attractive when compared to a classical breeding approach. The transfer of individual traits as single genes with a minimum disruption to the original genome would leave the traditional characteristics of the cultivar intact. However, a reliable transformation system is required for a successful transgenic approach to grapevine improvement. There are three criteria for achieving an efficient Agrobacterium-mediated transformation system: (1) the production of highly regenerative transformable tissue, (2) optimal cocultivation conditions for both grapevine tissue and Agrobacterium, and (3) an efficient selection regime for transgenic plant regeneration. In this chapter, we describe a grapevine transformation system that meets these criteria. We also describe a protocol for the production of transformed roots suitable for functional gene studies and for the production of semi-transgenic grafted plants. PMID:25416258

  1. Metabolic responses to sulfur dioxide in grapevine (Vitis vinifera L.: photosynthetic tissues and berries

    Directory of Open Access Journals (Sweden)

    Michael James Considine

    2015-02-01

    Full Text Available Research on sulfite metabolism in plants has historically been undertaken within the context of industrial pollution. Resolution of the problem of sulfur pollution has led to sulfur deficiency in many soils and questions remain concerning how different plant organs deal with reactive and potentially toxic sulfur metabolites. In this review, we discuss sulfur dioxide/ sulfite assimilation in grape berries in relation to gene expression and quality traits, features that remain significant to the food industry. We consider the intrinsic metabolism of sulfite and its consequences for fruit biology and postharvest physiology, comparing the different responses in fruit and leaves. We also highlight inconsistencies in what is considered the ‘ambient’ environmental or industrial exposures to SO2. We discuss these findings in relation to the persistent threat to the table grape industry that intergovernmental agencies will revoke the industry’s exemption to the worldwide ban on the use of SO2 for preservation of fresh foods. Transcriptome profiling studies on fruit suggest that added value may accrue from effects of SO2 fumigation on the expression of genes encoding components involved in processes that underpin traits related to customer satisfaction, particularly in table grapes, where SO¬2 fumigation may extend for several months.

  2. Generation of a predicted protein database from EST data and application to iTRAQ analyses in grape (Vitis vinifera cv. Cabernet Sauvignon berries at ripening initiation

    Directory of Open Access Journals (Sweden)

    Smith Derek

    2009-01-01

    Full Text Available Abstract Background iTRAQ is a proteomics technique that uses isobaric tags for relative and absolute quantitation of tryptic peptides. In proteomics experiments, the detection and high confidence annotation of proteins and the significance of corresponding expression differences can depend on the quality and the species specificity of the tryptic peptide map database used for analysis of the data. For species for which finished genome sequence data are not available, identification of proteins relies on similarity to proteins from other species using comprehensive peptide map databases such as the MSDB. Results We were interested in characterizing ripening initiation ('veraison' in grape berries at the protein level in order to better define the molecular control of this important process for grape growers and wine makers. We developed a bioinformatic pipeline for processing EST data in order to produce a predicted tryptic peptide database specifically targeted to the wine grape cultivar, Vitis vinifera cv. Cabernet Sauvignon, and lacking truncated N- and C-terminal fragments. By searching iTRAQ MS/MS data generated from berry exocarp and mesocarp samples at ripening initiation, we determined that implementation of the custom database afforded a large improvement in high confidence peptide annotation in comparison to the MSDB. We used iTRAQ MS/MS in conjunction with custom peptide db searches to quantitatively characterize several important pathway components for berry ripening previously described at the transcriptional level and confirmed expression patterns for these at the protein level. Conclusion We determined that a predicted peptide database for MS/MS applications can be derived from EST data using advanced clustering and trimming approaches and successfully implemented for quantitative proteome profiling. Quantitative shotgun proteome profiling holds great promise for characterizing biological processes such as fruit ripening

  3. Ampelographic description of cluster, berry and seed of merlot cultivar (Vitis vinifera L.) and its selected clones

    OpenAIRE

    Vujović Dragan S.; Žunić Dragoljub M.; Pejin Boris M.; Popović-Đorđević Jelena B.

    2016-01-01

    During a four-year period, ampelographic experiments focusing on the berry cluster (average length of grape cluster, number of grape clusters per shoot, number of berries per grape cluster and length of peduncle), berry (length of berry and berry juice yield), length of pedicel and seed (length of berry seed) of Merlot cultivar (used as a relevant standard) and 11 clones (Nos. 022, 023, 025, 026, 027, 028, 029, 030, 031, 033 and 034) were performed in order...

  4. Effect of Rain-Shelter Cultivation of Vitis vinifera cv. Cabernet Gernischet on the Phenolic Profile of Berry Skins and the Incidence of Grape Diseases

    Directory of Open Access Journals (Sweden)

    Teng-Fei Xu

    2012-12-01

    Full Text Available Rain-shelter cultivation is an effective cultural method to prevent rainfall damage during grape harvest and widely applied in the Chinese rainy regions. In this study we investigated the effect of rain-shelter cultivation on grape diseases and phenolic composition in the skins of Vitis vinifera cv. Cabernet Gernischet grape berries through the comparison with open-field cultivation at two vintages (2010 and 2011. The results showed that rain-shelter cultivation reduced the incidence of grape diseases significantly and delayed the maturation of Cabernet Gernischet fruits. With regards to most of the phenolic compounds identified in this study, their content in grape samples under rain-shelter cultivation was decreased compared to those under open-field cultivation. However, rain-shelter cultivation stimulated the accumulation of dihydroquercetin-3-O-rhamnoside in grape skins during grape maturation. These were related with micrometeorological alterations in vineyards by using plastic covering under rain-shelter cultivation. It suggests the rain-shelter cultivation makes possible the cultivation of “Cabernet Gernischet” grapes in an organic production system, for providing a decrease in the incidence of diseases and the dependence on chemical pesticides in the grape and wine industry.

  5. Whole-Metagenome-Sequencing-Based Community Profiles of Vitis vinifera L. cv. Corvina Berries Withered in Two Post-harvest Conditions.

    Science.gov (United States)

    Salvetti, Elisa; Campanaro, Stefano; Campedelli, Ilenia; Fracchetti, Fabio; Gobbi, Alex; Tornielli, Giovanni Battista; Torriani, Sandra; Felis, Giovanna E

    2016-01-01

    Vitis vinifera L. cv. Corvina grape forms the basis for the production of unique wines, such as Amarone, whose distinctive sensory features are strongly linked to the post-harvest grape withering process. Indeed, this process increases sugar concentration and changes must characteristics. While microorganisms involved in must fermentation have been widely investigated, few data are available on the microbiota of withered grapes. Thus, in this paper, a whole metagenome sequencing (WMS) approach was used to analyse the microbial consortium associated with Corvina berries at the end of the withering process performed in two different conditions ("traditional withering," TW or "accelerated withering," AW), and to unveil whether changes of drying parameters could have an impact on microbial diversity. Samples of healthy undamaged berries were collected and washed, to recover microorganisms from the surface and avoid contamination with grapevine genetic material. Isolated DNA was sequenced and the data obtained were analyzed with several bioinformatics methods. The eukaryotic community was mainly composed by members of the phylum Ascomycota, including Eurotiomycetes, Sordariomycetes, and Dothideomycetes. Moreover, the distribution of the genera Aspergillus and Penicillium (class Eurotiomycetes) varied between the withered berry samples. Instead, Botryotinia, Saccharomyces, and other wine technologically useful microorganisms were relatively scarce in both samples. For prokaryotes, 25 phyla were identified, nine of which were common to both conditions. Environmental bacteria belonging to the class Gammaproteobacteria were dominant and, in particular, the TW sample was characterized by members of the family Pseudomonadaceae, while members of the family Enterobacteriaceae dominated the AW sample, in addition to Sphyngobacteria and Clostridia. Finally, the binning procedure discovered 15 putative genomes which dominated the microbial community of the two samples, and

  6. Whole-metagenome-sequencing-based community profiles of Vitis vinifera L. cv. Corvina berries withered in two post-harvest conditions

    Directory of Open Access Journals (Sweden)

    Elisa eSalvetti

    2016-06-01

    Full Text Available Vitis vinifera L. cv. Corvina grape forms the basis for the production of unique wines, such as Amarone, whose distinctive sensory features are strongly linked to the post-harvest grape withering process. Indeed, this process increases sugar concentration and changes must characteristics. While microorganisms involved in must fermentation have been widely investigated, few data are available on the microbiota of withered grapes. Thus, in this paper, a whole metagenome sequencing (WMS approach was used to analyse the microbial consortium associated with Corvina berries at the end of the withering process performed in two different conditions (traditional withering, TW or accelerated withering, AW, and to unveil whether changes of environmental drying parameters could have an impact on microbial diversity.Samples of healthy undamaged berries were collected and washed, to recover microorganisms from the surface and avoid contamination with grapevine genetic material. Isolated DNA was sequenced and the data obtained were analyzed with several bioinformatics methods. The eukaryotic community was mainly composed by members of the phylum Ascomycota, including Eurotiomycetes, Sordariomycetes and Dothideomycetes. Moreover, the distribution of the genera Aspergillus and Penicillium (class Eurotiomycetes varied between the withered berry samples. Instead, Botryotinia, Saccharomyces and other wine technologically useful microorganisms were relatively scarce in both samples.For prokaryotes, 25 phyla were identified, nine of which were common to both conditions. Environmental bacteria belonging to the class Gammaproteobacteria were dominant and, in particular, the TW sample was characterized by members of the family Pseudomonadaceae, while members of the family Enterobacteriaceae dominated the AW sample, in addition to Sphyngobacteria and Clostridia. Finally, the binning procedure discovered 15 putative genomes which dominated the microbial community of the

  7. Whole-Metagenome-Sequencing-Based Community Profiles of Vitis vinifera L. cv. Corvina Berries Withered in Two Post-harvest Conditions

    Science.gov (United States)

    Salvetti, Elisa; Campanaro, Stefano; Campedelli, Ilenia; Fracchetti, Fabio; Gobbi, Alex; Tornielli, Giovanni Battista; Torriani, Sandra; Felis, Giovanna E.

    2016-01-01

    Vitis vinifera L. cv. Corvina grape forms the basis for the production of unique wines, such as Amarone, whose distinctive sensory features are strongly linked to the post-harvest grape withering process. Indeed, this process increases sugar concentration and changes must characteristics. While microorganisms involved in must fermentation have been widely investigated, few data are available on the microbiota of withered grapes. Thus, in this paper, a whole metagenome sequencing (WMS) approach was used to analyse the microbial consortium associated with Corvina berries at the end of the withering process performed in two different conditions (“traditional withering,” TW or “accelerated withering,” AW), and to unveil whether changes of drying parameters could have an impact on microbial diversity. Samples of healthy undamaged berries were collected and washed, to recover microorganisms from the surface and avoid contamination with grapevine genetic material. Isolated DNA was sequenced and the data obtained were analyzed with several bioinformatics methods. The eukaryotic community was mainly composed by members of the phylum Ascomycota, including Eurotiomycetes, Sordariomycetes, and Dothideomycetes. Moreover, the distribution of the genera Aspergillus and Penicillium (class Eurotiomycetes) varied between the withered berry samples. Instead, Botryotinia, Saccharomyces, and other wine technologically useful microorganisms were relatively scarce in both samples. For prokaryotes, 25 phyla were identified, nine of which were common to both conditions. Environmental bacteria belonging to the class Gammaproteobacteria were dominant and, in particular, the TW sample was characterized by members of the family Pseudomonadaceae, while members of the family Enterobacteriaceae dominated the AW sample, in addition to Sphyngobacteria and Clostridia. Finally, the binning procedure discovered 15 putative genomes which dominated the microbial community of the two samples, and

  8. Ampelographic description of cluster, berry and seed of merlot cultivar (Vitis vinifera L. and its selected clones

    Directory of Open Access Journals (Sweden)

    Vujović Dragan S.

    2016-01-01

    Full Text Available During a four-year period, ampelographic experiments focusing on the berry cluster (average length of grape cluster, number of grape clusters per shoot, number of berries per grape cluster and length of peduncle, berry (length of berry and berry juice yield, length of pedicel and seed (length of berry seed of Merlot cultivar (used as a relevant standard and 11 clones (Nos. 022, 023, 025, 026, 027, 028, 029, 030, 031, 033 and 034 were performed in order to establish the differences among them. These experiments were actually conducted in the third phase of individual clonal selection of Merlot cultivar carried out in Serbia. The lengths of grape cluster and pedicel as well as berry must yields differed significantly among the examined clones. The cluster and principal component analyses classified 12 samples into three divergent clusters/groups, respectively. The clones belonging to the cluster II /the second group/ had significantly higher values of numbers of grape clusters per shoot and berries per grape cluster; lengths of peduncle and berry; berry must yield and length of pedicel, compared both to standard Merlot /the cluster I, the first group/ and the clones of the cluster III /the third group/. The phenological observations showed no significant differences in the beginnings and durations of phenological stages and vegetation period of the examined clones. The obtained results indicate the real need for further research work focused both on the agrobiological and technological properties of the grapes and wines aiming to better describe the selected clones. [Projekat Ministarstva nauke Republike Srbije, br. 0719, br. 46009 i br. 172053

  9. New stable QTLs for berry weight do not colocalize with QTLs for seed traits in cultivated grapevine (Vitis vinifera L.)

    OpenAIRE

    Bertrand, Yves; Farnos, Marc; Grolier, Michel; Romieu, Charles; Esnault, Florence; Dias, Sonia; Berger, Gilles; Francois, Pierre; Pons, Thierry; Ortigosa, Patrick; Roux, Catherine; Houel, Cléa; Laucou, Valerie; Bacilieri, Roberto; PEROS, Jean-Pierre

    2013-01-01

    BACKGROUND: In grapevine, as in other fruit crops, fruit size and seed content are key components of yield and quality; however, very few Quantitative Trait Loci (QTLs) for berry weight and seed content (number, weight, and dry matter percentage) have been discovered so far. To identify new stable QTLs for marker-assisted selection and candidate gene identification, we performed simultaneous QTL detection in four mapping populations (seeded or seedless) with various genetic backgrounds. RES...

  10. Metabolic and biological profile of autochthonous Vitis vinifera L. ecotypes.

    Science.gov (United States)

    Impei, Stefania; Gismondi, Angelo; Canuti, Lorena; Canini, Antonella

    2015-05-01

    Vitis vinifera L. is a plant species rich in phenolic compounds that are usually associated with the health benefits of wine and grape consumption in the diet. Anthocyanins, catechins, flavonol, phenolic acids and stilbenes are key molecular constituents of the Vitis berries, affecting the quality of grape products. The purpose of this work was to identify the metabolic profiles of 37 genetically certified V. vinifera Latial accessions. In particular, qualitative and quantitative analyses of specific secondary metabolites and total phenolic and tannin contents were performed by LC-MS and spectrophotometric analysis. In addition, since plant molecules are well-known for their free radical scavenging properties, the antioxidant effects of the sample extracts were evaluated through two different antiradical assays: DPPH and FRAP tests. Finally, a preliminary screening of the antiproliferative activity of each specimen on HCT-116 human colorectal cancer cells was conducted. All the results showed a great variety and amount of phenolic compounds in all accessions; moreover, we observed a significant correlation in the extracts between the metabolite concentration and bioactivity. Besides, some samples presented extraordinary biological effects, such as reduction of tumor cell growth not associated with cytotoxicity, supporting their use as possible future adjuvants for cancer therapy. In conclusion, the present research increased the scientific knowledge about Italian autochthonous vine ecotypes in order to valorize them and support their reintroduction in the local economic system. PMID:25820686

  11. Fruit ripening in Vitis vinifera: spatiotemporal relationships among turgor, sugar accumulation, and anthocyanin biosynthesis

    OpenAIRE

    Castellarin, Simone D; Gambetta, Greg A.; Wada, Hiroshi; Shackel, Ken A.; Matthews, Mark A.

    2011-01-01

    This study reports the first observations indicating the spatiotemporal relationships among genetic and physiological aspects of ripening in the berry of Vitis vinifera. At the onset of ripening in the red flesh variety Alicante Bouschet, colour development began in the flesh at the stylar end of the fruit and progressed toward the pedicel end flesh and into the skin. Tissue solute potential and cell turgor also decreased first in the flesh. The decrease in flesh solute potential was due to a...

  12. Metabolomics reveals simultaneous influences of plant defence system and fungal growth in Botrytis cinerea-infected Vitis vinifera cv. Chardonnay berries.

    Science.gov (United States)

    Hong, Young-Shick; Martinez, Agathe; Liger-Belair, Gérard; Jeandet, Philippe; Nuzillard, Jean-Marc; Cilindre, Clara

    2012-10-01

    Botrytis cinerea is a fungal plant pathogen of grape berries, leading to economic and quality losses in wine production. The global metabolite changes induced by B. cinerea infection in grape have not been established to date, even though B. cinerea infection is known to cause significant changes in chemicals or metabolites. In order to better understand metabolic mechanisms linked to the infection process and to identify the metabolites associated with B. cinerea infection, (1)H NMR spectroscopy was used in global metabolite profiling and multivariate statistical analysis of berries from healthy and botrytized bunches. Pattern recognition methods, such as principal component analysis, revealed clear metabolic discriminations between healthy and botrytized berries of botrytized bunches and healthy berries of healthy bunches. Significantly high levels of proline, glutamate, arginine, and alanine, which are accumulated upon plant stress, were found in healthy and botrytized berries of botrytized bunches. Moreover, largely degraded phenylpropanoids, flavonoid compounds, and sucrose together with markedly produced glycerol, gluconic acid, and succinate, all being directly associated with B. cinerea growth, were only found in botrytized berries of botrytized bunches. This study reports that B. cinerea infection causes significant metabolic changes in grape berry and highlights that both the metabolic perturbations associated with the plant defence system and those directly derived from fungal pathogen growth should be considered to better understand the interaction between metabolic variation and biotic pathogen stress in plants. PMID:22945941

  13. Anatomy of Vitis Berries During Their Coloring

    Institute of Scientific and Technical Information of China (English)

    WAN Yi-zhen; HE Pu-chao

    2002-01-01

    During 1998-1999, the course of the berry coloring and the development of the pigment cells from veraison to ripeness were studied by freeze sectioning 43 accessions of 12 Vitis species (including 10 Chinese wild species). External observation showed that the berries of most species began coloring on the fruit top surface or on the sun-lit surface, and the berry surface color was evenly distributed when the berry was ripe.Internal observation revealed that the pigment cells in a few layers between cuticle and sub-cuticle colored first, the cuticle colored from inner layers to outer layers while the sub-cuticle from outer to inner, and the cuticle cells began coloring a little earlier than the sub-cuticle ones in most species. The pigment cells developed unevenly during the berry ripening. In the beginning of berry coloring, the cell pigment density among the layers or among the cells in the same layer was different. Both the numbers of the pigmented cells and the cell pigment density increased during the berry coloring, while the former lasted a short time; however, the latter kept increasing from veraison to ripeness, and they reached the deepest color when the berry was ripe.

  14. Seasonal pattern of apoplastic solute accumulation and loss of cell turgor during ripening of Vitis vinifera fruit under field conditions

    OpenAIRE

    Wada, Hiroshi; MATTHEWS, MARK A.; Shackel, Ken A

    2009-01-01

    Using a novel pressure membrane (PM) apparatus for the extraction of apoplastic fluid from field-grown grape (Vitis vinifera L.) berries, our hypothesis that significant apoplast solutes accumulate at the beginning of the ripening process (i.e. veraison), and that this accumulation might contribute to progressive berry softening due to a progressive loss of mesocarp cell turgor pressure (P) was tested. It was necessary to correct the solute potential (Ψs) of fluid collected with the PM for di...

  15. Xenia and metaxenia in grapes: differences in berry and seed characteristics of maternal grape cv. 'Narince' (Vitis vinifera L.) as influenced by different pollen sources.

    Science.gov (United States)

    Sabir, A

    2015-03-01

    Literature investigations indicate that the grapes have quite complex fertilisation biology. This complexity necessitates extensive investigations to obtain reliable knowledge for both well-organised hybridisation studies and maximising grape yield. Therefore, this study was conducted to investigate the influences of self-, free- and cross-pollination on berry and seed characteristics in grape. Five different pollination treatments were applied to 'Narince', the most widely known and popular white wine grape in Turkey. Pollen tests indicated that all the cultivars had satisfactory in vitro pollen viability percentages. Free-pollination produced a significantly higher percentage berry set. Among the pollinizers, the use of pollen of 'Thompson Seedless' and 'Cardinal' varieties resulted in higher berry set percentage in 'Narince'. The free-pollination was also superior in giving the highest weight, length and width of the berry, as well as number of seeds per berry. These findings revealed that there were strong xenial and metaxenial effects in the studied grape cultivars. Among the pollinizer cultivars, the most effective pollinator was 'Thompson Seedless'. Hence, for better berry set and quality, the use of 'Thompson Seedless' as a pollinizer may be an attractive option in both grape production and breeding studies. PMID:25251333

  16. Effects of solar radiation on grape (Vitis vinifera L.) composition and dried fruit colour

    International Nuclear Information System (INIS)

    Most sun-exposed fruit (Vitis vinifera L.) produced dark brown berries with low L-values, whereas most dried berries from shade fruit were acceptable in lightness although some had a green tinge. Fruit shaded by the natural vine canopy or exposed to direct solar radiation had similar drying ratios. However, berry weights were significantly higher in the shade than in the sun for both cultivars. The difference in berry weight between the two positions was less pronounced in the heat affected year. Solar radiation changed the composition of fresh berries and the colour of the dried fruit. The soluble-solid concentration was higher in fresh fruit exposed to direct solar radiation than in fruit grown in shaded conditions within the canopy. In the heat affected year the berries from both positions had the same soluble-solid concentrations, possibly due to dehydration of the fruit. No significant difference was found between the pH of sun fruit and shade fruit, but the titratable acidity was higher in shade fruit. Malate and tartrate concentrations in berry skin and the polyphenol oxidase activities had carotenoid concentrations in whole fresh berries were not significantly different for sun and shade fruit. Total phenol concentrations in berry skin were higher in sun fruit and chlorophyll concentrations in whole, fresh berries were higher in shade fruit. (author)

  17. (1)H NMR foodomics reveals that the biodynamic and the organic cultivation managements produce different grape berries (Vitis vinifera L. cv. Sangiovese).

    Science.gov (United States)

    Picone, Gianfranco; Trimigno, Alessia; Tessarin, Paola; Donnini, Silvia; Rombolà, Adamo Domenico; Capozzi, Francesco

    2016-12-15

    The increasing demand for natural foods and beverages, i.e. prepared by excluding synthetic chemicals along the whole production chain, has boosted the adoption of organic and biodynamic cultivation methods which are based on protocols avoiding use of synthetic pesticides. This trend is striking in viticulture, since wine production is largely shaped by the varying drinking attitudes of environment-friendly consumers. Using (1)H NMR, the compositions of grape berries, collected at harvest in 2009 and 2011, in experimental plots cultivated either with biodynamic or organic methods, were compared. Although the analysis provides a comprehensive metabolic profile of berries, the resulting distinctive pattern consists of a few molecules. Lower content of sugars, coumaric and caffeic acids, as well as higher amount of γ-aminobutyric acid (GABA) were observed in biodynamic grapes. The (1)H NMR foodomics approach evidenced a diverse fruit metabolome that could be associated to a different physiological response of plants to the agronomic environment. PMID:27451171

  18. Metabolic profiling reveals coordinated switches in primary carbohydrate metabolism in grape berry (Vitis vinifera L.), a non-climacteric fleshy fruit

    OpenAIRE

    Dai, Z.; Leon, C.; Feil, R.; Lunn, J.; Delrot, S.; Gomes, E.

    2013-01-01

    Changes in carbohydrate metabolism during grape berry development play a central role in shaping the final composition of the fruit. The present work aimed to identify metabolic switches during grape development and to provide insights into the timing of developmental regulation of carbohydrate metabolism. Metabolites from central carbon metabolism were measured using high-pressure anion-exchange chromatography coupled to tandem mass spectrometry and enzymatic assays during the development of...

  19. Use of response surface methodology for the assessment of changes in the volatile composition of Moscato bianco (Vitis vinifera L.) grape berries during ripening.

    Science.gov (United States)

    Torchio, Fabrizio; Giacosa, Simone; Vilanova, Mar; Río Segade, Susana; Gerbi, Vincenzo; Giordano, Manuela; Rolle, Luca

    2016-12-01

    The changes in the volatile composition of Moscato bianco grapes were evaluated during ripening. Grape berries were sampled for five weeks (16-20 °Brix) and sorted for each date in ten density classes (1.05-1.12g/cm(3)). The highest total concentration of free terpenes was found at 19.3 °Brix; however, total concentration of the bound fraction increased significantly throughout ripening. Response surface methodology was used to assess the simultaneous effect of sampling time and berry density on the volatile composition, which was satisfactorily fitted to regression models for some key terpene compounds. Total free and bound terpenes were more affected by grape density than by sampling date. The same behaviour was observed for free and bound linalool and bound nerol, whereas the stronger effect of sampling date was exhibited for bound t-rose oxide, c-rose oxide and geraniol. The results showed that the sampling strategy impacted strongly on the aroma quality of berries. PMID:27374570

  20. Analysis of the Molecular Dialogue Between Gray Mold (Botrytis cinerea) and Grapevine (Vitis vinifera) Reveals a Clear Shift in Defense Mechanisms During Berry Ripening.

    Science.gov (United States)

    Kelloniemi, Jani; Trouvelot, Sophie; Héloir, Marie-Claire; Simon, Adeline; Dalmais, Bérengère; Frettinger, Patrick; Cimerman, Agnès; Fermaud, Marc; Roudet, Jean; Baulande, Sylvain; Bruel, Christophe; Choquer, Mathias; Couvelard, Linhdavanh; Duthieuw, Mathilde; Ferrarini, Alberto; Flors, Victor; Le Pêcheur, Pascal; Loisel, Elise; Morgant, Guillaume; Poussereau, Nathalie; Pradier, Jean-Marc; Rascle, Christine; Trdá, Lucie; Poinssot, Benoit; Viaud, Muriel

    2015-11-01

    Mature grapevine berries at the harvesting stage (MB) are very susceptible to the gray mold fungus Botrytis cinerea, while veraison berries (VB) are not. We conducted simultaneous microscopic and transcriptomic analyses of the pathogen and the host to investigate the infection process developed by B. cinerea on MB versus VB, and the plant defense mechanisms deployed to stop the fungus spreading. On the pathogen side, our genome-wide transcriptomic data revealed that B. cinerea genes upregulated during infection of MB are enriched in functional categories related to necrotrophy, such as degradation of the plant cell wall, proteolysis, membrane transport, reactive oxygen species (ROS) generation, and detoxification. Quantitative-polymerase chain reaction on a set of representative genes related to virulence and microscopic observations further demonstrated that the infection is also initiated on VB but is stopped at the penetration stage. On the plant side, genome-wide transcriptomic analysis and metabolic data revealed a defense pathway switch during berry ripening. In response to B. cinerea inoculation, VB activated a burst of ROS, the salicylate-dependent defense pathway, the synthesis of the resveratrol phytoalexin, and cell-wall strengthening. On the contrary, in infected MB, the jasmonate-dependent pathway was activated, which did not stop the fungal necrotrophic process. PMID:26267356

  1. [Effects of rootstocks on the growth and berry quality of Vitis vinifera cv. Cabernet Sauvignon grapevine in Changli zone, Hebei Province, China].

    Science.gov (United States)

    Li, Min-min; Yuan, Jun-wei; Liu, Chang-jiang; Han, Bin; Huang, Jia-zhen; Guo, Zi-juan; Zhao, Sheng-iian

    2016-01-01

    Cabernet Sauvignon grafted onto seven rootstocks 188-08, 5BB, SO4, 3309C, 110R, 5C and 101-14M, with the own-rooted vines as control, were investigated to study the effects of different rootstocks on the growth, fruit quality and yield of Cabernet Sauvignon in Changli zone, Hebei Province, China. The results showed that Cabernet Sauvignon grafted on 5BB and 5C significantly increased the trunk diameter, and 5C significantly increased one-year-old shoot diameter. 188-08, 5BB and 5C as rootstock obviously improved berry soluble solid content, in addition 188- 08 and 5BB significantly increased berry reducing sugar content. The vines on 101-14M and 3309C significantly decreased berry titratable acid content. The rootstock 5C and 101-14M significantly raised grape skin phenol and anthocyanin contents, and rootstock 101-14M significantly increased tannin content in grape skin. Cabernet Sauvignon grafted onto 3309C, 110R, 5C and 101-14M obviously got higher yield per vine than own-rooted vines. Growing parameter, grape quality index and yield per vine grafted on seven rootstocks and own-rooted vine were synthetically evaluated by fuzzy evaluation method, and the synthetical effects of vine grafted on seven rootstocks were better than own-rooted vine, with the order of scores from high to low as 5C, 101-14M, 3309C, 5BB, 188-08, 110R and SO4 under Changli unique climate and environment conditions. PMID:27228593

  2. Biosynthesis of sesquiterpenes in grape berry exocarp of Vitis vinifera L.: evidence for a transport of farnesyl diphosphate precursors from plastids to the cytosol.

    Science.gov (United States)

    May, Bianca; Lange, B Markus; Wüst, Matthias

    2013-11-01

    The participation of the mevalonic acid (MVA) and 1-deoxy-d-xylulose 5-phosphate/2-C-methyl-d-erythritol-4-phosphate (DOXP/MEP) pathways in sesquiterpene biosynthesis of grape berries was investigated. There is an increasing interest in this class of terpenoids, since the oxygenated sesquiterpene rotundone was identified as the peppery aroma impact compound in Australian Shiraz wines. To investigate precursor supply pathway utilization, in vivo feeding experiments were performed with the deuterium labeled, pathway specific, precursors [5,5-(2)H2]-1-deoxy-d-xylulose and [5,5-(2)H2]-mevalonic acid lactone. Head Space-Solid Phase Micro Extraction-Gas Chromatography-Mass Spectrometry (HS-SPME-GC-MS) analysis of the generated volatile metabolites demonstrated that de novo sesquiterpene biosynthesis is mainly located in the grape berry exocarp (skin), with no detectable activity in the mesocarp (flesh) of the Lemberger variety. Interestingly, precursors from both the (primarily) cytosolic MVA and plastidial DOXP/MEP pathways were incorporated into grape sesquiterpenes in the varieties Lemberger, Gewürztraminer and Syrah. Our labeling data provide evidence for a homogenous, cytosolic pool of precursors for sesquiterpene biosynthesis, indicating that a transport of precursors occurs mostly from plastids to the cytosol. The labeling patterns of the sesquiterpene germacrene D were in agreement with a cyclization mechanism analogous to that of a previously cloned enantioselective (R)-germacrene D synthase from Solidago canadensis. This observation was subsequently confirmed by enantioselective GC-MS analysis demonstrating the exclusive presence of (R)-germacrene D, and not the (S)-enantiomer, in grape berries. PMID:23954075

  3. Genome-Wide Transcriptional Profiles of the Berry Skin of Two Red Grape Cultivars (Vitis vinifera) in Which Anthocyanin Synthesis Is Sunlight-Dependent or -Independent

    OpenAIRE

    Wu, Ben-Hong; Cao, Yue-Gang; Guan, Le; Xin, Hai-Ping; Li, Ji-Hu; Li, Shao-Hua

    2014-01-01

    Global gene expression was analyzed in the berry skin of two red grape cultivars, which can (‘Jingyan’) or cannot (‘Jingxiu’) synthesize anthocyanins after sunlight exclusion from fruit set until maturity. Gene transcripts responding to sunlight exclusion in ‘Jingyan’ were less complex than in ‘Jingxiu’; 528 genes were induced and 383 repressed in the former, whereas 2655 genes were induced and 205 suppressed in ‘Jingxiu’. They were regulated either in the same or opposing manner in the two c...

  4. MANIPULATION OF PHOTOSYNTHESIS IN GRAPE (VITIS VINIFERA) CV. âFLAMEâ BY THE APPLICATION OF TWO SUCROSE ANALOGS

    OpenAIRE

    M. E. Tiznado-Hernandez; J. A. Orozco-Avitia; A. J. Ojeda-Contreras; A. A. Gardea-Bejar

    2013-01-01

    The translocation of photosynthates from the leaves is important for the accumulation of sugars in grape berries. Two sucrose analogs were applied at post-veraison to determine their effects on leaf photosynthesis. It is hypothesized that the signal of sugar accumulation in leaves will bring a reduction in photosynthesis and an increase in the photosynthate translocation rate to the berries. The experiment was conducted in a commercial Vitis vinifera âFlameâ vineyard. The sucrose analogs used...

  5. Spliceosomal intron size expansion in domesticated grapevine (Vitis vinifera

    Directory of Open Access Journals (Sweden)

    Goertzen Leslie R

    2011-03-01

    Full Text Available Abstract Background Spliceosomal introns are important components of eukaryotic genes as their structure, sizes and contents reflect the architecture of gene and genomes. Intron size, determined by both neutral evolution, repetitive elements activities and potential functional constraints, varies significantly in eukaryotes, suggesting unique dynamics and evolution in different lineages of eukaryotic organisms. However, the evolution of intron size, is rarely studied. To investigate intron size dynamics in flowering plants, in particular domesticated grapevines, a survey of intron size and content in wine grape (Vitis vinifera Pinot Noir genes was conducted by assembling and mapping the transcriptome of V. vinifera genes from ESTs to characterize and analyze spliceosomal introns. Results Uncommonly large size of spliceosomal intron was observed in V. vinifera genome, otherwise inconsistent with overall genome size dynamics when comparing Arabidopsis, Populus and Vitis. In domesticated grapevine, intron size is generally not related to gene function. The composition of enlarged introns in grapevines indicated extensive transposable element (TE activity within intronic regions. TEs comprise about 80% of the expanded intron space and in particular, recent LTR retrotransposon insertions are enriched in these intronic regions, suggesting an intron size expansion in the lineage leading to domesticated grapevine, instead of size contractions in Arabidopsis and Populus. Comparative analysis of selected intronic regions in V. vinifera cultivars and wild grapevine species revealed that accelerated TE activity was associated with grapevine domestication, and in some cases with the development of specific cultivars. Conclusions In this study, we showed intron size expansion driven by TE activities in domesticated grapevines, likely a result of long-term vegetative propagation and intensive human care, which simultaneously promote TE proliferation and

  6. Response of “Red Globe” (Vitis vinifera L. to cane girdling

    Directory of Open Access Journals (Sweden)

    Soltekin Oğuzhan

    2015-01-01

    Full Text Available The effect of cane girdling on skin colour, harvest date, yield, and some quality characteristics of Vitis vinifera L. cv. Red Globe table grape variety, was measured over two growing seasons, 2013–2014, at the facility of Manisa Viticulture Research Station in Turkey. Cane girdling was performed on the spurs after first bud was left from the bottom and 4 mm-wide ring of bark was completely removed with a doubleded knife at veraison period. Statistical analyses showed that total soluble solid content, berry width, berry length, colour parameters, CIRG index and anthocyanin content of the Red Globe was significantly affected by the girdling treatment in both years, 2013 and 2014. In addition it was detected that any effect of girdling treatments cannot be determined statistically significant on total yield, marketable yield, total phenolics, titrable acidity, pH and 50 berry weight. Total and marketable yields of girdled vines had higher value although they weren’t statistically significant. Furthermore it was observed on girdled vines 7 and 11 days earliness compare to the control vines in 2013 and 2014, respectively.

  7. Lesão renal aguda por glicerol: efeito antioxidante da Vitis vinifera L Acute kidney injury by glycerol: antioxidant effect of Vitis vinifera L

    Directory of Open Access Journals (Sweden)

    Elisabete Cristina de Oliveira Martim

    2007-09-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: A lesão renal aguda (LRA é a complicação mais grave da rabdomiólise. Nessa síndrome, a liberação do pigmento heme desencadeia uma lesão que se caracteriza por vasoconstrição glomerular e toxicidade celular direta com provável componente oxidante. A renoproteção com antioxidantes tem demonstrado efeito satisfatório. As proantocianidinas são antioxidantes naturais encontradas no extrato da semente da uva. O objetivo deste estudo foi avaliar o efeito antioxidante da Vitis vinifera sobre a função renal de ratos submetidos à lesão induzida por rabdomiólise. MÉTODO: Foram utilizados ratos Wistar, machos e adultos pesando entre 250 e 300 g. A LRA foi induzida pela administração de glicerol 50% por via muscular. Os animais foram distribuídos em 4 grupos: grupo Salina (6 mL/kg de NaCl a 0,9%, por via intraperitoneal (dose única, Glicerol (6 mL/kg por via muscular metade da dose em cada região femoral, em dose única, grupo Vitis vinifera (3 mg/kg/dia, por via oral durante cinco dias e grupo Glicerol + Vitis vinifera que recebeu Vitis vinifera por cinco dias antes do glicerol. RESULTADOS: Foram avaliados a função renal (FR e o perfil oxidativo (peróxidos urinários FOX-2 e MDA-TBARS. O grupo glicerol de animais tratado com Vitis vinifera apresentou melhora da FR e redução dos níveis de peroxidação lipídica. CONCLUSÕES: Os resultados deste estudo confirmaram a ação antioxidante da Vitis vinifera na LRA induzida por glicerol.BACKGROUND AND OBJECTIVES: The Acute Kidney Injury (AKI is the most serious complication of rhabdomyolysis. In this syndrome, the delivery of heme pigment induces an injury that distinguishes itself by glomerular vasoconstriction and direct cellular toxicity with oxidative component. The renoprotection with antioxidants has demonstrated satisfactory effect. The proanthocyanidins are natural antioxidants found in the grape seed extract. The aim of this study was to

  8. Differences in the Phenolic Composition and Antioxidant Properties between Vitis coignetiae and Vitis vinifera Seeds Extracts

    Directory of Open Access Journals (Sweden)

    Ryszard Amarowicz

    2013-03-01

    Full Text Available Phenolic compounds were extracted from European and Japanese grapevine species (Vitis vinifera and V. coignetiae seeds using 80% methanol or 80% acetone. The total content of phenolic compounds was determined utilizing Folin-Ciocalteu’s phenol reagent, while the content of tannins was assayed by the vanillin and BSA precipitation methods. Additionally, the DPPH free radical and ABTS cation radical scavenging activities and the reduction power of the extracts were measured. The HPLC method was applied to determine the phenolic compounds, such as phenolic acids and catechins. The seeds contained large amounts of tannins and gallic acid and observable quantities of catechins, p-coumaric, ferulic and caffeic acids. The dominant form of phenolic acids in the extracts was the ester-bound form. The content of total phenolics was higher in the European grape V. vinifera seeds, which also contained more tannins, catechins and phenolic acids, except for caffeic acid. Extracts from V. vinifera seeds showed better radical scavenger properties and stronger reducing power. The total contents of phenolic compounds and tannins in acetone extracts were higher than in methanolic extracts. Acetone extracts also exhibited stronger antiradical properties as well as stronger reducing power.

  9. [Genetic Diversity of Vitis vinifera L. in Azerbaijan].

    Science.gov (United States)

    Salayeva, S J; Ojaghi, J M; Pashayeva, A N; Izzatullayeva, V I; Akhundova, E M; Akperov, Z I

    2016-04-01

    To examine the genetic diversity of Vitis vinifera L., growing in the Republic of Azerbaijan in the region near the Caspian Sea, nuclear genomes of 31 cultivated and 34 wild grapevine accessions were studied at population and individual levels using five ISSR primers. In total, 51 fragments were amplified, of which 45 were found to be polymorphic. A high level of polymorphism was revealed (the mean PPF and PIC values constituted 87.69% and 0.94, respectively). High values of the EMR, MI, and RP indices showed the effectiveness of the application of ISSR primers and the possibility of their use in further investigations in this direction. Cluster analysis based on Nei's genetic distance values showed that all genotypes could be grouped into seven main clusters. Furthermore, no differences between the wild and cultivated grape wine accessions were revealed. For instance, there was no distinct distribution of the accessions according to their geographical localization. On the basis of the PIC values, the group of cultivars from Absheron Peninsula--was distinguished by the highest polymorphism level (PIC = 0.36). Natural populations from the Guba and Shabran regions were characterized by a relatively low polymorphism level (PIC = 0.31 and PIC = 0.28, respectively); and a wild population from Nabran demonstrated the lowest polymorphism level (PIC = 0.25). The data obtained confirmed paleontological and historical data of different periods, provide the supposition that Azerbaijan is the center of diversity of V. vinifera L. In addition, our data indicate that Azerbaijan grape landraces originated from local wild forms. PMID:27529978

  10. Cloning, Sequencing, Purification, and Crystal Structure of Grenache (Vitis vinifera) Polyphenol Oxidase

    Energy Technology Data Exchange (ETDEWEB)

    Virador, V.; Reyes Grajeda, J; Blanco-Labra, A; Mendiola-Olaya, E; Smith, G; Moreno, A; Whitaker, J

    2010-01-01

    The full-length cDNA sequence (P93622{_}VITVI) of polyphenol oxidase (PPO) cDNA from grape Vitis vinifera L., cv Grenache, was found to encode a translated protein of 607 amino acids with an expected molecular weight of ca. 67 kDa and a predicted pI of 6.83. The translated amino acid sequence was 99%, identical to that of a white grape berry PPO (1) (5 out of 607 amino acid potential sequence differences). The protein was purified from Grenache grape berries by using traditional methods, and it was crystallized with ammonium acetate by the hanging-drop vapor diffusion method. The crystals were orthorhombic, space group C2221. The structure was obtained at 2.2 {angstrom} resolution using synchrotron radiation using the 39 kDa isozyme of sweet potato PPO (PDB code: 1BT1) as a phase donor. The basic symmetry of the cell parameters (a, b, and c and {alpha}, {beta}, and {gamma}) as well as in the number of asymmetric units in the unit cell of the crystals of PPO, differed between the two proteins. The structures of the two enzymes are quite similar in overall fold, the location of the helix bundles at the core, and the active site in which three histidines bind each of the two catalytic copper ions, and one of the histidines is engaged in a thioether linkage with a cysteine residue. The possibility that the formation of the Cys-His thioether linkage constitutes the activation step is proposed. No evidence of phosphorylation or glycoslyation was found in the electron density map. The mass of the crystallized protein appears to be only 38.4 kDa, and the processing that occurs in the grape berry that leads to this smaller size is discussed.

  11. Spasmolytic effect of Vitis vinifera leaf extract on rat colon

    Directory of Open Access Journals (Sweden)

    Gharib Naseri M.K.

    2006-07-01

    Full Text Available Vitis vinifera (grape leaf has been used traditionally to treat diarrhea and its extract induces relaxation in rat aorta and uterus. The aim of present study was to investigate the effect of grape leaf hydroalcoholic extract (GLHE on rat colon contractions induced by some spasmogens. A piece of distal colon from male adult Wistar rats were dissected and mounted in an organ bath containing Tyrode solution and colon contractions recorded by an isotonic transducer under 1g resting tension. The GLHE (0.5- 4 mg/ml reduced the contractions induced by KCl (60 mM, BaCl2 (4 mM, acetylcholine (1 μM dose-dependently (P<0.001. The spasmolytic effect of GLHE on ACh-induced contraction was unaffected by propranolol (1 μM, phentolamine (1 μM, L-NAME (300 μM, and naloxone (1μM. In Ca2+-free but rich in KCl (120 mM Tyrode solution, cumulative concentrations of CaCl2 induced colon contractions which, were inhibited by the extract. Glibenclamide (3 μM had no effect on the extract spasmolytic activity, but tetraethylammonium (5 mM contracted the pre-relaxed colon induced by the extract. Results suggest that the grape leaf hydroalcoholic extract spasmolytic effect is due to the blockade of the voltage dependent calcium channels and activation of Ca2+-operated potassium channels

  12. Grapes (Vitis vinifera) as a Potential Candidate for the Therapy of the Metabolic Syndrome.

    Science.gov (United States)

    Akaberi, Maryam; Hosseinzadeh, Hosein

    2016-04-01

    Metabolic syndrome is associated with several disorders, including hypertension, diabetes, hyperlipidemia as well as cardiovascular diseases and stroke. Plant-derived polyphenols, compounds found in numerous plant species, play an important role as potential treatments for components of metabolic syndrome. Studies have provided evidence for protective effects of various polyphenol-rich foods against metabolic syndrome. Fruits, vegetables, cereals, nuts, and berries are rich in polyphenolic compounds. Grapes (Vitis vinifera), especially grape seeds, stand out as rich sources of polyphenol potent antioxidants and have been reported helpful for inhibiting the risk factors involved in the metabolic syndrome such as hyperlipidemia, hyperglycemia, and hypertension. There are also many studies about gastroprotective, hepatoprotective, and anti-obesity effects of grape polyphenolic compounds especially proanthocyanidins in the literature. The present study investigates the protective effects of grape seeds in metabolic syndrome. The results of this study show that grape polyphenols have significant effects on the level of blood glucose, lipid profile, blood pressure, as well as beneficial activities in liver and heart with various mechanisms. In addition, the pharmacokinetics of grape polyphenols is discussed. More detailed mechanistic investigations and phytochemical studies for finding the exact bioactive component(s) and molecular signaling pathways are suggested. Copyright © 2016 John Wiley & Sons, Ltd. PMID:26800498

  13. EVALUATION OF COGNITIVE ENHANCING ACTIVITY OF VITIS VINIFERA LINN. ON ALBINO RATS

    OpenAIRE

    Tikare V.P; Hadaginhal R V; Raghavendra M M A V

    2011-01-01

    In the present study fruits of Vitis vinifera Linn. (Vitacae) commonly known as Draksh were selected for preliminary phytochemical investigation and pharmacological screening of cognitive enhancing activity. The shade dried fruits were subjected to successive solvent extraction with 70 % ethanol. The extracts revealed the presence of carbohydrates, proteins, cardiac glycosides, alkaloids and flavonoids when subjected to chemical tests. TLC was run for their confirmation of flavonoids in Vitis...

  14. ANTIOXIDANT AND ANTIMUTAGENIC ACTIVITIES OF TAIF GRAPE (VITIS VINIFERA CULTIVARS

    Directory of Open Access Journals (Sweden)

    Abdelmegid Ibrahim Fahmi

    2013-01-01

    Full Text Available Extract of grape Vitis vinifera has been reported to exhibit antioxidant and antimutagenic activities and the phenolic compounds play a vital role in determining these activities. Therefore; the objective of the present study was to evaluate the antioxidant and anti-mutagenic activities as well as the phenolic composition of different grape cultivar extracts collected from Taif region. The grape cultivars namely; Italian, American, Lebanese, Taifyb and Taifye were collected at maturity stage to represent Taif region cultivars. The total concentrations of phenoles were determined for the five cultivar extracts and results indicated that the concentrations ranged from 115-960 mg L-1 Gallic Acid Equivalent (GAE. Also, HPLC analysis included was carried out of nine important phenolic compounds namely; Cyanidine chloride, Myricetin, Chrysin, Quercetin, Delphinidine chloride, Malvidine chloride, Naringenin, Galangin and Caffeic acid. Significant differences among cultivars were obtained for each compound. However, the highest cultivar for each compound differed from compound to another. At the same time, DPPH was used to estimate antioxidant activity and the data showed that different grape cultivar extracts were able to quench 47-60% of DPPH radical solution and to exhibited potent radical scavenging activity. Also, antimutagenic activity was measured as a decrease of chromosomal aberrations in bone marrow cells of mice treated with the mutagen Endoxan. Results showed that treatment of mice with grape cultivar extracts resulted in a significant decrease in all types of chromosomal aberrations induced by Endoxan. Also, the anticlastogenic effect was measured using micronulei test and results indicated that all grape cultivar extracts reduced significantly the effect of Endoxan on micronulei test. Finally, treatment of mice with grape cultivar extracts enhanced mitotic index of mice bone marrow cells reduced by Endoxan treatment. The relationship

  15. Crystallization and preliminary X-ray characterization of the Vitis vinifera fucokinase:GDP-fucose pyrophosphorylase

    OpenAIRE

    Quirk, Stephen

    2012-01-01

    The Vitis vinifera dual-activity fucose and nucleotide-sugar metabolizing enzyme l-fucokinase:GDP-fucose pyrophosphorylase (FKP) has been purified to homogeneity and the 118.8 kDa monomeric protein has been crystallized by vapor diffusion in Zeppezauer tubes at 277 K.

  16. Mycotoxin potential in high-risk American Vitis vinifera vineyards and wines

    Science.gov (United States)

    Mycotoxins pose a serious worldwide threat to the safety of numerous food commodities. Red wine made from Vitis vinifera grapes is particularly prone to contamination from ochratoxin A, produced by black-spored Aspergillus spp. worldwide, and it was recently discovered that these species can also p...

  17. Regulated deficit irrigation as a water management strategy in Vitis vinifera production

    International Nuclear Information System (INIS)

    An initial six-year study in a commercial vineyard located in the Columbia River Valley of Washington State, United States of America, examined the management practices and potential benefits of regulated deficit irrigation (RDI) on Vitis vinifera cv. Sauvignon blanc. The objective of the treatments was to evaluate the effect of deficit irrigation prior to, compared with after, veraison. Each of four irrigation treatments was applied to 1.6 ha and replicated four times for a total 27.0 ha. Irrigation treatments were based on desired soil moisture levels in the top metre of the profile where most of the root system is found. Soil moisture was monitored using a neutron probe and the information was combined with calculations of evaporative demand to determine the irrigation required on a weekly basis. Vine growth, yield, fruit quality and cold hardiness were monitored throughout the study. The results indicated that RDI prior to veraison was effective in controlling shoot growth, as determined by shoot length and elongation rate, as well as pruning weights. Sixteen wine lots, each of approximately 12,000 litres, were prepared each season. Although there was some effect on berry weight, yield was not always significantly reduced. Full irrigation prior to veraison resulted in excessive shoot growth. RDI applied after veraison to vines with large canopies resulted in greater water deficit stress. Fruit quality was increased by pre-veraison RDI compared to postveraison RDI based on wines made. Regulated deficit irrigation applied at anytime resulted in better early-season lignification of canes and cold hardening of buds. There was a slight improvement in mid-winter cold hardiness of vines subjected to RDI. However, this effect was inconsistent. Studies on Cabernet Sauvignon and White Riesling are underway to confirm these results and to investigate the impact of RDI on fruit quality and winemaking practices. (author)

  18. Effect of irrigation regime on perceived astringency and proanthocyanidin composition of skins and seeds of Vitis vinifera L. cv. Syrah grapes under semiarid conditions.

    Science.gov (United States)

    Kyraleou, Maria; Kotseridis, Yorgos; Koundouras, Stefanos; Chira, Kleopatra; Teissedre, Pierre-Louis; Kallithraka, Stamatina

    2016-07-15

    In this work, the effect of water availability on astringency of seed and skin extracts of Vitis vinifera cv. Syrah berries under the typical semiarid conditions of Greece was investigated. Moreover, astringency was assessed in relation to proanthocyanidin composition. For this purpose, three irrigation treatments were applied starting at berry set through harvest of 2011 and 2012: full irrigation (FI) at 100% of crop evapotranspiration, deficit irrigation (DI) at 50% and non-irrigated (NI). FI skin and seed extracts were perceived significantly more astringent than NI. Total phenol, total tannin, (+)-catechin, (-)-epicatechin and procyanidin C1 concentrations were positively correlated with astringency. Positive correlations were also obtained among astringency and average degree of polymerization and proportion of the extension units of shorter tannins while astringency of larger tannins was correlated with the proportion of terminal units. On the contrary, total anthocyanin and epigallocatechin contents were negatively correlated with astringency. PMID:26948617

  19. Contributions to the study of Vitis vinifera defence mechanisms against esca

    OpenAIRE

    Lima, Marta Raquel Martins

    2009-01-01

    Esca is a destructive disease of complex aetiology affecting grapevines worldwide and leading to great economic losses in viticulture. In the Vinho Verde Demarcated Region (North of Portugal), esca and young grapevine decline has been leading to important losses in wine production. The disease is widespread all over the region affecting all varieties of Vinho Verde grapevines, both old and young plants. To study the putative response of Vitis vinifera to esca-related fungi a la...

  20. Copper impacts in grapevine (Vitis vinifera L.): molecular, biochemical and biotechnological approaches

    OpenAIRE

    Martins, Viviana Maria Varajão

    2014-01-01

    Tese de doutoramento em Programa Doutoral em Biologia de Plantas Since the development of Bordeaux mixture in the late 1800’s, copper-based fungicides have been widely used against grapevine (Vitis vinifera L.) diseases, mainly in organic but also in conventional viticulture. Although they initially seemed to improve plant growth in unproductive lands, their intensive use has raised concerns regarding toxicity to plants and soil contamination, and research has emerged to characterize coppe...

  1. Various Extraction Methods for Obtaining Stilbenes from Grape Cane of Vitis vinifera L

    Czech Academy of Sciences Publication Activity Database

    Soural, I.; Vrchotová, Naděžda; Tříska, Jan; Balík, J.; Horník, Štěpán; Cuřínová, Petra; Sýkora, Jan

    2015-01-01

    Roč. 20, č. 4 (2015), s. 6093-6112. ISSN 1420-3049 R&D Projects: GA MŠk(CZ) LD14038 Institutional support: RVO:67179843 ; RVO:67985858 Keywords : Vitis vinifera L * grape cane * stilbenes * accelerated solvent extraction (ASE) * microwave-assisted extraction (MAE) * LC-MS Subject RIV: EH - Ecology, Behaviour; CB - Analytical Chemistry, Separation (UCHP-M) Impact factor: 2.416, year: 2014

  2. Phaemoniella chlamydospora infection induces changes in phenolic compounds content in Vitis vinifera

    OpenAIRE

    Oliveira, Helena; Martin, Nico; Vesentini, Damiano; Rego, Cecilia; Monteiro, Sara; Ferreira, Ricardo Boavida

    2009-01-01

    The effect of Phaeomoniella chlamydospora infection was evaluated in three grapevine cultivars, in relation to the variation in phenolic compounds within the host. Young plants of Vitis vinifera (cv. Chardonnay, Touriga Nacional and two clones of cv. Aragonez) were infected using two strains of Pa. chlamydospora and were harvested after fi ve months from inoculation. Overall, a localised increment in the amount of total phenolics within a methanolic extract of grapevine wood tissu...

  3. Penggunaan Sari Buah Anggur Hijau ( Vitis vinifera L ) Dalam Sediaan Krim Pelembab

    OpenAIRE

    Siahaan, Elisabet H.F

    2012-01-01

    Dry skin need a moisturizer that is usually shaped cream. The ingredients moisturizing that are commonly used include glycerin. Grape fruit ( Vitis vinifera L.) is a natural material that can be used skin moisturizer because it is rich in vitamins A, B1, B6, C and E. Beside vitamin, green grape fruit also has mineral as calcium, phosphor, potassium, iron, carbohydrate, protein and lipid. Based on its contents, when conducting research using guava juice has concentrated into moisturizing cream...

  4. Transcriptomic analysis of grape (Vitis vinifera L.) leaves during and after recovery from heat stress

    OpenAIRE

    Liu Guo-Tian; Wang Jun-Fang; Cramer Grant; Dai Zhan-Wu; Duan Wei; Xu Hong-Guo; Wu Ben-Hong; Fan Pei-Ge; Wang Li-Jun; Li Shao-Hua

    2012-01-01

    Abstract Background Grapes are a major fruit crop around the world. Heat stress can significantly reduce grape yield and quality. Changes at the molecular level in response to heat stress and subsequent recovery are poorly understood. To elucidate the effect of heat stress and subsequent recovery on expression of genes by grape leaves representing the classic heat stress response and thermotolerance mechanisms, transcript abundance of grape (Vitis vinifera L.) leaves was quantified using the ...

  5. Optimization of extraction and microencapsulation of bioactive compounds from red grape (Vitis vinifera L.) pomace

    OpenAIRE

    Boonchu, Thapakorn; Utama-ang, Niramon

    2013-01-01

    Grape (Vitis vinifera L.) pomace constitutes a promising source of phenolic compounds, gallic acid, flavan-3-ols, flavonoids, stilbene and anthocyanins that are beneficial for human health. The objectives of this study were to optimize the extraction and microencapsulation of red grape pomace. Central composite designs with two factors were conducted for optimization using response surface methodology. The temperature (45–85 °C), and the time (2–8 h) were designed for the extraction. The resu...

  6. Is there a future for wild grapevine (Vitis vinifera subsp. silvestris) in the Rhine Valley?

    OpenAIRE

    Arnold, Claire; Schnitzler, Annik; Douard, Anne; Peter, Richard; Gillet, François

    2011-01-01

    The wild grapevine, Vitis vinifera subsp. silvestris (Gmelin) Hegi, is considered to be an endangered taxon in Europe, mainly as a consequence of the introduction of pathogens from North America and of the destruction of its habitat. In the Rhine Valley, nearly all populations disappeared due to river management, the intensi.cation of forestry, and the introduction of phylloxera. After a growing awareness of the need to preserve endangered forest ecosystems, attempts to reintroduce wild grape...

  7. Characterization of Vitis vinifera L. subspecies sylvestris (Gmelin) Hegi in the Ebro river Basin (Spain)

    OpenAIRE

    Ocete Rubio, Rafael; Arroyo García, R.; Morales, M. L.; Cantos, Manuel; Gallardo Cano, A.; Pérez Izquierdo, Mª Á.; Gómez Parrales, Isidoro; López Martínez, Mª Ángeles

    2011-01-01

    A wild grapevine population of 76 vines of Vitis vinifera L. subspecies sylvestris (Gmelin) Hegi was found along the Iregua river valley (Northeastern Spain), located in the Ibérica mountain-range. The characterization of this phytogenetic resource was based on an ampelographic description of the male and female individuals and an evaluation of their sanitary state. This shows that the imported North American downy and powdery mildews are the main pathogens, but no symptoms caused by phylloxe...

  8. Microsatellite characterization of grapevine (Vitis vinifera L.) genetic diversity in Asturias (Northern Spain)

    OpenAIRE

    Moreno-Sanz, Paula; Dolores, María; Suárez, Belén

    2013-01-01

    The genetic heritage of the Asturian grapevine (Vitis vinifera L.) has been declining over the past century due to the phylloxera attack and the further abandonment of this culture. In addition, efforts in recent years to restore the Asturian vineyard with the pulling-up of old vineyards and replanting with cultivars endorsed by Cangas Quality Wine regulations are contributing even more to this genetic erosion. The aim of this study was the evaluation and identification of the phytogenetic...

  9. Polyphenol Oxidase Activity during Rooting in Cuttings of Grape (Vitis vinifera L.) Varieties

    OpenAIRE

    YILMAZ, Hayrullah

    2003-01-01

    Polyphenol oxidase (PPO) activity was investigated during rooting in cuttings from three different grape cultivars (Vitis vinifera L. cvs. Muscat, Cardinal and Perlelte), and the enzyme activity and rooting ability were compared. Rooting was observed on the Muscat and Perlelte cuttings, but not on the Cardinal cuttings. PPO activity started to increase in the early stage of the experiment, and decreased after root emergence in the Muscat and Perlelte cuttings. However, enzyme activity started...

  10. Fungal Endophytic Communities in Grapevines (Vitis vinifera L.) Respond to Crop Management

    OpenAIRE

    Pancher, Michael; Ceol, Marco; Corneo, Paola Elisa; Longa, Claudia Maria Oliveira; Yousaf, Sohail; Pertot, Ilaria; Campisano, Andrea

    2012-01-01

    We studied the distribution of fungal endophytes of grapevine (Vitis vinifera L.) plants in a subalpine area of northern Italy, where viticulture is of high economic relevance. We adopted both cultivation-based and cultivation-independent approaches to address how various anthropic and nonanthropic factors shape microbial communities. Grapevine stems were harvested from several locations considering organic and integrated pest management (IPM) and from the cultivars Merlot and Chardonnay. Cul...

  11. EVALUATION OF COGNITIVE ENHANCING ACTIVITY OF VITIS VINIFERA LINN. ON ALBINO RATS

    Directory of Open Access Journals (Sweden)

    Tikare V P

    2011-04-01

    Full Text Available In the present study fruits of Vitis vinifera Linn. (Vitacae commonly known as Draksh were selected for preliminary phytochemical investigation and pharmacological screening of cognitive enhancing activity. The shade dried fruits were subjected to successive solvent extraction with 70 % ethanol. The extracts revealed the presence of carbohydrates, proteins, cardiac glycosides, alkaloids and flavonoids when subjected to chemical tests. TLC was run for their confirmation of flavonoids in Vitis vinifera and than subjected to isolation by preparative TLC method and analyzed by UV, FTIR and HPTLC. In the pharmacological screening, the alcoholic extract was used for the evaluation of cognitive enhancing activity using elevated plus maze & passive avoidance task method with Mentat as Standard by using parameters of step down and transfer latency. Induction was carried out by MES and scopolamine for 7 days. On 7th day the brain was isolated for evaluation of Acetylcholinesterase enzyme activity. The alcoholic extracts (200mg/kg.B.W showed significant effect when compare to control, there was significant increase in step down latency and decrease in the transfers latency and also decrease in acetylcholinesterase enzyme activity, which was as effective as that of standard drug. Hence it can by conclude that fruits of Vitis vinifera contain favonoid and hence possess significant cognitive enhancing activity.

  12. Isolation of Resveratrol from Vitis Viniferae Caulis and Its Potent Inhibition of Human Tyrosinase

    Directory of Open Access Journals (Sweden)

    Jiaa Park

    2013-01-01

    Full Text Available Tyrosinase (TYR catalyzes rate-limiting reactions of cellular melanin synthesis, and its inhibitors are of commercial interest as potential skin whitening agents. However, the limited availability of human TYR makes the screening of TYR inhibitors difficult. To overcome this hurdle, we transformed nonmelanocytic human embryonic kidney (HEK 293 cells to express human TYR constitutively. Using these cells as a source of human TYR, the ethanolic extracts of 52 medicinal plants grown in Korea were tested for human TYR activity, and the extract of Vitis Viniferae Caulis (dried stems of the grape tree, Vitis vinifera L. was found to inhibit human TYR activity potently. An active compound was isolated from this extract by solvent fractionation followed by liquid column chromatography and identified as resveratrol by spectroscopic and chromatographic analyses. Resveratrol was determined to be a highly potent inhibitor of human TYR (IC50=0.39 μg mL−1 as compared with p-coumaric acid (IC50=0.66 μg mL−1 and arbutin (IC50>100 μg mL−1 and inhibited melanin synthesis by human epidermal melanocytes at subtoxic concentrations. This study suggests that resveratrol and resveratrol-containing extracts of Vitis Viniferae Caulis have a potential use as skin whitening agents.

  13. UV screening by phenolics in berries of grapevine (Vitis vinifera)

    Czech Academy of Sciences Publication Activity Database

    Kolb, Ch.; Kopecký, Jiří; Riederer, M.; Pfundel, E. E.

    2003-01-01

    Roč. 30, - (2003), s. 1177-1186. ISSN 1445-4408 Institutional research plan: CEZ:AV0Z5020903 Keywords : acclimation * caffeic acid * flavonoid Subject RIV: CE - Biochemistry Impact factor: 1.747, year: 2003

  14. Clone lineages of grape phylloxera differ in their performance on Vitis vinifera.

    Science.gov (United States)

    Herbert, K S; Umina, P A; Mitrovski, P J; Powell, K S; Viduka, K; Hoffmann, A A

    2010-12-01

    Grape phylloxera, Daktulosphaira vitifoliae Fitch, is an important pest of grapevines (Vitis vinifera L.) (Vitaceae). The distribution and frequency of phylloxera clone lineages vary within infested regions of Australia, suggesting the introduction of separate lineages of D. vitifoliae with host associations. Virulence levels of particular phylloxera clones may vary on V. vinifera, but much of this evidence is indirect. In this study, we directly tested the performance of phylloxera clones on V. vinifera using an established excised root assay and a new glasshouse vine assessment. In the root assay, grape phylloxera clones differed in egg production and egg to adult survivorship. In the vine assay, clones differed in the number of immature and adult life stages on roots. In addition vine characteristics, including mean stem weight, root weight, leaf chlorophyll and leaf area, were affected by different phylloxera clones. The two most widespread clones displayed high levels of virulence. These results point to only some phylloxera clones being highly virulent on V. vinifera, helping to explain patterns of field damage, phylloxera distributions and continued survival and production of V. vinifera vines in some infested areas. PMID:20482931

  15. Identification, expression analysis and characterization of defense and signaling genes in Vitis vinifera.

    Science.gov (United States)

    Chong, Julie; Le Henanff, Gaëlle; Bertsch, Christophe; Walter, Bernard

    2008-04-01

    The reduction of phytochemicals applied to grapevine relies on the development of alternative strategies involving activation of the plant's own defense system. The aim of this work was to study the signaling of defense responses to pathogens in Vitis vinifera. We identified in V. vinifera cv. Chardonnay two putative regulatory elements, VvNHL1 and VvEDS1, with similarity to Arabidopsis defense regulators NDR1 and EDS1. Expression studies of these putative signaling genes together with other known grape defense genes show that they are differentially regulated by salicylic acid and jasmonate-ethylene treatments, as well as by inoculation with different types of pathogens. The expression of VvEDS1 was stimulated by salicylic acid treatment, Botrytis cinerea and Plasmopara viticola inoculation, whereas VvNHL1 was repressed by B. cinerea. VvNHL1 overexpression introduced in Arabidopsis ndr1 mutant did not complement the mutation in terms of sensitivity to avirulent Pseudomonas syringae pv. tomato. Moreover, we observed a weakened resistance to B. cinerea of ndr1 mutants overexpressing VvNHL1, which may be related to cell death enhancement. Together, our results identify two new pathogen-responsive regulatory elements in Vitis vinifera, with potential roles in pathogen defense. PMID:17988883

  16. Adaptogenic and nootropic activities of aqueous extract of Vitis vinifera (grape seed): an experimental study in rat model

    OpenAIRE

    Koppula Sushruta; Kolanukonda Rajabhanu; Nammi Srinivas; Sreemantula Satyanarayana; Boini Krishna M

    2005-01-01

    Abstract Background The aerial parts of Vitis vinifera (common grape or European grape) have been widely used in Ayurveda to treat a variety of common and stress related disorders. In the present investigation, the seed extract of V. vinifera was evaluated for antistress activity in normal and stress induced rats. Furthermore, the extract was studied for nootropic activity in rats and in-vitro antioxidant potential to correlate its antistress activity. Methods For the evaluation of antistress...

  17. Quantitative analysis of polymeric procyanidins (Tannins) from grape (Vitis vinifera) seeds by reverse phase high-performance liquid chromatography.

    Science.gov (United States)

    Peng, Z; Hayasaka, Y; Iland, P G; Sefton, M; Høj, P; Waters, E J

    2001-01-01

    A reverse phase C(18) HPLC method with potential for high automated throughput has been developed for the quantitative analysis of polymeric procyanidins (tannins) in grape seed extracts. Chromatography gave rise to 13 distinct UV-absorbing peaks with good baseline separation. The UV-absorbing peak eluting last is distinct and therefore easily quantified. Biochemical analyses including ultrafiltration, protein precipitation, and Sephadex LH20 chromatography combined with electrospray mass spectrometric analyses establish that this peak predominantly contains polymeric procyanidins. The polymers, which appear to be galloylated to various degrees and seem to fragment in a characteristic manner during electrospray mass spectrometry, are well separated from catechins and procyanidin oligomers of up to 4 units. The recovery of polymeric grape seed tannins with this HPLC method was 86%, which is similar to the 89% recovery achieved with commercial quebracho tannins. The concentration of tannins in seeds from ripe Vitis vinifera cv. Shiraz grapes ranged from 1360 to 2830 mg/kg of berries. PMID:11170555

  18. Jasmonic acid-isoleucine formation in grapevine (Vitis vinifera L.) by two enzymes with distinct transcription profiles

    Institute of Scientific and Technical Information of China (English)

    Christine Böttcher; Crista A. Burbidge; Valentina di Rienzo; PauLK. Boss; Christopher Davies

    2015-01-01

    The plant hormone jasmonic acid (JA) is essential for stress responses and the formation of reproductive organs, but its role in fruit development and ripening is unclear. Conjugation of JA to isoleucine is a crucial step in the JA signaling pathway since only JA-Ile is recognized by the jasmonate receptor. The conjugation reaction is catalyzed by JA-amido synthetases, belonging to the family of Gretchen Hagen3 (GH3) proteins. Here, in vitro studies of two grapevine (Vitis vinifera L. cv Shiraz) GH3 enzymes, VvGH3-7 and VvGH3-9, demonstrated JA-conjugating activ-ities with an overlapping range of amino acid substrates, including isoleucine. Expression studies of the correspond-ing genes in grape berries combined with JA and JA-Ile measurements suggested a primary role for JA signaling in fruit set and cell division and did not support an involvement of JA in the ripening process. In response to methyl JA (MeJA) treatment, and in wounded and unwounded (distal) leaves, VvGH3-9 transcripts accumulated, indicating a participation in the JA response. In contrast, VvGH3-7 was unresponsive to MeJA and local wounding, demonstrating a differential transcriptional regulation of VvGH3-7 and VvGH3-9. The transient induction of VvGH3-7 in unwounded, distal leaves was suggestive of the involvement of an unknown mobile wound signal.

  19. Sviluppo di approcci di gene silencing in vite (Vitis vinifera L.) per studi di genomica funzionale.

    OpenAIRE

    Urso, Simona

    2009-01-01

    Sviluppo di approcci di gene silencing in vite (Vitis vinifera L.) per studi di genomica funzionale. Nel corso del lavoro è stato messo a punto un sistema per la micropropagazione della vite in modo tale da disporre delle piantine durante tutto il corso dell’anno evitando pause di lavoro dovute al fisiologico riposo vegetativo annuale della vite. Utilizzando le banche dati del NSBI, TIGR e IASMA Genomics sono state trovate le sequenze in vite dei geni che regolano la risposta di difesa co...

  20. Volatile composition of Vitis vinifera L. Fernão-Pires variety from Bairrada appellation : 1.

    OpenAIRE

    Ferreira, Paula Raquel da Silva Jorge Coutinho

    2007-01-01

    A Bairrada é uma das regiões vitivinícolas mais antigas de Portugal, apesar de a Região Demarcada da Bairrada só ter sido oficialmente criada em 1979. A casta Fernão-Pires (FP) Vitis vinifera L. é a principal casta branca cultivada nesta região, onde é conhecida pelo nome de Maria-Gomes. As castas Bical (Bic), Arinto (Ari) e Cerceal (Cer), são outras castas brancas relevantes igualmente cultivadas na Região Demarcada da Bairrada. Estas quatro castas representam, respectivame...

  1. Spatial distribution of root activity in Thompson seedless grape (Vitis vinifera L.)

    International Nuclear Information System (INIS)

    Spatial distribution of root activity was studied in grape (Vitis vinifera L.) cv., Thompson Seedless during vegetative and reproductive phases using the 32p soil injection technique. In 9-year old vines, a large proportion of the active roots amounting to 68 per cent was located deeper in the soil at 45 to 75 cm depth and as much as 80 per cent was concentrated within a radius of 120 cm. There was no change in the pattern of distribution of root activity during the two seasons although the intensity of activity during the vegetative phase was slightly more than that observed during the reproductive phase. (author). 9 refs., 2 figs

  2. Effect of Vitis Vinifera Leaf Extract on Ileum Mechanical Activity in Rat

    Directory of Open Access Journals (Sweden)

    N Etemad

    2004-10-01

    Full Text Available Introduction: Vitis vinifera (grape is from Vitaceae family and many researches have performed on its seed but not on leaf. It has been reported that Vitis vinifera leaf extract induces relaxation in rat uterus, aorta, trachea and vas deferens precontracted by KCl. According to these reports, the inhibitory effects have been evoked through the voltage dependent calcium channels blockade. The aim of present study was to investigate the effect of Vitis vinifera leaf hydroalcoholic extract (VHLE on rat ileum contractions induced by KCl, acetylcholine (ACh and barium chloride. Methods: Vitis vinifera leaf powder was extracted using manerated method by 70% alcohol for 72 h at ambient temperature and then solvent was evaporated. From Sprague Dawley rats (male and female pieces of ileum (2cm were isolated and placed in an organ bath (10ml containing Tyrode’s solution gassed with oxygen. An isotonic transducer recorded contractions under 0.5g initial tension. The mean±SEM of changes in length (mm or the percentages of length changes were calculated. Results: The results indicate that VHLE (0.25, 0.5, 1, 2 and 4mg/ml reduces the ileum contractions induced by KCl (60mM dose dependently (P<0.001. This inhibitory effect was unaffected by propranolol (1μM. VHLE (1mg/ml also inhibited the ileum contractions induced by ACh (0.05 and 0.5μg/ml P<0.001 and P<0.05 respectively. Ileum contraction induced by BaCl2 (4mM was unaffected by VHLE (2mg/ml. Conclusion: In conclusion, it seems that VHLE inhibits ileum contractions via blocking the voltage dependent calcium channels. Ineffectiveness of propranolol on inhibitory effect of extract indicates that the adrenoceptors are not involved in this inhibitory effect. VHLE failed to relax ileum precontracted by BaCl2 probably because, BaCl2 increases intracellular calcium concentration via releasing calcium ions from intracellular pools that was not affected by VHLE.

  3. Distribution of Rotundone and Possible Translocation of Related Compounds Amongst Grapevine Tissues in Vitis vinifera L. cv. Shiraz.

    Science.gov (United States)

    Zhang, Pangzhen; Fuentes, Sigfredo; Wang, Yueying; Deng, Rui; Krstic, Mark; Herderich, Markus; Barlow, Edward W R; Howell, Kate

    2016-01-01

    Rotundone is an attractive wine aroma compound, especially important for cool climate Shiraz. Its presence in wine is mainly from the grape skin, but can also be found in non-grape tissues, such as leaves and stems. Whether rotundone is produced independently within different grapevine tissues or transported amongst non-grape tissues and grape berries remains unclear. The current study investigated the distribution of this compound in different vine tissues during development and studied the most likely mode of rotundone translocation-via phloem-using stable isotope feeding. In addition, local production of rotundone induced by herbivore feeding was assessed. Results showed that rotundone was firstly detected in the petioles and peduncles/rachises within the development of Vitis vinifera L. cv. Shiraz. Different grapevine tissues had a similar pattern of rotundone production at different grape developmental stages. In the individual vine shoots, non-grape tissues contained higher concentrations and amounts of rotundone compared to berries, which showed that non-grape tissues were the larger pool of rotundone within the plant. This study confirmed the local production of rotundone in individual tissues and ruled out the possibility of phloem translocation of rotundone between different tissues. In addition, other terpenes, including one monoterpenoid (geraniol) and six sesquiterpenes (clovene, α-ylangene, β-copaene, α-muurolene, δ-cadinene, and cis/trans-calamenene) were, for the first time, detected in the ethylenediaminetetraacetic acid-facilitated petiole phloem exudates, with their originality unconfirmed. Unlike other herbivore-induced terpenes, herbivorous activity had limited influences on the concentration of rotundone in grapevine leaves. PMID:27446104

  4. Distribution of Rotundone and Possible Translocation of Related Compounds Amongst Grapevine Tissues in Vitis vinifera L. cv. Shiraz

    Science.gov (United States)

    Zhang, Pangzhen; Fuentes, Sigfredo; Wang, Yueying; Deng, Rui; Krstic, Mark; Herderich, Markus; Barlow, Edward W. R.; Howell, Kate

    2016-01-01

    Rotundone is an attractive wine aroma compound, especially important for cool climate Shiraz. Its presence in wine is mainly from the grape skin, but can also be found in non-grape tissues, such as leaves and stems. Whether rotundone is produced independently within different grapevine tissues or transported amongst non-grape tissues and grape berries remains unclear. The current study investigated the distribution of this compound in different vine tissues during development and studied the most likely mode of rotundone translocation—via phloem—using stable isotope feeding. In addition, local production of rotundone induced by herbivore feeding was assessed. Results showed that rotundone was firstly detected in the petioles and peduncles/rachises within the development of Vitis vinifera L. cv. Shiraz. Different grapevine tissues had a similar pattern of rotundone production at different grape developmental stages. In the individual vine shoots, non-grape tissues contained higher concentrations and amounts of rotundone compared to berries, which showed that non-grape tissues were the larger pool of rotundone within the plant. This study confirmed the local production of rotundone in individual tissues and ruled out the possibility of phloem translocation of rotundone between different tissues. In addition, other terpenes, including one monoterpenoid (geraniol) and six sesquiterpenes (clovene, α-ylangene, β-copaene, α-muurolene, δ-cadinene, and cis/trans-calamenene) were, for the first time, detected in the ethylenediaminetetraacetic acid-facilitated petiole phloem exudates, with their originality unconfirmed. Unlike other herbivore-induced terpenes, herbivorous activity had limited influences on the concentration of rotundone in grapevine leaves. PMID:27446104

  5. Tracing phenolic biosynthesis in Vitis vinifera via in situ C-13 labeling and liquid chromatography–diode-array detector–mass spectrometer/mass spectrometer detection

    International Nuclear Information System (INIS)

    Highlights: ► L-Phenyl-13C6-alanine was incorporated into grape berries, intact on the vine, at two stages of maturity. ► Labeled anthocyanins were synthesized by the berry and quantified by LC–UV/Vis–MS/MS. ► Extremely tight regulation of phenylpropanoid pathways was observed. - Abstract: Phenolic compounds in Vitis vinifera contribute important flavor, functionality, and health qualities to both table and wine grapes. The plant phenolic metabolic pathway has been well characterized, however many important questions remain regarding the influence of environmental conditions on pathway regulation. As a diagnostic for this pathway's regulation, we present a technique to incorporate a stable-isotopic tracer, L-phenyl-13C6-alanine (Phe13), into grape berries in situ and the accompanying high throughput analytical method based on LC–DAD–MS/MS to quantify and track the label into phenylalanine metabolites. Clusters of V. vinifera cv. Cabernet Sauvignon, either near the onset of ripening or 4 weeks later, were exposed to Phe13 in the vineyard. Phe13 was present in berries 9 days afterwards as well as labeled flavonols and anthocyanins, all of which possessed a molecular ion shift of 6 amu. However, nearly all the label was found in anthocyanins, indicating tight regulation of phenolic biosynthesis at this stage of maturity. This method provides a framework for examining the regulation of phenolic metabolism at different stages of maturity or under different environmental conditions. Additionally, this technique could serve as a tool to further probe the metabolism/catabolism of grape phenolics.

  6. Tracing phenolic biosynthesis in Vitis vinifera via in situ C-13 labeling and liquid chromatography-diode-array detector-mass spectrometer/mass spectrometer detection

    Energy Technology Data Exchange (ETDEWEB)

    Chassy, Alexander W.; Adams, Douglas O. [Department of Viticulture and Enology, One Shields Avenue, University of California, Davis, CA (United States); Laurie, V. Felipe [School of Agricultural Sciences, Universidad de Talca, Talca (Chile); Waterhouse, Andrew L., E-mail: alwaterhouse@ucdavis.edu [Department of Viticulture and Enology, One Shields Avenue, University of California, Davis, CA (United States)

    2012-10-17

    Highlights: Black-Right-Pointing-Pointer L-Phenyl-{sup 13}C{sub 6}-alanine was incorporated into grape berries, intact on the vine, at two stages of maturity. Black-Right-Pointing-Pointer Labeled anthocyanins were synthesized by the berry and quantified by LC-UV/Vis-MS/MS. Black-Right-Pointing-Pointer Extremely tight regulation of phenylpropanoid pathways was observed. - Abstract: Phenolic compounds in Vitis vinifera contribute important flavor, functionality, and health qualities to both table and wine grapes. The plant phenolic metabolic pathway has been well characterized, however many important questions remain regarding the influence of environmental conditions on pathway regulation. As a diagnostic for this pathway's regulation, we present a technique to incorporate a stable-isotopic tracer, L-phenyl-{sup 13}C{sub 6}-alanine (Phe{sup 13}), into grape berries in situ and the accompanying high throughput analytical method based on LC-DAD-MS/MS to quantify and track the label into phenylalanine metabolites. Clusters of V. vinifera cv. Cabernet Sauvignon, either near the onset of ripening or 4 weeks later, were exposed to Phe{sup 13} in the vineyard. Phe{sup 13} was present in berries 9 days afterwards as well as labeled flavonols and anthocyanins, all of which possessed a molecular ion shift of 6 amu. However, nearly all the label was found in anthocyanins, indicating tight regulation of phenolic biosynthesis at this stage of maturity. This method provides a framework for examining the regulation of phenolic metabolism at different stages of maturity or under different environmental conditions. Additionally, this technique could serve as a tool to further probe the metabolism/catabolism of grape phenolics.

  7. Oxidative stress homeostasis in grapevine (Vitis vinifera L.

    Directory of Open Access Journals (Sweden)

    Luisa C Carvalho

    2015-03-01

    Full Text Available Plants can maintain growth and reproductive success by sensing changes in the environment and reacting through mechanisms at molecular, cellular, physiological and developmental levels. Each stress condition prompts a unique response although some overlap between the reactions to abiotic stress (drought, heat, cold, salt or high light and to biotic stress (pathogens does occur. A common feature in the response to all stresses is the onset of oxidative stress, through the production of reactive oxygen species (ROS. As hydrogen peroxide and superoxide are involved in stress signaling, a tight control in ROS homeostasis requires a delicate balance of systems involved in their generation and degradation. If the plant lacks the capacity to generate scavenging potential, this can ultimately lead to death. In grapevine, antioxidant homeostasis can be considered at whole plant levels and during the development cycle. The most striking example lies in berries and their derivatives, such as wine, with nutraceutical properties associated with their antioxidant capacity. Antioxidant homeostasis is tightly regulated in leaves, assuring a positive balance between photosynthesis and respiration, explaining the tolerance of many grapevine varieties to extreme environments.In this review we will focus on antioxidant metabolites, antioxidant enzymes, transcriptional regulation and cross-talk with hormones prompted by abiotic stress conditions. We will also discuss three situations that require specific homeostasis balance: biotic stress, the oxidative burst in berries at veraison and in vitro systems. The genetic plasticity of the antioxidant homeostasis response put in evidence by the different levels of tolerance to stress presented by grapevine varieties will be addressed. The gathered information is relevant to foster varietal adaptation to impending climate changes, to assist breeders in choosing the more adapted varieties and to suitable viticulture

  8. Impact of clonal variability in Vitis vinifera Cabernet franc on grape composition, wine quality, leaf blade stilbene content, and downy mildew resistance.

    Science.gov (United States)

    van Leeuwen, Cornelis; Roby, Jean-Philippe; Alonso-Villaverde, Virginia; Gindro, Katia

    2013-01-01

    In this study, 10 clones of Vitis vinifera Cabernet franc (not yet commercial) have been phenotyped on precocity, grape composition, and assessment of wine quality made by microvinification in 2008-2010. Additionally, two original criteria have been considered: concentration of 3-isobutyl-2-methoxypyrazine (IBMP) in grapes and wines (the green bell pepper flavor) and resistance of grapevines to downy mildew ( Plasmopara viticola ) by stilbene quantification upon infection. Precocity of veraison varied up to four days at veraison. Berry size and yield were highly variable among clones. However, these variables were not correlated. Tanins and anthocyanins varied among clones in grapes and wines. Variations in grape and wine IBMP were not significant. Some clones showed lower susceptibility for downy mildew on leaves. Lower susceptibility was linked to a higher production of stilbenic phytoalexins involved in downy mildew resistance mechanisms. PMID:23205623

  9. Integrating biotechnological advancements with induced mutagenesis: New opportunities for horticulture with special reference to Vitis vinifera

    International Nuclear Information System (INIS)

    Mutation assisted breeding (MAB) is a highly effective way of enhancing natural genetic resources. Increasing mutation rates is important when natural variation is insufficient, when a single trait in a desirable variety needs improvement or when the species is apomictic or seedless. Development of cell and tissue culture-based regeneration techniques in many horticultural crops and increased knowledge of biochemical pathways provide ample opportunities to exploit MAB at an advanced level. Traditionally buds, bulbs, corms, cuttings or whole plants are treated in vegetatively propagated crops, but this results in chimeras. We have initiated a collaborative project to use embryogenic cell lines of Sicilian and international cultivars of Vitis vinifera to produce mutant populations for use in genetic studies as well as for selecting disease-resistant mutants in vitro. We have established embryogenic cell lines of Sicilian and New Zealand cultivars and established the LD 20 for ethylmethane sulphonate for several cultivars. The cell lines will be subjected to treatment with mutagenic agents, and mutants with tolerance to Botrytis toxins will be selected in vitro and regenerated. With the genome sequencing of Vitis vinifera being completed and the resistance to genetically modified crops in both Europe and New Zealand very high, our mutant collection will provide a valuable resource for genetic studies of this species. (author)

  10. Crystallization and preliminary X-ray characterization of the Vitis vinifera fucokinase:GDP-fucose pyrophosphorylase

    International Nuclear Information System (INIS)

    The Vitis vinifera dual-activity fucose and nucleotide-sugar metabolizing enzyme l-fucokinase:GDP-fucose pyrophosphorylase (FKP) has been purified to homogeneity and the 118.8 kDa monomeric protein has been crystallized by vapor diffusion in Zeppezauer tubes at 277 K. The Vitis vinifera dual-activity fucose and nucleotide-sugar metabolizing enzyme l-fucokinase:GDP-fucose pyrophosphorylase (FKP) has been purified to homogeneity and the 118.8 kDa monomeric protein has been crystallized by vapor diffusion in Zeppezauer tubes at 277 K. Crystals of the apoenzyme diffracted to 2.6 Å resolution and belonged to the tetragonal space group P41212. There is a single FKP monomer in the asymmetric unit, giving a Matthews coefficient of 3.22 Å3 Da−1 and a solvent content of 61.8%. A complete native data set has been collected as a first step in determining the three-dimensional structure of this enzyme

  11. Wine grape (Vitis vinifera L.) color associates with allelic variation in the domestication gene VvmybA1

    Science.gov (United States)

    During the process of crop domestication and early selection, numerous changes occur in the genetic and physiological make-up of crop plants. In grapevine (Vitis vinifera) numerous changes have occurred as a result of human selection, including the emergence of hermaphroditism and greatly increased...

  12. Characterization of expression dynamics of WOX homeodomain transcription factors during somatic embryogenesis in Vitis vinifera.

    Science.gov (United States)

    Gambino, Giorgio; Minuto, Martina; Boccacci, Paolo; Perrone, Irene; Vallania, Rosalina; Gribaudo, Ivana

    2011-01-01

    Different cultivars of Vitis vinifera vary in their potential to form embryogenic tissues. The WUSCHEL (WUS)-related homeobox (WOX) genes have been shown to play an important role in coordinating the gene transcription involved in the early phases of embryogenesis. The expression dynamics of 12 VvWOX genes present in the V. vinifera genome in embryogenic and other tissues of 'Chardonnay' were analysed. In order to understand the influence of WOX genes on the somatic embryogenic process, their expression profiles were compared in two cultivars of V. vinifera ('Chardonnay' and 'Cabernet Sauvignon') that show different aptitudes for embryogenesis. The expression of all VvWOX genes was influenced by culture conditions. VvWOX2 and VvWOX9 were the principal WOX genes expressed during the somatic embryogenesis process, and the low aptitude for embryogenesis of 'Cabernet Sauvignon' was generally correlated with the low expression levels of these VvWOX genes. VvWOX3 and VvWOX11 were strongly activated in correspondence to torpedo and cotyledonary stages of somatic embryos, with low expression in the earlier developmental stages (pre-embryogenic masses and globular embryos) and during embryo germination. VvWOX genes appeared to be key regulators of somatic embryogenesis in grapevine, and the regulation of these genes during early phases of somatic embryogenesis differed between the two cultivars of the same species. PMID:21127025

  13. Are Epiphytic Microbial Communities in the Carposphere of Ripening Grape Clusters (Vitis vinifera L.) Different between Conventional, Organic, and Biodynamic Grapes?

    Science.gov (United States)

    Kecskeméti, Elizabeth; Berkelmann-Löhnertz, Beate; Reineke, Annette

    2016-01-01

    Using barcoded pyrosequencing fungal and bacterial communities associated with grape berry clusters (Vitis vinifera L.) obtained from conventional, organic and biodynamic vineyard plots were investigated in two subsequent years at different stages during berry ripening. The four most abundant operational taxonomic units (OTUs) based on fungal ITS data were Botrytis cinerea, Cladosporium spp., Aureobasidium pullulans and Alternaria alternata which represented 57% and 47% of the total reads in 2010 and 2011, respectively. Members of the genera Sphingomonas, Gluconobacter, Pseudomonas, Erwinia, and Massilia constituted 67% of the total number of bacterial 16S DNA reads in 2010 samples and 78% in 2011 samples. Viticultural management system had no significant effect on abundance of fungi or bacteria in both years and at all three sampling dates. Exceptions were A. alternata and Pseudomonas spp. which were more abundant in the carposphere of conventional compared to biodynamic berries, as well as Sphingomonas spp. which was significantly less abundant on conventional compared to organic berries at an early ripening stage in 2011. In general, there were no significant differences in fungal and bacterial diversity indices or richness evident between management systems. No distinct fungal or bacterial communities were associated with the different maturation stages or management systems, respectively. An exception was the last stage of berry maturation in 2011, where the Simpson diversity index was significantly higher for fungal communities on biodynamic compared to conventional grapes. Our study highlights the existence of complex and dynamic microbial communities in the grape cluster carposphere including both phytopathogenic and potentially antagonistic microorganisms that can have a significant impact on grape production. Such knowledge is particularly relevant for development, selection and application of effective control measures against economically important

  14. Elicitation Phenolic Compounds in Cell Culture of Vitis vinifera L. by Phaeomoniella chlamydospora

    Directory of Open Access Journals (Sweden)

    Sák Martin

    2014-12-01

    Full Text Available The in vitro cell cultures of Vitis vinifera L. cv. St. Laurent were treated with two elicitors - synthetic methyl jasmonate and natural, prepared from grapevine plant infected with the Phaeomoniella chlamydospora, the agent causing the Esca disease of grapevine. Efficiency of phenolic compounds production after elicitation of cell culture was analysed immediately after treatment (15 min, 30 min, 60 min and later (after 24, 48, and 72 hours. The cell growth and content of phenolic compounds (+-catechin, (--epicatechin, p-coumaric acid, syringaldehyde, rutin, vanillic acid, and trans-resveratrol were analysed in cultivated cells as well as in cultivation medium. Pch-treatment increased production of total polyphenols the most significantly 15 min after the elicitation and in optimal time was 2.86 times higher than in nonelicited culture and 1.44 times higher than in MeJa induced cell culture.

  15. Ampelographic Characterization and Sanitary Status of Grapevine Cultivar ‘Prč bijeli’ (Vitis vinifera L.

    Directory of Open Access Journals (Sweden)

    Goran Zdunić

    2008-06-01

    Full Text Available ‘Prč bijeli’ is an old Croatian autochthonous grapevine cultivar (Vitis vinifera L., which has not been ampelographically characterized in detail until now. Ampelographic description was performed following 52 morphological, 22 phyllometric and seven bunches dimension characteristics. ‘Prč bijeli’ showed acceptable yield and a must composition suitable for oenological purposes, with low acidity value and medium sugar content. The following synonyms were established: ‘Ćimavica’, ‘Parč’ and ‘Muškat’. The results of sanitary analysis (ELISA test on four viruses on twenty-seven vines revealed that 92.6 % samples were GLRaV-3 positive, while ArMV was not detected. Only one vine was free of the tested viruses.

  16. Morphological and phylogenetic identification of Botrytis sinoviticola, a novel cryptic species causing gray mold disease of table grapes (Vitis vinifera) in China.

    Science.gov (United States)

    Zhou, Y J; Zhang, J; Wang, X D; Yang, L; Jiang, D H; Li, G Q; Hsiang, T; Zhuang, W Y

    2014-01-01

    Seventy-five isolates of Botrytis collected from table grapes (Vitis vinifera) with gray mold symptoms in China were identified based on morpho-cultural characteristics on potato dextrose agar (20 C) and/or phylogenetic analysis using the sequences of three nuclear genes (G3PDH, HSP60, RPB2). Isolates of different species of Botrytis were compared with fenhexamid sensitivity, Bc-hch gene-RFLP haplotyping and pathogenicity to V. vinifera. The 75 isolates comprise two species, B. cinerea (63 isolates) and an undescribed Botrytis sp. (12 isolates) described here as Botrytis sinoviticola Zhang et al. sp., nov. Both B. sinoviticola (Bs) and B. cinerea (Bc) were found to have 20 C optimum for mycelial growth and 25 C for conidial germination. Sensitivity to fenhexamid was significantly greater (P < 0.05) for Bc (EC50 = 0.04 ± 0.01 μg mL(-1)) than for Bs (EC50 = 0.08 ± 0.02 μg mL(-1)). Digestion of the PCR amplicons of the Bc-hch gene with Hha I generated two haplotypes, Group I haplotype for Bs and Group II haplotype for Bc. Bs infected table grapes (leaves, berries) only through wounds, whereas Bc infected both injured and non-injured tissues of table grapes. This study suggests that Bs is a cryptic species sympatric with Bc on table grapes in China. PMID:24396103

  17. Poly(lactic-co-glycolic) acid nanoparticles uptake by Vitis vinifera and grapevine-pathogenic fungi

    Energy Technology Data Exchange (ETDEWEB)

    Valletta, Alessio [“Sapienza” University of Rome, Department of Environmental Biology (Italy); Chronopoulou, Laura; Palocci, Cleofe, E-mail: cleofe.palocci@uniroma1.it [“Sapienza” University of Rome, Department of Chemistry (Italy); Baldan, Barbara [University of Padua, Department of Biology (Italy); Donati, Livia; Pasqua, Gabriella [“Sapienza” University of Rome, Department of Environmental Biology (Italy)

    2014-12-15

    Poly(lactic-co-glycolic) acid (PLGA)-based NPs are currently considered among the most promising drug carriers, nevertheless their use in plants has never been investigated. In this work, for the first time, we demonstrated the ability of PLGA NPs to cross the plant cell wall and membrane of Vitis vinifera cell cultures and grapevine-pathogenic fungi. By means of fluorescence microscopy, we established that PLGA NPs can enter in grapevine leaf tissues through stomata openings and that they can be absorbed by the roots and transported to the shoot through vascular tissues. TEM analysis on cultured cells showed that NPs ≤ 50 nm could enter cells, while bigger ones remained attached to the cell wall. Viability tests demonstrated that PLGA NPs were not cytotoxic for V. vinifera-cultured cells. The cellular uptake of PLGA NPs by some important grapevine-pathogenic fungi has also been observed, thus suggesting that PLGA NPs could be used to deliver antifungal compounds within fungal cells. Overall the results reported suggest that such NPs may play a key role in future developments of agrobiotechnologies, as it is currently happening in biomedicine.

  18. Cloning, expression, purification and crystallization of dihydrodipicolinate synthase from the grapevine Vitis vinifera

    International Nuclear Information System (INIS)

    Dihydrodipicolinate synthase from the common grapevine V. vinifera has been cloned, expressed, purified and crystallized in the presence of the substrate pyruvate by in-drop hexahistidine-tag cleavage. A diffraction data set has been collected to a resolution of 2.2 Å. Dihydrodipicolinate synthase (DHDPS) catalyses the first committed step of the lysine-biosynthesis pathway in bacteria, plants and some fungi. This study describes the cloning, expression, purification and crystallization of DHDPS from the grapevine Vitis vinifera (Vv-DHDPS). Following in-drop cleavage of the hexahistidine tag, cocrystals of Vv-DHDPS with the substrate pyruvate were grown in 0.1 M Bis-Tris propane pH 8.2, 0.2 M sodium bromide, 20%(w/v) PEG 3350. X-ray diffraction data in space group P1 at a resolution of 2.2 Å are presented. Preliminary diffraction data analysis indicated the presence of eight molecules per asymmetric unit (VM = 2.55 Å3 Da−1, 52% solvent content). The pending crystal structure of Vv-DHDPS will provide insight into the molecular evolution in quaternary structure of DHDPS enzymes

  19. Poly(lactic-co-glycolic) acid nanoparticles uptake by Vitis vinifera and grapevine-pathogenic fungi

    International Nuclear Information System (INIS)

    Poly(lactic-co-glycolic) acid (PLGA)-based NPs are currently considered among the most promising drug carriers, nevertheless their use in plants has never been investigated. In this work, for the first time, we demonstrated the ability of PLGA NPs to cross the plant cell wall and membrane of Vitis vinifera cell cultures and grapevine-pathogenic fungi. By means of fluorescence microscopy, we established that PLGA NPs can enter in grapevine leaf tissues through stomata openings and that they can be absorbed by the roots and transported to the shoot through vascular tissues. TEM analysis on cultured cells showed that NPs ≤ 50 nm could enter cells, while bigger ones remained attached to the cell wall. Viability tests demonstrated that PLGA NPs were not cytotoxic for V. vinifera-cultured cells. The cellular uptake of PLGA NPs by some important grapevine-pathogenic fungi has also been observed, thus suggesting that PLGA NPs could be used to deliver antifungal compounds within fungal cells. Overall the results reported suggest that such NPs may play a key role in future developments of agrobiotechnologies, as it is currently happening in biomedicine

  20. Water deficit modulates the response of Vitis vinifera to the Pierce's disease pathogen Xylella fastidiosa.

    Science.gov (United States)

    Choi, Hong-Kyu; Iandolino, Alberto; da Silva, Francisco Goes; Cook, Douglas R

    2013-06-01

    Pierce's disease, caused by the bacterium Xylella fastidiosa, is one of the most devastating diseases of cultivated grape, currently restricted to the Americas. To test the long-standing hypothesis that Pierce's disease results from pathogen-induced drought stress, we used the Affymetrix Vitis GeneChip to compare the transcriptional response of Vitis vinifera to Xylella infection, water deficit, or a combination of the two stresses. The results reveal a redirection of gene transcription involving 822 genes with a minimum twofold change (P Xylella infection was largely distinct from the response of healthy plants to water stress, we find that 138 of the pathogen-induced genes exhibited a significantly stronger transcriptional response when plants were simultaneously exposed to infection and drought stress, suggesting a strong interaction between disease and water deficit. This interaction between drought stress and disease was mirrored in planta at the physiological level for aspects of water relations and photosynthesis and in terms of the severity of disease symptoms and the extent of pathogen colonization, providing a molecular correlate of the classical concept of the disease triangle in which environment impacts disease severity. PMID:23425100

  1. Impacts of Grapevine Leafroll Disease on Fruit Yield and Grape and Wine Chemistry in a Wine Grape (Vitis vinifera L.) Cultivar

    Science.gov (United States)

    Gutha, Linga R.; Larsen, Richard C.; Henick-Kling, Thomas; Harbertson, James F.; Naidu, Rayapati A.

    2016-01-01

    Grapevine leafroll disease (GLD) is an economically important virus disease affecting wine grapes (Vitis vinifera L.), but little is known about its effect on wine chemistry and sensory composition of wines. In this study, impacts of GLD on fruit yield, berry quality and wine chemistry and sensory features were investigated in a red wine grape cultivar planted in a commercial vineyard. Own-rooted Merlot vines showing GLD symptoms and tested positive for Grapevine leafroll-associated virus 3 and adjacent non-symptomatic vines that tested negative for the virus were compared during three consecutive seasons. Number and total weight of clusters per vine were significantly less in symptomatic relative to non-symptomatic vines. In contrast to previous studies, a time-course analysis of juice from grapes harvested at different stages of berry development from symptomatic and non-symptomatic vines indicated more prominent negative impacts of GLD on total soluble solids (TSS) and berry skin anthocyanins than in juice pH and titratable acidity. Differences in TSS between grapes of symptomatic and non-symptomatic vines were more pronounced after the onset of véraison, with significantly lower concentrations of TSS in grapes from symptomatic vines throughout berry ripening until harvest. Wines made from grapes of GLD-affected vines had significantly lower alcohol, polymeric pigments, and anthocyanins compared to corresponding wines from grapes of non-symptomatic vines. Sensory descriptive analysis of 2010 wines indicated significant differences in color, aroma and astringency between wines made from grapes harvested from GLD-affected and unaffected vines. The impacts of GLD on yield and fruit and wine quality traits were variable between the seasons, with greater impacts observed during a cooler season, suggesting the influence of host plant × environment interactions on overall impacts of the disease. PMID:26919614

  2. Impacts of Grapevine Leafroll Disease on Fruit Yield and Grape and Wine Chemistry in a Wine Grape (Vitis vinifera L. Cultivar.

    Directory of Open Access Journals (Sweden)

    Olufemi J Alabi

    Full Text Available Grapevine leafroll disease (GLD is an economically important virus disease affecting wine grapes (Vitis vinifera L., but little is known about its effect on wine chemistry and sensory composition of wines. In this study, impacts of GLD on fruit yield, berry quality and wine chemistry and sensory features were investigated in a red wine grape cultivar planted in a commercial vineyard. Own-rooted Merlot vines showing GLD symptoms and tested positive for Grapevine leafroll-associated virus 3 and adjacent non-symptomatic vines that tested negative for the virus were compared during three consecutive seasons. Number and total weight of clusters per vine were significantly less in symptomatic relative to non-symptomatic vines. In contrast to previous studies, a time-course analysis of juice from grapes harvested at different stages of berry development from symptomatic and non-symptomatic vines indicated more prominent negative impacts of GLD on total soluble solids (TSS and berry skin anthocyanins than in juice pH and titratable acidity. Differences in TSS between grapes of symptomatic and non-symptomatic vines were more pronounced after the onset of véraison, with significantly lower concentrations of TSS in grapes from symptomatic vines throughout berry ripening until harvest. Wines made from grapes of GLD-affected vines had significantly lower alcohol, polymeric pigments, and anthocyanins compared to corresponding wines from grapes of non-symptomatic vines. Sensory descriptive analysis of 2010 wines indicated significant differences in color, aroma and astringency between wines made from grapes harvested from GLD-affected and unaffected vines. The impacts of GLD on yield and fruit and wine quality traits were variable between the seasons, with greater impacts observed during a cooler season, suggesting the influence of host plant × environment interactions on overall impacts of the disease.

  3. Impacts of Grapevine Leafroll Disease on Fruit Yield and Grape and Wine Chemistry in a Wine Grape (Vitis vinifera L.) Cultivar.

    Science.gov (United States)

    Alabi, Olufemi J; Casassa, L Federico; Gutha, Linga R; Larsen, Richard C; Henick-Kling, Thomas; Harbertson, James F; Naidu, Rayapati A

    2016-01-01

    Grapevine leafroll disease (GLD) is an economically important virus disease affecting wine grapes (Vitis vinifera L.), but little is known about its effect on wine chemistry and sensory composition of wines. In this study, impacts of GLD on fruit yield, berry quality and wine chemistry and sensory features were investigated in a red wine grape cultivar planted in a commercial vineyard. Own-rooted Merlot vines showing GLD symptoms and tested positive for Grapevine leafroll-associated virus 3 and adjacent non-symptomatic vines that tested negative for the virus were compared during three consecutive seasons. Number and total weight of clusters per vine were significantly less in symptomatic relative to non-symptomatic vines. In contrast to previous studies, a time-course analysis of juice from grapes harvested at different stages of berry development from symptomatic and non-symptomatic vines indicated more prominent negative impacts of GLD on total soluble solids (TSS) and berry skin anthocyanins than in juice pH and titratable acidity. Differences in TSS between grapes of symptomatic and non-symptomatic vines were more pronounced after the onset of véraison, with significantly lower concentrations of TSS in grapes from symptomatic vines throughout berry ripening until harvest. Wines made from grapes of GLD-affected vines had significantly lower alcohol, polymeric pigments, and anthocyanins compared to corresponding wines from grapes of non-symptomatic vines. Sensory descriptive analysis of 2010 wines indicated significant differences in color, aroma and astringency between wines made from grapes harvested from GLD-affected and unaffected vines. The impacts of GLD on yield and fruit and wine quality traits were variable between the seasons, with greater impacts observed during a cooler season, suggesting the influence of host plant × environment interactions on overall impacts of the disease. PMID:26919614

  4. Effect of Partial Grapevine Defoliation (Vitis vinifera on Wine Quality / Efecto de la Defoliación Parcial en Uva (Vitis vinifera sobre la Calidad del Vino

    Directory of Open Access Journals (Sweden)

    Peña Olmos Jaime Ernesto

    2013-08-01

    Full Text Available The wine quality was determined for partially-defoliatedgrapevines grown in Villa de Leyva, Colombia at an elevation of2,143 masl. The experimental design was totally randomized,with two treatments (50% defoliation and 0% defoliation andthree repetitions per treatment. The planting material consistedof five-year-old vines of Vitis vinifera cv. Chardonnay, trainedto trellises, with a spacing of 2.1 m x 1 m. Every fifteen days,the plants in the defoliation treatment underwent the removalof half of the newly-emerged leaves. Before undertaking themicro-vinification process, the total soluble solids (TSS weremeasured in the grape must, and after a fermentation of 100days, wine quality parameters were measured, namely: residual sugars (TSS of the wine, pH, total titratable acid (TTA, and potential alcohol content of the wine. In the plants undergoing partial defoliation, the total soluble solids in the grape must increased, as well as the wine pH and potential alcohol content. At the same time, total titratable acid decreased in the wine of partially-defoliated plants. These results demonstrate that the wine quality was greatly improved by the reduction of leaf area in Chardonnay variety grape plants. / Con el uso de un diseño completamente aleatorizado, con dos tratamientos (defoliación al 50% y sin defoliación parcial y tres repeticiones por tratamiento, se determinó la calidad del vino en plantas de uva sometidas a defoliación parcial temprana en Villa de Leyva – Colombia a una altitud de 2.143 msnm. Como material vegetal se utilizaron plantas de Vitis vinifera L. cv. Chardonnay de cinco años de edad, sembradas en un sistema de espalderas a 2,1 x 1 m. Quincenalmente, se realizó la defoliación parcial a las plantas, la cual consistió en retirar una de cada doshojas recién emergidas en cada una de las plantas sometidas al tratamiento de defoliación. Antes de iniciar el proceso de microvinificación se determinaron los sólidos solubles

  5. Potential of a multiparametric optical sensor for determining in situ the maturity components of red and white Vitis vinifera wine grapes.

    Science.gov (United States)

    Agati, Giovanni; D'Onofrio, Claudio; Ducci, Eleonora; Cuzzola, Angela; Remorini, Damiano; Tuccio, Lorenza; Lazzini, Francesca; Mattii, Giovanni

    2013-12-18

    A nondestructive fluorescence-based technique for evaluating Vitis vinifera L. grape maturity using a portable sensor (Multiplex) is presented. It provides indices of anthocyanins and chlorophyll in Cabernet Sauvignon, Merlot, and Sangiovese red grapes and of flavonols and chlorophyll in Vermentino white grapes. The good exponential relationship between the anthocyanin index and the actual anthocyanin content determined by wet chemistry was used to estimate grape anthocyanins from in field sensor data during ripening. Marked differences were found in the kinetics and the amount of anthocyanins between cultivars and between seasons. A sensor-driven mapping of the anthocyanin content in the grapes, expressed as g·kg(-1) fresh weight, was performed on a 7-ha vineyard planted with Sangiovese. In the Vermentino, the flavonol index was favorably correlated to the actual content of berry skin flavonols determined by means of HPLC analysis of skin extracts. It was used to make a nondestructive estimate of the evolution in the flavonol concentration in grape berry samplings. The chlorophyll index was inversely correlated in a linear manner to the total soluble solids (°Brix): it could, therefore, be used as a new index of technological maturity. The fluorescence sensor (Multiplex) possesses a high potential for representing an important innovative tool for controlling grape maturity in precision viticulture. PMID:24279372

  6. Electronic Nose Analysis of Cabernet Sauvignon (Vitis vinifera L.) Grape and Wine Volatile Differences during Cold Soak and Postfermentation

    OpenAIRE

    Gardner, D. M.; Zoecklein, B. W.; Mallikarjunan, K.

    2011-01-01

    Cold soak is a prefermentation maceration process at cold temperatures, traditionally used to enhance red wine color. This study monitored changes in Vitis vinifera L. cv. Cabernet Sauvignon volatiles using a commercial conducting polymer electronic nose (ENose) during a five-day cold soak and postfermentation. Principal component analysis (PCA) of juice volatiles detected by the ENose during cold soak showed PCI accounted for 95.7% of the variation. Various volatile associations were made wi...

  7. Rain-Shelter Cultivation Modifies Carbon Allocation in the Polyphenolic and Volatile Metabolism of Vitis vinifera L. Chardonnay Grapes

    OpenAIRE

    Yuan Gao; Xiao-Xi Li; Mei-Mei Han; Xiao-Fan Yang; Zheng Li; Jun Wang; Qiu-Hong Pan

    2016-01-01

    This study investigated the effect of rain-shelter cultivation on the biosynthesis of flavonoids and volatiles in grapes, with an aim of determining whether rain-shelter application could help to improve the sensory attributes and quality of grapes. Vitis vinifera L. Chardonnay grapes, grown in the Huaizhuo basin region of northern China, were selected within two consecutive years. A rain-shelter roof was constructed using a colorless polyethylene (PE) film with a light transmittance of 80%. ...

  8. The effect of lignin as a natural adhesive on the physico-mechanical properties of Vitis vinifera fiberboards

    OpenAIRE

    Camilo Mancera; Nour-Eddine El Mansouri; Fabiola Vilaseca; Francesc Ferrando; Joan Salvado

    2011-01-01

    Lignin was used as a natural adhesive to manufacture Vitis vinifera fiberboards. The fiberboards were produced at laboratory scale by adding powdered lignin to material that had previously been steam-exploded under optimized pretreatment and pressing conditions. The kraft lignin used was washed several times with an acidic solution to eliminate any contaminants and low molecular weight compounds. This research studied the effects of amounts of lignin ranging from 5% to 20% on the properties o...

  9. Hepatoprotective Effects of Total Triterpenoids and Total Flavonoids from Vitis vinifera L against Immunological Liver Injury in Mice

    OpenAIRE

    Tao Liu; Jun Zhao; Long Ma; Yusong Ding; Deqi Su

    2012-01-01

    Suosuo grape (the fruits of Vitis vinifera L) has been used for prevention and treatment of liver diseases in Uighur folk medicine in China besides its edible value. In this study, the hepatoprotective effects of total triterpenoids (VTT) and total flavonoids (VTF) from Suosuo grape were evaluated in Bacille-Calmette-Guerin- (BCG-) plus-lipopolysaccharide- (LPS-) induced immunological liver injury (ILI) in mice. Various dose groups (50, 150, and 300 mg/kg) of VTT and VTF alleviated the degree...

  10. Discriminated release of phenolic substances from red wine grape skins (Vitis vinifera L.) by multicomponent enzymes treatment

    DEFF Research Database (Denmark)

    Arnous, Anis; Meyer, Anne S.

    2010-01-01

    and Cabernet Sauvignon wine grapes (Vitis vinifera L.). Anthocyanins were released from skins during the early phases of the enzymatic treatments, but were then degraded during further enzymatic treatment; flavonols underwent transformation from glycosylated (rutin) to deglycosylated (quercetin...... lignin. The data moreover suggest that p-coumaric acid was also released during enzyme catalyzed degradation of acylated anthocyanins, probably as a result of cinnamate esterase activity. The data thus provided unexpected new clues as to how the enzymatic treatment with multicomponent pectinolytic...

  11. Assessment of the potential health benefits of certain total extracts from Vitis vinifera, Aesculus hyppocastanum and Curcuma longa

    OpenAIRE

    MARGINĂ, DENISA; Olaru, Octavian Tudorel; Ilie, Mihaela; GRĂDINARU, DANIELA; GUȚU, CLAUDIA; VOICU, SORINA; Dinischiotu, Anca; Spandidos, Demetrios A.; TSATSAKIS, ARISTIDIS M.

    2015-01-01

    A number of recent studies have illustrated the active role of food/natural components in the prevention of chronic diseases and in the improvement of the quality of life. In the present study, we aimed to obtain and characterize certain extracts from Vitis vinifera L., Aesculus hippocastanum L. and Curcuma longa L., focusing on their antioxidant effects in vitro. Three vegetal extracts were obtained for each plant: in water, 50% water-alcohol and in 96% ethanol. These extracts were then anal...

  12. Shared and divergent pathways for flower abscission are triggered by gibberellic acid and carbon starvation in seedless Vitis vinifera L

    OpenAIRE

    Domingos, Sara; Fino, Joana; Cardoso, Vânia; Sánchez, Claudia; Ramalho, José C; Larcher, Roberto; Paulo, Octávio S; Oliveira, Cristina M.; Goulao, Luis F.

    2016-01-01

    Background Abscission is a highly coordinated developmental process by which plants control vegetative and reproductive organs load. Aiming at get new insights on flower abscission regulation, changes in the global transcriptome, metabolome and physiology were analyzed in ‘Thompson Seedless’ grapevine (Vitis vinifera L.) inflorescences, using gibberellic acid (GAc) spraying and shading as abscission stimuli, applied at bloom. Results Natural flower drop rates increased from 63.1 % in non-trea...

  13. EFFECT OF THE BROWN ALGA ASCOPHYLLUM NODOSUM AS BIOFERTILIZER ON VEGETATIVE GROWTH IN GRAPEVINE (VITIS VINIFERA L.)

    OpenAIRE

    Gheorghe Cristian Popescu; Monica Popescu

    2014-01-01

    Environmental growing farm technology involves utilization of agricultural inputs which are friendly with the production and ecosystem. Seaweed extracts are used as biofertilizers in horticulture in special to increase plant growth and productivity. In this study, we investigated the effect of seaweed extracts made from Ascophyllum nodosum, on vegetative growth of Vitis vinifera cv. Feteasca Alba. We used three different concentrations of seaweed extracts to asset the effect on fertility coe...

  14. EXPERIMENTAL EVALUATION OF THE ANTI-ULCER ACTIVITY OF GRAPE (VITIS VINIFERA) SEED EXTRACT IN WISTAR ALBINO RATS

    OpenAIRE

    Anand M. Ingale; Vijaya Rajendran; Venkata BharatKumar Pinnelli

    2014-01-01

    Background: Peptic ulcer disease is a common condition of present day life, and its incidence is markedly increasing. The available drugs for the treatment are associated with adverse effects. Hence, there is a need for newer and better treatment for the same. Objectives: To evaluate the anti-ulcer activity of ethanolic extract of Vitis Vinifera (seed) by Water Immersion stress induced gastric ulcer model in Wistar albino rats using two doses (100, 200mg/kg body weight.) Methods: The antiu...

  15. The transcription factor VvWRKY33 is involved in the regulation of grapevine (Vitis vinifera) defense against the oomycete pathogen Plasmopara viticola.

    Science.gov (United States)

    Merz, Patrick R; Moser, Tina; Höll, Janine; Kortekamp, Andreas; Buchholz, Günther; Zyprian, Eva; Bogs, Jochen

    2015-03-01

    Grapevine (Vitis vinifera ssp. vinifera) is one of the most important fruit species; however, it is highly susceptible to various pathogens, which can cause severe crop losses in viticulture. It has been shown that several WRKY class transcription factors (TFs) are part of the signal transduction cascade, which leads to the activation of plant defense reactions against various pathogens. In the present investigation, a full-length cDNA was isolated from V. vinifera leaf tissue encoding a predicted protein, designated VvWRKY33, which shows the characteristics of group I WRKY protein family. VvWRKY33 induction correlates with the expression of VvPR10.1 (pathogenesis-related 10.1) gene in the leaves of the resistant cultivar 'Regent' after infection with Plasmopara viticola, whereas in the susceptible cultivar 'Lemberger' VvWRKY33 and VvPR10.1 are not induced. Corresponding expression of the TF and VvPR10.1 was even obtained in uninfected ripening berries. In planta, analysis of VvWRKY33 has been performed by ectopic expression of VvWRKY33 in grapevine leaves of greenhouse plants mediated via Agrobacterium tumefaciens transformation. In consequence, VvWRKY33 strongly increases resistance to P. viticola in the susceptible cultivar 'Shiraz' and reduces pathogen sporulation of about 50-70%, indicating a functional role for resistance in grapevine. Complementation of the resistance-deficient Arabidopsis thaliana Columbia-0 (Col-0) mutant line wrky33-1 by constitutive expression of VvWRKY33 restores resistance against Botrytis cinerea to wild-type level and in some complemented mutant lines even exceeds the resistance level of the parental line Col-0. Our results support the involvement of VvWRKY33 in the defense reaction of grapevine against different pathogens. PMID:25132131

  16. Acclimatization of 'VR043-43' (Vitis vinifera x Vitis rotundifolia grapevine rootstock Aclimatização do porta-enxerto de videira 'VR043-43' (Vitis vinifera x Vitis rotundifolia

    Directory of Open Access Journals (Sweden)

    Marília Pereira Machado

    2010-08-01

    Full Text Available The pre-acclimatization stage can be used to improve micropropagation protocols and increase the yield of produced plants. The influence of sucrose and photon flux density (PFD levels on the acclimatization of in vitro-grown 'VR043-43' (Vitis vinifera x Vitis rotundifolia grapevine rootstocks was evaluated. Rooted shoots were obtained from 4-week-old in vitro shoots cultivated in QL (Quoirin and Lepoivre, 1977 culture medium supplemented with 15, 30 and 45 g L-1 of sucrose. The experiment was kept in a 25 ± 2ºC growth room, under 16-h photoperiod and PFD of 18 µmol m-2 s-1 or 43 µmol m-2 s-1. Plants were transferred to an intermittent misting system greenhouse for 10 d followed by 20 d of once-a-day watering routine using a handheld hose. Plant height was influenced by sucrose concentration, and shoots produced on media supplemented with 30 g L-1 sucrose were the tallest (5.0 cm. The largest leaf area was obtained with 31.3 g L-1 of sucrose, under the PFD of 43 µmol m-2 s-1 (13.3 cm². Absence of sucrose in the culture medium led to a significant reduction in leaf area at both PFDs. Shoot (aerial part dry matter was largest when 30 or 45 g L-1 of sucrose (17.5 and 16.7 mg per plant, respectively were used. Microcuttings rooted in all sucrose concentrations tested. The highest survival percentage (100% during ex vitro acclimatization was obtained for shoots cultured in media supplemented with 45 g L-1 of sucrose under both PFDs tested.A fase de pré-aclimatização pode ser utilizada para aperfeiçoar os protocolos de micropropagação e aumentar o rendimento na produção de mudas. Avaliou-se a influência da sacarose e níveis de densidade de fluxo de fóton (DFF in vitro, na sobrevivência das mudas do porta-enxerto de videira 'VR043-43'(Vitis vinifera x Vitis rotundifolia, na fase de aclimatização. Microestacas obtidas de brotações in vitro foram cultivadas em meio de cultura QL suplementado 15, 30 e 45 g L-1 de sacarose. O

  17. Transcriptomic analysis of grape (Vitis vinifera L. leaves after exposure to ultraviolet C irradiation.

    Directory of Open Access Journals (Sweden)

    Huifen Xi

    Full Text Available BACKGROUND: Only a small amount of solar ultraviolet C (UV-C radiation reaches the Earth's surface. This is because of the filtering effects of the stratospheric ozone layer. Artificial UV-C irradiation is used on leaves and fruits to stimulate different biological processes in plants. Grapes are a major fruit crop and are grown in many parts of the world. Research has shown that UV-C irradiation induces the biosynthesis of phenols in grape leaves. However, few studies have analyzed the overall changes in gene expression in grape leaves exposed to UV-C. METHODOLOGY/PRINCIPAL FINDINGS: In the present study, transcriptional responses were investigated in grape (Vitis vinifera L. leaves before and after exposure to UV-C irradiation (6 W·m-2 for 10 min using an Affymetrix Vitis vinifera (Grape Genome Array (15,700 transcripts. A total of 5274 differentially expressed probe sets were defined, including 3564 (67.58% probe sets that appeared at both 6 and 12 h after exposure to UV-C irradiation but not before exposure. A total of 468 (8.87% probe sets and 1242 (23.55% probe sets were specifically expressed at these times. The probe sets were associated with a large number of important traits and biological pathways, including cell rescue (i.e., antioxidant enzymes, protein fate (i.e., HSPs, primary and secondary metabolism, and transcription factors. Interestingly, some of the genes involved in secondary metabolism, such as stilbene synthase, responded intensely to irradiation. Some of the MYB and WRKY family transcription factors, such as VvMYBPA1, VvMYB14, VvMYB4, WRKY57-like, and WRKY 65, were also strongly up-regulated (about 100 to 200 fold. CONCLUSIONS: UV-C irridiation has an important role in some biology processes, especially cell rescue, protein fate, secondary metabolism, and regulation of transcription.These results opened up ways of exploring the molecular mechanisms underlying the effects of UV-C irradiation on grape leaves and have

  18. In Vitro Propagarion and Cryopreservation of Important Grape Cultivars (Vitis Vinifera L. and Rootstocks

    Directory of Open Access Journals (Sweden)

    F. CELEBI TOPRAK

    2014-06-01

    Full Text Available Grape (Vitis vinifera L. is among the most important species that is cultivated almost all around the world. There are over one thousand varieties that are grown for raisin, fresh consumption and wine making purposes. The grape germplasm resources are generally maintained as whole plants under field conditions. The traditional way of germplasm preservation is very risky due to natural uncertainties. In vitro technologies can help producing healthy propagation materials free from viroids, viruses, bacteria, phytoplasmas, fungi, and nematodes. When combined with cryopreservation technologies in vitro preservation systems can allow safe protection and propagation of valuable Vitis genetic resources. In this study, 12 commercial cultivar and two rootstock materials were tested for the applicability of long term preservation by in vitro clonal propagation and cryopreservation techniques. Axillary shoot tips collected from newly emerging shoots were placed in Magenda boxes containing 30 g/l sucrose on MS medium and cultured in a growth chamber adjusted to 16 h ligth/25o C and 8 h dark/17o C. All grape genotypes tested responded well to this application and produced healthy root and shoots. Shoot explants from these in vitro stocks were subcultured in every three months for one year. Apical dome explants excised from in vitro grape plants were stored in liquid nitrogen for cryopreservation. Genotypes varied in their responses to cryopservation treatment. Five genotypes showed shoot or callus formation. Regenerated shoots continued to grow and produced normal shoots and roots, but no plants could be developed from calli. Flow cytometry analysis of regenerants from continuous subculture and cryopreservation did not show any chromosome number abnormalities. In vitro micropropagation is an excellent choice for a long-term conservation of grape germplasm, which allows access to actively growing plant materials without seasonal restriction. Such cultures are

  19. MANIPULATION OF PHOTOSYNTHESIS IN GRAPE (VITIS VINIFERA CV. ‘FLAME’ BY THE APPLICATION OF TWO SUCROSE ANALOGS

    Directory of Open Access Journals (Sweden)

    M. E. Tiznado-Hernandez

    2013-01-01

    Full Text Available The translocation of photosynthates from the leaves is important for the accumulation of sugars in grape berries. Two sucrose analogs were applied at post-veraison to determine their effects on leaf photosynthesis. It is hypothesized that the signal of sugar accumulation in leaves will bring a reduction in photosynthesis and an increase in the photosynthate translocation rate to the berries. The experiment was conducted in a commercial Vitis vinifera ‘Flame’ vineyard. The sucrose analogs used were palatinose and turanose at 5 mM. For each treatment, five fully expanded leaves from five different vines were sprayed until run-off. Control leaves were treated with distilled water. Net photosynthesis rate (Pn, stomatal conductance (gs, Photosynthetically Active Radiation (PAR and leaf temperature (Lt were measured at 0, 10, 20, 30, 60 and 90 min after the treatment with a LICOR-6200 portable photosynthesis system. Statistical analysis was made by variance analysis based on a randomized complete block design and means separated using the Student-Newman-Keuls test with a confidence level of 0.05. The application of turanose did not affect Pn whereas palatinose reduced the Pn one hour after application. At this point, not statistical differences were found in gs and PAR. It was concluded that the application of palatinose can reduce the net photosynthesis which suggests that it is possible to manipulate photosynthesis by the utilization of sucrose analogs which maybe also increases the translocation of photosynthates from grape leaves to grape berries.

  20. Effect of Three Training Systems on Grapes in a Wet Region of China: Yield, Incidence of Disease and Anthocyanin Compositions of Vitis vinifera cv. Cabernet Sauvignon.

    Science.gov (United States)

    Liu, Mei-Ying; Chi, Ming; Tang, Yong-Hong; Song, Chang-Zheng; Xi, Zhu-Mei; Zhang, Zhen-Wen

    2015-01-01

    Grapevine training systems determine the suitability for grape varieties in a specific growing region. We evaluated the influence of three training systems, Single Guyot (SG), Spur-pruned Vertical Shoot-Positioned (VSP), and Four-Arm Kniffin (4AK), on the performance of grapes and vines of Vitis vinifera L. cv. Cabernet Sauvignon in the 2012 and 2013 growing seasons in a wet region of central China. 4AK was the most productive system in comparison to SG and VSP. SG and VSP had lower disease infections of leaves and berries, especially in the mid- and final stage of berry ripening. Three training systems had no impact on berry maturity. PLS-DA (Partial Least Squares-Discriminant) analysis showed that the relatively dry vintage could well discriminate three training systems, but the wet vintage was not. A wet vintage of 2013 had more accumulation of 3'5'-substituted and acylated anthocyanins, including malvidin-3-O-(6-O-acetyl)-glucoside, malvidin-3-O-glucoside, and petunidin-3-O-(cis-6-O-coumaryl)-glucoside, etc. With regard to the effect of training systems, 4AK grapes had the lowest concentrations of total anthocyanins and individual anthocyanins, SG and VSP differed according to the different vintages, and showed highest concentration of total individual anthocyanins in 2012 and 2013, respectively. Generally, VSP benefited the most, contributing to significantly highest levels of total individual anthocyanins, and major anthocyanin, including malvidin-3-O-glucoside and malvidin-3-O-(6-O-acetyl)-glucoside, and the grapes obtained from VSP presented significantly highest proportion of 3'5'-substituted anthocyanins. With regard to the ratios of 3'5'/3'-substituted, methoxylated/non-methoxylated and acylated/non-acylated anthocyanins, the significantly higher levels were also shown in VSP system. In summary, VSP was the best training system for Cabernet Sauvignon to accumulate relatively stable individual anthocyanins in this wet region of China and potentially in

  1. Antioxidant and antiproliferative activities of twenty-four Vitis vinifera grapes.

    Directory of Open Access Journals (Sweden)

    Zhenchang Liang

    Full Text Available Grapes are rich in phytochemicals with many proven health benefits. Phenolic profiles, antioxidant and antiproliferative activities of twenty-four selected Vitis vinifera grape cultivars were investigated in this study. Large ranges of variation were found in these cultivars for the contents of total phenolics (95.3 to 686.5 mg/100 g and flavonoids (94.7 to 1055 mg/100 g and antioxidant activities (oxygen radical absorbance capacity 378.7 to 3386.0 mg of Trolox equivalents/100 g and peroxylradical scavenging capacity14.2 to 557 mg of vitamin C equivalents/100 g, cellular antioxidant activities (3.9 to 139.9 µmol of quercetin equivalents/100 g without PBS wash and 1.4 to 95.8 µmol of quercetin equivalents /100 g with PBS wash and antiproliferative activities (25 to 82% at the concentrations of 100 mg/mL extracts.The total antioxidant activities were significantly correlated with the total phenolics and flavonoids. However, no significant correlations were found between antiproliferative activities and total phenolics or total flavonoids content. Wine grapes and color grapes showed much higher levels of phytochemicals and antioxidant activities than table grapes and green/yellow grapes. Several germplasm accessions with much high contents of phenolics and flavonoids, and total antioxidant activity were identified. These germplasm can be valuable sources of genes for breeding grape cultivars with better nutritional qualities of wine and table grapes in the future.

  2. Treatment strategies for high resveratrol induction in Vitis vinifera L. cell suspension culture

    Directory of Open Access Journals (Sweden)

    Thu V. Vuong

    2014-06-01

    Full Text Available Bioprocesses capable of producing large scales of resveratrol at nutraceutical grade are in demand. This study herein investigated treatment strategies to induce the production of resveratrol in Vitis vinifera L. cell suspension cultures. Among seven investigated elicitors, jasmonic acid (JA, salicylic acid, β-glucan (GLU, and chitosan enhanced the production of intracellular resveratrol manyfold. The combined treatment of JA and GLU increased extracellular resveratrol production by up to tenfold. The application of Amberlite XAD-7 resin for in situ removal and artificial storage of secreted resveratrol further increased resveratrol production by up to four orders of magnitude. The level of resveratrol produced in response to the combined treatment with 200 g/L XAD-7, 10 μM JA and 1 mg/mL GLU was approximately 2400 mg/L, allowing the production of resveratrol at an industrial scale. The high yield of resveratrol is due to the involvement of a number of mechanisms working in concert.

  3. Performance of several models for predicting budburst date of grapevine ( Vitis vinifera L.)

    Science.gov (United States)

    García de Cortázar-Atauri, Iñaki; Brisson, Nadine; Gaudillere, Jean Pierre

    2009-07-01

    The budburst stage is a key phenological stage for grapevine ( Vitis vinifera L.), with large site and cultivar variability. The objective of the present work was to provide a reliable agro-meteorological model for simulating grapevine budburst occurrence all over France. The study was conducted using data from ten cultivars of grapevine (Cabernet Sauvignon, Chasselas, Chardonnay, Grenache, Merlot, Pinot Noir, Riesling, Sauvignon, Syrah, Ugni Blanc) and five locations (Bordeaux, Colmar, Angers, Montpellier, Epernay). First, we tested two commonly used models that do not take into account dormancy: growing degree days with a base temperature of 10°C (GDD10), and Riou’s model (RIOU). The errors of predictions of these models ranged between 9 and 21 days. Second, a new model (BRIN) was studied relying on well-known formalisms for orchard trees and taking into account the dormancy period. The BRIN model showed better performance in predicting budburst date than previous grapevine models. Analysis of the components of BRIN formalisms (calculation of dormancy, use of hourly temperatures, base temperature) explained the better performances obtained with the BRIN model. Base temperature was the main driver, while dormancy period was not significant in simulating budburst date. For each cultivar, we provide the parameter estimates that showed the best performance for both the BRIN model and the GDD model with a base temperature of 5°C.

  4. Somatic embryogenesis and histological analysis from zygotic embryos in Vitis vinifera L. 'Moldova'

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    We examined the somatic embryogenesis from and histological studies of zygotic embryos of seeds in European Grape 'Moldova' (Vitis vinifera L. 'Moldova'). Primary calli were initiated on Nitsch and Nitsch (NN) medium supplemented with 1.0mg'L-1 2,4-D and 0.5 mg'L-1 6-BA. Embryogenic calli were produced upon transfer to a NN medium with 0.5 mg-L-1 6-BA and 2 mg.L-1 NAA and somatic embryos were obtained on a half strength MS medium without plant growth regulators. During the somatic embryo germination, an addition of 1.0 mg.L-1 6-BA in the medium could accelerate somatic embryos to develop into normal plants and increase the conversion rate from 0 to 43.3%. Histological studies of embryogenic calli and somatic embryos demonstrated dy-namic changes of proteins and starch grains. The developmental processes of somatic embryos were similar to those of zygotic em-bryos, including typical epiderma, cotyledon primordium and vascular tissue.

  5. Expanding the chemical space of polyketides through structure-guided mutagenesis of Vitis vinifera stilbene synthase.

    Science.gov (United States)

    Bhan, Namita; Cress, Brady F; Linhardt, Robert J; Koffas, Mattheos

    2015-08-01

    Several natural polyketides (PKs) have been associated with important pharmaceutical properties. Type III polyketide synthases (PKS) that generate aromatic PK polyketides have been studied extensively for their substrate promiscuity and product diversity. Stilbene synthase-like (STS) enzymes are unique in the type III PKS class as they possess a hydrogen bonding network, furnishing them with thioesterase-like properties, resulting in aldol condensation of the polyketide intermediates formed. Chalcone synthases (CHS) in contrast, lack this hydrogen-bonding network, resulting primarily in the Claisen condensation of the polyketide intermediates formed. We have attempted to expand the chemical space of this interesting class of compounds generated by creating structure-guided mutants of Vitis vinifera STS. Further, we have utilized a previously established workflow to quickly compare the wild-type reaction products to those generated by the mutants and identify novel PKs formed by using XCMS analysis of LC-MS and LC-MS/MS data. Based on this approach, we were able to generate 15 previously unreported PK molecules by exploring the substrate promiscuity of the wild-type enzyme and all mutants using unnatural substrates. These structures were specific to STSs and cannot be formed by their closely related CHS-like counterparts. PMID:26048582

  6. Hydrogen sulfide is involved in the chilling stress response in Vitis vinifera L.

    Directory of Open Access Journals (Sweden)

    Peining Fu

    2013-11-01

    Full Text Available Hydrogen sulfide (H2S is an important signaling molecule involved in several stress-resistance processes in plants, such as drought and heavy metal stresses. However, little is known about the roles of H2S in responses to chilling stress. In this paper, we demonstrated that chilling stress enhance the H2S levels, the H2S synthetase (L-/D-cysteine desulfhydrase, L/DCD activities, and the expression of L/DCD gene in Vitis vinifera L. ‘F-242’. Furthermore, the seedlings were treated with sodium hydrosulfide (NaHS, a H2S donor and hypotaurine (HT, a H2S scavenger at 4°C to examine the effects of exogenous H2S on grape. The results revealed that the high activity of superoxide dismutase and enhanced expression of VvICE1 and VvCBF3 genes, but low level of super oxide anion radical, malondialdehyde content and cell membrane permeability were detected after addition of NaHS. In contrast, HT treatment displayed contrary effect under the chilling temperature. Taken together, these data suggested that H2S might be directly involved in the cold signal transduction pathway of grape.

  7. Optimization of extraction and microencapsulation of bioactive compounds from red grape (Vitis vinifera L.) pomace.

    Science.gov (United States)

    Boonchu, Thapakorn; Utama-Ang, Niramon

    2015-02-01

    Grape (Vitis vinifera L.) pomace constitutes a promising source of phenolic compounds, gallic acid, flavan-3-ols, flavonoids, stilbene and anthocyanins that are beneficial for human health. The objectives of this study were to optimize the extraction and microencapsulation of red grape pomace. Central composite designs with two factors were conducted for optimization using response surface methodology. The temperature (45-85 °C), and the time (2-8 h) were designed for the extraction. The results indicated that the extraction temperature and time introduced the increasing the extraction yield, total phenolic content, anthocyanin and resveratrol, but the long extraction time reduced the tannin content. The results showed that the optimize condition was the extraction at 80 ± 1 °C for 2 h 53 min. This provided the highest content of polyphenolic compounds. The next experiment was microencapsulation of the extract which studied the amounts of maltodextrin (7-28 % w/v) and carboxymethylcellulose (CMC) (0-1.4 % w/v). The results showed that the optimized microencapsulation used 10.21 % w/v maltodextrin and 0.21 % w/v CMC to maximize all polyphenolic compounds, and also to minimize bitterness and astringency. This study illustrated that the optimal conditions for extraction and microencapsulation of the red grape extract have a high potential to produce functional ingredients. PMID:25694686

  8. Regulation of cell wall remodeling in grapevine (Vitis vinifera L.) callus under individual mineral stress deficiency.

    Science.gov (United States)

    Fernandes, João C; Goulao, Luis F; Amâncio, Sara

    2016-01-15

    Cell wall (CW) is a dynamic structure that determines the plant form, growth and response to environmental conditions. Vitis vinifera callus grown under nitrogen (-N), phosphorous (-P) and sulfur (-S) deficiency were used as a model system to address the influence of mineral stress in CW remodeling. Callus cells morphology was altered, mostly under -N, resulting in changes in cell length and width compared with the control. CW composition ascertained with specific staining and immuno-detection showed a decrease in cellulose and altered pattern of pectin methylesterification. Under mineral stress genes expression from candidate families disclosed mainly a downregulation of a glycosyl hydrolase family 9C (GH9C), xyloglucan transglycosylase/hydrolases (XTHs) with predicted hydrolytic activity and pectin methylesterases (PMEs). Conversely, upregulation of PMEs inhibitors (PMEIs) was observed. While methylesterification patterns can be associated to PME/PMEI gene expression, the lower cellulose content cannot be attributed to altered cellulose synthase (CesA) gene expression suggesting the involvement of other gene families. Salt extracts from -N and -P callus tissues increased plastic deformation in cucumber hypocotyls while no effect was observed with -S extracts. The lower endo-acting glycosyl hydrolase activity of -N callus extracts pinpoints a more expressive impact of -N on CW-remodeling. PMID:26735749

  9. Aloe vera and Vitis vinifera improve wound healing in an in vivo rat burn wound model.

    Science.gov (United States)

    Lin, Li-Xin; Wang, Peng; Wang, Yu-Ting; Huang, Yong; Jiang, Lei; Wang, Xue-Ming

    2016-02-01

    Aloe vera and Vitis vinifera have been traditionally used as wound healing agents. The present study aimed to investigate the effects of aloe emodin and resveratrol in the burn wound healing procedure. Burn wounds are common in developed and developing countries, however, in developing countries, the incidence of severe complications is higher and financial resources are limited. The results of the present study demonstrated that neither aloe emodin or resveratrol were cytotoxic to THP-1 macrophages at concentrations of 1, 100 and 500 ng/ml. A significant increase in wound-healing activity was observed in mice treated with the aloe emodin and resveratrol, compared with those which received control treatments. The levels of IL-1β in the exudates of the burn wound area of the treated mice increased in a time-dependent manner over 7 days following burn wound injury. At 10 days post-injury, steady and progressive wound healing was observed in the control animals. The present study confirmed that increased wound healing occurs following treatment with aloe emodin,, compared with resveratrol, providing support for the use of Aloe vera plants to improve burn wound healing. PMID:26677006

  10. Proteomic analysis of the compatible interaction between Vitis vinifera and Plasmopara viticola.

    Science.gov (United States)

    Milli, Alberto; Cecconi, Daniela; Bortesi, Luisa; Persi, Anna; Rinalducci, Sara; Zamboni, Anita; Zoccatelli, Gianni; Lovato, Arianna; Zolla, Lello; Polverari, Annalisa

    2012-02-01

    We analyzed the proteome of grapevine (Vitis vinifera) leaves 24, 48 and 96 h post infection (hpi) with the downy mildew pathogen Plasmopara viticola. Total proteins were separated on 2-DE gels. By MS analysis, we identified 82 unique grapevine proteins differentially expressed after infection. Upregulated proteins were often included in the functional categories of general metabolism and stress response, while proteins related to photosynthesis and energy production were mostly downregulated. As expected, the activation of a defense reaction was observed more often at the late time point, consistent with the establishment of a compatible interaction. Most proteins involved in resistance were isoforms of different PR-10 pathogenesis-related proteins. Although >50 differentially expressed protein isoforms were observed at 24 and 96 hpi, only 18 were detected at 48 hpi and no defense-related proteins were among this group. This profile suggests a transient breakdown in defense responses accompanying the onset of disease, further supported by gene expression analyses and by a western blot analysis of a PR-10 protein. Our data reveal the complex modulation of plant metabolism and defense responses during compatible interactions, and provide insight into the underlying molecular processes which may eventually yield novel strategies for pathogen control in the field. PMID:22120121

  11. Study of Cytostatic and Cytotoxic Activity of Several Polyphenolic Extracts Obtained from Vitis vinifera

    Directory of Open Access Journals (Sweden)

    Ancuta NECHITA

    2012-05-01

    Full Text Available The study of polyphenolic extracts from skins, seeds, grape pomace and lees is justified by the huge amount of information from specialized literature, drawing attention to the many pharmacological effects of these biomolecules. The concentrated vegetal extracts obtained from seeds, skins, grape pomace and lees (yeast deposit after fermentation were characterized according to their content of total polyphenols, anthocyanins, dry matter, ash and pH. The biological material used in the in vitro testing experiments in order to study cytostatic and cytotoxic effects were stabilized cultures of HeLa cancer cells, uncontaminated with mycoplasma and derived from a human uterine cervix carcinoma. Another action of the cytostatic substances could be exerted upon the cell proliferation process. The cell division process of the HeLa cell cultures treated with seeds by-product showed remarkable quantitative changes. The study has also evidenced a great number of dead cells in the composition of the treated HeLa cell cultures, their existence pointing out that the bioactive agent induced a major decrease of the cells viability. The obtained results in the context of the complex evaluation of the in vitro antitumoral property of the extracts, obtained from seeds, skins, grape pomace and wine lees from the ‘Arcaş’ grape variety, on HeLa cells cultures, have demonstrated the significant cytostatic and cytotoxic potential of the seeds polyphenolic biopreparate. The results obtained show that polyphenolic extracts from Vitis vinifera seeds act as cytostatic and cytotoxic agents.

  12. Chlorophyll Fluorescence in Partially Defoliated Grape Plants (Vitis vinifera L. cv. Chardonnay / Fluorescencia de la Clorofila en Plantas de Uva (Vitis vinifera L. cv. Chardonnay Defoliadas Parcialmente

    Directory of Open Access Journals (Sweden)

    Peña Olmos Jaime Ernesto

    2013-08-01

    Full Text Available The chlorophyll content and fluorescence weredetermined in five-year-old grape plants (Vitis vinifera L. cv.Chardonnay that were subjected to early partial defoliation,in Villa de Leyva, Colombia. The experimental design wascompletely randomized, consisting of two treatments (50%defoliation and control, each with four replications of 35 plants. Every two weeks, one of every two recently-emerged leaves was removed from the non-control plants. The determination of total chlorophyll content was carried out on six leaves per plant using a CCM-200 Plus chlorophyll meter, while chlorophyll fluorescence measurements were taken with one darkadapted leaf per plant using a Junior-PAM fluorometer. Initial fluorescence (Fo, maximum fluorescence (Fm, terminal fluorescence (Ft, variable fluorescence (Fv, electron transport rate (ETR, maximum photochemical quantum yield of PSII (Fv/ Fm, effective photochemical quantum yield of photosystem II (Y(II, photochemical fluorescence quenching coefficient (qP, two non-photochemical quenching coefficients (qN and NPQ,quantum yield of light-induced non-photochemical fluorescence quenching (Y(NPQ, and quantum yield of non-light-induced non-photochemical quenching (Y(NO were measured. The chlorophyll concentration index showed higher values in the defoliated plants. There were no significant differences for the values of Fm, Ft and Fv. Fo was higher in the defoliated plants, while ETR, Fv/Fm and Y(II showed higher values in the control plants. It is evident that a reduction in leaf area modifies thepartitioning of excitation energy destined for photochemicaland non-photochemical processes, thus directly influencing the photosynthetic process of the plants evaluated. / Utilizando un diseño completamente aleatorizado,con dos tratamientos (defoliación al 50% y control y cuatrorepeticiones de 35 plantas cada una, se determinó el contenido y la fluorescencia de la clorofila en plantas de uva, sometidas a defoliación parcial

  13. Characterization of Vitis vinifera NPR1 homologs involved in the regulation of Pathogenesis-Related gene expression

    Directory of Open Access Journals (Sweden)

    Walter Bernard

    2009-05-01

    Full Text Available Abstract Background Grapevine protection against diseases needs alternative strategies to the use of phytochemicals, implying a thorough knowledge of innate defense mechanisms. However, signalling pathways and regulatory elements leading to induction of defense responses have yet to be characterized in this species. In order to study defense response signalling to pathogens in Vitis vinifera, we took advantage of its recently completed genome sequence to characterize two putative orthologs of NPR1, a key player in salicylic acid (SA-mediated resistance to biotrophic pathogens in Arabidopsis thaliana. Results Two cDNAs named VvNPR1.1 and VvNPR1.2 were isolated from Vitis vinifera cv Chardonnay, encoding proteins showing 55% and 40% identity to Arabidopsis NPR1 respectively. Constitutive expression of VvNPR1.1 and VvNPR1.2 monitored in leaves of V. vinifera cv Chardonnay was found to be enhanced by treatment with benzothiadiazole, a SA analog. In contrast, VvNPR1.1 and VvNPR1.2 transcript levels were not affected during infection of resistant Vitis riparia or susceptible V. vinifera with Plasmopara viticola, the causal agent of downy mildew, suggesting regulation of VvNPR1 activity at the protein level. VvNPR1.1-GFP and VvNPR1.2-GFP fusion proteins were transiently expressed by agroinfiltration in Nicotiana benthamiana leaves, where they localized predominantly to the nucleus. In this system, VvNPR1.1 and VvNPR1.2 expression was sufficient to trigger the accumulation of acidic SA-dependent Pathogenesis-Related proteins PR1 and PR2, but not of basic chitinases (PR3 in the absence of pathogen infection. Interestingly, when VvNPR1.1 or AtNPR1 were transiently overexpressed in Vitis vinifera leaves, the induction of grapevine PR1 was significantly enhanced in response to P. viticola. Conclusion In conclusion, our data identified grapevine homologs of NPR1, and their functional analysis showed that VvNPR1.1 and VvNPR1.2 likely control the expression of

  14. Adaptogenic and nootropic activities of aqueous extract of Vitis vinifera (grape seed: an experimental study in rat model

    Directory of Open Access Journals (Sweden)

    Koppula Sushruta

    2005-01-01

    Full Text Available Abstract Background The aerial parts of Vitis vinifera (common grape or European grape have been widely used in Ayurveda to treat a variety of common and stress related disorders. In the present investigation, the seed extract of V. vinifera was evaluated for antistress activity in normal and stress induced rats. Furthermore, the extract was studied for nootropic activity in rats and in-vitro antioxidant potential to correlate its antistress activity. Methods For the evaluation of antistress activity, groups of rats (n = 6 were subjected to forced swim stress one hour after daily treatment of V. vinifera extract. Urinary vanillylmandelic acid (VMA and ascorbic acid were selected as non-invasive biomarkers to assess the antistress activity. The 24 h urinary excretion of vanillylmandelic acid (VMA and ascorbic acid were determined by spectrophotometric methods in all groups under normal and stressed conditions. The nootropic activity of the extract as determined from acquisition, retention and retrieval in rats was studied by conditioned avoidance response using Cook's pole climbing apparatus. The in vitro antioxidant activity was determined based on the ability of V. vinifera to scavenge hydroxyl radicals. Results Daily administration of V. vinifera at doses of 100, 200 and 300 mg/kg body weight one hour prior to induction of stress inhibited the stress induced urinary biochemical changes in a dose dependent manner. However, no change in the urinary excretion of VMA and ascorbic acid was observed in normal animals at all the doses studied. The cognition, as determined by the acquisition, retention and recovery in rats was observed to be dose dependent. The extract also produced significant inhibition of hydroxyl radicals in comparison to ascorbic acid in a dose dependent manner. Conclusion The present study provides scientific support for the antistress (adaptogenic, antioxidant and nootropic activities of V. vinifera seed extract and

  15. Vitis vinifera canes, a new source of antifungal compounds against Plasmopara viticola, Erysiphe necator, and Botrytis cinerea.

    Science.gov (United States)

    Schnee, Sylvain; Queiroz, Emerson F; Voinesco, Francine; Marcourt, Laurence; Dubuis, Pierre-Henri; Wolfender, Jean-Luc; Gindro, Katia

    2013-06-12

    Methanolic and ethanolic crude extracts of Vitis vinifera canes exhibited significant antifungal activity against the three major fungal pathogens affecting grapevines, Plasmopara viticola, Erysiphe necator and Botrytis cinerea. The active extracts were analyzed by LC-PDA-ESI-MS, and selected compounds were identified. Efficient targeted isolation using medium-pressure liquid chromatography afforded six pure constituents in one step. The structures of the isolated compounds were elucidated by NMR and HRMS. Six identified compounds (ampelopsin A, hopeaphenol, trans-resveratrol, ampelopsin H, ε-viniferin, and E-vitisin B) presented antifungal activities against P. viticola. ε-Viniferin also exhibited a low antifungal activity against B. cinerea. None of the identified compounds inhibited the germination of E. necator. The potential to develop a novel natural fungicide against the three major fungal pathogens affecting V. vinifera from viticulture waste material is discussed. PMID:23730921

  16. Molecular cloning and characterization of UDP-glucose: furaneol glucosyltransferase gene from grapevine cultivar Muscat Bailey A (Vitis labrusca × V. vinifera).

    Science.gov (United States)

    Sasaki, Kanako; Takase, Hideki; Kobayashi, Hironori; Matsuo, Hironori; Takata, Ryoji

    2015-10-01

    2,5-Dimethyl-4-hydroxy-3(2H)-furanone (furaneol) is an important aroma compound in fruits, such as pineapple and strawberry, and is reported to contribute to the strawberry-like note in some wines. Several grapevine species are used in winemaking, and furaneol is one of the characteristic aroma compounds in wines made from American grape (Vitis labrusca) and its hybrid grape. Furaneol glucoside was recently isolated as an important furaneol derivative from the hybrid grapevine cultivar, Muscat Bailey A (V. labrusca × V. vinifera), and this was followed by its isolation from some fruits such as strawberry and tomato. Furaneol glucoside is a significant 'aroma precursor of wine' because furaneol is liberated from it during alcoholic fermentation. In this study, a glucosyltransferase gene from Muscat Bailey A (UGT85K14), which is responsible for the glucosylation of furaneol was identified. UGT85K14 was expressed in the representative grape cultivars regardless of species, indicating that furaneol glucoside content is regulated by the biosynthesis of furaneol. On the other hand, furaneol glucoside content in Muscat Bailey A berry during maturation might be controlled by the expression of UGT85K14 along with the biosynthesis of furaneol. Recombinant UGT85K14 expressed in Escherichia coli is able to transfer a glucose moiety from UDP-glucose to the hydroxy group of furaneol, indicating that this gene might be UDP-glucose: furaneol glucosyltransferase in Muscat Bailey A. PMID:26160581

  17. Genetic analysis and QTL mapping for fruit skin anthocyanidin in grape (vitis vinifera)

    International Nuclear Information System (INIS)

    In this study, an F1 population was created by the cross 87-1*9-22. The female parent 87-1 was a black purple cultivar and the male parent was an excellent breeding line with green pericarp. the skin color separation of population and distribution, and determined the content of each individual fruit peel pigment. On the basis of the genetic map of Vitis vinifera L. We carried out the grape skin pigment content quantitative trait locus (QTL) analyses. The results show that the fruit color performance for continuous variation and the inheritance of fruit skin anthocyanidin content was a quantitative inheritance. The color of offspring ranges from green and black-blue and existing distribution. Using SSR and SRAP molecular markers to construct 188 female parent maps,175 male parent maps and 251 consensus maps, and the total map distance is 1047.5 cM,1100.2 cM and 1264.2 cM respectively. The result of QTL showed that there were more QTLs exist in the linkage group of 1, 2, 3, 4, 9, 13, 14, 16 and 19 and in the linkage group of 3, 4, 13 and 14, we detected QTLs in the similar position with the result of the study in the year of 2011 and 2012, and based on this we will conduct the fine QTL location in the future, this result will lay a good foundation for the grape in the department of molecular assistant breeding in the future. (author)

  18. The combined effect of deuterium depleted water and magnetic nano particles on Vitis vinifera (L) organogenesis

    International Nuclear Information System (INIS)

    Full text: The combined effect of Deuterium Depleted Water (DDW) associated with Magnetic Nano Particles (MNPs) on organogenesis evolution of the Vitis vinifera (L) was investigated. A total of 10 cuttings of first year shoots belonging to three varieties were put into liquid medium (500 cm3 / jar) in three experimental groups and one control (C) each in four replications. The experiment was one year long being divided in two parts, laboratory and greenhouse conditions respectively. During the laboratory experiment, no nutrients were added in experimental solutions. The number of roots, sprouts and leafs were determined periodically. The capacity to perform organogenesis depended on genotype. Each of them pointed out a particular behaviour. In lab conditions the shoot number significantly differs in each variety/liquid composition (P≤0.001). In greenhouse condition on Burgund variety the shoot growth was very fast. In 90 pottings the shoots length varied from 7.36±1.88 to 14.39±4.53 cm in DDW and Negative Control (NC). The number of leafs after 3 months varied from 3.75±0.41 to 7.59±0.45 on Silvania NC and Socodor TW and MNPs respectively. The largest leaves area was 20.32±0.04 cm2 on Burgund variety in DDW conditions. The DDW and MNPs repressed the organogenesis on Silvania and Burgund varieties. The association DDW and MNPs enhanced the leaves area. Generally, the single action of DDW enhanced the plantlet traits and improved the chlorophyll content. The single action of DDW or in association with MNPs had a favourable influence in organogenesis, growth and synthesis of chlorophyll involved in metabolic activity. The deuterium amount decreased in leave juice if the plantlets grew in DDW presence. (authors)

  19. A candidate gene association study on muscat flavor in grapevine (Vitis vinifera L.

    Directory of Open Access Journals (Sweden)

    Boursiquot Jean-Michel

    2010-11-01

    Full Text Available Abstract Background The sweet, floral flavor typical of Muscat varieties (Muscats, due to high levels of monoterpenoids (geraniol, linalool and nerol, is highly distinct and has been greatly appreciated both in table grapes and in wine since ancient times. Muscat flavor determination in grape (Vitis vinifera L. has up to now been studied by evaluating monoterpenoid levels through QTL analysis. These studies have revealed co-localization of 1-deoxy-D-xylulose 5-phosphate synthase (VvDXS with the major QTL positioned on chromosome 5. Results We resequenced VvDXS in an ad hoc association population of 148 grape varieties, which included muscat-flavored, aromatic and neutral accessions as well as muscat-like aromatic mutants and non-aromatic offsprings of Muscats. Gene nucleotide diversity and intragenic linkage disequilibrium (LD were evaluated. Structured association analysis revealed three SNPs in moderate LD to be significantly associated with muscat-flavored varieties. We identified a putative causal SNP responsible for a predicted non-neutral substitution and we discuss its possible implications for flavor metabolism. Network analysis revealed a major star-shaped cluster of reconstructed haplotypes unique to muscat-flavored varieties. Moreover, muscat-like aromatic mutants displayed unique non-synonymous mutations near the mutated site of Muscat genotypes. Conclusions This study is a crucial step forward in understanding the genetic regulation of muscat flavor in grapevine and it also sheds light on the domestication history of Muscats. VvDXS appears to be a possible human-selected locus in grapevine domestication and post-domestication. The putative causal SNP identified in Muscat varieties as well as the unique mutations identifying the muscat-like aromatic mutants under study may be immediately applied in marker-assisted breeding programs aimed at enhancing fragrance and aroma complexity respectively in table grape and wine cultivars.

  20. Profiling monoterpenol glycoconjugation in Vitis vinifera L. cv. Muscat of Alexandria using a novel putative compound database approach, high resolution mass spectrometry and collision induced dissociation fragmentation analysis.

    Science.gov (United States)

    Hjelmeland, Anna K; Zweigenbaum, Jerry; Ebeler, Susan E

    2015-08-01

    In this work we present a novel approach for the identification of plant metabolites using ultrahigh performance liquid chromatography coupled to accurate mass time-of-flight mass spectrometry. The workflow involves developing an in-house compound database consisting of exact masses of previously identified as well as putative compounds. The database is used to screen accurate mass spectrometry (MS) data to identify possible compound matches. Subsequent tandem MS data is acquired for possible matches and used for structural elucidation. The methodology is applied to profile monoterpene glycosides in Vitis vinifera cv. Muscat of Alexandria grape berries over three developmental stages. Monoterpenes are a subclass of terpenes, the largest class of plant secondary metabolites, and are found in two major forms in the plant, "bound" to one or more sugar moieties or "free" of said sugar moieties. In the free form, monoterpenes are noted for their fragrance and play important roles in plant defense and as attractants for pollinators. However, glycoconjugation renders these compounds odorless, and it is this form that the plant uses for monoterpene storage. In order to gain insight into monoterpene biochemistry and their fate in the plant an analysis of intact glycosides is essential. Eighteen monoterpene glycosides were identified including a monoterpene trisaccharide glycoside, which is tentatively identified here for this first time in any plant. Additionally, while previous studies have identified monoterpene malonylated glucosides in other grapevine tissue, we tentatively identify them for the first time in grape berries. This analytical approach can be readily applied to other plants and the workflow approach can also be used for other classes of compounds. This approach, in general, provides researchers with data to support the identification of putative compounds, which is especially useful when no standard is available. PMID:26320795

  1. A framework map from grapevine V3125 (Vitis vinifera 'Schiava grossa' x 'Riesling') x rootstock cultivar 'Börner' (Vitis riparia x Vitis cinerea) to localize genetic determinants of phylloxera root resistance.

    Science.gov (United States)

    Zhang, Junke; Hausmann, Ludger; Eibach, Rudolf; Welter, Leocir J; Töpfer, Reinhard; Zyprian, Eva M

    2009-10-01

    Grapevine rootstock cultivar 'Börner' is a hybrid of Vitis riparia and Vitis cinerea Arnold that shows high resistance to phylloxera (Daktulosphaira vitifoliae Fitch). To localize the determinants of phylloxera root resistance, the susceptible grapevine V3125 (Vitis vinifera 'Schiava grossa' x 'Riesling') was crossed to 'Börner'. Genetic framework maps were built from the progeny. 235 microsatellite markers were placed on the integrated parental map. They cover 1,155.98 cM on 19 linkage groups with an average marker distance of 4.8 cM. Phylloxera resistance was scored by counting nodosities after inoculation of the root system. Progeny plants were triplicated and experimentally infected in 2 years. A scan of the genetic maps indicated a quantitative trait locus on linkage group 13. This region was targeted by six microsatellite-type markers newly developed from the V. vinifera model genome sequence. Two of these appear closely linked to the trait, and can be useful for marker-assisted breeding. PMID:19626311

  2. VvMJE1 of the grapevine (Vitis vinifera) VvMES Methylesterase family encodes for Methyl Jasmonate Esterase and has a role in stress response

    Science.gov (United States)

    The known members of the plant methyl esterase (MES) family catalyze hydrolysis of a C-O ester linkage of methyl esters of several phytohormones including indole-3-acetic acid, salicylic acid, and jasmonic acid. The genome of grapevine (Vitis vinifera) was found to contain 15 MES genes, designated V...

  3. Modulation of protein phosphorylation, N-glycosylation and Lys-acetylation in grape (Vitis vinifera) mesocarp and exocarp owing to Lobesia botrana infection

    DEFF Research Database (Denmark)

    Melo-Braga, Marcella N; Verano-Braga, Thiago; León, Ileana R;

    2012-01-01

    Grapevine (Vitis vinifera) is an economically important fruit crop that is subject to many types of insect and pathogen attack. To better elucidate the plant response to Lobesia botrana pathogen infection, we initiated a global comparative proteomic study monitoring steady-state protein expressio...

  4. Temperature dependence of refractive index and of electrical impedance of grape seed (Vitis vinifera, Vitis labrusca oils extracted by Soxhlet and mechanical pressing

    Directory of Open Access Journals (Sweden)

    Vieira, D. S.

    2015-09-01

    Full Text Available In this report, the temperature dependence of the refractive index and electric impedance of vegetable oil grape seeds extracted from Vitis vinifera (v. Cabernet and Vitis labrusca (v. Bordo are investigated by means of experimental techniques. The seeds were collected from wineries located in two cities in the south of Brazil. In both extraction methods, the seeds were dried at 40.0 °C and at 80.0 °C, respectively, before the oil extraction. From optical microscopy and refractometry results, one can see that the grape seed oil extracted by mechanical pressing shows a linear dependence between the refractive index and temperature and has no birefringent residues. From the fitting of the EIS (Electrical Impedance Spectroscopy data, an equivalent electric circuit composed of a parallel RC in series with a resistor is proposed. The circuit model is in good agreement with the experimental data and provides the electrical permittivity of the vegetable oils investigated.Se investiga mediante técnicas experimentales la dependencia del índice de refracción y la impedancia eléctrica de aceites vegetales extraídos de semillas de uva Vitis vinifera (v. Cabernet y Vitis labrusca (v. Bordo. Las semillas fueron recolectadas de bodegas situadas en dos ciudades al sur de Brasil. Antes de la extracción del aceite, mediante dos métodos de extracción, las semillas fueron secadas a 40,0 °C y 80,0 °C. De los resultados de refractometria y microscopía óptica, se comprueba que el aceite de semilla de uva extraída por prensado mecánico obedece a una relación lineal del índice de refracción con la temperatura y no presentan resíduos birrefringentes. Con los datos de impedancia eléctrica, se propone un circuito eléctrico equivalente formado por una resistencia y un condensador en paralelo, a su vez ligado a otra resistencia en serie. El modelo de circuito tiene una alta correlación con los datos experimentales y permite obtener la constante diel

  5. Geochemical behaviour of rare earths in Vitis vinifera grafted onto different rootstocks and growing on several soils

    Energy Technology Data Exchange (ETDEWEB)

    Censi, P., E-mail: paolo.censi@unipa.it [DISTEM, University of Palermo, Via Archirafi, 22-90123 Palermo (Italy); Saiano, F.; Pisciotta, A. [SAF Department, University of Palermo, Viale delle Scienze, 13-90128 Palermo (Italy); Tuzzolino, N. [DISTEM, University of Palermo, Via Archirafi, 22-90123 Palermo (Italy)

    2014-03-01

    The geochemical behaviour of lanthanides and yttrium (Rare Earth Elements, REEs) has been investigated mainly in geological systems where these elements represent the best proxies of processes involving the occurrence of an interface between different media. This behaviour is assessed according to features recorded in sequences of REE concentrations along the REE series normalised with respect to a reference material. In this study, the geochemical behaviour of REE was investigated in different parts of Vitis vinifera specimens grown off-soil, on soils of different nature and grafted onto several rootstocks in order to evaluate effects induced by these changes. The results indicated that roots are the plant organs where REEs are preferentially concentrated, in particular elements from Sm to Ho (middle REE, MREE) whereas Eu enrichments occur in aerial parts. The geochemical behaviour of REE suggests that MREE enrichments in roots are due to preferential MREE interactions with biological membranes or to surface complexation with newly formed phosphates. Eu-positive anomalies suggest that Eu{sup 3+} can form stable organic complexes in place of Ca{sup 2+} in several biological processes in xylem fluids. The possibility that Eu mobility in these fluids can be enhanced by its reductive speciation as Eu{sup 2+} cannot be ruled out. The assessment of the geochemical behaviour of REE according to the theory of the Tetrad Effect carried out confirms that REEs coming from soil are scavenged onto root tissues or mineral surfaces whereas their behaviour in aerial parts of V. vinifera is driven by dissolved complexation. - Highlights: • REE behaviour is driven by scavenging onto authigenic solids or membranes in roots. • REE behaviour is driven by dissolved complexation in aerial plant parts. • Positive Eu anomalies are a consequence of the REE translocation by xylem fluids. • Significant REE tetrad effects are observed in Vitis vinifera plants.

  6. Transcriptomic analysis of grape (Vitis vinifera L. leaves during and after recovery from heat stress

    Directory of Open Access Journals (Sweden)

    Liu Guo-Tian

    2012-09-01

    Full Text Available Abstract Background Grapes are a major fruit crop around the world. Heat stress can significantly reduce grape yield and quality. Changes at the molecular level in response to heat stress and subsequent recovery are poorly understood. To elucidate the effect of heat stress and subsequent recovery on expression of genes by grape leaves representing the classic heat stress response and thermotolerance mechanisms, transcript abundance of grape (Vitis vinifera L. leaves was quantified using the Affymetrix Grape Genome oligonucleotide microarray (15,700 transcripts, followed by quantitative Real-Time PCR validation for some transcript profiles. Results We found that about 8% of the total probe sets were responsive to heat stress and/or to subsequent recovery in grape leaves. The heat stress and recovery responses were characterized by different transcriptional changes. The number of heat stress-regulated genes was almost twice the number of recovery-regulated genes. The responsive genes identified in this study belong to a large number of important traits and biological pathways, including cell rescue (i.e., antioxidant enzymes, protein fate (i.e., HSPs, primary and secondary metabolism, transcription factors, signal transduction, and development. We have identified some common genes and heat shock factors (HSFs that were modulated differentially by heat stress and recovery. Most HSP genes were upregulated by heat stress but were downregulated by the recovery. On the other hand, some specific HSP genes or HSFs were uniquely responsive to heat stress or recovery. Conclusion The effect of heat stress and recovery on grape appears to be associated with multiple processes and mechanisms including stress-related genes, transcription factors, and metabolism. Heat stress and recovery elicited common up- or downregulated genes as well as unique sets of responsive genes. Moreover, some genes were regulated in opposite directions by heat stress and recovery

  7. MINERAIS DE VITIS VINIFERA CULTIVADAS NA FRONTEIRA DO RIO GRANDE DO SUL

    Directory of Open Access Journals (Sweden)

    Neidi Garcia Penna

    1993-04-01

    Full Text Available Vitis vinifera Cabernet Sauvignon, Pinot Chardonnay e Sauvignon Blanc foram analizadas durante oito (8 anos, com o objetivo de quantificar Nitrogênio(N, Fósforo(P, Potássio (K, Cálcio (Ca, Magnésio (Mg, Ferro (Fe, Cobre (Cu, Sódio (Na, Manganês (Mn, Boro (Bo e Zinco(Zn nos pecíolos. As amostras peciolares foram secas numa estufa com circulação de ar a aproximadamente 70°C e moídas. Nitrogênio foi determinado pelo método microkjeldahl, Fósforo por colorimetria, Potássio e Sódio por emissão de chama, Cálcio, Magnésio, Ferro, Cobre, Manganês e Zinco por espectrometria de absorção atômica e Boro por colorimetria usando curcumina como derivatizante. Valores médios dos oito (8 anos encontrados na matéria seca (MS foram para Cabernet Sauvignon (g/100g: 1,59N, 0,76P, 3,28K, 0,93Ca, 0,28Mg e em mg/100g: 11,52Fe, 4,18Cu, 85,08Na, 70,17Mn, 2.07B e 13,97Zn; para Pinot Chardonnay (g/100g: 1,26N, 0,47P, 3,20K, 0,82Ca, 0,31 Mg e em mg/100g: 15,25Fe, 3,25Cu, 63,73Na, 42,91Mn, 2,08B e 11,13Zn; para Sauvignon Blanc (g/100g: 1,51 N, 0,49P, 2.29K, 0,79Ca, 0,32Mg e em mg/100g: 16,01 Fe, 5,91 Cu, 76,02Na, 70,61 Mn, 1,91 B e 11,9Zn.

  8. Effect of Three Training Systems on Grapes in a Wet Region of China: Yield, Incidence of Disease and Anthocyanin Compositions of Vitis vinifera cv. Cabernet Sauvignon

    Directory of Open Access Journals (Sweden)

    Mei-Ying Liu

    2015-10-01

    Full Text Available Grapevine training systems determine the suitability for grape varieties in a specific growing region. We evaluated the influence of three training systems, Single Guyot (SG, Spur-pruned Vertical Shoot-Positioned (VSP, and Four-Arm Kniffin (4AK, on the performance of grapes and vines of Vitis vinifera L. cv. Cabernet Sauvignon in the 2012 and 2013 growing seasons in a wet region of central China. 4AK was the most productive system in comparison to SG and VSP. SG and VSP had lower disease infections of leaves and berries, especially in the mid- and final stage of berry ripening. Three training systems had no impact on berry maturity. PLS-DA (Partial Least Squares-Discriminant analysis showed that the relatively dry vintage could well discriminate three training systems, but the wet vintage was not. A wet vintage of 2013 had more accumulation of 3′5′-substituted and acylated anthocyanins, including malvidin-3-O-(6-O-acetyl-glucoside, malvidin-3-O-glucoside, and petunidin-3-O-(cis-6-O-coumaryl-glucoside, etc. With regard to the effect of training systems, 4AK grapes had the lowest concentrations of total anthocyanins and individual anthocyanins, SG and VSP differed according to the different vintages, and showed highest concentration of total individual anthocyanins in 2012 and 2013, respectively. Generally, VSP benefited the most, contributing to significantly highest levels of total individual anthocyanins, and major anthocyanin, including malvidin-3-O-glucoside and malvidin-3-O-(6-O-acetyl-glucoside, and the grapes obtained from VSP presented significantly highest proportion of 3′5′-substituted anthocyanins. With regard to the ratios of 3′5′/3′-substituted, methoxylated/non-methoxylated and acylated/non-acylated anthocyanins, the significantly higher levels were also shown in VSP system. In summary, VSP was the best training system for Cabernet Sauvignon to accumulate relatively stable individual anthocyanins in this wet region of

  9. Evaluation of Protein Extraction Methods for Vitis vinifera Leaf and Root Proteome Analysis by Two-Dimensional Electrophoresis

    Institute of Scientific and Technical Information of China (English)

    Neila Jellouli; Asma Ben Salem; Abdelwahed Ghorbel; Hatem Ben Jouira

    2010-01-01

    An efficient protein extraction method is crucial to ensure successful separation by two-dimensional electrophoresis(2-DE)for recalcitrant plant species, in particular for grapevine(Vitis vinifera L.). Trichloroacetic acid-acetone(TCA-acetone)and phenol extraction methods were evaluated for proteome analysis of leaves and roots from the Tunisian cultivar 'Razegui'. The phenol-based protocol proved to give a higher protein yield,a greater spot resolution, and a minimal streaking on 2-DE gels for both leaf and root tissues compared with the TCA-based protocol. Furthermore, the highest numbers of detected proteins on 2-DE gels were observed using the phenol extraction from leaves and roots as compared with TCA-acetone extraction.

  10. Caracterización de los recursos fitogenéticos de vid \\(Vitis Vinifera L.\\) del Principado de Asturias

    OpenAIRE

    Moreno Sanz, Paula

    2011-01-01

    El cultivo de la vid (Vitis vinifera L.) en Asturias está documentado desde el siglo IX. A mediados del siglo XIX, alcanzó una superficie de 5.493 ha, pero la plaga filoxérica sufrida a finales de ese mismo siglo, junto con el desarrollo de la minería a mediados del siglo XX y la migración de la población rural a las ciudades, redujeron dicha extensión a las cerca de 100 ha actuales, la mayoría de ellas localizadas en el concejo de Cangas del Narcea. En los últimos años se está intentando rec...

  11. Effects of Maceration Duration on the Phenolic Composition and Antioxidant Capacity of ‘Teran’ (Vitis vinifera L. Wine

    Directory of Open Access Journals (Sweden)

    Kristijan Damijanić

    2012-06-01

    Full Text Available Effects of maceration duration on the phenolic composition and antioxidant capacity in red grapevine variety ‘Teran’ (Vitis vinifera L. was investigated in this study. Total phenolics, flavonoids, nonflavonoids, individual and total anthocyanins, vanillin index and antioxidant capacity measured by DPPH, ABST and FRAP methods were determined in ‘Teran’ wines during five different skin maceration periods (3, 7, 12, 17 and 21 days. Th e highest increase in the concentration of the most phenolic compounds and antioxidant capacity was obtained between the 3rd and 7th day of maceration. Prolonging the maceration from 7 to 21 days did not lead to significantly higher concentrations of total phenolics, flavonoids, nonflavonoids, total anthocyanins and antioxidant capacity measured with ABTS and FRAP methods. It is concluded that maceration duration of seven days is the most appropriate in order to obtain high concentrations of total phenolics and anthocyanins and high antioxidant capacity of ‘Teran’ wines.

  12. Local tissue destruction and procoagulation properties of Echis carinatus venom: inhibition by Vitis vinifera seed methanol extract.

    Science.gov (United States)

    Mahadeswaraswamy, Y H; Nagaraju, S; Girish, K S; Kemparaju, K

    2008-07-01

    Plant extracts are extensively used against snakebites in Indian folk medicine. In this study, one such traditionally used plant, Vitis vinifera L. (Vitaceae) seed methanol extract has been studied for its ability to neutralize Indian Echis carinatus (saw-scaled viper) venom. The extract effectively inhibited toxic effects, such as oedema, haemorrhage, myonecrosis and coagulation of citrated human plasma. Further, the extract inhibited the caseinolytic, hyaluronolytic and fibrinogenolytic activities of the venom. The extract caused dose dependent inhibition of the toxic activities studied, suggesting venom inhibition. Thus, the anti-snake venom property of the extract appears to be highly promising for further investigation in order to achieve better neutralization of Indian E. carinatus venom poisoning. PMID:18567054

  13. Anti-oxidant properties and polyphenolic profile screening of Vitis vinifera stems and leaves crude extracts grown in Perlis, Malaysia

    Science.gov (United States)

    Zakaria, Nursyahda; Zulkifli, Razauden Mohamed; Akhir, Fazrena Nadia Md; Basar, Norazah

    2014-03-01

    Grape has become a fast growing agricultural sector in Malaysia producing between 0.62 kg to 2.03 kg waste per vinestock. This study aims to generate useful information on anti-oxidative properties as well as polyphenolic composition of grapevine waste. Stems and leaves of Vitis vinifera cultivated in Perlis, Malaysia were extracted using methanol, ethyl acetate and petroleum ether. Ethyl acetate stems extract exhibited highest total phenolic content. While in DPPH assay, methanolic stems extract show the highest antioxidant activities. This result indicates that total phenolic content in the extracts may not contribute directly to the antioxidant activities. Thin Layer Chromatograms of all crude extracts exhibited good separation under solvent system petroleum ether-ethyl acetate (2:3) resulted in detection of resveratrol in ethyl acetate stems crude extract.

  14. Developmental and metabolic plasticity of white-skinned grape berries in response to botrytis cinerea during noble rot

    OpenAIRE

    Blanco-Ulate, B; Amrine, KCH; Collins, TS; Rivero, RM; Vicente, AR; Morales-Cruz, A; Doyle, CL; Ye, Z.; Allen, G.; Heymann, H; Ebeler, SE; Cantu, D.

    2015-01-01

    © 2015 American Society of Plant Biologists. All rights reserved. Noble rot results from exceptional infections of ripe grape (Vitis vinifera) berries by Botrytis cinerea. Unlike bunch rot, noble rot promotes favorable changes in grape berries and the accumulation of secondary metabolites that enhance wine grape composition. Noble rot-infected berries of cv Sémillon, a white-skinned variety, were collected over 3 years from a commercial vineyard at the same time that fruit were harvested for ...

  15. Effects of climate variability on irrigation scheduling in white varieties of Vitis vinifera of NW Spain

    Science.gov (United States)

    Martínez, Emma M.; Trigo-Córdoba, Emiliano; Bouzas-Cid, Yolanda; Fandiño, María; Rey, Benjamín J.; Mirás-Avalos, Jose M.; Cancela, Javier J.

    2014-05-01

    Inter-annual climate variability, in particular the temporal distribution of rainfall is regarded as a critical factor to obtain an optimal irrigation management on crops, being more marked their relevance in Atlantic climates. The presence of precision irrigation systems in Vitis vinifera (L.) has created the need to understand the physiological effects on plant, and vineyard soils, together with production and quality parameters, to achieve and adequate irrigation management. This trial was performed on two relevant white grapevine varieties from Galicia (NW-Spain), cv. `Albariño` (D.O. Rías Baixas and Ribeiro) and cv. `Godello` (D.O. Valdeorras and D.O. Monterrei) during the 2012 and 2013 seasons. Two treatments were established following a completely randomized block design with four replications (7 plants each). The treatments were rainfed (R) and surface drip irrigation (DI), these last one was not applied in DO Monterrei during 2012. Irrigation was initiated when an average value of 400 cumulative degree days was reached, ending 15 days before the harvest. Different bioclimatic indices were calculated to characterize each season and location: Cool night index (CI); Heliothermal index (HI), which corresponds to Huglin's heliothermal index; and Winkler index. To assess the water status of the vines leaf (Ψmid) and stem (Ψstem) water potentials were measured at noon. Finally, production and qualitative data were collected for each treatment. No differences between DOs were observed for 'Godello' cultivar in bioclimatic indices within the Geoviticulture MCC system (Tonietto and Carboneau, 2004), indicating temperate warm-temperate (HI) and very cool nights (CI). For the Winkler index, cv. Godello is within the region I, near the region II in the case of D.O. Valdeorras in both years. In the case of 'Albariño', warmer nights were observed in DO Rías Baixas compared with DO Ribeiro, whereas the opposite was found for the thermal index. Leaf water potential

  16. Terpene evolution during the development of Vitis vinifera L. cv. Shiraz grapes

    OpenAIRE

    Zhang, Pangzhen; Fuentes, Sigfredo; Siebert, Tracey; Krstic, Mark; Herderich, Markus; Edward William R Barlow

    2016-01-01

    The flavour of wine is derived, in part, from the flavour compounds present in the grape, which change as the grapes accumulate sugar and ripen. Grape berry terpene concentrations may vary at different stages of berry development. This study aimed to investigate terpene evolution in grape berries from four weeks post-flowering to maturity. Grape bunches were sampled at fortnightly intervals over two vintages (2012-13 and 2013-14). In total, five monoterpenoids, 24 sesquiterpenes, and four nor...

  17. Reference gene selection and validation for the early responses to downy mildew infection in susceptible and resistant Vitis vinifera cultivars.

    Science.gov (United States)

    Monteiro, Filipa; Sebastiana, Mónica; Pais, Maria Salomé; Figueiredo, Andreia

    2013-01-01

    The pivotal role of cultivated grapevine (Vitis vinifera L.) in many countries economy is compromised by its high susceptibility to Plasmopara viticola, the causal agent of downy mildew disease. Recent research has identified a set of genes related to resistance which may be used to track downy mildew infection. Quantification of the expression of these resistance genes requires normalizing qPCR data using reference genes with stable expression in the system studied. In this study, a set of eleven genes (VATP16, 60 S, UQCC, SMD3, EF1α, UBQ, SAND, GAPDH, ACT, PsaB, PTB2) was evaluated to identify reference genes during the first hours of interaction (6, 12, 18 and 24 hpi) between two V. vinifera genotypes and P. viticola. Two analyses were used for the selection of reference genes: direct comparison of susceptible, Trincadeira, and resistant, Regent, V. vinifera cultivars at 0 h, 6, 12, 18 and 24 hours post inoculation with P. viticola (genotype effect); and comparison of each genotype with mock inoculated samples during inoculation time-course (biotic stress effect). Three statistical methods were used, GeNorm, NormFinder, and BestKeeper, allowing to identify UBQ, EF1α and GAPDH as the most stable genes for the genotype effect. For the biotic stress effect, EF1α, SAND and SMD3 were the most constant for the susceptible cultivar Trincadeira and EF1α, GAPDH, UBQ for the resistant cultivar Regent. In addition, the expression of three defense-related transcripts, encoding for subtilisin-like protein, CYP and PR10, was analysed, for both datasets, during inoculation time-course. Taken together, our results provide guidelines for reference gene(s) selection towards a more accurate and widespread use of qPCR to study the first hours of interaction between different grapevine cultivars and P. viticola. PMID:24023800

  18. Effects of elevated CO2 on grapevine (Vitis vinifera L.): volatile composition, phenolic content, and in vitro antioxidant activity of red wine.

    Science.gov (United States)

    Gonçalves, Berta; Falco, Virgílio; Moutinho-Pereira, José; Bacelar, Eunice; Peixoto, Francisco; Correia, Carlos

    2009-01-14

    The impact of elevated carbon dioxide concentration ([CO2]) on the quality of berries, must, and red wine (with special reference to volatile composition, phenolic content, and antioxidant activity) made from Touriga Franca, a native grape variety of Vitis vinifera L. for Port and Douro wine manufacturing grown in the Demarcated Region of Douro, was investigated during 2005 and 2006. Grapevines were grown either in open-top chambers (OTC) with ambient (365 +/- 10 ppm) or elevated (500 +/-16 ppm) [CO2] or in an outside plot. In general, the increase of [CO2] did not affect berry characteristics, especially the total anthocyan and tannin concentrations. However, the total anthocyan and polyphenol concentrations of the red wine were inhibited under elevated [CO2]. The antioxidant capacity of the wines was determined by DPPH, ABTS, and TBARS assays and, despite the low concentrations of phenolics, the elevated [CO2] did not significantly change the total antioxidant capacity of the red wines. Thirty-five volatile compounds belonging to seven chemical groups were identified: C6 alcohols, higher alcohols, esters, terpenols, carbonyl compounds, acids, volatile phenols, and C13 norisoprenoids. Generally, the same volatile compounds were present in all of the wines, but the relative levels varied among the treatments. The effect of elevated [CO2] was significant because it was detected as an increase in ethyl 2-methylbutyrate, isoamyl acetate, ethyl hexanoate, ethyl octanoate, butyric acid, and isovaleric acid concentrations and a decrease in ethyl acetate concentration when compared to wines produced in ambient [CO2] in 2005. In elevated [CO2], wines from 2006 had lower methionol, 1-octanol, and 4-ethylguaiacol and higher ethyl lactate and linalool concentrations. The increase in [CO2] did not significantly affect C6 alcohols, citronellol, carbonyl compounds, and beta-damascenone concentrations. This study showed that the predicted rise in [CO2] did not produce negative

  19. Purification, molecular cloning, and characterization of glutathione S-transferases (GSTs) from pigmented Vitis vinifera L. cell suspension cultures as putative anthocyanin transport proteins

    OpenAIRE

    Conn, Simon; Curtin, Chris; Bézier, Annie; Franco, Chris; Zhang, Wei

    2008-01-01

    The ligandin activity of specific glutathione S-transferases (GSTs) is necessary for the transport of anthocyanins from the cytosol to the plant vacuole. Five GSTs were purified from Vitis vinifera L. cv. Gamay Fréaux cell suspension cultures by glutathione affinity chromatography. These proteins underwent Edman sequencing and mass spectrometry fingerprinting, with the resultant fragments aligned with predicted GSTs within public databases. The corresponding coding sequences were cloned, with...

  20. The Novel Gene VpPR4-1 from Vitis pseudoreticulata Increases Powdery Mildew Resistance in Transgenic Vitis vinifera L.

    Science.gov (United States)

    Dai, Lingmin; Wang, Dan; Xie, Xiaoqing; Zhang, Chaohong; Wang, Xiping; Xu, Yan; Wang, Yuejin; Zhang, Jianxia

    2016-01-01

    Pathogenesis-related proteins (PRs) can lead to increased resistance of the whole plant to pathogen attack. Here, we isolate and characterize a PR-4 protein (VpPR4-1) from a wild Chinese grape Vitis pseudoreticulata which shows greatly elevated transcription following powdery mildew infection. Its expression profiles under a number of abiotic stresses were also investigated. Powdery mildew, salicylic acid, and jasmonic acid methyl ester significantly increased the VpPR4-1 induction while NaCl and heat treatments just slightly induced VpPR4-1 expression. Abscisic acid and cold treatment slightly affected the expression level of VpPR4-1. The VpPR4-1 gene was overexpressed in 30 regenerated V. vinifera cv. Red Globe via Agrobacterium tumefaciens-mediated transformation and verified by the Western blot. The 26 transgenic grapevines exhibited higher expression levels of PR-4 protein content than wild-type vines and six of them were inoculated with powdery mildew which showed that the growth of powdery mildew was repressed. The powdery mildew-resistance of Red Globe transformed with VpPR4-1 was enhanced inoculated with powdery mildew. Moreover, other powdery mildew resistant genes were associated with feedback regulation since VpPR4-1 is in abundance. This study demonstrates that PR-4 protein in grapes plays a vital role in defense against powdery mildew invasion. PMID:27303413

  1. Flame seedless grape variety (Vitis vinifera L.) and different concentration of gibberellic acid (GA3)

    OpenAIRE

    Dimovska, Violeta; Ivanova, Violeta; Salamovska, Ana; Ilieva, Fidanka

    2014-01-01

    Solutions of gibberellic acid prepared at three concentration levels including 5, 10 and 20 mg/L, were applied on Flame seedless grape variety, by spraying, during the three different periods of the vine growing: before blooming, after blooming and before veraison, in order to study their influence on some cultural technological characteristics. The dimension and shape of the cluster and berry, mechanical characteristics of the berries, chemical content of the must (sugar and total acids) ...

  2. Dynamics and Reversibility of the DNA Methylation Landscape of Grapevine Plants (Vitis vinifera Stressed by In Vitro Cultivation and Thermotherapy.

    Directory of Open Access Journals (Sweden)

    Miroslav Baránek

    Full Text Available There is relatively little information concerning long-term alterations in DNA methylation following exposure of plants to environmental stress. As little is known about the ratio of non-heritable changes in DNA methylation and mitotically-inherited methylation changes, dynamics and reversibility of the DNA methylation states were investigated in grapevine plants (Vitis vinifera stressed by in vitro cultivation. It was observed that significant part of induced epigenetic changes could be repeatedly established by exposure to particular planting and stress conditions. However, once stress conditions were discontinued, many methylation changes gradually reverted and plants returned to epigenetic states similar to those of maternal plants. In fact, in the period of one to three years after in vitro cultivation it was difficult to distinguish the epigenetic states of somaclones and maternal plants. Forty percent of the observed epigenetic changes disappeared within a year subsequent to termination of stress conditions ending and these probably reflect changes caused by transient and reversible stress-responsive acclimation mechanisms. However, sixty percent of DNA methylation diversity remained after 1 year and probably represents mitotically-inherited epimutations. Sequencing of regions remaining variable between maternal and regenerant plants revealed that 29.3% of sequences corresponded to non-coding regions of grapevine genome. Eight sequences (19.5% corresponded to previously identified genes and the remaining ones (51.2% were annotated as "hypothetical proteins" based on their similarity to genes described in other species, including genes likely to undergo methylation changes following exposure to stress (V. vinifera gypsy-type retrotransposon Gret1, auxin-responsive transcription factor 6-like, SAM-dependent carboxyl methyltransferase.

  3. Impact of irrigation regime on berry development and flavonoids composition in Aragonez (Syn. Tempranillo) grapevine

    OpenAIRE

    Zarrouk, Olfa; Francisco, Rita; Pinto-Marijuan, Marta; Brossa, Ricardo; Santos, Raquen Raissa; Pinheiro, Carla; Costa, Joaquim M.; Lopes, Carlos M.; Chaves, M. M.

    2012-01-01

    In the present study, field grown Aragonez (Syn. Tempranillo) grapevines (Vitis vinifera L.) were subjected to three irrigation regimes (conventional sustained deficit irrigation (DI), regulated deficit irrigation (RDI) and non-irrigated (NI)) during two successive seasons (2007–2008). An integrative study was performed in grape berry skin tissues at four phenological stages of grape berry (pea size, véraison, mid-ripening and full maturation). The accumulation of flavonoid compou...

  4. Terpene evolution during the development of Vitis vinifera L. cv. Shiraz grapes.

    Science.gov (United States)

    Zhang, Pangzhen; Fuentes, Sigfredo; Siebert, Tracey; Krstic, Mark; Herderich, Markus; Barlow, Edward William R; Howell, Kate

    2016-08-01

    The flavour of wine is derived, in part, from the flavour compounds present in the grape, which change as the grapes accumulate sugar and ripen. Grape berry terpene concentrations may vary at different stages of berry development. This study aimed to investigate terpene evolution in grape berries from four weeks post-flowering to maturity. Grape bunches were sampled at fortnightly intervals over two vintages (2012-13 and 2013-14). In total, five monoterpenoids, 24 sesquiterpenes, and four norisoprenoids were detected in grape samples. The highest concentrations of total monoterpenoids, total sesquiterpenes, and total norisoprenoids in grapes were all observed at pre-veraison. Terpenes derived from the same biosynthetic pathway had a similar production pattern during berry development. Terpenes in grapes at harvest might not necessarily be synthesised at post-veraison, since the compounds or their precursors may already exist in grapes at pre-veraison, with the veraison to harvest period functioning to convert these precursors into final products. PMID:26988525

  5. Effect of γ-radiation on the production of aflatoxin B1 by Aspergillus parasiticus in raisins (Vitis vinifera L.)

    International Nuclear Information System (INIS)

    Aflatoxin B1 (AFB1) mostly produced by Aspergillus flavus and Aspergillus parasiticus, is an extremely toxic and carcinogenic metabolite. The effect of gamma irradiation at dose of 10 kGy on the production of aflatoxin B1 (AFB1) inoculated by Aspergillus parasiticus in raisins (Vitis vinifera L.) and on AFB1 in contaminated samples, was investigated. Values of the amount of aflatoxin B1 produced on the 12th day of incubation, after irradiation, showed that gamma radiation exposure at 10 kGy decreased AFB1 production at 65% compared with the non-irradiated sample, on the same day. The application of 10 kGy gamma radiation directly on 100 ng of AFB1 which were spiked in raisins resulted in ∼29% reduction of AFB1. According to the risk assessment analysis the Provisional Maximum Tolerable Daily Intake (PMTDI) of 1.0 ng AFB1 kg−1bw, indicates that consumers are less exposed to AFB1 from the irradiated raisins. - Highlights: • Aflatoxin B1 (AFB1) is an extremely toxic and carcinogenic metabolite. • AFB1 is produced in raisins. • Irradiation at the dose of 10 kGy affects AFB1 production. • 10 kGy reduced (∼65%) AFB1 production by A.parasiticus in raisins. • 10 kGy reduced (∼29%) AFB1 spiked directly in raisins

  6. Leaf blade and petiole nutritional evolution and variability throughout the crop season for Vitis vinifera L. cv. Graciano

    Directory of Open Access Journals (Sweden)

    Natalia Dominguez

    2015-09-01

    Full Text Available An adequate nutritional state of a crop can be kept by means of a well-designed fertilization plan based on the assessment of the nutrient availability throughout the growing season. The objective of this study was to determine the reliability of leaf blade and petiole diagnosis and the period of validity of their references at both flowering and veraison by means of systematic monitoring throughout the complete growing season. The study was carried out in two plots planted with Vitis vinifera L. cv. Graciano within the AOC Rioja (Spain. Blades and petioles were collected throughout a growing season (2006 and total N, P, K, Ca, Mg, Fe, Mn, Zn, Cu and B concentrations were analyzed in both tissues. Results suggest, in general, that petioles have higher variability and lower analysis reproducibility than blades. Therefore, blade could be a more appropriate tissue to evaluate N, P, K, Ca, and Mg at both flowering and veraison in this variety. Micronutrients in blade and petiole showed different variability behaviour in each of the vineyards studied, therefore, based on our results, it was difficult to determine which one could be the best tissue for the nutritional diagnosis of the ‘Graciano’ variety. Seasonal changes of nutrient concentration in both tissues also confirmed the need for reference values for each tissue and each phenological stage.

  7. Phenological behavior of the grapevine (vitis vinifera l., cv cabernet sauvignon in Sutamarchán - Boyacá.

    Directory of Open Access Journals (Sweden)

    Diana Carolina Vargas Herrera

    2013-12-01

    Full Text Available In tropical cold weather, the grapevine presents phenological disorders, difficult agronomic disfavoring vintage quality. With the purpose of establishing phenological cycles determined the duration of the different phases of the development cycle of the grapevine, cv "Cabernet Sauvignon" (Vitis vinifera L. in the vineyard Ain-Karim (5º39` N, 73º95' W, 2110 masl. We determined the average duration of sprouting (SP, flowering (FL, veraison (VE and vintage (VI periods from pruning, and the total cycle of growth, according to the phenological scale Biologische Bundesanstalt Bundessortenamt Chemise (BBCH. To set the average of the process was considered when the plants reached 50% of each event. Determining growing degree days (GDD support the temperature record by a datalogger. Phenological data were subjected to a descriptive analysis as means and standard deviation. The duration of the period between pruning (PR and vintage (VI, with average temperature of 17.87 ° C, had a duration of 183 days after pruning (DAP, accumulating growing degree days 1458.1 (GDD. Flowering occurred at 50 days after pruning (DAP, accumulating 397.7 GDD. Veraison 122 was presented to the accumulation of 578.2 DAP with GDD. While from veraison to maturity 478.9 GDD accumulated in 62 days. Under Sutamarchán agro-climatic conditions, during the investigation, collects, on average, 7.98 degrees daily growth, which implies that for the Cabernet Sauvignon, the total duration of the phenological cycle is 184 days, accumulating 1458.1 GDD.

  8. Hepatoprotective Effects of Total Triterpenoids and Total Flavonoids from Vitis vinifera L against Immunological Liver Injury in Mice

    Directory of Open Access Journals (Sweden)

    Tao Liu

    2012-01-01

    Full Text Available Suosuo grape (the fruits of Vitis vinifera L has been used for prevention and treatment of liver diseases in Uighur folk medicine in China besides its edible value. In this study, the hepatoprotective effects of total triterpenoids (VTT and total flavonoids (VTF from Suosuo grape were evaluated in Bacille-Calmette-Guerin- (BCG- plus-lipopolysaccharide- (LPS- induced immunological liver injury (ILI in mice. Various dose groups (50, 150, and 300 mg/kg of VTT and VTF alleviated the degree of liver injury of ILI mice, effectively reduced the BCG/LPS-induced elevated liver index and spleen index, hepatic nitric oxide (NO, and malondialdehyde (MDA content, increased liver homogenate alanine aminotransferase (ALT and aspartate aminotransferase (AST levels, and restored hepatic superoxide dismutase (SOD activity in ILI mice. VTT and VTF also significantly inhibited intrahepatic expression of Th1 cytokines (IFN-γ and IL-2 in ILI mice and increased intrahepatic expression of Th2 cytokines (IL-4 and IL-10. Moreover, the increased Bax/Bcl-2 ratio was significantly downregulated by VTT and VTF in liver tissue of ILI mice. These results are comparable to those of biphenyl dicarboxylate (DDB, the reference hepatoprotective agent and suggest that VTT and VTF play a protective role against immunological liver injury, which may have important implications for our understanding of the immunoregulatory mechanisms of this plant.

  9. Comparison between aroma compounds in wines from four Vitis vinifera grape varieties grown in different shoot positions

    Directory of Open Access Journals (Sweden)

    Guo Cheng

    2015-06-01

    Full Text Available The aroma characteristics of wines from four Vitis vinifera grape varieties (‘Cabernet sauvignon’, ‘Merlot’, ‘Chardonnay’, and ‘Italian Riesling’ grown in three shoot positions were evaluated by HS-SPME-GC/MS. In this study, the numerous significant differences found in most of the aromatic compounds influence of different shoot positions on the quality of wine. The results showed that the middle shoot position increased significantly the aroma concentration in the majority of wines investigated. The volatile components showing the greatest differences in the wines of different cultivars were aldehydes and terpenes. 8 and 11 compounds were found and quantified (OAVs>1 in the two red wines and white wines at concentrations higher than their corresponding odor thresholds, respectively; and therefore they significantly contributed to the wine aromas. According to their OAVs, fruity, floral, cheese and fatty aroma strongly influenced the characteristics of the four monovarietal wines, while the two white wines showed the green and fresh aroma characteristics. These results are related to the different microclimate of the canopies of the different shoot positions and varieties. They suggest that proper elevating the fruiting zones could improve the accumulation of aroma compounds in wines from the different varieties. On the other hand, grapevines trained to systems with uniform fruiting zones could improve the quality of wine.

  10. Enhanced extracellular production of trans-resveratrol in Vitis vinifera suspension cultured cells by using cyclodextrins and coronatine.

    Science.gov (United States)

    Almagro, Lorena; Belchí-Navarro, Sarai; Martínez-Márquez, Ascensión; Bru, Roque; Pedreño, María A

    2015-12-01

    In the present work the effect of cyclodextrin and coronatine on both trans-resveratrol production and the expression of stilbene biosynthetic genes in Vitis vinifera L. cv Monastrell suspension cultured cells were evaluated. The results showed the maximum level of trans-resveratrol produced by cells and secreted to the culture medium with 50 mM cyclodextrins and 1 μM coronatine. Since the levels of trans-resveratrol produced in the combined treatment were higher than the sum of the individual treatments, a synergistic effect between both elicitors was assumed. In addition, all the analysed genes were induced by cyclodextrins and/or coronatine. The expression of the phenylalanine ammonia lyase and stilbene synthase genes was greatly enhanced by coronatine although an increase in the amount of trans-resveratrol in the spent medium was not detected. Therefore, despite the fact that trans-resveratrol production is related with the expression of genes involved in the biosynthetic process, other factors may be involved, such as post-transcriptional and post-traductional regulation. The expression maximal levels of cinnamate 4-hydroxylase and 4-coumarate-CoA ligase genes were found with cyclodextrins alone or in combination with coronatine suggesting that the activity of these enzymes could be not only important for the formation of intermediates of trans-R biosynthesis but also for those intermediates involved in the biosynthesis of lignins and/or flavonoids. PMID:26529079

  11. Evaluation of the Anti-Inflammatory Activity of Raisins (Vitis vinifera L.) in Human Gastric Epithelial Cells: A Comparative Study.

    Science.gov (United States)

    Di Lorenzo, Chiara; Sangiovanni, Enrico; Fumagalli, Marco; Colombo, Elisa; Frigerio, Gianfranco; Colombo, Francesca; Peres de Sousa, Luis; Altindişli, Ahmet; Restani, Patrizia; Dell'Agli, Mario

    2016-01-01

    Raisins (Vitis vinifera L.) are dried grapes largely consumed as important source of nutrients and polyphenols. Several studies report health benefits of raisins, including anti-inflammatory and antioxidant properties, whereas the anti-inflammatory activity at gastric level of the hydro-alcoholic extracts, which are mostly used for food supplements preparation, was not reported until now. The aim of this study was to compare the anti-inflammatory activity of five raisin extracts focusing on Interleukin (IL)-8 and Nuclear Factor (NF)-κB pathway. Raisin extracts were characterized by High Performance Liquid Chromatography-Diode Array Detector (HPLC-DAD) analysis and screened for their ability to inhibit Tumor necrosis factor (TNF)α-induced IL-8 release and promoter activity in human gastric epithelial cells. Turkish variety significantly inhibited TNFα-induced IL-8 release, and the effect was due to the impairment of the corresponding promoter activity. Macroscopic evaluation showed the presence of seeds, absent in the other varieties; thus, hydro-alcoholic extracts from fruits and seeds were individually tested on IL-8 and NF-κB pathway. Seed extract inhibited IL-8 and NF-κB pathway, showing higher potency with respect to the fruit. Although the main effect was due to the presence of seeds, the fruit showed significant activity as well. Our data suggest that consumption of selected varieties of raisins could confer a beneficial effect against gastric inflammatory diseases. PMID:27447609

  12. Enhancement of phenolics, resveratrol and antioxidant activity by nitrogen enrichment in cell suspension culture of Vitis vinifera.

    Science.gov (United States)

    Sae-Lee, Napaporn; Kerdchoechuen, Orapin; Laohakunjit, Natta

    2014-01-01

    Ammonium nitrate (NH4NO3), an important nitrogen source (34% N), has been used as an elicitor to stimulate plant growth and development as well as induce secondary metabolites under controlled conditions. In the present paper, we investigated the enhancement of cell biomass, total phenolics, resveratrol levels, and antioxidant activity of Vitis vinifera cv. Pok Dum by nitrogen enrichment (MS medium supplemented with NH4NO3 at 0, 500, 1,000, 5,000 and 10,000 mg/L). The highest accumulations of biomass, phenolics and resveratrol contents were observed at 8.8-fold (86.6 g DW/L), 15.9-fold (71.91 mg GAE/g DW) and 5.6-fold (277.89 µg/g DW) by the 14th day, in the medium supplemented with 500 mg/L NH4NO3. Moreover, the antioxidant activities of cultured grape cells estimated by the DPPH· and ABTS·+ assay were positively correlated with phenolics and resveratrol, and the maximum activity was also observed in cultured cells with 500 mg/L NH4NO3 at 176.11 and 267.79 mmol TE/100 g DW, respectively. PMID:24962393

  13. Enhancement of Phenolics, Resveratrol and Antioxidant Activity by Nitrogen Enrichment in Cell Suspension Culture of Vitis vinifera

    Directory of Open Access Journals (Sweden)

    Napaporn Sae-Lee

    2014-06-01

    Full Text Available Ammonium nitrate (NH4NO3, an important nitrogen source (34% N, has been used as an elicitor to stimulate plant growth and development as well as induce secondary metabolites under controlled conditions. In the present paper, we investigated the enhancement of cell biomass, total phenolics, resveratrol levels, and antioxidant activity of Vitis vinifera cv. Pok Dum by nitrogen enrichment (MS medium supplemented with NH4NO3 at 0, 500, 1,000, 5,000 and 10,000 mg/L. The highest accumulations of biomass, phenolics and resveratrol contents were observed at 8.8-fold (86.6 g DW/L, 15.9-fold (71.91 mg GAE/g DW and 5.6-fold (277.89 µg/g DW by the 14th day, in the medium supplemented with 500 mg/L NH4NO3. Moreover, the antioxidant activities of cultured grape cells estimated by the DPPH· and ABTS·+ assay were positively correlated with phenolics and resveratrol, and the maximum activity was also observed in cultured cells with 500 mg/L NH4NO3 at 176.11 and 267.79 mmol TE/100 g DW, respectively.

  14. Evaluation of Anti-Candida Activity of Vitis vinifera L. Seed Extracts Obtained from Wine and Table Cultivars

    Directory of Open Access Journals (Sweden)

    Giovanna Simonetti

    2014-01-01

    Full Text Available For the first time, grape seed extracts (GSEs, obtained from wine and table cultivars of Vitis vinifera L., cultured in experimental fields of Lazio and Puglia regions of Italy and grown in different agronomic conditions, have been tested on 43 Candida species strains. We demonstrated a significant correlation between the content of the flavan-3-ols in GSEs extracts, with a polymerization degree ≥4, and anti-Candida activity. Moreover, we demonstrated that GSEs, obtained from plants cultured with reduced irrigation, showed a content of polymeric flavan-3-ols >250 mg/g with geometric mean MIC values between 5.7 and 20.2 mg/L against Candida albicans reference strains. GSE, showing 573 mg/g of polymeric flavan-3-ols, has been tested in an experimental murine model of vaginal candidiasis by using noninvasive in vivo imaging technique. The results pointed out a significant inhibition of Candida albicans load 5 days after challenge. These findings indicate that GSEs with high content of polymeric flavan-3-ols can be used in mucosal infection as vaginal candidiasis.

  15. Evaluation of the Anti-Inflammatory Activity of Raisins (Vitis vinifera L.) in Human Gastric Epithelial Cells: A Comparative Study

    Science.gov (United States)

    Di Lorenzo, Chiara; Sangiovanni, Enrico; Fumagalli, Marco; Colombo, Elisa; Frigerio, Gianfranco; Colombo, Francesca; Peres de Sousa, Luis; Altindişli, Ahmet; Restani, Patrizia; Dell’Agli, Mario

    2016-01-01

    Raisins (Vitis vinifera L.) are dried grapes largely consumed as important source of nutrients and polyphenols. Several studies report health benefits of raisins, including anti-inflammatory and antioxidant properties, whereas the anti-inflammatory activity at gastric level of the hydro-alcoholic extracts, which are mostly used for food supplements preparation, was not reported until now. The aim of this study was to compare the anti-inflammatory activity of five raisin extracts focusing on Interleukin (IL)-8 and Nuclear Factor (NF)-κB pathway. Raisin extracts were characterized by High Performance Liquid Chromatography-Diode Array Detector (HPLC-DAD) analysis and screened for their ability to inhibit Tumor necrosis factor (TNF)α-induced IL-8 release and promoter activity in human gastric epithelial cells. Turkish variety significantly inhibited TNFα-induced IL-8 release, and the effect was due to the impairment of the corresponding promoter activity. Macroscopic evaluation showed the presence of seeds, absent in the other varieties; thus, hydro-alcoholic extracts from fruits and seeds were individually tested on IL-8 and NF-κB pathway. Seed extract inhibited IL-8 and NF-κB pathway, showing higher potency with respect to the fruit. Although the main effect was due to the presence of seeds, the fruit showed significant activity as well. Our data suggest that consumption of selected varieties of raisins could confer a beneficial effect against gastric inflammatory diseases. PMID:27447609

  16. EFFECT OF THE BROWN ALGA ASCOPHYLLUM NODOSUM AS BIOFERTILIZER ON VEGETATIVE GROWTH IN GRAPEVINE (VITIS VINIFERA L.

    Directory of Open Access Journals (Sweden)

    Gheorghe Cristian Popescu

    2014-11-01

    Full Text Available Environmental growing farm technology involves utilization of agricultural inputs which are friendly with the production and ecosystem. Seaweed extracts are used as biofertilizers in horticulture in special to increase plant growth and productivity. In this study, we investigated the effect of seaweed extracts made from Ascophyllum nodosum, on vegetative growth of Vitis vinifera cv. Feteasca Alba. We used three different concentrations of seaweed extracts to asset the effect on fertility coefficients, shoot length, shoot diameter and leaf area. All treatments with seaweed extract showed a stimulatory effect for studied parameters. The plants treated with the higher levels of seaweed concentrate produced the highest absolute fertility coefficient and relative fertility coefficient relative to the plants treated with lower concentration of or untreated control plants. Foliar spray application at different concentration of seaweed extract of Ascophyllum nodosum influenced the vegetative growth expressed by leaf area of vine stock. The results indicate that the 170 ml-1hl concentration of seaweed extract showed the higher enhanced of growth parameters in grapevine.

  17. Vine vigor and cluster uniformity on Vitis vinifera L. seed procyanidin composition in a warm Mediterranean climate

    Directory of Open Access Journals (Sweden)

    Maite Edo-Roca

    2014-07-01

    Full Text Available Seed procyanidin composition of Vitis vinifera L. var. ˈCarignanˈ and ˈGrenacheˈ was analyzed to assess the impact of vintage climatology, plant vigor and bunch variability on the quality of grapes. This study was carried out over 2007 and 2008 vintages in Terra Alta denomination of origin (DO. This region is located in northeastern Spain and characterized by a Mediterranean climate with a continental tendency. Procyanidin composition of seeds from four vineyards was analyzed by rapid resolution liquid chromatography (RRLC-DAD-TOF/MS. Vintage, vigor and ripeness uniformity had an influence on the procyanidin concentration in seeds. Flavan-3-ol polymerization increased during the warm year, together with a notable dependence on the variety and vine vigor. In warmer years and low vigor, ˈGrenacheˈ seed composition is likely to be more vulnerable than ˈCarignanˈ. High levels of flavan-3-ol monomers and low polymerization characterized the seeds of the temperate year.

  18. Environmental Factors and Seasonality Affect the Concentration of Rotundone in Vitis vinifera L. cv. Shiraz Wine.

    Directory of Open Access Journals (Sweden)

    Pangzhen Zhang

    Full Text Available Rotundone is a sesquiterpene that gives grapes and wine a desirable 'peppery' aroma. Previous research has reported that growing grapevines in a cool climate is an important factor that drives rotundone accumulation in grape berries and wine. This study used historical data sets to investigate which weather parameters are mostly influencing rotundone concentration in grape berries and wine. For this purpose, wines produced from 15 vintages from the same Shiraz vineyard (The Old Block, Mount Langi Ghiran, Victoria, Australia were analysed for rotundone concentration and compared to comprehensive weather data and minimal temperature information. Degree hours were obtained by interpolating available temperature information from the vineyard site using a simple piecewise cubic hermite interpolating polynomial method (PCHIP. Results showed that the highest concentrations of rotundone were consistently found in wines from cool and wet seasons. The Principal Component Analysis (PCA showed that the concentration of rotundone in wine was negatively correlated with daily solar exposure and grape bunch zone temperature, and positively correlated with vineyard water balance. Finally, models were constructed based on the Gompertz function to describe the dynamics of rotundone concentration in berries through the ripening process according to phenological and thermal times. This characterisation is an important step forward to potentially predict the final quality of the resultant wines based on the evolution of specific compounds in berries according to critical environmental and micrometeorological variables. The modelling techniques described in this paper were able to describe the behaviour of rotundone concentration based on seasonal weather conditions and grapevine phenological stages, and could be potentially used to predict the final rotundone concentration early in future growing seasons. This could enable the adoption of precision irrigation and

  19. Composició fenòlica en varietats negres de Vitis vinifera. Estudi de la influència de diferents factors

    OpenAIRE

    Valls Fonayet, Josep

    2004-01-01

    La composició antociànica és un caràcter fenotípic fortament diferenciat i característic de cada varietat vinífera, de manera que pot utilitzar-se com a identificador varietal. En la present tesi s'han caracteritzat 8 varietats negres (Cabernet sauvignon, Carinyena, Garnatxa, Merlot, Monstrell, Pinot noir, Syrah i Ull de llebre) de Vitis vinifera a partir de la seva composició en antocians. Tanmateix, una sèrie de factors poden modificar aquesta composició. En condicions in vitro, en situacio...

  20. Contribución al estudio de la nematofauna peri-radicular de la vid (Vitis vinifera L.) del Vallès Occidental (Barcelona)

    OpenAIRE

    Ripoll, Francesc; Palomo González, Alejandro

    1985-01-01

    This paper is a contribution to the knowledge of the free-living nematological fauna of Spanish vineyard soils and its seasonal fluctuations. Two Vitis vinifera fields were studied. One of them is under cultivation (V field) while the other was abandoned 10 years ago (CE field). Soils are alkaline, with sandy-loam (VI or sandyclay-loam (CE) textures. Ten soil samples were taken each season from each field, at a depth of 0-20 cm. Nematodes were extracted by the Baermann's method, stained with ...

  1. Cytologic Investigations on Identification of Induced Mutation Effects in Sultani Çekirdeksiz ve Kalecik Karası Grape cvs. (Vitis vinifera L.)

    International Nuclear Information System (INIS)

    The effects of induced mutation applied by 5 different doses of gamma irradiation (20, 25, 30, 40 ve 50 Gy) were cytologic investigated on Vitis vinifera L. cultivars, Sultani Çekirdeksiz (SÇ) ve Kalecik karası (KK). Mutant candidates were selected through the morphological observations of the mutation-induced phenotypic changes in the first (M1V1), second (M1V2) and third (M1V3) vegetations. In cytological studies, diploid cells (2n=38) were observed for both cultivars. Cells showing ploidy level other than diploidy were found only in the individual SÇ 30 Gy 34. (author)

  2. EFECTO DE LAS AGUAS RESIDUALES TRATADAS SOBRE EL CRECIMIENTO, FOTOSÍNTESIS Y RENDIMIENTO EN VIDES TEMPRANILLO (Vitis vinifera) EN BAJA CALIFORNIA, MÉXICO

    OpenAIRE

    Dinora Acosta-Zamorano; Víctor Macías-Carranza; Leopoldo Mendoza-Espinosa; Alejandro Cabello-Pasini

    2013-01-01

    Baja California es una zona semidesértica donde la agricul - tura, incluyendo la viticultura, está limitada por la dispo - nibilidad de agua. Ensenada es una ciudad adyacente a la zona viticultural donde 100 % de las aguas de drenaje son tratadas, no son reutilizadas y se vierten al mar. Por tanto, el objetivo de este estudio fue evaluar el efecto de las aguas residuales tratadas (ART) sobre el crecimiento, la fotosínte - sis y el rendimiento de vid ( Vitis vinifera var. Tempranillo) en el Va...

  3. Chemical composition and bioactive compounds of grape pomace (Vitis vinifera L.), Benitaka variety, grown in the semiarid region of Northeast Brazil

    OpenAIRE

    Eldina Castro Sousa; Ana Maria Athayde Uchôa-Thomaz; José Osvaldo Beserra Carioca; Selene Maia de Morais; Alessandro de Lima; Clécio Galvão Martins; Cristiane Duarte Alexandrino; Pablito Augusto Travassos Ferreira; Ana Livya Moreira Rodrigues; Suliane Praciano Rodrigues; Jurandy do Nascimento Silva; Larissa Lages Rodrigues

    2014-01-01

    Grape pomace (Vitis vinifera L.), Benitaka variety, grown in the semiarid region of Northeast Brazil was evaluated in relation to chemical composition, and content of minerals and functional properties. Its microbiological quality and toxic potential, using Artemia salina sp, were also investigated. The results showed that the flour obtained from these residues had below neutral pH (3.82), moisture (3.33g/100g), acidity of (0.64g of citric acid/100g), and ash (4.65 g/100g). The amount of tota...

  4. Élimination des caractères juvéniles typiques de Vitis vinifera L., cv. Albarino provenant de culture in vitro par utilisation du greffage.

    OpenAIRE

    Martínez Rodríguez, María del Carmen; Mantilla, José Luis G.

    1993-01-01

    [EN] Buds token from the basal area (very juvenile characters), from the central area (char­acters between the juvenile and adult stages) and from the apex (adult characters) of a Vitis vinifera L., cv. Albariño wine which was grown in vitro (five year old wine), were grafted onto two types of rootstock, the SO 4 and the 196-17 C. All the plants obtained were equal, with an adult leaf morphology from the first year after grafting, and the appearance of the first bunches in the second...

  5. Variabilidad morfológica, patogénica y susceptibilidad a fungicidas de Rhizoctonia solani aislado de rizósfera de Vitis vinifera var. perlette seedless

    OpenAIRE

    Amparo Meza-Moller; Martín Esqueda; Alfonso Gardea; Martín Tiznado; Gil Virgen-Calleros

    2007-01-01

    Se estudió la variabilidad morfológica, reacción de anastomosis, patogenicidad y susceptibilidad a fungicidas de Rhizoctonia solani aislado de la rizósfera de Vitis vinifera var. perlette seedless plantada a pie franco en Sonora, México. El hongo se aisló mediante el método de tamizado en húmedo y la siembra en agar-agua 2 %. Se obtuvieron 122 cepas, las cuales presentaron hifas con 3 a 9 núcleos por célula, de 3 a 8 µm de diámetro y de color blanco sucio a moreno oscuro. Los aislamientos cor...

  6. A study on total phenolics and vitamin c contents of kalecik karasi (vitis vinifera l.) clones

    International Nuclear Information System (INIS)

    In this study total phenolic and vitamin C contents of the fully ripe berries of 23 clones of Kalecik Karasi which is one of the leading Turkish local red-wine grape cultivar originally grown in Kizilirmak valley near Kalecik/Ankara region were examined under the clone selection project supported by TUBTAK (Project Nr: 107 O 731). High-pressure liquid chromatography (HPLC) was used for vitamin C and spectrophotometer for total phenolics estimation. One way ANOVA was used to compare means of clone for their total phenolic and vitamin C contents. In addition to this univariate method, hierarchical cluster analysis was performed to identify similarity levels among the clones by considering total phenolics and vitamin C content together. Differences among the clones were found statistically significant for both characteristics. Total phenolic contents of the clones varied from 3.310 mg (clone 21) to 3.389 mg (clone 6) as GAE g fw. Vitamin C content ranged from 14.010 mg (clone 6) to 16.500 mg (clone 19) in 100g fw. Furthermore, similarity level for all clones was 83.1% that means variation rate is about 17% among the clones. As a summary of whole data, the first three performing clones are 6 (3.389 mg), 10 (3.374 mg) and 1 (3.365 mg) for total phenolics, and 19 (16.500 mg), 9 (16.020 mg), and 21 (16.015 mg) for vitamin C contents of the berries. (author)

  7. iTRAQ-based protein profiling provides insights into the central metabolism changes driving grape berry development and ripening

    OpenAIRE

    Martínez-Esteso, María José; Vilella-Antón, María Teresa; Pedreño, María Ángeles; Valero, María Luz; Bru-Martínez, Roque

    2013-01-01

    Background: Grapevine (Vitis vinifera L.) is an economically important fruit crop. Quality-determining grape components such as sugars, acids, flavors, anthocyanins, tannins, etc., accumulate in the different grape berry development stages. Thus, correlating the proteomic profiles with the biochemical and physiological changes occurring in grape is of paramount importance to advance in our understanding of berry development and ripening processes. Results: We report the developmental analysis...

  8. Influence of constitutive phenolic compounds on the response of grapevine (Vitis vinifera L.) leaves to infection by Plasmopara viticola.

    Science.gov (United States)

    Latouche, Gwendal; Bellow, Sébastien; Poutaraud, Anne; Meyer, Sylvie; Cerovic, Zoran G

    2013-01-01

    Flavonols and hydroxycinnamic acids are known to contribute to plant resistance against pathogens, but there are few reports on the implication of flavonols in the resistance of grapevine against Plasmopara viticola, and none on the involvement of hydroxycinnamic acids. In order to analyze the effect of flavonols on P. viticola infection, variable amounts of flavonols were induced by different light conditions in otherwise phenologically identical leaves. Differences in content of leaf hydroxycinnamic acids were induced at the same time. A non-invasive monitoring of flavonols and hydroxycinnamic acids was performed with Dualex leaf-clip optical sensors. Whatever the light condition, there were no significant changes in flavonol or in hydroxycinnamic acid contents for control and inoculated leaves during the development of P. viticola until 6 days after inoculation. The violet-blue autofluorescence of stilbenes, the main phytoalexins of grapevine that accumulate in inoculated leaves, was used as an indicator of infection by P. viticola. The implication of leaf constitutive flavonols and hydroxycinnamic acids in the defence of Vitis vinifera against P. viticola could be investigated in vivo thanks to this indicator. The increase in stilbene violet-blue autofluorescence started earlier for leaves with low flavonol content than for leaves with higher content, suggesting that constitutive flavonols are able to slow down the infection by P. viticola. On the contrary, constitutive hydroxycinnamic acids did not seem to play a role in defence against P. viticola. The non-destructive nature of the methods used alleviates the major problem of destructive experiments: the large variability in leaf phenolic contents. PMID:23080015

  9. Rain-Shelter Cultivation Modifies Carbon Allocation in the Polyphenolic and Volatile Metabolism of Vitis vinifera L. Chardonnay Grapes

    Science.gov (United States)

    Han, Mei-Mei; Yang, Xiao-Fan; Li, Zheng; Wang, Jun; Pan, Qiu-Hong

    2016-01-01

    This study investigated the effect of rain-shelter cultivation on the biosynthesis of flavonoids and volatiles in grapes, with an aim of determining whether rain-shelter application could help to improve the sensory attributes and quality of grapes. Vitis vinifera L. Chardonnay grapes, grown in the Huaizhuo basin region of northern China, were selected within two consecutive years. A rain-shelter roof was constructed using a colorless polyethylene (PE) film with a light transmittance of 80%. Results showed that rain-shelter treatment did not affect the accumulation of soluble solids during grape maturation. However, the allocation of assimilated carbon in phenolic and volatile biosynthetic pathways varied significantly, leading to alterations in polyphenolic and volatile profiles. The rain-shelter cultivation enhanced the concentration of flavan-3-ols via the flavonoid-3’5’-hydroxylase (F3’5’H) pathway, but reduced the level of flavonols and flavan-3-ols via the flavonoid-3’-hydroxylase (F3’H) pathway. In addition, the rain-shelter cultivation significantly enhanced the synthesis of fatty acid-derived volatiles, isoprene-derived terpenoids and amino acid-derived branched-chain aliphatics, but led to a decrease in the accumulation of isoprene-derived norisoprenoids and amino acid-derived benzenoids. Principal component analysis revealed some key compounds that differentiated the grapes cultivated under open-field and rain-shelter conditions. Moreover, the effect of the rain-shelter application on the accumulation of these compounds appeared to be vintage dependent. The alteration of their profiles caused by the rain-shelter treatment was significant in the vintage that received higher rainfall, which usually took place in the first rapid growth and veraison phases. PMID:27218245

  10. Phenolic Compounds and Bioactivity of Healthy and Infected Grapevine Leaf Extracts from Red Varieties Merlot and Vranac (Vitis vinifera L.).

    Science.gov (United States)

    Anđelković, Marko; Radovanović, Blaga; Anđelković, Ana Milenkovic; Radovanović, Vladimir

    2015-09-01

    We investigated the phenolic composition, radical scavenging activity, and antimicrobial activity of grapevine leaf extracts from two red grape varieties, Vranac and Merlot (Vitis vinifera L.). The extracts were prepared from healthy grapevine leaves and those infected by Plasmopara viticola (downy mildew). The phenolic composition of the grapevine leaf extracts was determined using spectrophotometric assays and reverse-phase high performance liquid chromatography (RP-HPLC). The radical scavenging activity of grapevine leaf extracts was determined by the 2,2-diphenyl-1-picrylhydrazyl assay, and their antimicrobial activity was determined by microwell dilution tests. The total phenolic content was higher in healthy grapevine leaf extracts than in infected grapevine leaf extracts. The RP-HPLC analysis detected significant amounts of flavonols, phenolic acids, and flavan-3-ols, and small amounts of stilbenes in the grapevine leaf extracts. Compared with the infected grapevine leaf extracts, the healthy grapevine leaf extracts were richer in flavonols, phenolic acids, and flavan-3-ols, but had lower stilbenes contents. All extracts showed strong free radical scavenging activity, which was strongly correlated with the total phenolic content (R(2) = 0.978). The extracts showed a stronger antimicrobial activity towards Gram-positive bacterial strains than towards Gram-negative bacterial strains and yeast. The phenolic compounds in grapevine leaves were responsible for their strong radical scavenging and antimicrobial activities. Together, these results demonstrate that grapevine leaves have high nutritional value and can be used as a fresh food and to prepare extracts that can be used as additives in food and medicines. PMID:26174183

  11. Various extraction methods for obtaining stilbenes from grape cane of Vitis vinifera L.

    Science.gov (United States)

    Soural, Ivo; Vrchotová, Naděžda; Tříska, Jan; Balík, Josef; Horník, Štěpán; Cuřínová, Petra; Sýkora, Jan

    2015-01-01

    Grape cane, leaves and grape marc are waste products from viticulture, which can be used to obtain secondary stilbene derivatives with high antioxidant value. The presented work compares several extraction methods: maceration at laboratory temperature, extraction at elevated temperature, fluidized-bed extraction, Soxhlet extraction, microwave-assisted extraction, and accelerated solvent extraction. To obtain trans-resveratrol, trans-ε-viniferin and r2-viniferin from grape cane of the V. vinifera variety Cabernet Moravia, various conditions were studied: different solvents, using powdered versus cut cane material, different extraction times, and one-step or multiple extractions. The largest concentrations found were 6030 ± 680 µg/g dry weight (d.w.) for trans-resveratrol, 2260 ± 90 µg/g d.w. for trans-ε-viniferin, and 510 ± 40 µg/g d.w. for r2-viniferin. The highest amounts of stilbenes (8500 ± 1100 µg/g d.w.) were obtained using accelerated solvent extraction in methanol. PMID:25856060

  12. Various Extraction Methods for Obtaining Stilbenes from Grape Cane of Vitis vinifera L.

    Directory of Open Access Journals (Sweden)

    Ivo Soural

    2015-04-01

    Full Text Available Grape cane, leaves and grape marc are waste products from viticulture, which can be used to obtain secondary stilbene derivatives with high antioxidant value. The presented work compares several extraction methods: maceration at laboratory temperature, extraction at elevated temperature, fluidized-bed extraction, Soxhlet extraction, microwave-assisted extraction, and accelerated solvent extraction. To obtain trans-resveratrol, trans-ε-viniferin and r2-viniferin from grape cane of the V. vinifera variety Cabernet Moravia, various conditions were studied: different solvents, using powdered versus cut cane material, different extraction times, and one-step or multiple extractions. The largest concentrations found were 6030 ± 680 µg/g dry weight (d.w. for trans-resveratrol, 2260 ± 90 µg/g d.w. for trans-ε-viniferin, and 510 ± 40 µg/g d.w. for r2-viniferin. The highest amounts of stilbenes (8500 ± 1100 µg/g d.w. were obtained using accelerated solvent extraction in methanol.

  13. Genetic Variability in Rhizoctonia solani Isolated from Vitis vinifera Based on Amplified Fragment Length Polymorphism

    Directory of Open Access Journals (Sweden)

    Amparo Meza-Moller

    2011-01-01

    Full Text Available Problem statement: Rhizoctonia solani is a potential grapevine pathogen. In order to develop effective methods of control, it is necessary to document its genetic diversity. Approach: The objective of this study was to analyze the genetic variability of R. solani isolated from the rhizosphere of ungrafted V. vinifera var. perlette seedless planted in Sonora, Mexico using Amplified Fragment Length Polymorphism (AFLP. Results: In the selective amplification using eight primer combinations we obtained a total of 446 AFLP markers with a 100% polymorphism. Out of 41 isolates, 36 different AFLP patterns were observed and five were replicates of the same pattern. The dendrogram shows inter- and intrapopulation similarity indexes of 0.26, 0.98 and 0.31, 0.98, respectively. Six groups emerged from the principal components analysis, five of which were clearly defined, while the other one was spread out. Conclusion: We conclude that R. solani growing in Sonoran vineyards shows a high degree of genetic variability, even under similar environmental conditions.

  14. Determination of carotenoid profiles in grapes, musts, and fortified wines from Douro varieties of Vitis vinifera.

    Science.gov (United States)

    Guedes De Pinho, P; Silva Ferreira, A C; Mendes Pinto, M; Benitez, J G; Hogg, T A

    2001-11-01

    beta-Carotene and six xanthophylls (lutein, neoxanthin, violaxanthin, luteoxanthin, cryptoxanthin, and echinenone) have been identified and semiquantitatively or quantitatively determined in musts and port wines for the first time. An HPLC method was developed and compared with that of one based on thin layer cromatography with scanning densitometry. The most abundant carotenoids present in red grape varieties are beta-carotene and lutein. In wines, significant quantities of violaxanthin, luteoxanthin, and neoxanthin were found. This study was done with berries (skin and pulp), musts, and fortified wines. Some experiments were performed to follow carotenoid content from grapes to wines. Although the levels of beta-carotene and lutein found in fortified wines were lower than those found in musts, other xanthophylls, such as neoxanthin, violaxanthin, and luteoxanthin, exist in appreciable amounts in young ports. PMID:11714348

  15. Interactive effects of soil water deficit and air vapour pressure deficit on mesophyll conductance to CO2 in Vitis vinifera and Olea europaea.

    Science.gov (United States)

    Perez-Martin, A; Flexas, J; Ribas-Carbó, M; Bota, J; Tomás, M; Infante, J M; Diaz-Espejo, A

    2009-01-01

    The present work aims to study the interactive effect of drought stress and high vapour pressure deficit (VPD) on leaf gas exchange, and especially on mesophyll conductance to CO(2) (g(m)), in two woody species of great agronomical importance in the Mediterranean basin: Vitis vinifera L. cv. Tempranillo and Olea europaea L. cv. Manzanilla. Plants were grown in specially designed outdoor chambers with ambient and below ambient VPD, under both well-irrigated and drought conditions. g(m) was estimated by the variable J method from simultaneous measurements of gas exchange and fluorescence. In both species, the response to soil water deficit was larger in g(s) than in g(m), and more important than the response to VPD. Olea europaea was apparently more sensitive to VPD, so that plants growing in more humid chambers showed higher g(s) and g(m). In V. vinifera, in contrast, soil water deficit dominated the response of g(s) and g(m). Consequently, changes in g(m)/g(s) were more related to VPD in O. europaea and to soil water deficit in V. vinifera. Most of the limitations of photosynthesis were diffusional and especially due to stomatal closure. No biochemical limitation was detected. The results showed that structural parameters played an important role in determining g(m) during the acclimation process. Although the relationship between leaf mass per unit area (M(A)) with g(m) was scattered, it imposed a limitation to the maximum g(m) achievable, with higher values of M(A) in O. europaea at lower g(m) values. M(A) decreased under water stress in O. europaea but it increased in V. vinifera. This resulted in a negative relationship between M(A) and the CO(2) draw-down between substomatal cavities and chloroplasts in O. europaea, while being positive in V. vinifera. PMID:19457982

  16. A reliable protocol for the stable transformation of non-embryogenic cells cultures of grapevine (Vitis vinifera L. and Taxus x media

    Directory of Open Access Journals (Sweden)

    Ascensión Martínez-Márquez

    2015-06-01

    Full Text Available One of the major intent of metabolic engineering in cell culture systems is to increase yields of secondary metabolites. Efficient transformation methods are a priority to successfully apply metabolic engineering to cell cultures of plants that produce bioactive or therapeutic compounds, such as Vitis vinifera and Taxus x media. The aim of this study was to establish a reliable method to transform non-embryogenic cell cultures of these species. The V. vinifera cv. Gamay/cv. Monastrell cell lines and Taxus x media were used for Agrobacterium-mediated transformation using the Gateway-compatible Agrobacterium sp. binary vector system for fast reliable DNA cloning. The Taxus x media and Vitis cell lines were maintained in culture for more than 4 and 15 months, respectively, with no loss of reporter gene expression or antibiotic resistance. The introduced genes had no discernible effect on cell growth, or led to extracellular accumulation of phytoalexin trans-Resveratrol (t-R in response to elicitation with methylated cyclodextrins (MBCD and methyl jasmonate (MeJA in the grapevine transgenic cell lines compared to the parental control. The method described herein provides an excellent tool to exploit exponentially growing genomic resources to enhance, optimize or diversify the production of bioactive compounds generated by grapevine and yew cell cultures, and offers a better understanding of many grapevine and yew biology areas.

  17. EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA); Scientific Opinion on the substantiation of health claims related to oligomeric procyanidins (OPCs) from grape (Vitis vinifera L.) seeds and improvement of visual adaptation to the dark (ID 680) pursuant to Article 13(1) of Regulation

    DEFF Research Database (Denmark)

    Tetens, Inge

    claims in relation to oligomeric procyanidins (OPCs) from grape (Vitis vinifera L.) seeds and improvement of visual adaptation to the dark. The scientific substantiation is based on the information provided by the Member States in the consolidated list of Article 13 health claims and references that EFSA...... has received from Member States or directly from stakeholders. The food constituent that is the subject of the health claim is oligomeric procyanidins (OPCs) from grape (Vitis vinifera L.) seeds. The Panel considers that OPCs from grape (Vitis vinifera L.) seeds are sufficiently characterised. The...... conclusions could be drawn for the scientific substantiation of the claim. On the basis of the data presented, the Panel concludes that a cause and effect relationship has not been established between the consumption of OPCs from grape (Vitis vinifera L.) seeds and improvement of visual adaptation to the dark....

  18. Changes in growth, photosynthetic activities, biochemical parameters and amino acid profile of Thompson Seedless grapes (Vitis vinifera L.).

    Science.gov (United States)

    Somkuwar, R G; Bahetwar, Anita; Khan, I; Satisha, J; Ramteke, S D; Itroutwar, Prerna; Bhongale, Aarti; Oulkar, Dashrath

    2014-11-01

    The study on photosynthetic activity and biochemical parameters in Thompson Seedless grapes grafted on Dog Ridge rootstock and its impact on growth, yield and amino acid profile at various stages of berry development was conducted during the year 2012-2013. Leaf and berry samples from ten year old vines of Thompson Seedless were collected at different growth and berry developmental stages. The analysis showed difference in photosynthetic activity, biochemical parameters and amino acid status with the changes in berry development stage. Higher photosynthetic rate of 17.39 umol cm(-2) s(-1) was recorded during 3-4mm berry size and the lowest (10.08 umol cm(-2) s(-1)) was recorded during the veraison stage. The photosynthetic activity showed gradual decrease with the onset of harvest while the different biochemical parameters showed increase and decrease from one stage to another in both berry and leaves. Changes in photosynthetic activity and biochemical parameters thereby affected the growth, yield and amino acid content of the berry. Positive correlation of leaf area and photosynthetic rate was recorded during the period of study. Reducing sugar (352.25 mg g(-1)) and total carbohydrate (132.52 mg g(-1)) was more in berries as compared to leaf. Amino acid profile showed variations in different stages of berry development. Marked variations in photosynthetic as well as biochemical and amino acid content at various berry development stages was recorded and thereby its cumulative effect on the development of fruit quality. PMID:25522520

  19. Quantitative Prediction of Cell Wall Polysaccharide Composition in Grape (Vitis vinifera L.) and Apple (Malus domestica) Skins from Acid Hydrolysis Monosaccharide Profiles

    DEFF Research Database (Denmark)

    Arnous, Anis; Meyer, Anne S.

    2009-01-01

    On the basis of monosaccharide analysis after acid hydrolysis of fruit skin samples of three wine grape cultivars, Vitis vinifera L. Cabernet Sauvignon, Merlot, and Shiraz, and of two types of apple, Malus domestica Red Delicious and Golden Delicious, an iterative calculation method is reported for...... the quantitative allocation of plant cell wall monomers into relevant structural polysaccharide elements. By this method the relative molar distribution (mol %) of the different polysaccharides in the red wine grape skins was estimated as 57-62 mol % homogalacturonan, 6.0-14 mol % cellulose, 10-11 mol......-47% by weight of the skins (dry matter), the rest mainly being lignin. The predicted relative molar levels of the polysaccharide elements in the apple skins, which made up similar to 49-64% by weight of the skins (dry matter), appeared to be similar to those of the grape skins. The apple skins were...

  20. Effects of various rootstocks on xylem exudates cytokinin content, nutrient uptake and growth patterns of grapevine Vitis vinifera L. cv. Thompson seedless

    OpenAIRE

    Nikolaou, Nikolaos; Koukourikou, Magdalini; Karagiannidis, Nikitas

    2000-01-01

    Étude de l'effet de différents porte-greffes sur la concentration en cytokinines dans les pleurs du bois, l'absorption minérale et les caractéristiques de croissance de la vigne Vitis vinifera cv. Sultanine. Les variations de la teneur en cytokinines et en éléments minéraux des exudats du xylème récoltés avant le débourrement, de la compositions minérale du limbe et du pétiole à la véraison, et de la croissance des rameaux ont été étudiées en fonction du porte-greffe. Les essais ont été réali...

  1. Separation and identification of highly fluorescent compounds derived from trans-resveratrol in the leaves of Vitis vinifera infected by Plasmopara viticola.

    Science.gov (United States)

    Tříska, Jan; Vrchotová, Naděžda; Olejníčková, Julie; Jílek, Rudolf; Sotolář, Radek

    2012-01-01

    A method for identification of highly fluorescent compounds in vine leaves infected by Plasmopara viticola was developed using reversed phase liquid chromatography with simultaneous diode array and fluorometric detection. Fluorescent compounds were extracted from leaves with a methanol-water mixture (70:30). Separation by HPLC was performed using a C(18) column and gradient elution with water-acetonitrile mixtures (20-80% of acetonitrile). The main unknown fluorescent compound was identified by line spectral comparison with a standard obtained by UV photoisomerization of trans-resveratrol glucoside, and its structure was confirmed by liquid chromatography-mass spectrometry. Identification and structural elucidation of the fluorescent compound in the leaves of Vitis vinifera allows early detection of Plasmopara viticola invasion. PMID:22395406

  2. Separation and Identification of Highly Fluorescent Compounds Derived from trans-Resveratrol in the Leaves of Vitis vinifera Infected by Plasmopara viticola

    Directory of Open Access Journals (Sweden)

    Radek Sotolář

    2012-03-01

    Full Text Available A method for identification of highly fluorescent compounds in vine leaves infected by Plasmopara viticola was developed using reversed phase liquid chromatography with simultaneous diode array and fluorometric detection. Fluorescent compounds were extracted from leaves with a methanol-water mixture (70:30. Separation by HPLC was performed using a C18 column and gradient elution with water-acetonitrile mixtures (20–80% of acetonitrile. The main unknown fluorescent compound was identified by line spectral comparison with a standard obtained by UV photoisomerization of trans-resveratrol glucoside, and its structure was confirmed by liquid chromatography-mass spectrometry. Identification and structural elucidation of the fluorescent compound in the leaves of Vitis vinifera allows early detection of Plasmopara viticola invasion.

  3. Phenolic compounds and properties of antioxidants in grapevine roots (Vitis vinifera L. under low-temperature stress followed by recovery

    Directory of Open Access Journals (Sweden)

    Stanisław Weidner

    2011-04-01

    Full Text Available The research has been performed on roots of Vitis vinifera, cv. Himrod, obtained from seedlings grown under chill stress conditions (+10oC in the day and +7oC at night, under optimum conditions (+25oC in the day and +18oC at night and from seedling which underwent a recover period after the chill stress treatment. The purpose of the study has been to determine quantitative and qualitative changes in phenolic compounds as well as to demonstrate changes in antiradical properties of extracts from grapevine roots, which appeared as a result of chill stress and during recovery under the optimum conditions following the stress. Phenolic compounds from grapevine roots were extracted using 80% acetone. The total content of phenolics was determined by colorimetry. The content of tannins was tested by precipitation with bovine serum albumin. The reducing power as well as DPPH• free radical and ABTS+• cation radical scavenging activity of the extracts were also tested. In order to identify phenolic compounds present in the extracts the RP-HPLC technique was employed. The tested material was found to contain tannins and three identified phenolic acids: ferulic, caffeic and p-coumaric ones. The latter occurred in the highest concentrations (from 4.46 to 6.28 µg/g fresh matter. Ferulic acid appeared in smaller amounts (from 1.68 to 2.65 µg/g fresh matter, followed by caffeic acid (from 0.87 to 1.55 µg/g fresh matter. Significantly less total phenolic compounds occurred in roots of seedlings subjected to chill stress. However, the total content of these compounds increased significantly in roots of plants which underwent recovery after chill stress. Concentration of tannins was determined by two methods. The content of condensed tannins was depressed in roots as a result of low temperature stress, whereas the content of condensed and hydrolysing tannins (determined via the BSA method rose under chill stress conditions. A significant increase in tannins

  4. Crystallization and preliminary X-ray crystallographic analysis of UDP-glucuronic acid:flavonol-3-O-glucuronosyltransferase (VvGT5) from the grapevine Vitis vinifera

    International Nuclear Information System (INIS)

    The UDP-glucuronic acid:flavonol-3-O-glucuronosyltransferase (VvGT5) from the grapevine V. vinifera was purified and crystallized. The best crystal diffracted X-rays to 2.2 Å resolution and belonged to space group P6122. Grapevine (Vitis vinifera) glycosyltransferase 5 (VvGT5) is a UDP-glucuronic acid:flavonol-3-O-glucuronosyltransferase that catalyses the 3-O-specific glucuronosylation of flavonols using UDP-glucuronic acid as a sugar donor to produce flavonol 3-O-glucosides, which are important bioactive phytochemicals. Recombinant VvGT5 expressed in Escherichia coli cells was purified and crystallized by the sitting-drop vapour-diffusion method. A full set of X-ray diffraction data was collected to 2.2 Å Bragg spacing from a single crystal using a synchrotron-radiation source. The crystal was hexagonal, belonging to space group P6122, with unit-cell parameters a = b = 102.70, c = 535.92 Å. The initial phases were determined by the molecular-replacement method

  5. Determination of polyphenols and antioxidant activity of Vitis labrusca cv. baile berries.

    Science.gov (United States)

    Nile, Shivraj Hariram; Park, Se Won

    2015-10-01

    Grape juice and grape skin extracts are important commercial source of polyphenolic compounds which exert different functional properties such as color potential, antimicrobial, antioxidant activity, and health benefits. In this paper we describe a sensitive and specific assay for determination of bioactive polyphenolic compounds in Campbell Early (Vitis labrusca cv. baile). Five polyphenolic components were separated on an Agilent Zorbax Extend C18 Column (250 mm x 4.6 mm x 5 μm) and detected by a diode array detector. The mobile phase was composed of (a) aqueous phosphoric acid (0.2%, v/v); and (b) acetonitrile using a gradient elution. Analytes were performed at 25 degrees C with a flow rate of 0.8 ml/min and UV detection at 280, 360, and 520 nm. All calibration curves showed good linear regression (r2 ≥ 0.9999) within tested ranges. Overall intra- and inter-day variations were less than 1.90%, and the average recoveries were 95.5-105% for analytes. The antioxidant activity determined by DPPH radical assay, ranged from 86-105 for extracts, and 165-252 for studied standards (μM trolox/100 g dry wt.). The proposed method would be sensitive enough and reliable for quality control in functional food and modernization of Campbell Early (Vitis labrusca cv. baile) as potent antioxidant agents. PMID:26665298

  6. General and species-specific transcriptional responses to downy mildew infection in a susceptible (Vitis vinifera and a resistant (V. riparia grapevine species

    Directory of Open Access Journals (Sweden)

    Lovato Arianna

    2010-02-01

    Full Text Available Abstract Background Downy mildew is a destructive grapevine disease caused by Plasmopara viticola (Berk. and Curt. Berl. and de Toni, which can only be controlled by intensive fungicide treatments. Natural sources of resistance from wild grapevine (Vitis species are used in conventional breeding approaches, but the signals and effectors involved in resistance in this important crop species are not well understood. Results Early transcriptional changes associated with P. viticola infection in susceptible V. vinifera and resistant V. riparia plants were analyzed using the Combimatrix microarray platform. Transcript levels were measured 12 and 24 h post-inoculation, reflecting the time points immediately preceding the onset of resistance in V. riparia, as determined by microscopic analysis. Our data indicate that resistance in V. riparia is induced after infection, and is not based on differences in basal gene expression between the two species. The strong and rapid transcriptional reprogramming involves the induction of pathogenesis-related proteins and enzymes required for the synthesis of phenylpropanoid-derived compounds, many of which are also induced, albeit to a lesser extent, in V. vinifera. More interestingly, resistance in V. riparia also involves the specific modulation of numerous transcripts encoding components of signal transduction cascades, hypersensitive reaction markers and genes involved in jasmonate biosynthesis. The limited transcriptional modulation in V. vinifera represents a weak attempted defense response rather than the activation of compatibility-specific pathways. Conclusions Several candidate resistance genes were identified that could be exploited in future biotechnological approaches to increase disease resistance in susceptible grapevine species. Measurements of jasmonic acid and methyl jasmonate in infected leaves suggest that this hormone may also be involved in V. riparia resistance to P. viticola.

  7. Influência do solvente no conteúdo total de polifenóis, antocianinas e atividade antioxidante de extratos de bagaço de uva (Vitis vinifera variedades Tannat e Ancelota Solvent Influence on total polyphenol content, anthocyanins, and antioxidant activity of grape (Vitis vinifera bagasse extracts from Tannat and Ancelota - different varieties of Vitis vinifera varieties

    Directory of Open Access Journals (Sweden)

    Ismael Ivan Rockenbach

    2008-12-01

    Full Text Available Diferentes sistemas solventes foram aplicados para determinar a eficiência de extração de compostos com capacidade antioxidante em bagaço de uva, importante subproduto do processo de vinificação. Realizou-se a quantificação de compostos fenólicos totais, antocianinas totais e atividade antioxidante nos extratos de bagaço de uva Vitis vinifera das variedades Tannat e Ancelota, provenientes da região de Videira, Santa Catarina. A atividade antioxidante foi determinada pelos métodos ABTS, FRAP e β-caroteno/ácido linoléico. Conteúdos de compostos fenólicos totais em acetona 50 e 70% foram maiores nas duas variedades, enquanto que os conteúdos de antocianinas totais extraídos em ambas as variedades foram maiores no solvente etanol em concentrações de 50 e 70%. Pelo método ABTS, a atividade antioxidante foi maior nas concentrações de 50 e 70% de acetona para a variedade Tannat e 50 e 70% de acetona e etanol para a variedade Ancelota. Em relação ao poder redutor pelo método FRAP, este foi maior em solvente acetona 70% para as duas variedades. No ensaio do poder de inibição da oxidação, a adição de 100 e 200 µL de extratos etanólicos a 50% das variedades Tannat e Ancelota apresentou maior eficiência, sendo quase duas vezes superior aos extratos acetônicos testados.Different solvent systems were applied in order to determine the extraction efficiency of compounds with antioxidant capacity from grape bagasse, an important by-product from wine production. The quantification of total phenolics, anthocyanins, and antioxidant activity was carried out in grape bagasse extracts of Tannat and Ancelota varieties from the region of Videira, state of Santa Catarina. The antioxidant activity was determined by ABTS, FRAP, and β-carotene/linoleic acid system methods. Extracts from acidified aqueous solutions of acetone and ethanol in different concentrations (v/v showed higher yield in aqueous solutions of acetone 50 and 70% for

  8. Phenolic Compound Profiles in Berry Skins from Nine Red Wine Grape Cultivars in Northwest China

    OpenAIRE

    Xiang-Yun Cui; Chang-Qing Duan; Jian-Jun He; He-Qiong Bi; Zan-Min Jin

    2009-01-01

    Phenolic compound profiles were investigated by HPLC-MS in two consecutive years to assess genotypic variation in berry skins of nine red Vitis vinifera cultivars. The results showed that the types and levels of phenolic compounds greatly varied with cultivar. Common wine grape cultivars such as Syrah, Cabernet Sauvignon, Cabernet Gernischt and Merlot contained more types of anthocyanins, flavonols, flavan-3-ols, stilbenes and phenolic acids than Gamay, Yan73, Pinot Noir, Zinfandel and Мускат...

  9. Caracterização fenológica e produtiva das videiras 'Cabernet Sauvignon' e 'Alicante' (Vitis vinifera L. produzidas fora de época, no norte do Paraná Phenological and productive characterization out of season of 'Cabernet Sauvignon' and 'Alicante' (Vitis vinifera L. grapevines in the north of Paraná

    Directory of Open Access Journals (Sweden)

    Bruno da Silva Jubileu

    2010-06-01

    Full Text Available Este trabalho objetivou caracterizar a fenologia e a produção das videiras 'Cabernet Sauvignon' e 'Alicante' (Vitis vinifera L. produzidas fora de época, no norte do Paraná, para a elaboração de vinho tinto. A área experimental foi instalada em uma propriedade comercial pertencente à Vinícola Intervin®, em Maringá-PR. As videiras foram conduzidas em latada sobre o 'IAC 766 Campinas'. As avaliações tiveram início a partir das podas de frutificação para a produção fora de época, durante dois anos consecutivos, realizadas no fim de janeiro de 2007 e 2008, onde foram utilizadas 20 plantas representativas de cada variedade. Avaliou-se a duração, em dias, das principais fases fenológicas das videiras, bem como estimadas a produção por planta e a produtividade de cada variedade. A evolução de maturação das uvas foi determinada pela análise semanal do teor de sólidos solúveis totais (SST, acidez titulável (AT e índice de maturação (SST/AT. A duração média do ciclo da videira 'Cabernet Sauvignon' foi de 128 dias, enquanto da 'Alicante' foi de 131 dias, sendo consideradas tardias ambas as variedades para a região norte do Paraná. As estimativas da produção por planta e produtividade foram de 12,4 kg e 22,3 t.ha-1 para a uva 'Cabernet Sauvignon' e 11,9 kg e 19,8 t.ha-1 para a 'Alicante'. Os teores médios de SST, AT e SST/AT foram de 19,2 °Brix, 1,8% de ácido tartárico e 11,6 para a uva 'Cabernet Sauvignon', e 19,1 °Brix, 1,3% de ácido tartárico e 14,1, para a 'Alicante'. Ambas as variedades apresentam elevadas produtividades e matéria-prima adequada para processamento quando produzidas fora de época no norte do Paraná.This study aimed to characterize the phenology and the production of 'Cabernet Sauvignon' and 'Alicante' (Vitis vinifera L. grapes produced out of season in the north of Paraná State for red wine elaboration. The experimental area was located in a commercial property belonging to the

  10. Historical reconstruction of a relictual population of wild grapevines (Vitis vinifera SSP sylvestris, Gmelin, Hegi) in a floodplain forest of the upper Seine valley, France

    OpenAIRE

    Arnold, Claire; Schnitzler, Annik; Parisot, Christophe; Maurin, Alexandre

    2011-01-01

    Wild grapevine (Vitis vinifera ssp sylvestris) is considered to be nearly extinct in its western range as a result of the expansion of American diseases combined with drastic hydraulic works in the region. In such a context, the discovery of a population of 120 individuals, offered an excellent opportunity to evaluate the status of the plant at the current edge of its western range. We focussed on the distribution patterns and the reconstruction of the history of the population through a comb...

  11. Understanding the Constitutive and Induced Biosynthesis of Mono- and Sesquiterpenes in Grapes (Vitis vinifera): A Key to Unlocking the Biochemical Secrets of Unique Grape Aroma Profiles.

    Science.gov (United States)

    Schwab, Wilfried; Wüst, Matthias

    2015-12-16

    The present review integrates current knowledge on mono- and sesquiterpenes in grapes with a special focus on biochemical and physiological aspects. Recent research has impressively shown the prominence of terpenoid metabolism in grapevine (Vitis sp). The 69 putatively functional mono- and sesquiterpene synthases that were identified by the analysis of the updated 12-fold sequencing and assembly of the grapevine genome deliver the scaffolds for structural diversity and display a surprising expansion of the terpene synthase (TPS) gene family in grapevine when compared to other plants like Arabidopsis thaliana (32 TPS). While monoterpenes occur as highly functionalized compounds and are stored as their corresponding glycoconjugates in berry tissues, sesquiterpenes are mainly present as unsaturated hydrocarbons and accumulate in the epicuticular wax layer of intact berries. Interestingly, both groups of terpenes appear to be involved as volatile organic compounds in plant defense and their biosynthesis is enhanced via the jasmonic acid signaling pathway. These novel aspects will help to understand how environmental cues affect the genes and enzymes of various metabolic pathways of relevant wine aroma compounds with numerous links to enology and wine flavor chemistry. PMID:26592256

  12. The crucial role of Φ- and K-segments in the in vitro functionality of Vitis vinifera dehydrin DHN1a.

    Science.gov (United States)

    Rosales, Raquel; Romero, Irene; Escribano, Ma Isabel; Merodio, Carmen; Sanchez-Ballesta, Ma Teresa

    2014-12-01

    Dehydrins (DHNs), group II LEA (Late Embryogenesis Abundant) proteins, are among the most commonly observed proteins which accumulate in plants in response to cold and any other environmental factors, causing the dehydration of cells. In previous studies, we isolated a YSK2-type VvcDHN1a gene from table grapes (Vitis vinifera cv. Cardinal) which presented two spliced variants (the spliced, DHN1a_s and the unspliced, DHN1a_u). Their expression was induced by low temperature storage and CO2, although with different accumulation patterns. DHN1a_u codifies for a truncated YS protein lacking Ф- and K-segments, which might affect its functionality. In this work, we expressed both DHN1a_s and DHN1a_u recombinant proteins in Escherichia coli. We carried out a number of in vitro assays to analyze the implications that Ф- and K-segments have in the protective role of VvcDHN1 against different abiotic stresses and their antifungal activity against the fungal pathogen Botrytis cinerea. Our results showed that unlike DHN1a_u, DHN1a_s has a potent cryoprotective effect on lactate dehydrogenase activity, protects malate dehydrogenase against dehydration and partially inhibits B. cinerea growth. Moreover, the DHN1a promoter presented cis-regulatory elements related to cold and drought, as well as biotic stress-related elements. We also observed that both spliced variants interact weakly with DNA, suggesting that K-segments are not involved in DNA binding. Overall, this work highlights the crucial role of Ф- and K-segments in DHNs function in plant response to abiotic stress showing for the first time, the potential role of the V. vinifera DHN1a_s in the protection against freezing and dehydration as well as inhibiting B. cinerea growth. PMID:25457499

  13. Diversity of bacterial endophytes in 3 and 15 year-old grapevines of Vitis vinifera cv. Corvina and their potential for plant growth promotion and phytopathogen control.

    Science.gov (United States)

    Andreolli, Marco; Lampis, Silvia; Zapparoli, Giacomo; Angelini, Elisa; Vallini, Giovanni

    2016-02-01

    This study represents the first investigation on ecology of endophytic bacteria isolated from 3 and 15 year-old vine stems of Vitis vinifera cv. Corvina. The analysis was performed by means of culture-dependent techniques. The obtained results showed that new grapevine endophytic genera are being discovered. Moreover, Bacilli and Actinobacteria are frequently isolated from 3 year-old plants, whereas Alpha- and Gamma- Proteobacteria classes are more prevalent in the 15 year-old plants. Shannon-Wiener (H) index and analysis of rarefaction curves revealed greater genus richness in young grapevine plants. Furthermore, results evidenced an increase of genotypic group number within specific genera (e.g., Rhizobium and Pantoea). Among isolated strains from 3 and 15 year-old stems, respectively, 34 and 39% produce siderophores; 22 and 15% secrete ammonia; 22 and 21% produce indole-3-acetic acid; 8.7 and 41% solubilize phosphate. Besides, two strains isolated from 15 year-old grapevines showed 1-aminocyclopropane-1-carboxylate deaminase activity. Antifungal activity analysis evidenced that two Bacillus strains possess growth antagonistic effect toward all the tested fungal strains. Therefore, the present study extends our knowledge of the diversity of the endophytic bacteria by providing new insights into the complexity of the grapevine microbiome. PMID:26805617

  14. Leaf blade and petiole nutritional diagnosis for Vitis vinifera L. cv. 'Tempranillo' by deviation from optimum percentage method

    Energy Technology Data Exchange (ETDEWEB)

    Romero, I.; Benito, A.; Dominguez, N.; Garcia-Escudero, E.

    2014-06-01

    Deviation from optimum percentage (DOP) is a diagnosis methodology for leaf analyses which expresses the deviation for each element with respect to its optimal concentration. This deviation is an individual index for each nutrient and allows the sorting of all the analyzed nutrients according to their limitations. A nutritional survey was undertaken over eleven years in La Rioja (Spain), to establish reference concentrations for the nutritional diagnosis of Vitis vinifera L., cv. 'Tempranillo' grafted on Richter-110. Reference concentrations for DOP methodology are proposed, and sensibility for the nutritional diagnosis was evaluated for blade and petiole analysis of N, P, K, Ca, Mg, Fe, Mn, Zn, Cu, and B at flowering and veraison phenological stages by comparison between DOP and sufficiency ranges (SR) methods. Results suggest that petiole has lower sensibility than blade to detect deficiencies or excesses of N, P, K, Ca, Mg, Zn, and Mn at veraison. In addition, petiole is a better tissue than blade to detect Fe and B deficiencies or excesses. Therefore, our results make possible the right choice between tissues, leaf blade or petiole, for a general nutritional diagnosis of 'Tempranillo' grapevines. On the other hand, it is possible to evaluate the status of each nutrient in each phonological stage analyzing both tissues and comparing the nutrient status to its references, DOP or SR, in the most adequate tissue. (Author)

  15. A novel green synthesis of Fe{sub 3}O{sub 4}-Ag core shell recyclable nanoparticles using Vitis vinifera stem extract and its enhanced antibacterial performance

    Energy Technology Data Exchange (ETDEWEB)

    Venkateswarlu, Sada; Natesh Kumar, B.; Prathima, B. [Analytical and inorganic Division of Chemistry, S.V. University, Tirupati-517502, Andhra Pradesh (India); Anitha, K. [Department of Chemistry, S.K. University, Anantapur-515003, Andhra Pradesh (India); Jyothi, N.V.V., E-mail: nvvjyothi01@gmail.com [Analytical and inorganic Division of Chemistry, S.V. University, Tirupati-517502, Andhra Pradesh (India)

    2015-01-15

    We described a novel and eco-friendly method for preparing Fe{sub 3}O{sub 4}-Ag core shell nanoparticles (CSNPs) with high magnetism and potent antibacterial activity. The Fe{sub 3}O{sub 4}-Ag CSNPs were obtained using waste material of Vitis vinifera (grape) stem extract as the green solvent, reducing and capping agent. The result recorded from X-ray powder diffraction (XRD), UV–vis spectrum, energy dispersive spectroscopy (EDS), Fourier transform infrared spectroscopy (FT-IR) supports the biosynthesis and characterization of Fe{sub 3}O{sub 4}-Ag CSNPs. From transmission electron microscopy (TEM) the size of the Fe{sub 3}O{sub 4}-Ag nanoparticles was measured below 50 nm; high-resolution TEM (HRTEM) indicates the core shell structure; and selected area electron diffraction (SAED) has revealed polycrystalline nature. Vibrating sample magnetometer (VSM) shows the ferromagnetic nature of Fe{sub 3}O{sub 4}-Ag CSNPs at room temperature with saturation magnetization of 15.74 emu/g. Further, these biogenic nanoparticles were highly hazardous to microorganisms. The antibacterial activity of biogenic Fe{sub 3}O{sub 4}-Ag CSNPs showed potent inhibitory activity against both Gram-positive and Gram-negative pathogens. These nanoparticles may also be reusable because of its excellent ferromagnetic property.

  16. Effects of exogenous growth regulators on cell suspension culture of yin-hong grape (vitis vinifera l.) and establishment of the optimum medium

    International Nuclear Information System (INIS)

    Callus induced by stem of Yin-hong grape (Vitis vinifera L.) was used as materials and B5 medium as basic medium. The major growth parameters of cell suspension cultures with various levels of 1-Naphthaleneacetic acid (NAA) and 6-Benzyl aminopurine (6-BA) were investigated to provide a basis for the optimum medium of suspension cell cultures of Yin-hong grape regarding cell number, packed cell volume (PCV), dry cell weight (DCW), cell viability, and morphology. All data were analysed by of two-way analysis of variance (ANOVA). Results showed that the treatment of 6-BA and NAA would effect the cell growth dynamics, probably causing logarithmic phase in advance at higher levels of 6-BA. Different concentration of 6-BA and NAA had significant effects on cells number, PCV, DCW and viability (p<0.05), while no-significant effect was observed on the cells morphology. The optimum medium for suspension cell cultures of Yin-hong grape was identified as B5+1.5 mg/L6-BA+1.5 mg/LNAA+ 250 mg/L casein hydrolysate + 30 g/L sucrose. With the optimum medium, the maximum number of suspension cells after the logarithmic growth phase was 34.78 * 108 / mL, the highest cell viability reached 86.45%.; DCW reached 3.84 g/L and PCV reached 0.092 mL/mL after eight days cultivating. (author)

  17. Chemical composition and bioactive compounds of grape pomace (Vitis vinifera L., Benitaka variety, grown in the semiarid region of Northeast Brazil

    Directory of Open Access Journals (Sweden)

    Eldina Castro Sousa

    2014-03-01

    Full Text Available Grape pomace (Vitis vinifera L., Benitaka variety, grown in the semiarid region of Northeast Brazil was evaluated in relation to chemical composition, and content of minerals and functional properties. Its microbiological quality and toxic potential, using Artemia salina sp, were also investigated. The results showed that the flour obtained from these residues had below neutral pH (3.82, moisture (3.33g/100g, acidity of (0.64g of citric acid/100g, and ash (4.65 g/100g. The amount of total dietary fiber (46.17g/100g stood out quantitatively compared to the content of carbohydrate (29.2g/100 g, protein (8.49g/100g, and lipids (8.16g/100g. The total energy was 224Kcal/100g. With regard to the compounds with functional properties, higher values of insoluble fiber 79% (36.4 g/100 g; vitamin C (26.25 mg of acid ascorbic/100g, and anthocyanins (131mg/100g were found. The minerals iron, potassium, zinc, manganese, and calcium were present in higher concentrations. There were no significant copper values. The results showed that the grape residues are an important source of nutrients and compounds with functional properties suggesting that they can be incorporated as an ingredient in the diet and/or used as a dietary supplement aiming at health benefits. The residues did not show microbiological contamination and were considered nontoxic.

  18. Characterization of a bifunctional O- and N-glucosyltransferase from Vitis vinifera in glucosylating phenolic compounds and 3,4-dichloroaniline in Pichia pastoris and Arabidopsis thaliana.

    Directory of Open Access Journals (Sweden)

    Zhi-Sheng Xu

    Full Text Available 2,4,5-Trichlorophenol, 2,6-dimethylphenol, 3-methylcatechol, phenol, hydroquinone, catechol, and 3,4-dichloroaniline are present in the environment and are risky to humans and animals because of their wide applications in many industries. In this study, a putative uridine diphosphate glucose-dependent glycosyltransferase from Vitis vinifera (VvUGT72B1 displayed high O-glucosyltransferase or N-glucosyltransferase activity toward all these xenbiotics and was able to enhance the resistance of P. pastoris to them. Compared with wild-type Arabidopsis plants, VvUGT72B1-transgenic Arabidopsis plants showed higher resistance to all the xenobiotics except for phenol and exhibited higher removal efficiencies against all xenobiotics. Glucosides of 3-methylcatechol, 2,6-dimethylphenol, phenol, and 3,4-dichloroaniline were exported to the surrounding media by Arabidopsis plants while transgenic Arabidopsis plants exported more glucosides than wild-type Arabidopsis plants. Our findings have the potential to provide a broader spectrum remediation strategy for the phytoremoval and degradation of phenolic compounds and 3,4-dichloroaniline than previous works.

  19. Analysis of the diastereoisomers of the cysteinylated aroma precursor of 3-sulfanylhexanol in Vitis vinifera grape must by gas chromatography coupled with ion trap tandem mass spectrometry.

    Science.gov (United States)

    Thibon, Cécile; Shinkaruk, Svitlana; Tominaga, Takatoshi; Bennetau, Bernard; Dubourdieu, Denis

    2008-03-01

    The diastereoisomeric distribution of S-3-(hexan-1-ol)cysteine (P-3SH), the cysteinylated precursor of 3-sulfanylhexan-1-ol (3SH) in Vitis vinifera grape juice, was determined by a new method. This procedure is based on the purification of P-3SH in a small volume of must (500 microL) by affinity chromatography, followed by the separation of chiral molecules in derivative forms by gas chromatography coupled with ion trap tandem mass spectrometry (GC-MS/MS). The diastereoisomers were easily separated using heptafluorobutyric anhydride and heptafluorobutanol (HFBA and HFOH) as derivatization reagents. Method validation was conducted using samples of grape juice, synthetic must, fermenting must, and wine that were fortified with P-3SH at concentrations of 0.6 and 2.5 microM. The relative standard deviation (RSD) and limit of detection (LOD) of the GC-MS/MS method were 4.6% and 1.5 nM, respectively. P-3SH assays in Bordeaux white grape juice affected by Botrytis cinerea showed an unusually increased proportion of the RS form of the precursor (approximately RR:RS=30:70) as compared to a diastereoisomer ratio (in the vicinity of 50:50) in healthy grape juice. PMID:18249409

  20. A novel green synthesis of Fe3O4-Ag core shell recyclable nanoparticles using Vitis vinifera stem extract and its enhanced antibacterial performance

    International Nuclear Information System (INIS)

    We described a novel and eco-friendly method for preparing Fe3O4-Ag core shell nanoparticles (CSNPs) with high magnetism and potent antibacterial activity. The Fe3O4-Ag CSNPs were obtained using waste material of Vitis vinifera (grape) stem extract as the green solvent, reducing and capping agent. The result recorded from X-ray powder diffraction (XRD), UV–vis spectrum, energy dispersive spectroscopy (EDS), Fourier transform infrared spectroscopy (FT-IR) supports the biosynthesis and characterization of Fe3O4-Ag CSNPs. From transmission electron microscopy (TEM) the size of the Fe3O4-Ag nanoparticles was measured below 50 nm; high-resolution TEM (HRTEM) indicates the core shell structure; and selected area electron diffraction (SAED) has revealed polycrystalline nature. Vibrating sample magnetometer (VSM) shows the ferromagnetic nature of Fe3O4-Ag CSNPs at room temperature with saturation magnetization of 15.74 emu/g. Further, these biogenic nanoparticles were highly hazardous to microorganisms. The antibacterial activity of biogenic Fe3O4-Ag CSNPs showed potent inhibitory activity against both Gram-positive and Gram-negative pathogens. These nanoparticles may also be reusable because of its excellent ferromagnetic property

  1. Physiological parameters and protective energy dissipation mechanisms expressed in the leaves of two Vitis vinifera L. genotypes under multiple summer stresses.

    Science.gov (United States)

    Palliotti, Alberto; Tombesi, Sergio; Frioni, Tommaso; Silvestroni, Oriana; Lanari, Vania; D'Onofrio, Claudio; Matarese, Fabiola; Bellincontro, Andrea; Poni, Stefano

    2015-08-01

    Photosynthetic performances and energy dissipation mechanisms were evaluated on the anisohydric cv. Sangiovese and on the isohydric cv. Montepulciano (Vitis vinifera L.) under conditions of multiple summer stresses. Potted vines of both cultivars were maintained at 90% and 40% of maximum water availability from fruit-set to veraison. One week before veraison, at predawn and midday, main gas-exchange and chlorophyll fluorescence parameters, chlorophyll content, xanthophyll pool and cycle and catalase activity were evaluated. Under water deficit and elevated irradiance and temperature, contrary to cv. Montepulciano and despite a significant leaf water potential decrease, Sangiovese's leaves kept their stomata more open and continued to assimilate CO2 while also showing higher water use efficiency. Under these environmental conditions, in comparison with the isohydric cv. Montepulciano, the protective mechanisms of energy dissipation exerted by the anisohydric cv. Sangiovese were: (i) higher stomatal conductance and thermoregulation linked to higher transpiration rate; (ii) greater ability at dissipating more efficiently the excess energy via the xanthophylls cycle activity (thermal dissipation) due to higher VAZ pool and greater increase of de-epoxidation activity. PMID:26310367

  2. Instability of anthocyanin composition under different subculture conditions during long-term suspension cultures of Vitis vinifera L. var. Gamay Fréaux.

    Science.gov (United States)

    Qu, Junge; Zhang, Wei; Yu, Xingju

    2011-11-01

    The instability of secondary metabolite production is a ubiquitous problem in plant cell culture. In order to understand the instability in plant cell culture, we investigated anthocyanin accumulation in suspension cultures of Vitis vinifera, as a model system, in our laboratory. Not only the anthocyanin contents but also its composition exhibited instability along with the long-term subculture. New methods were developed to indicate the instability of plant cell culture. Both the definition of instability coefficient (delta) and the application of factor scores were the first time in this field. To examine the effects of culture conditions on instability of anthocyanin biosynthesis, different subculture cycles and inoculum sizes had been investigated. Subculture cycle and inoculum size were both environmental cues driving the instability. Compared with subculture cycle, inoculum size was more effective in working on the instability of anthocyanin accumulation. Among all the conditions investigated in our study, (6.5 d, 2.00 g), (7 d, 2.00 g), (7.5 d, 2.00 g), (7 d, 1.60 g) and (7 d, 2.40 g), the condition of 7 d-subculture cycle together with 1.60 g-inoculum size was the best one to keep the stable production of anthocyanins. PMID:22393716

  3. Profiling of resveratrol oligomers, important stress metabolites, accumulating in the leaves of hybrid Vitis vinifera (Merzling × Teroldego) genotypes infected with Plasmopara viticola.

    Science.gov (United States)

    Mattivi, Fulvio; Vrhovsek, Urska; Malacarne, Giulia; Masuero, Domenico; Zulini, Luca; Stefanini, Marco; Moser, Claudio; Velasco, Riccardo; Guella, Graziano

    2011-05-25

    In the Vitaceae, viniferins represent a relatively restricted group of trans-resveratrol oligomers with antifungal properties, thus enabling plants to cope with pathogen attack. The aim of this study was to perform isolation and structural characterization of the whole class of viniferins accumulating in the leaves of hybrid Vitis vinifera (Merzling × Teroldego) genotypes infected with Plasmopara viticola . Infected leaves of resistant plants were collected 6 days after infection, extracted with methanol, and prepurified by flash chromatography using ENV+ and Toyopearl HW 40S resins. Further fractionation using normal-phase preparative chromatography and then reversed-phase preparative chromatography allowed isolation of 14 peaks. The isolated compounds were identified using advanced mass spectrometry techniques and extensive one- and two-dimensional nuclear magnetic resonance measurements, UV, CD, optical properties, and molecular mechanic calculations. The results demonstrated the presence in infected leaves of seven dimers (six stilbenes and one stilbenoid), of which four were new in grapevine (ampelopsin D, quadrangularin A, E-ω-viniferin, and Z-ω-viniferin), four trimers (three stilbenes and one stilbenoid), of which two (Z-miyabenol C and E-cis-miyabenol C) were new in grapevine, three tetramer stilbenoids, all new in grapevine, isohopeaphenol, ampelopsin H, and a vaticanol C-like isomer. The isolation of a dimer deriving from the condensation of (+)-catechin with trans-caffeic acid also indicated that other preformed phenolics are structurally modified in tissues infected with P. viticola. PMID:21510709

  4. Preparation and textural characterisation of activated carbon from vine shoots ( Vitis vinifera) by H 3PO 4—Chemical activation

    Science.gov (United States)

    Corcho-Corral, B.; Olivares-Marín, M.; Fernández-González, C.; Gómez-Serrano, V.; Macías-García, A.

    2006-06-01

    An abundant and low-cost agricultural waste as vine shoots ( Vitis vinifera) (VS), which is generated by the annual pruning of vineyards, has been used as raw material in the preparation of powder activated carbon (AC) by the method of chemical activation with phosphoric acid. After size reduction, VS were impregnated for 2 h with 60 wt.% H 3PO 4 solution at room temperature, 50 and 85 °C. The three impregnated products were carbonised at 400 °C. The product impregnated at 50 °C was heated either first at 150-250 °C and then at 400 °C or simply at 350-550 °C in N 2 atmosphere. The time of isothermal treatment after each dynamic heating was 2 h. The carbons were texturally characterised by gas adsorption (N 2, -196 °C), mercury porosimetry, and density measurements. FT-IR spectroscopy was also applied. Better developments of surface area and microporosity are obtained when the impregnation of VS with the H 3PO 4 solution is effected at 50 °C and for the products heated isothermally at 200 and 450 °C. The mesopore volume is also usually higher for the products impregnated and heated at intermediate temperatures.

  5. Comparative Transcriptomic Profiling of Vitis vinifera Under High Light Using a Custom-Made Array and the Affymetrix GeneChip

    Institute of Scientific and Technical Information of China (English)

    Luisa C. Carvalho; Belmiro J. Vilela; Phil M. Mullineaux; Sara Am(a)ncio

    2011-01-01

    Understanding abiotic stress responses is one of the most important issues in plant research nowadays.Abiotic stress,including excess light,can promote the onset of oxidative stress through the accumulation of reactive oxygen species.Oxidative stress also arises when in vitro propagated plants are exposed to high light upon transfer to ex vitro.To determine whether the underlying pathways activated at the transfer of in vitro grapevine to ex vitro conditions reflect the processes occurring upon light stress,we used Vitis vinifera Affymetrix GeneChip (VvGA) and a custom array of genes responsive to light stress (LSCA) detected by real-time reverse transcriptase PCR (qRT-PCR).When gene-expression profiles were compared,‘protein metabolism and modification',‘signaling',and ‘anti-oxidative' genes were more represented in LSCA,while,in VvGA,‘cell wall metabolism' and ‘secondary metabolism' were the categories in which gene expression varied more significantly.The above functional categories confirm previous studies involving other types of abiotic stresses,enhancing the common attributes of abiotic stress defense pathways.The LSCA analysis of our experimental system detected strong response of heat shock genes,particularly the protein rescuing mechanism involving the cooperation of two ATP-dependent chaperone systems,Hsp100 and Hsp70,which showed an unusually late response during the recovery period,of extreme relevance to remove non-functional,potentially harmful polypeptides arising from misfolding,denaturation,or aggregation brought about by stress.The success of LSCA also proves the feasibility of a custommade qRT-PCR approach,particularly for species for which no GeneChip is available and for researchers dealing with a specific and focused problem.

  6. Effects of chilling and ABA on [3H]gibberellin A4 metabolism in somatic embryos of grape (Vitis vinifera L. x V. rupestris Scheele)

    International Nuclear Information System (INIS)

    Previous work has indicated that changes in gibberellin (GA) metabolism may be involved in chilling-induced release from dormancy in somatic embryos of grape (Vitis vinifera L. x V. rupestris Scheele). The authors have chilled somatic embryos of grape for 2, 4, or 8 weeks, then incubated them with [3H]GA4 (of high specific activity, 4.81 x 1019 becquerel per millimole) for 48 hours at 260C. Chilling had little effect on the total amount of free [3H]GA-like metabolites formed during incubation at 260C, but did change the relative proportions of individual metabolites. The amount of highly water-soluble [3H] metabolites formed at 260C decreased in embryos chilled for 4 or 8 weeks. The concentration of endogeneous GA precursors (e.g., GA12 aldehyde-, kaurene, and kaurenoic acid-like substances) increased in embryos chilled for 4 or 8 weeks. Treatment with abscisic acid (ABA) (known to inhibit germination in grape embryos) concurrent with [3H]GA4 treatment at 260C, reduced the uptake of [3H] GA4 but had little effect on the qualitative spectrum of metabolites. However, in the embryos chilled for 8 weeks and then treated with ABA for 48 hours at 260C, there was a higher concentration of GA precursors than in untreated control embryos. Chilled embryos thus have an enhanced potential for an increase in free GAs through synthesis from increased amounts of GA precursors, or through a reduced ability to form highly water-soluble GA metabolites (i.e., GA conjugates or polyhydroxylated free GAs)

  7. Ancestral synteny shared between distantly-related plant species from the asterid (Coffea canephora and Solanum Sp. and rosid (Vitis vinifera clades

    Directory of Open Access Journals (Sweden)

    Guyot Romain

    2012-03-01

    Full Text Available Abstract Background Coffee trees (Rubiaceae and tomato (Solanaceae belong to the Asterid clade, while grapevine (Vitaceae belongs to the Rosid clade. Coffee and tomato separated from grapevine 125 million years ago, while coffee and tomato diverged 83-89 million years ago. These long periods of divergent evolution should have permitted the genomes to reorganize significantly. So far, very few comparative mappings have been performed between very distantly related species belonging to different clades. We report the first multiple comparison between species from Asterid and Rosid clades, to examine both macro-and microsynteny relationships. Results Thanks to a set of 867 COSII markers, macrosynteny was detected between coffee, tomato and grapevine. While coffee and tomato genomes share 318 orthologous markers and 27 conserved syntenic segments (CSSs, coffee and grapevine also share a similar number of syntenic markers and CSSs: 299 and 29 respectively. Despite large genome macrostructure reorganization, several large chromosome segments showed outstanding macrosynteny shedding new insights into chromosome evolution between Asterids and Rosids. We also analyzed a sequence of 174 kb containing the ovate gene, conserved in a syntenic block between coffee, tomato and grapevine that showed a high-level of microstructure conservation. A higher level of conservation was observed between coffee and grapevine, both woody and long life-cycle plants, than between coffee and tomato. Out of 16 coffee genes of this syntenic segment, 7 and 14 showed complete synteny between coffee and tomato or grapevine, respectively. Conclusions These results show that significant conservation is found between distantly related species from the Asterid (Coffea canephora and Solanum sp. and Rosid (Vitis vinifera clades, at the genome macrostructure and microstructure levels. At the ovate locus, conservation did not decline in relation to increasing phylogenetic distance

  8. Low level of pollen-mediated gene flow from cultivated to wild grapevine: consequences for the evolution of the endangered subspecies Vitis vinifera L. subsp. silvestris.

    Science.gov (United States)

    Di Vecchi-Staraz, Manuel; Laucou, Valérie; Bruno, Gérard; Lacombe, Thierry; Gerber, Sophie; Bourse, Thibaut; Boselli, Maurizio; This, Patrice

    2009-01-01

    A parentage and a paternity-based approach were tested for estimation of pollen-mediated gene flow in wild grapevine (Vitis vinifera L. subsp. silvestris), a wind-pollinated species occurring in Mediterranean Europe and southwestern Asia. For this purpose, 305 seedlings collected in 2 years at 2 locations in France from 4 wild female individuals and 417 wild individuals prospected from France and Italy were analyzed using 20 highly polymorphic microsatellite loci. Their profiles were compared with a database consisting of 3203 accessions from the Institut National de la Recherche Agronomique Vassal collection including cultivars, rootstocks, interspecific hybrids, and other wild individuals. Paternity was assigned for 202 (66.2%) of the 305 seedlings, confirming the feasibility of the method. Most of the fertilizing pollen could be assigned to wild males growing nearby. Estimates of pollen immigration from the cultivated compartment (i.e., the totality of cultivars) ranged from 4.2% to 26% from nearby vineyards and from hidden pollinators such as cultivars and rootstocks that had escaped from farms. In an open landscape, the pollen flow was correlated to the distance between individuals, the main pollinator being the closest wild male (accounting for 51.4-86.2% of the pollen flow). In a closed landscape, more complex pollination occurred. Analysis of the parentage of the 417 wild individuals also revealed relationships between nearby wild individuals, but in the case of 12 individuals (3%), analysis revealed pollen immigration from vineyards, confirming the fitness of the hybrid seedlings. These pollen fluxes may have a significant effect on the evolution of wild populations: on the one hand, the low level of pollen-mediated gene flow from cultivated to wild grapevine could contribute to a risk of extinction of the wild compartment (i.e., the totality of the wild individuals). On the other hand, pollen dispersal within the wild populations may induce inbreeding

  9. Rhizosphere associated bacteria trigger accumulation of terpenes in leaves of Vitis vinifera L. cv. Malbec that protect cells against reactive oxygen species.

    Science.gov (United States)

    Salomon, María Victoria; Purpora, Rebeca; Bottini, Rubén; Piccoli, Patricia

    2016-09-01

    It has been proposed that plant growth promoting rhizobacteria (PGPR) stimulate plant growth and development by inducing the biosynthesis of secondary metabolites, like terpenes, which reduce stress incidence. Three bacteria previously isolated from grapevine roots and adjacent soil (Microbacterium imperiale Rz19M10, Kocuria erythromyxa Rt5M10 and Terribacillus saccharophilus Rt17M10) were tested as PGPR. After 30 days since root inoculation of in vitro grown Vitis vinifera cv. Malbec plants, the monoterpenes α-pinene, terpinolene and 4-carene, and the sesquiterpene nerolidol were detected only in bacterized-plant leaves. Also, the concentrations of the diterpenes α and γ-tocopherol, and the sterols sitosterol and lupeol were significantly enhanced compared to controls. The leaf extracts of bacterized plants showed photoprotective properties since they decreased the oxygen consumption (that is photo-oxidation) of the amino acid tryptophan in a sensitized solution, thus indicating an increment of the antioxidant capacity of the tissues. In addition, experiments with α-pinene and nerolidol standards showed the capability to intercept reactive oxygen species in the sensitized solution. Moreover, bacterized plants infected with the pathogen Botrytis cinerea showed a reduction in the lesion diameter compared with non-bacterized plants. The results suggest that M. imperiale, K. erythromyxa and mainly T. saccharophilus are able to induce a systemic response that trigger increases on monoterpenes, sesquiterpenes, tocopherols and membrane sterols. These compounds enhance the antioxidant capacity in leaf tissues that may help grapevine to cope with stresses. PMID:27231874

  10. Ontology-oriented retrieval of putative microRNAs in Vitis vinifera via GrapeMiRNA: a web database of de novo predicted grape microRNAs

    Directory of Open Access Journals (Sweden)

    Fontana Paolo

    2009-06-01

    Full Text Available Abstract Background Two complete genome sequences are available for Vitis vinifera Pinot noir. Based on the sequence and gene predictions produced by the IASMA, we performed an in silico detection of putative microRNA genes and of their targets, and collected the most reliable microRNA predictions in a web database. The application is available at http://www.itb.cnr.it/ptp/grapemirna/. Description The program FindMiRNA was used to detect putative microRNA genes in the grape genome. A very high number of predictions was retrieved, calling for validation. Nine parameters were calculated and, based on the grape microRNAs dataset available at miRBase, thresholds were defined and applied to FindMiRNA predictions having targets in gene exons. In the resulting subset, predictions were ranked according to precursor positions and sequence similarity, and to target identity. To further validate FindMiRNA predictions, comparisons to the Arabidopsis genome, to the grape Genoscope genome, and to the grape EST collection were performed. Results were stored in a MySQL database and a web interface was prepared to query the database and retrieve predictions of interest. Conclusion The GrapeMiRNA database encompasses 5,778 microRNA predictions spanning the whole grape genome. Predictions are integrated with information that can be of use in selection procedures. Tools added in the web interface also allow to inspect predictions according to gene ontology classes and metabolic pathways of targets. The GrapeMiRNA database can be of help in selecting candidate microRNA genes to be validated.

  11. Responses of In vitro-Grown Plantlets (Vitis vinifera) to Grapevine leafroll-Associated Virus-3 and PEG-Induced Drought Stress

    Science.gov (United States)

    Cui, Zhen-Hua; Bi, Wen-Lu; Hao, Xin-Yi; Xu, Yan; Li, Peng-Min; Walker, M. Andrew; Wang, Qiao-Chun

    2016-01-01

    Stresses caused by viral diseases and drought have long threatened sustainable production of grapevine. These two stresses frequently occur simultaneously in many of grapevine growing regions of the world. We studied responses of in vitro-grown plantlets (Vitis vinifera) to Grapevine leafroll associated virus-3 (GLRaV-3) and PEG-induced drought stress. Results showed that stress induced by either virus infection or drought had negative effects on vegetative growth, caused significant decreases and increases in total soluble protein and free proline, respectively, induced obvious cell membrane damage and cell death, and markedly increased accumulations of O2·- and H2O2. Co-stress by virus and drought had much severer effects than single stress on the said parameters. Virus infection alone did not cause significant alternations in activities of POD, ROS, and SOD, and contents of MDA, which, however, markedly increased in the plantlets when grown under single drought stress and co-stress by the virus and drought. Levels of ABA increased, while those of IAA decreased in the plantlets stressed by virus infection or drought. Simultaneous stresses by the virus and drought had co-effects on the levels of ABA and IAA. Up-regulation of expressions of ABA biosynthesis genes and down-regulation of expressions of IAA biosynthesis genes were responsible for the alternations of ABA and IAA levels induced by either the virus infection or drought stress and co-stress by them. Experimental strategies established in the present study using in vitro system facilitate investigations on ‘pure’ biotic and abiotic stress on plants. The results obtained here provide new insights into adverse effects of stress induced by virus and drought, in single and particularly their combination, on plants, and allow us to re-orientate agricultural managements toward sustainable development of the agriculture. PMID:27313542

  12. Production Performance of ‘Malvaisa Bianca’ grape (Vitis vinifera L. grown in Subtropical Regions / Comportamento da uva ‘Malvasia Bianca’ (Vitis vinifera L. cultivada em zona subtropical

    Directory of Open Access Journals (Sweden)

    Cristiano Ezequiel dos Santos

    2007-08-01

    Full Text Available The objective of this study was to assess the phenotypic/phenology and production performance of ‘Malvasiva Bianca’ grape used to make white wine at North of Parana State. The experiment was done in one vineyard located in Maringa, PR, conducted pergola system accounting with an space of 4.0 X 1.5 m enxert about IAC 766 Campinas. Twenty plants were used previously identified and market during two consecutive harvest seasons (2004/2005 and 2005/2006. The phenotipic performance of grape vives was assessed considering duration of time in days of their principal phases. The chemical characteristics of the berries were assessed performing weekly analysis of pH measurements, Total Solutable Solid (TSS, titratable Acidity (AT and relationship TSS/TA, starting at the biggining of the maturing process until seven days after harvesting. The production characteristics were assessed considering the average diameter and average mass weight of the berry, number on average of clusters per plant, average mass weight of the cluster and estimates of production and productivity on each plant. The duration of production’s cicle (cutting to harvest in this region was on average 127 days. Due the harvest period, the pH’s average, SST, AT levels and the relationship SST/AT of the berries ranged were 3.6 ; 21.2 °Brix; 0.6% of Tartaric Acid and 36.0 respectively. The berry presented on average 15.5 mm and 2.2g. It was observed on average 62 clusters per plant, with mass weight of 0.3 Kg; production of 20.0 Kg per plant and productivity of 33.3 t/ha. The results showed that the ‘Malvasia Bianca’ grape presents a great potential to be cultivated for further make aromatic white wine at North of Parana State.O presente trabalho teve como objetivo avaliar o comportamento fenológico e produtivo da uva ‘Malvasia Bianca’ destinada à elaboração de vinhos brancos aromáticos no norte do Paraná. O experimento foi realizado em um vinhedo localizado em Maring

  13. Pre-harvest application of polyamines enhances antioxidants and table grape (Vitis vinifera L.) quality during postharvest period.

    Science.gov (United States)

    Mirdehghan, S H; Rahimi, S

    2016-04-01

    Pre-harvest foliar spraying of grapevines with putrescine (Put) and spermidine (Spd) (0, 1, 2mM) was evaluated for determining the fruit quality at harvest and improving postharvest characteristics of table grapes during cold storage. Fruit parameters in terms of firmness, fungal infection, weight loss, total phenol concentration, antioxidant activity, skin color, total anthocyanin concentration, total soluble solids (TSS) and titratable acidity (TA) were evaluated after 0, 25 and 55 days of storage at 1.5 ± 1 °C and 90 ± 5% R.H. Softening, fungal infection and weight loss increased during cold storage but the rate of changes significantly was delayed in Put- and Spd-treated fruits. Besides these, the application of Put and Spd maintained higher values of phenolics content, antioxidant activity and anthocyanins at the end of storage in compare to control. Furthermore, after 55 days of storage all treated fruits with Put and Spd showed lower changes in L(∗), TSS and TA and also higher value of chroma in berries. PMID:26593587

  14. Distinctive Anthocyanin Accumulation Responses to Temperature and Natural UV Radiation of Two Field-Grown Vitis vinifera L. Cultivars

    Directory of Open Access Journals (Sweden)

    Ana Fernandes de Oliveira

    2015-01-01

    Full Text Available The responses of two red grape varieties, Bovale Grande (syn. Carignan and Cannonau (syn. Grenache, to temperature and natural UV radiation were studied in a three-years field experiment conducted in Sardinia (Italy, under Mediterranean climate conditions. Vines were covered with plastic films with different transmittances to UV radiation and compared to uncovered controls. Light intensity and spectral composition at the fruit zone were monitored and berry skin temperature was recorded from veraison. Total skin anthocyanin content (TSA and composition indicated positive but inconsistent effects of natural UV light. Elevated temperatures induced alterations to a greater extent, decreasing TSA and increasing the degree of derivatives acylation. In Cannonau total soluble solids increases were not followed by increasing TSA as in Bovale Grande, due to both lower phenolic potential and higher sensitivity to permanence of high temperatures. Multi linear regression analysis tested the effects of different ranges of temperature as source of variation on anthocyanin accumulation patterns. To estimate the thermal time for anthocyanin accumulation, the use of normal heat hours model had benefit from the addition of predictor variables that take into account the permanence of high (>35 °C and low (<15 °C and <17 °C temperatures during ripening.

  15. Characterization of a multifunctional caffeoyl-CoA O-methyltransferase activated in grape berries upon drought stress.

    Science.gov (United States)

    Giordano, Debora; Provenzano, Sofia; Ferrandino, Alessandra; Vitali, Marco; Pagliarani, Chiara; Roman, Federica; Cardinale, Francesca; Castellarin, Simone D; Schubert, Andrea

    2016-04-01

    Drought stress affects anthocyanin accumulation and modification in vegetative and reproductive plant tissues. Anthocyanins are the most abundant flavonoids in grape (Vitis vinifera L.) coloured berry genotypes and are essential markers of grape winemaking quality. They are mostly mono- and di-methylated, such modifications increase their stability and improve berry quality for winemaking. Anthocyanin methylation in grape berries is induced by drought stress. A few caffeoyl-CoA O-methyltransferases (CCoAOMTs) active on anthocyanins have been described in grape. However, no drought-activated O-methyltransferases have been described in grape berries yet. In this study, we characterized VvCCoAOMT, a grapevine gene known to induce methylation of CoA esters in cultured grape cells. Transcript accumulation of VvCCoAOMT was detected in berry skins, and increased during berry ripening on the plant, and in cultured berries treated with ABA, concomitantly with accumulation of methylated anthocyanins, suggesting that anthocyanins may be substrates of this enzyme. Contrary as previously observed in cell cultures, biotic stress (Botrytis cinerea inoculation) did not affect VvCCoAOMT gene expression in leaves or berries, while drought stress increased VvCCoAOMT transcript in berries. The recombinant VvCCoAOMT protein showed in vitro methylating activity on cyanidin 3-O-glucoside. We conclude that VvCCoAOMT is a multifunctional O-methyltransferase that may contribute to anthocyanin methylation activity in grape berries, in particular under drought stress conditions. PMID:26851572

  16. Phenology, Canopy Aging and Seasonal Carbon Balance as Related to Delayed Winter Pruning of Vitis vinifera L. cv. Sangiovese Grapevines

    Science.gov (United States)

    Gatti, Matteo; Pirez, Facundo J.; Chiari, Giorgio; Tombesi, Sergio; Palliotti, Alberto; Merli, Maria C.; Poni, Stefano

    2016-01-01

    Manipulating or shifting annual grapevine growing cycle to offset limitations imposed by global warming is a must today, and delayed winter pruning is a tool to achieve it. However, no information is available about its physiological background, especially in relation to modifications in canopy phenology, demography and seasonal carbon budget. Mechanistic hypothesis underlying this work was that very late winter pruning (LWP) can achieve significant postponement of phenological stages so that ripening might occur in a cooler period and, concurrently, ripening potential can be improved due to higher efficiency and prolonged longevity of the canopy. Variability in the dynamics of the annual cycle was created in mature potted cv. Sangiovese grapevines subjected to either standard winter pruning (SWP) or late and very late winter pruning (LWP, VLWP) performed when apical shoots on the unpruned canes were at the stage of 2 and 7 unfolded leaves. Vegetative growth, phenology and canopy net CO2 exchange (NCER) were followed throughout the season. Despite LWP and VLWP induced a bud-burst delay of 17 and 31 days vs. SWP, the delay was fully offset at harvest for LWP and was reduced to 6 days in VLWP. LWP showed notably higher canopy efficiency as shorter time needed to reach maximum NCER/leaf area (22 days vs. 34 in SWP), highest maximum NCER/leaf area (+37% as compared to SWP) and higher NCER/leaf area rates from veraison to end of season. As a result, seasonal cumulated carbon in LWP was 17% higher than SWP. A negative functional relationship was also established between amount of leaf area removed at winter pruning and yield per vine and berry number per cluster. Although retarded winter pruning was not able to postpone late-season phenological stages under the warm conditions of this study, it showed a remarkable potential to limit yield while improving grape quality, thereby fostering the hypothesis that it could be used to replace time-consuming and costly cluster

  17. Phenology, Canopy Aging and Seasonal Carbon Balance as Related to Delayed Winter Pruning of Vitis vinifera L. cv. Sangiovese Grapevines.

    Science.gov (United States)

    Gatti, Matteo; Pirez, Facundo J; Chiari, Giorgio; Tombesi, Sergio; Palliotti, Alberto; Merli, Maria C; Poni, Stefano

    2016-01-01

    Manipulating or shifting annual grapevine growing cycle to offset limitations imposed by global warming is a must today, and delayed winter pruning is a tool to achieve it. However, no information is available about its physiological background, especially in relation to modifications in canopy phenology, demography and seasonal carbon budget. Mechanistic hypothesis underlying this work was that very late winter pruning (LWP) can achieve significant postponement of phenological stages so that ripening might occur in a cooler period and, concurrently, ripening potential can be improved due to higher efficiency and prolonged longevity of the canopy. Variability in the dynamics of the annual cycle was created in mature potted cv. Sangiovese grapevines subjected to either standard winter pruning (SWP) or late and very late winter pruning (LWP, VLWP) performed when apical shoots on the unpruned canes were at the stage of 2 and 7 unfolded leaves. Vegetative growth, phenology and canopy net CO2 exchange (NCER) were followed throughout the season. Despite LWP and VLWP induced a bud-burst delay of 17 and 31 days vs. SWP, the delay was fully offset at harvest for LWP and was reduced to 6 days in VLWP. LWP showed notably higher canopy efficiency as shorter time needed to reach maximum NCER/leaf area (22 days vs. 34 in SWP), highest maximum NCER/leaf area (+37% as compared to SWP) and higher NCER/leaf area rates from veraison to end of season. As a result, seasonal cumulated carbon in LWP was 17% higher than SWP. A negative functional relationship was also established between amount of leaf area removed at winter pruning and yield per vine and berry number per cluster. Although retarded winter pruning was not able to postpone late-season phenological stages under the warm conditions of this study, it showed a remarkable potential to limit yield while improving grape quality, thereby fostering the hypothesis that it could be used to replace time-consuming and costly cluster

  18. Epiphyas postvittana (Lepidoptera: Tortricidae)-Botrytis cinerea (Helotiales: Sclerotiniaceae)-Vitis vinifera (Vitales: Vitaceae) Interaction: The Role of B. cinerea on the Development of E. postvittana in Synthetic Nutritional Media.

    Science.gov (United States)

    Rizvi, S Z M; Raman, A

    2015-08-01

    Epiphyas postvittana (Walker) (light-brown apple moth) is a polyphagous herbivore of economic significance, which also feeds on Vitis vinifera L. The E. postvittana-V. vinifera interacting system also involves the participation of the fungus Botrytis cinerea Persoon ex Fries. We have been exploring the relationship among E. postvittana-V. vinifera-B. cinerea over the past two years. In this article, we report the preference and performance of the larvae of E. postvittana raised solely on a synthetic diet incorporated with the mycelial material of B. cinerea (Diet B). To characterize the effect of fungus on the development of E. postvittana, another synthetic diet was prepared that included the lyophilized leaf material of V. vinifera (Diet C). When raised on Diets B and C, a decrease in the duration of larval development and an increase in the survival and fecundity rate of E. postvittana occurred. Diet B influenced the pupal mass, but a significant increase occurred when the larvae were fed on Diet C. The larval emergence rate was the greatest in E. postvittana raised on Diet B, followed by those on Diet C. The F2 generation of the larvae reared on Diet B showed similar effects as F1 on the life-history performance of the larvae. Diet B enhanced the life-history performance of E. postvittana, although the larvae of E. postvittana showed little preference to Diet B. The greater fertility rate of E. postvittana reared on Diet B suggests the importance of sterols as shown in Lobesia botrana (Denis & Schiffermüller) (Lepidoptera: Tortricidae) and in a few Myrmicinae (Hymenoptera: Formicidae), which serve as precursors to different ecdysteroids that regulate many critical processes through embryonic development. PMID:26470305

  19. Concentrações de cloreto de cálcio e tempos de armazenamento nos teores de açúcares redutores de uvas cv red globe (Vitis vinifera L Calcium chloride concentrations and storage time on reducing sugar contents of grape cv red globe (Vitis vinifera L

    Directory of Open Access Journals (Sweden)

    Geny Lopes de Carvalho

    2008-06-01

    Full Text Available Objetivou-se avaliar a ação do cloreto de cálcio na doçura pós-colheita de uvas 'Red Globe' (Vitis vinifera L cultivadas em Jales, noroeste do Estado de São Paulo, foram adotados os procedimentos: os cachos foram tratados por imersão durante 10 minutos em soluções CaCl2 0, 1, 2 e 3% e deixados por 30, 60 e 90 dias a uma temperatura de 0ºC a 3ºC, 90+ 3% de UR e 0,2 0,3 m/s de velocidade do ar, após os quais foram deixados em temperatura ambiente (20 a 25ºC, para avaliações aos 0, 3 e 6 dias. O delineamento experimental foi inteiramente casualizado em esquema fatorial 4 x 3 x 3 (concentrações de CaCl2 x tempo de armazenamento refrigerado x tempo de armazenamento em temperatura ambiente com três repetições. Foram feitas avaliações de açúcares redutores totais (g 100g -1, frutose (g 100g -1 e glicose (g 100g -1. Os teores de açúcares redutores totais, frutose e glicose dos frutos variaram com a aplicação de CaCl2, tempos de armazenamento a frio e em temperatura ambiente. Destaca-se a frutose cujos teores em todas as concentrações de CaCl2 (1, 2 e 3%, aos 30 e 60 dias de armazenamento refrigerado e 3 e 6 dias em temperatura ambiente, foram superiores aos teores dos frutos controle. Conclui-se que tratamentos com CaCl2 propicia às uvas melhor sabor, sendo indicada a concentração de CaCl2 2% e o armazenamento a frio por 60 dias e em temperatura ambiente até seis dias.This work was carried out with the aim of evaluating the calcium chloride influence on both post harvest sweetness of grapes 'Red Globe' (Vitis vinifera L grown in Jales, in the northwest of São Paulo State. The procedures adopted were as follows: banches were treated in a CaCla2 1%, 2%, and 3% immersion for 10 minutes and then left at na 0º C tempereture, 90 + 3% relative humidity, and 0,2-0,3 m/s air speed for 30, 60, and 90 days after which they were left at room temperature (20 to 25º C for evaluation. A ramdomized block design with a 4 x 3 x 3 (Ca

  20. Influência das condições climáticas sobre a eficácia de fungicidas empregados para o controle do míldio em Vitis vinifera Effect of environmental conditions on efficacy of fungicides to downy mildew control in Vitis vinifera

    Directory of Open Access Journals (Sweden)

    Ana Beatriz Costa Czermainski

    2004-02-01

    Full Text Available Um dos fatores a serem manejados para a máxima produtividade de um vinhedo é o míldio, doença causada por Plasmopara viticola, que afeta regiões produtoras de uva do mundo inteiro. No Brasil, são necessárias diversas aplicações de fungicida para seu controle. Diferentes princípios ativos são encontrados no mercado. Com base em resultados de ensaios de fungicidas para controle do míldio em Vitis vinifera conduzidos em 1995 e 1996, foi analisada a influência dos fatores climáticos temperatura do ar, precipitação e umidade relativa do ar sobre a eficácia dos produtos disponíveis. Os experimentos foram instalados na Embrapa Uva e Vinho, sobre a cv. Tannat, conduzida no sistema espaldeira. A análise dos fatores ambientais apontou períodos de infecções primárias e secundárias. A maior ocorrência de chuvas e alta umidade relativa do ar foram determinantes da maior severidade do míldio no ano de 1996. A análise da incidência e do índice de intensidade de doença em folhas e em cachos, indicou maior eficácia dos fungicidas cymoxanil + mancozeb, metalaxil + mancozeb e dithianona, nos dois anos. Os princípios ativos cúpricos - oxicloreto de cobre, isolado ou combinado com mancozeb, e sulfato de cobre - não foram eficazes para controlar o míldio nos cachos sob condições climáticas favoráveis à doença.One of the factors to be managed for maximum vineyard productivity is the downy mildew, disease caused by Plasmopara viticola that affects grape production in many parts of the world. In Brazil, several fungicide applications for its control are necessary. Different active ingredients are available on the market. The influence of climatic factors (air temperature, rainfall and relative humidity on fungicide efficacy in Vitis vinifera was analyzed using results of fungicide trials for downy mildew control as a base. The experiments were carried out at Embrapa Uva e Vinho with the cv. Tannat conducted on vertical trellis

  1. Acumulación de compuestos nitrogenados en relación al problema de baya blanda en uva de mesa Accumulation of nitrogen compounds as related to the "soft berry" problem in table grapes.

    Directory of Open Access Journals (Sweden)

    Rafael Ruiz S.

    2004-10-01

    Full Text Available Con el objeto de evaluar la probable incidencia de trastornos del metabolismo del N en el problema denominado "baya blanda" de la vid (Vitis vinifera L., a inicio de la cosecha 2002 se recolectaron muestras de bayas y raquis de racimos procedentes de un parronal Vitis vinifera L. cv. Thompson Seedless de la VI Región, Chile (34º15’ lat. Sur, 72º25’ long. Oeste con presencia de bayas "blandas", "intermedias" y "firmes". Los análisis indicaron que las bayas incluidas en las categorías blanda y/o intermedia presentaron una concentración mayor de N en la pulpa y en la piel, mayores niveles de arginina y de putrescina. Evaluaciones en la fruta indicaron que las bayas blandas presentaron además menor firmeza (menos de 190 g-fuerza mm-1, menor peso y menor concentración de sólidos solubles (°Brix. Los resultados indicaron una similitud con los factores que se han asociado al trastorno conocido como "palo negro".With the objective of evaluating a probable association between N metabolic disorders and the problem known as "soft berry" at the beginning of 2002 rachis and berries of bunches from a vineyard, Vitis vinifera L. cv. Thompson Seedless, of the VI Region, Chile (34º15’ S. lat, 72º25’ W. long with the presence of "soft", "intermediate", and "firm" berries were collected The results indicated that soft or intermediate berries had higher levels of N in the pulp and skin, and higher arginine and putrescine levels in berries and rachis. Evaluations of the fruit indicated that soft berries showed less firmness, less than 190 g-strength mm-1, less weight and less soluble solids (ºBrix. The results indicated some similarity with factors that have been associated to the disorder known as "bunch stem necrosis" or "waterberry".

  2. The relationships between consumer liking, sensory and chemical attributes of Vitis vinifera L. cv. Pinotage wines elaborated with different Oenococcus oeni starter cultures

    DEFF Research Database (Denmark)

    Malherbe, Sulette; Menichelli, Elena; du Toit, Maret; Tredoux, Andreas; Muller, Nina; Næs, Tormod; Nieuwoudt, Helene

    2013-01-01

    over two vintages by four different lactic acid Oenococcus oeni starter cultures as well as a control treatment where MLF was prevented. ResultsDescriptive analysis showed that the sensory attributes buttery, caramel, vegetative flavour, fruity and nutty aroma differed significantly between the wines......BackgroundMalolactic fermentation (MLF) mediated by lactic acid bacteria (LAB) has been shown to modulate chemical and sensory attributes of wine. This study investigated the relation between consumer liking, chemical and sensory attributes of Vitis vinifera L. cv. Pinotage wines that were made...... buttery character and various esters with fruity aromas. ConclusionAlthough the direct effect of the bacterial starter cultures on wine sensory attributes is difficult to establish, and subject to variation over vintage, the present work suggests that the contribution of LAB starter cultures to wine...

  3. Identification and quantification of phenolic compounds in berry skin, pulp, and seeds in 13 grapevine varieties grown in Serbia.

    Science.gov (United States)

    Pantelić, Milica M; Dabić Zagorac, Dragana Č; Davidović, Sonja M; Todić, Slavica R; Bešlić, Zoran S; Gašić, Uroš M; Tešić, Živoslav Lj; Natić, Maja M

    2016-11-15

    Phenolic profile of 13 grapevine varieties was determined, with respect to three different parts of berries: skin, seed and pulp. Identification and quantification of the phenols was done using ultra-high performance liquid chromatography (UHPLC) coupled with a diode array detector and a triple-quadrupole mass spectrometer. The most abundant phenols in grape seeds were found to be flavan-3-ols, most of which are gallocatechin gallate and catechin. The skins were characterized mostly by flavonols, i.e. quercetin and myricetin. Characterization of anthocyanins in the berry skin by UHPLC coupled with Linear Trap Quadrupole and OrbiTrap mass analyzer revealed a total of twenty derivatives of malvidin, delphinidin, petunidin, cyanidin, and peonidin. To the extent of our knowledge this is the first work that shows the presence of malvidin 3,5-O-dihexoside in the berry skin of 'Merlot', 'Cabernet Franc', 'Shiraz' 'Sangiovese', 'Pinot Noir' and 'Prokupac', untypical for Vitis vinifera Linneo species. PMID:27283628

  4. Transcriptomic and metabolite analyses of Cabernet Sauvignon grape berry development

    Directory of Open Access Journals (Sweden)

    Schlauch Karen A

    2007-11-01

    Full Text Available Abstract Background Grape berry development is a dynamic process that involves a complex series of molecular genetic and biochemical changes divided into three major phases. During initial berry growth (Phase I, berry size increases along a sigmoidal growth curve due to cell division and subsequent cell expansion, and organic acids (mainly malate and tartrate, tannins, and hydroxycinnamates accumulate to peak levels. The second major phase (Phase II is defined as a lag phase in which cell expansion ceases and sugars begin to accumulate. Véraison (the onset of ripening marks the beginning of the third major phase (Phase III in which berries undergo a second period of sigmoidal growth due to additional mesocarp cell expansion, accumulation of anthocyanin pigments for berry color, accumulation of volatile compounds for aroma, softening, peak accumulation of sugars (mainly glucose and fructose, and a decline in organic acid accumulation. In order to understand the transcriptional network responsible for controlling berry development, mRNA expression profiling was conducted on berries of V. vinifera Cabernet Sauvignon using the Affymetrix GeneChip® Vitis oligonucleotide microarray ver. 1.0 spanning seven stages of berry development from small pea size berries (E-L stages 31 to 33 as defined by the modified E-L system, through véraison (E-L stages 34 and 35, to mature berries (E-L stages 36 and 38. Selected metabolites were profiled in parallel with mRNA expression profiling to understand the effect of transcriptional regulatory processes on specific metabolite production that ultimately influence the organoleptic properties of wine. Results Over the course of berry development whole fruit tissues were found to express an average of 74.5% of probes represented on the Vitis microarray, which has 14,470 Unigenes. Approximately 60% of the expressed transcripts were differentially expressed between at least two out of the seven stages of berry

  5. Anthocyanin yield and skin softening during maceration, as affected by vineyard row orientation and grape ripeness of Vitis vinifera L. cv. Shiraz.

    Science.gov (United States)

    Giacosa, Simone; Marengo, Fabio; Guidoni, Silvia; Rolle, Luca; Hunter, Jacobus J

    2015-05-01

    Anthocyanin and mechanical properties were evaluated on Shiraz grapes, picked from both sides of North-South and East-West vineyard row orientations at two harvest dates. Wines were made from each combination. The evaluation and evolution of crushed skin mechanical properties during maceration-fermentation, as also affected by grape ripeness, are shown for the first time. No significant differences in anthocyanin content were found in the grapes between the two vineyard row orientations. However, a significant decrease in anthocyanins and berry skin break force (also referred as skin hardness or strength) was found between the two harvest dates. During maceration, a reduction in the crushed berry skin break force of more than 15% occurred. The intact berries and macerated skins showed similarity in skin break energy values. The anthocyanin profile of the grapes and of the wines prominently displayed malvidin forms, changed mainly by the ripeness level of the grapes. PMID:25529645

  6. Diagnóstico da área cultivada com uva fina de mesa (Vitis vinifera L sob cobertura plástica e do manejo de pragas Area grown with table grape (Vitis vinifera L under protected cultivation and pest management practices used by growers in Caxias do Sul, RS

    Directory of Open Access Journals (Sweden)

    Rodrigo Formolo

    2011-03-01

    Full Text Available Neste trabalho, foi realizado o censo das áreas cultivadas com uvas finas de mesa sob cultivo protegido e a identificação das principais espécies de pragas e estratégias de controle empregadas pelos produtores, no município de Caxias do Sul-RS. Na safra de 2007/2008, foram identificados os produtores envolvidos com a atividade no município e através de entrevista presencial e semiestruturada ao estabelecimento produtivo, registrou-se a área cultivada e variedades. Para produtores com cultivo de áreas superiores a 2.000m² da cultivar Itália, com dois anos ou mais de produção, foi aplicado outro questionário na safra de 2008/2009 com o objetivo de levantar as informações referentes: a espécies de insetos e ácaros-praga que danificam as uvas finas de mesa na propriedade, segundo o viticultor; b conhecer a realidade do manejo de insetos e ácaros-praga na cultura; c verificar os parâmetros que o produtor utiliza para a aplicação de inseticidas; d conhecer os produtos aplicados, e e identificar o tipo de assistência técnica recebida pelo viticultor. Foram identificados 43 produtores de uvas finas de mesa sob cultivo protegido com área total cultivada de 30,36 ha, sendo 70,31% desta área da cultivar Itália. As pragas mais importantes mencionadas pelos produtores foram tripes - Frankliniella rodeos Moulton e a mosca-das-frutas-sul-americana Anastrepha fraterculus (Wied. O manejo realizado para controle destas pragas é através da aplicação de inseticidas com os ingredientes ativos acefato e fentiona, respectivamente, com base em calendário. Os principais problemas enfrentados para implementar estratégias de manejo de pragas no cultivo são a falta de assistência técnica, a ausência de metodologias confiáveis para o monitoramento e o reduzido número de inseticidas autorizados para a cultura.The area grown with table grapes (Vitis vinifera under protected cultivation, pests associated with the crop and control

  7. 葡萄苯丙氨酸解氨酶基因家族的全基因组鉴定及表达分析%Genome-wide characterization and expression analysis of the phenylalanine ammonia-lyase gene family in grapevine (Vitis vinifera L.)

    Institute of Scientific and Technical Information of China (English)

    孙润泽; 张雪; 成果; 李强; 朱燕溶; 陈武; 潘秋红; 段长青; 王军

    2016-01-01

    Phenylalanine ammonia-lyase (PAL), the first enzyme in the phenylpropanoid pathway, plays critical roles in plant growth, development and resistance to biotic/abiotic stresses. In this research, a total of 17 PAL genes were identified from the Vitis vinifera reference genome by the bioinformatics methods. Thirteen of the VviPAL genes are arranged in tandem in two duplication blocks located on chromosomes 11 and 16, the rests are randomly distributed on other chromosomes. Phylogenetic tree analysis revealed that most of the VviPAL members have a closer relationship with PALs from other dicots species, whereas the four VviPALs arranged in tandem on chromosome 11, which classified into neither the dicot nor monocot group, may serve as ancestral PALs in plants. The full-length cDNA of five VviPAL genes were isolated from ‘Cabernet Sauvignon’ according to the reference transcriptome of ‘Cabernet Sauvignon’ grape berries. Sequence analysis of the deduced VviPAL proteins showed that all of them contain conserved functional domains, confirming that these VviPALs may have similar functions with PALs from other plant species. Expression profiling reveals that VviPAL2 and VviPAL15 were strongly expressed in all test organs/tissues, and their expression throughout berry development was positively correlated with the accumulation of phenolic compounds. Furthermore, the transcripts of VviPAL2, VviPAL4 and VviPAL7 in grape berries were induced by cluster sunlight exposure and suppressed by cluster shading, which might contribute to changes in metabolites accumulation.%苯丙氨酸解氨酶(PAL)作为苯丙烷途径的入口酶,与植物生长发育以及生物和非生物胁迫响应等生物过程密切相关。本研究通过生物信息学方法,在已测序的葡萄基因组中预测得到17个PAL基因,其中13个串联分布在第11和16号染色体的2个重复基因群中,4个随机分布于其他染色体。系统发育树分析表明,葡萄大部分PAL基因与

  8. Effects of Grapevine Leafroll associated Virus 3 (GLRaV-3) and duration of infection on fruit composition and wine chemical profile of Vitis vinifera L. cv. Sauvignon blanc.

    Science.gov (United States)

    Montero, R; Mundy, D; Albright, A; Grose, C; Trought, M C T; Cohen, D; Chooi, K M; MacDiarmid, R; Flexas, J; Bota, J

    2016-04-15

    In order to determine the effects of Grapevine Leafroll associated Virus 3 (GLRaV-3) on fruit composition and chemical profile of juice and wine from Vitis vinifera L. cv. Sauvignon blanc grown in New Zealand, composition variables were measured on fruit from vines either infected with GLRaV-3 (established or recent infections) or uninfected vines. Physiological ripeness (20.4°Brix) was the criterion established to determine the harvest date for each of the three treatments. Date of grape ripeness was strongly affected by virus infection. In juice and wine, GLRaV-3 infection prior to 2008 reduced titratable acidity compared with the uninfected control. Differences observed in amino acids from the three infection status groups did not modify basic wine chemical properties. In conclusion, GLRaV-3 infection slowed grape ripening, but at equivalent ripeness to result in minimal effects on the juice and wine chemistry. Time of infection produced differences in specific plant physiological variables. PMID:26675855

  9. VitisExpDB: A Database Resource for Grape Functional Genomics

    Science.gov (United States)

    VitisExpDB is an online MySQL-PHP driven relational database that houses annotated EST and gene expression data for Vitis vinifera and non-vinifera grape varieties. Currently, the database stores ~320,000 EST sequences derived from 8 species/hybrids, their annotation details and gene ontology based...

  10. Phenological behaviour of Vitis rotundifolia cultivars in Pinhais – PR / Comportamento fenológico de cultivares de Vitis rotundifolia em Pinhais – PR

    Directory of Open Access Journals (Sweden)

    Flávio Zanette

    2010-04-01

    Full Text Available The aim of this work was to characterize the phenological cycle of nine Vitis rotundifolia cultivars during the 2004/2005 season. The cultivars were Bontiful, Creek, Dixie, Magnolia, Magoon, Noble, Regale, Roanoke e Topsail. The experiment was performed on an orchard implanted in 1999 at the Canguiri Experimental Station of the Federal University of Paraná in Pinhais-PR. The phenology of two adult plants of each cultivar was monitored. The recorded phenological stages were: 1 Dormant bud; 2 Swollen bud; 3 Wool bud; 4 Green tip; 5 Bud burst (first leaf appearance; 6 Two to three leaves unfolded; 7 Five to six leaves unfolded; 8 Fully developed inflorescence; 9 Trace bloom (flowerhoods detached; 10 Full flowering (50% of the flowerhoods fallen; 11 Fruit set; 12 Groat-sized berries; 13 Pea-sized berries; 14 50% filled berries (beginning to touch berries; 15 Final size; 16 Color change; 17 Berries ripe for harvest; and 18 End of harvesting. A very long phenological cycle was observed when compared to species such as Vitis vinifera and Vitis labrusca. These evaluations allowed us to conclude that: a there is no difference in the phenological cycle periods between bronze and dark skinned cultivars; b cultivars presented desuniform wool bud to full flowering cycle, ranging from 25 days (‘Regale’ to 81 days (‘Creek’; c the cultivar Regale presented the longest cycle (203 days from full flowering to harvest and the cultivar Creek the shortest (136 days. The evaluated cultivars additionally presented desuniform ripening and a tendency to drop berries. O objetivo foi caracterizar o ciclo fenológico de nove cultivares de Vitis rotundifolia avaliadas na safra de 2004/2005. As cultivares estudadas foram as seguintes: Bontiful, Creek, Dixie, Magnolia, Magoon, Noble, Regale, Roanoke e Topsail. O trabalho foi realizado em um pomar do Setor de Fruticultura da Estação Experimental do Canguiri da Universidade Federal do Paraná, em Pinhais-PR, sendo que

  11. The Effects of Bud Load and Applied Water Amounts on the Biochemical Composition of the ‘Narince’ Grape Variety (Vitis vinifera L.

    Directory of Open Access Journals (Sweden)

    Serpil GOK TANGOLAR

    2015-12-01

    Full Text Available This study evaluated the effects of various bud load and water amounts (WA on the berry composition of the ‘Narince’ white wine grape variety. Two water amounts (WA-I and WA-II administered during growth stages or a non-irrigated (rain-fed control treatment were paired with two different bud loads (K (normal and 2K (two-fold buds to assess their effects on sugar, organic acid and  phenolic compound contents, as well as antioxidant capacity of the berries for a white wine grape variety ‘Narince’. Despite a slight decrease observed only in sugars in the second year, increases in all phenolic compounds examined (especially in catechin and epicatechin were detected in the WA-I application. The total phenolic compound values obtained for 2K in the same application was also high. The antioxidant capacity values were not significantly affected by the irrigation or bud load applications. Therefore, a 2K bud load with WA-I treatments in which 50% and 75% of the cumulative evaporation from the Class A pan during berry set to veraison and veraison to ripening, respectively, are recommended for irrigation in high plateau viticulture. By maintaining or increasing the fruit composition of ‘Narince’ grapes, these treatments can optimize grape yield and the earnings of growers. In all applications, glucose (among the sugars, tartaric acid (among the organic acids, and catechin and epicatechin (among the phenolic compounds were higher than their counterparts.

  12. RNA sequencing reveals high resolution expression change of major plant hormone pathway genes after young seedless grape berries treated with gibberellin.

    Science.gov (United States)

    Chai, Lijuan; Li, Yanmei; Chen, Shangwu; Perl, Avihai; Zhao, Fengxia; Ma, Huiqin

    2014-12-01

    Seedless varieties are of particular importance to the table-grape and raisin industries. Gibberellin (GA) application is widely used in the early stages of seedless berry development to increase berry size and economic value. However, the underlying mechanism of GA induction of berry enlargement is not well understood. Here, RNA-sequencing analysis of 'Centennial Seedless' (Vitis vinifera L.) berries treated with GA3 12 days after flowering is reported. Pair-wise comparison of GA3-treated and control samples detected 165, 444, 463 genes with an over two-fold change in expression 1, 3, and 7 days after GA3 treatment, respectively. The number of differentially expressed genes increased with time after GA3 treatment, and the differential expression was dominated by downregulation. Significantly modulated expression included genes encoding synthesis and catabolism to manage plant hormone homeostasis, hormone transporters, receptors and key components in signaling pathways; exogenous GA3 induced multipoint cross talk with auxin, cytokinin, brassinosteroid, ABA and ethylene. The temporal gene-expression patterns of cell-wall-modification enzymes, cytoskeleton and membrane components and transporters revealed a pivotal role for cell-wall-relaxation genes in GA3-induced berry enlargement. Our results provide the first sequential transcriptomic atlas of exogenous GA3-induced berry enlargement and reveal the complexity of GA3's effect on berry sizing. PMID:25443848

  13. Microcollinearity in an ethylene receptor coding gene region of the Coffea canephora genome is extensively conserved with Vitis vinifera and other distant dicotyledonous sequenced genomes

    Directory of Open Access Journals (Sweden)

    Campa Claudine

    2009-02-01

    Full Text Available Abstract Background Coffea canephora, also called Robusta, belongs to the Rubiaceae, the fourth largest angiosperm family. This diploid species (2x = 2n = 22 has a fairly small genome size of ≈ 690 Mb and despite its extreme economic importance, particularly for developing countries, knowledge on the genome composition, structure and evolution remain very limited. Here, we report the 160 kb of the first C. canephora Bacterial Artificial Chromosome (BAC clone ever sequenced and its fine analysis. Results This clone contains the CcEIN4 gene, encoding an ethylene receptor, and twenty other predicted genes showing a high gene density of one gene per 7.8 kb. Most of them display perfect matches with C. canephora expressed sequence tags or show transcriptional activities through PCR amplifications on cDNA libraries. Twenty-three transposable elements, mainly Class II transposon derivatives, were identified at this locus. Most of these Class II elements are Miniature Inverted-repeat Transposable Elements (MITE known to be closely associated with plant genes. This BAC composition gives a pattern similar to those found in gene rich regions of Solanum lycopersicum and Medicago truncatula genomes indicating that the CcEIN4 regions may belong to a gene rich region in the C. canephora genome. Comparative sequence analysis indicated an extensive conservation between C. canephora and most of the reference dicotyledonous genomes studied in this work, such as tomato (S. lycopersicum, grapevine (V. vinifera, barrel medic M. truncatula, black cottonwood (Populus trichocarpa and Arabidopsis thaliana. The higher degree of microcollinearity was found between C. canephora and V. vinifera, which belong respectively to the Asterids and Rosids, two clades that diverged more than 114 million years ago. Conclusion This study provides a first glimpse of C. canephora genome composition and evolution. Our data revealed a remarkable conservation of the microcollinearity

  14. Life history and assessment of grapevine phylloxera leaf galling incidence on Vitis species in Uruguay

    OpenAIRE

    Vidart, María Valeria; Mujica, María Valentina; Bao, Leticia; Duarte, Felicia; Bentancourt, Carlos María; Franco, Jorge; Scatoni, Iris Beatriz

    2013-01-01

    Grapevine phylloxera, Daktulosphaira vitifoliae (Fitch) (Hemiptera: Phylloxeridae) is a worldwide pest of Vitis species. It has forms that feed on leaves and roots. Root forms predominate on Vitis vinifera (L.) cultivars, while leaf forms predominate on Vitis species from its native American range. Recently, high densities of D. vitifoliae infestations in leaves of V. vinifera in Brazil, Peru, and Uruguay have been reported. The aims of this study were to determine the seasonal development of...

  15. Developmental and Metabolic Plasticity of White-Skinned Grape Berries in Response to Botrytis cinerea during Noble Rot.

    Science.gov (United States)

    Blanco-Ulate, Barbara; Amrine, Katherine C H; Collins, Thomas S; Rivero, Rosa M; Vicente, Ariel R; Morales-Cruz, Abraham; Doyle, Carolyn L; Ye, Zirou; Allen, Greg; Heymann, Hildegarde; Ebeler, Susan E; Cantu, Dario

    2015-12-01

    Noble rot results from exceptional infections of ripe grape (Vitis vinifera) berries by Botrytis cinerea. Unlike bunch rot, noble rot promotes favorable changes in grape berries and the accumulation of secondary metabolites that enhance wine grape composition. Noble rot-infected berries of cv Sémillon, a white-skinned variety, were collected over 3 years from a commercial vineyard at the same time that fruit were harvested for botrytized wine production. Using an integrated transcriptomics and metabolomics approach, we demonstrate that noble rot alters the metabolism of cv Sémillon berries by inducing biotic and abiotic stress responses as well as ripening processes. During noble rot, B. cinerea induced the expression of key regulators of ripening-associated pathways, some of which are distinctive to the normal ripening of red-skinned cultivars. Enhancement of phenylpropanoid metabolism, characterized by a restricted flux in white-skinned berries, was a common outcome of noble rot and red-skinned berry ripening. Transcript and metabolite analyses together with enzymatic assays determined that the biosynthesis of anthocyanins is a consistent hallmark of noble rot in cv Sémillon berries. The biosynthesis of terpenes and fatty acid aroma precursors also increased during noble rot. We finally characterized the impact of noble rot in botrytized wines. Altogether, the results of this work demonstrated that noble rot causes a major reprogramming of berry development and metabolism. This desirable interaction between a fruit and a fungus stimulates pathways otherwise inactive in white-skinned berries, leading to a greater accumulation of compounds involved in the unique flavor and aroma of botrytized wines. PMID:26450706

  16. Developmental and Metabolic Plasticity of White-Skinned Grape Berries in Response to Botrytis cinerea during Noble Rot1[OPEN

    Science.gov (United States)

    Collins, Thomas S.; Vicente, Ariel R.; Doyle, Carolyn L.; Ye, Zirou; Allen, Greg; Heymann, Hildegarde

    2015-01-01

    Noble rot results from exceptional infections of ripe grape (Vitis vinifera) berries by Botrytis cinerea. Unlike bunch rot, noble rot promotes favorable changes in grape berries and the accumulation of secondary metabolites that enhance wine grape composition. Noble rot-infected berries of cv Sémillon, a white-skinned variety, were collected over 3 years from a commercial vineyard at the same time that fruit were harvested for botrytized wine production. Using an integrated transcriptomics and metabolomics approach, we demonstrate that noble rot alters the metabolism of cv Sémillon berries by inducing biotic and abiotic stress responses as well as ripening processes. During noble rot, B. cinerea induced the expression of key regulators of ripening-associated pathways, some of which are distinctive to the normal ripening of red-skinned cultivars. Enhancement of phenylpropanoid metabolism, characterized by a restricted flux in white-skinned berries, was a common outcome of noble rot and red-skinned berry ripening. Transcript and metabolite analyses together with enzymatic assays determined that the biosynthesis of anthocyanins is a consistent hallmark of noble rot in cv Sémillon berries. The biosynthesis of terpenes and fatty acid aroma precursors also increased during noble rot. We finally characterized the impact of noble rot in botrytized wines. Altogether, the results of this work demonstrated that noble rot causes a major reprogramming of berry development and metabolism. This desirable interaction between a fruit and a fungus stimulates pathways otherwise inactive in white-skinned berries, leading to a greater accumulation of compounds involved in the unique flavor and aroma of botrytized wines. PMID:26450706

  17. The grapevine VviPrx31 peroxidase as a candidate gene involved in anthocyanin degradation in ripening berries under high temperature.

    Science.gov (United States)

    Movahed, Nooshin; Pastore, Chiara; Cellini, Antonio; Allegro, Gianluca; Valentini, Gabriele; Zenoni, Sara; Cavallini, Erika; D'Incà, Erica; Tornielli, Giovanni Battista; Filippetti, Ilaria

    2016-05-01

    Anthocyanin levels decline in some red grape berry varieties ripened under high-temperature conditions, but the underlying mechanism is not yet clear. Here we studied the effects of two different temperature regimes, representing actual Sangiovese (Vitis vinifera L.) viticulture regions, on the accumulation of mRNAs and enzymes controlling berry skin anthocyanins. Potted uniform plants of Sangiovese were kept from veraison to harvest, in two plastic greenhouses with different temperature conditions. The low temperature (LT) conditions featured average and maximum daily air temperatures of 20 and 29 °C, respectively, whereas the corresponding high temperature (HT) conditions were 22 and 36 °C, respectively. The anthocyanin concentration at harvest was much lower in HT berries than LT berries although their profile was similar under both conditions. Under HT conditions, the biosynthesis of anthocyanins was suppressed at both the transcriptional and enzymatic levels, but peroxidase activity was higher. This suggests that the low anthocyanin content of HT berries reflects the combined impact of reduced biosynthesis and increased degradation, particularly the direct role of peroxidases in anthocyanin catabolism. Overexpression of VviPrx31 decreased anthocyanin contents in Petunia hybrida petals under heat stress condition. These data suggest that high temperature can stimulate peroxidase activity thus anthocyanin degradation in ripening grape berries. PMID:26825649

  18. Plasticity of the Berry Ripening Program in a White Grape Variety.

    Science.gov (United States)

    Dal Santo, Silvia; Fasoli, Marianna; Negri, Stefano; D'Incà, Erica; Vicenzi, Nazareno; Guzzo, Flavia; Tornielli, Giovanni Battista; Pezzotti, Mario; Zenoni, Sara

    2016-01-01

    Grapevine (Vitis vinifera L.) is considered one of the most environmentally sensitive crops and is characterized by broad phenotypic plasticity, offering important advantages such as the large range of different wines that can be produced from the same cultivar, and the adaptation of existing cultivars to diverse growing regions. The uniqueness of berry quality traits reflects complex interactions between the grapevine plant and the combination of natural factors and human cultural practices which leads to the expression of wine typicity. Despite the scientific and commercial importance of genotype interactions with growing conditions, few studies have characterized the genes and metabolites directly involved in this phenomenon. Here, we used two large-scale analytical approaches to explore the metabolomic and transcriptomic basis of the broad phenotypic plasticity of Garganega, a white berry variety grown at four sites characterized by different pedoclimatic conditions (altitudes, soil texture, and composition). These conditions determine berry ripening dynamics in terms of sugar accumulation and the abundance of phenolic compounds. Multivariate analysis unraveled a highly plastic metabolomic response to different environments, especially the accumulation of hydroxycinnamic and hydroxybenzoic acids and flavonols. Principal component analysis (PCA) revealed that the four sites strongly affected the berry transcriptome allowing the identification of environmentally-modulated genes and the plasticity of commonly-modulated transcripts at different sites. Many genes that control transcription, translation, transport, and carbohydrate metabolism showed different expression depending on the environmental conditions, indicating a key role in the observed transcriptomic plasticity of Garganega berries. Interestingly, genes representing the phenylpropanoid/flavonoid pathway showed plastic responses to the environment mirroring the accumulation of the corresponding

  19. Plasticity of the Berry Ripening Program in a White Grape Variety

    Science.gov (United States)

    Dal Santo, Silvia; Fasoli, Marianna; Negri, Stefano; D'Incà, Erica; Vicenzi, Nazareno; Guzzo, Flavia; Tornielli, Giovanni Battista; Pezzotti, Mario; Zenoni, Sara

    2016-01-01

    Grapevine (Vitis vinifera L.) is considered one of the most environmentally sensitive crops and is characterized by broad phenotypic plasticity, offering important advantages such as the large range of different wines that can be produced from the same cultivar, and the adaptation of existing cultivars to diverse growing regions. The uniqueness of berry quality traits reflects complex interactions between the grapevine plant and the combination of natural factors and human cultural practices which leads to the expression of wine typicity. Despite the scientific and commercial importance of genotype interactions with growing conditions, few studies have characterized the genes and metabolites directly involved in this phenomenon. Here, we used two large-scale analytical approaches to explore the metabolomic and transcriptomic basis of the broad phenotypic plasticity of Garganega, a white berry variety grown at four sites characterized by different pedoclimatic conditions (altitudes, soil texture, and composition). These conditions determine berry ripening dynamics in terms of sugar accumulation and the abundance of phenolic compounds. Multivariate analysis unraveled a highly plastic metabolomic response to different environments, especially the accumulation of hydroxycinnamic and hydroxybenzoic acids and flavonols. Principal component analysis (PCA) revealed that the four sites strongly affected the berry transcriptome allowing the identification of environmentally-modulated genes and the plasticity of commonly-modulated transcripts at different sites. Many genes that control transcription, translation, transport, and carbohydrate metabolism showed different expression depending on the environmental conditions, indicating a key role in the observed transcriptomic plasticity of Garganega berries. Interestingly, genes representing the phenylpropanoid/flavonoid pathway showed plastic responses to the environment mirroring the accumulation of the corresponding

  20. 7 CFR 51.904 - Shot berries.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Shot berries. 51.904 Section 51.904 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... Standards for Grades of Table Grapes (European or Vinifera Type) 1 Definitions § 51.904 Shot berries....

  1. Simple Rain-Shelter Cultivation Prolongs Accumulation Period of Anthocyanins in Wine Grape Berries

    Directory of Open Access Journals (Sweden)

    Xiao-Xi Li

    2014-09-01

    Full Text Available Simple rain-shelter cultivation is normally applied during the grape growth season in continental monsoon climates aiming to reduce the occurrence of diseases caused by excessive rainfall. However, whether or not this cultivation practice affects the composition and concentration of phenolic compounds in wine grapes remains unclear. The objective of this study was to investigate the effect of rain-shelter cultivation on the accumulation of anthocyanins in wine grapes (Vitis vinifera L. Cabernet Sauvignon grown in eastern China. The results showed that rain-shelter cultivation, compared with the open-field, extended the period of rapid accumulation of sugar, increased the soluble solid content in the grape berries, and delayed the senescence of the green leaves at harvest. The concentrations of most anthocyanins were significantly enhanced in the rain-shelter cultivated grapes, and their content increases were closely correlated with the accumulation of sugar. However, the compositions of anthocyanins in the berries were not altered. Correspondingly, the expressions of VvF3'H, VvF3'5'H, and VvUFGT were greatly up-regulated and this rising trend appeared to continue until berry maturation. These results suggested that rain-shelter cultivation might help to improve the quality of wine grape berries by prolonging the life of functional leaves and hence increasing the assimilation products.

  2. Testing of a simplified LED based vis/NIR system for rapid ripeness evaluation of white grape (Vitis vinifera L.) for Franciacorta wine.

    Science.gov (United States)

    Giovenzana, Valentina; Civelli, Raffaele; Beghi, Roberto; Oberti, Roberto; Guidetti, Riccardo

    2015-11-01

    The aim of this work was to test a simplified optical prototype for a rapid estimation of the ripening parameters of white grape for Franciacorta wine directly in field. Spectral acquisition based on reflectance at four wavelengths (630, 690, 750 and 850 nm) was proposed. The integration of a simple processing algorithm in the microcontroller software would allow to visualize real time values of spectral reflectance. Non-destructive analyses were carried out on 95 grape bunches for a total of 475 berries. Samplings were performed weekly during the last ripening stages. Optical measurements were carried out both using the simplified system and a portable commercial vis/NIR spectrophotometer, as reference instrument for performance comparison. Chemometric analyses were performed in order to extract the maximum useful information from optical data. Principal component analysis (PCA) was performed for a preliminary evaluation of the data. Correlations between the optical data matrix and ripening parameters (total soluble solids content, SSC; titratable acidity, TA) were carried out using partial least square (PLS) regression for spectra and using multiple linear regression (MLR) for data from the simplified device. Classification analysis were also performed with the aim of discriminate ripe and unripe samples. PCA, MLR and classification analyses show the effectiveness of the simplified system in separating samples among different sampling dates and in discriminating ripe from unripe samples. Finally, simple equations for SSC and TA prediction were calculated. PMID:26452865

  3. Molecular candidates for early-stage flower-to-fruit transition in stenospermocarpic table grape (Vitis vinifera L.) inflorescences ascribed by differential transcriptome and metabolome profiles.

    Science.gov (United States)

    Domingos, Sara; Fino, Joana; Paulo, Octávio S; Oliveira, Cristina M; Goulao, Luis F

    2016-03-01

    Flower-to-fruit transition depends of nutrient availability and regulation at the molecular level by sugar and hormone signalling crosstalk. However, in most species, the identities of fruit initiation regulators and their targets are largely unknown. To ascertain the main pathways involved in stenospermocarpic table grape fruit set, comprehensive transcriptional and metabolomic analyses were conducted specifically targeting the early phase of this developmental stage in 'Thompson Seedless'. The high-throughput analyses performed disclosed the involvement of 496 differentially expressed genes and 28 differently accumulated metabolites in the sampled inflorescences. Our data show broad transcriptome reprogramming of molecule transporters, globally down-regulating gene expression, and suggest that regulation of sugar- and hormone-mediated pathways determines the downstream activation of berry development. The most affected gene was the SWEET14 sugar transporter. Hormone-related transcription changes were observed associated with increased indole-3-acetic acid, stimulation of ethylene and gibberellin metabolisms and cytokinin degradation, and regulation of MADS-box and AP2-like ethylene-responsive transcription factor expression. Secondary metabolism, the most representative biological process at transcriptome level, was predominantly repressed. The results add to the knowledge of molecular events occurring in grapevine inflorescence fruit set and provide a list of candidates, paving the way for genetic manipulation aimed at model research and plant breeding. PMID:26810452

  4. Distribution of major sugars, acids, and total phenols in juice of five grapevine (Vitis spp.) cultivars at different stages of berry development

    Energy Technology Data Exchange (ETDEWEB)

    Sabir, A.; Kafkas, E.; Tangolar, S.

    2010-07-01

    The juices of five grapevine cultivars cultivated in a typical Mediterranean climate were analyzed for sugars, organic acids, and phenols at four distinct stages of berry development. When the unripe berries were almost in full size, the glucose and fructose contents, based on HPLC detection, ranged from 13.3 to 30.7 g L{sup -}1 and from 8.3 to 23.7 g L{sup -}1 for Muscat of Alexandria and Muscat of Hamburg, respectively. At this stage, tartaric acid concentration was between 10.3 (Italia) and 12.3 g L{sup -}1 (Muscat of Alexandria), while the level of total phenols was low. Up to veraison, there were slight reductions in organic acids, while sugar content increased slightly. However, dramatic changes in all genotypes were apparent after veraison. Slight reductions were determined in the glucose and fructose levels of Italia prior to final analysis, possibly indicating this cultivars sensitivity to late harvest. In the final analysis, glucose and fructose content varied from 86.4 (Italia) to 107.0 g L-1 (Muscat of Hamburg), and from 73.1 (Italia) to 94.1 g L{sup -}1 (Alphonse Lavallee), respectively. Tartaric acid content of ripe berries was between 3.8 (Alphonse Lavallee) and 5.2 g L{sup -}1 (Isabella) with a mean value of 4.6 g L{sup -}1, and phenol content of mature berries ranged from 2253 to 2847 mg L{sup -}1. This study provides valuable information for further understanding the sugar, acid and total phenol changes that occur in some grape cultivars during berry maturation. Therefore, these results will be useful for future research on the biochemistry of the grape berry. (Author) 22 refs.

  5. NEWEST PINK BERRY AROMATIC VINE GRAPE VARIETY – RADOST LEONIDOV

    Directory of Open Access Journals (Sweden)

    Zamanidi P. C.

    2014-12-01

    Full Text Available New wine grape flavored pink berry grape variety named “Radost Leonidov” breed at Athens Institute of Viticulture by P.Zamanidi, L.Troshin and P.Radchevskii in 2009 by crossing the new Moskhoragos Greek muscat variety with old European variety Traminer pink. According to morphological and biological characteristics, it can be assigned to Western European eco-geographical group of varieties. Strong growth of shoots (2,1-3,0 m. The extent of maturation of vines is very high (over the entire length, except for the top. Duration of production period from bud burst to harvest - 146-155 days. Productivity is high: 20-25 t / ha. The average weight of clusters is 260. Characterized by high winter hardiness, drought resistance and increased resistance to fungal diseases in comparison with the varieties of Vitis vinifera. Flower is hermaphrodite, fully developed stamens and gynoecium. Bunch is small, conical, sometimes winged, average density. Berry is small, spherical, pinkish in color, with a thick waxy coating. Peel of medium thickness, dense and durable. Pulp and juice with a strong varietal flavor, similar to the aroma of Traminer pink. Sugar content is very high: more than 24%. Cluster of the variety of Radost Leonidov at overripening is drying and stored on the bushes for a long time. The variety is intended for the production of dry white wines of excellent class, as well as highquality sparkling wines, dessert and sweet wines; suitable for the production of high-quality aromatic juices

  6. ACROPOLIS - NEWEST WINE WHITE BERRY AROMATIC GRAPE VARIETY

    Directory of Open Access Journals (Sweden)

    Zamanidi P. C.

    2014-03-01

    Full Text Available The newest aromatic wine white berry grape variety Acropolis was breeded by hybridization at the Athens Institute of Viticulture (Likovrisi, Greece by professors P.Zamanidi and L.Troshinym in 2006 by crossing the Greek variety Kidonitsa with European Riesling. According to the morphological and physiological characteristics it is related to the eco-geographical group of Black Sea. Strong growth of shoots (2,1-3,0 m. Degree of ripening vines is very high: over the entire length, except for the top. Length of production period 146-155 days. High yield 25-30 t / ha. Average weight of cluster is 360 g. Characterized by high resistance to cold, drought and increased resistance to fungal diseases in comparison with common varieties of Vitis vinifera L. Flower is androgynous. Bunch is medium, conical, medium density. Berry is medium, spherical, greenish-yellow color with a thick waxy coating. Cuticle of medium thickness, dense, durable. Pulp and juice are with pronounced varietal type taste of Riesling. Sugar content is very high: up to 24% more. Bunches of variety Acropolis continuously stored in the bushes. Variety is intended for manufacturing dry white wines of excellent grade and high-quality sparkling wines, dessert and sweet wines, suitable for production of high quality aromatic juices

  7. AGAPI - NEWEST WINE WHITE BERRY AROMATIC GRAPE VARIETY

    Directory of Open Access Journals (Sweden)

    Zamanidi P. C.

    2014-06-01

    Full Text Available Newest aromatic white berry wine grape variety Agapi was breeded by hybridization at the Athens Institute of Viticulture (Likovrisi, Greece by professors P.Zamanidi, L.Troshin and P.Radchevskiy in 2006 by crossing the Greek varieties Afiri white with central European variety Traminer pink. Strong growth of shoots (2,1-3,0 m. Level of ripening vines is very high: over the entire length except the top. Length of production period 146-155 days. Productivity is very high: 25-30 t / ha. Average weight of cluster 300 g. Characterized by a high resistance to cold, drought and increased resistance to fungal diseases compared to varieties of Vitis vinifera L. Flower is androgynous. Bunch is medium, conical, medium density. Berry is medium, short elliptical or spherical, greenish-yellow in color, with a thick waxy coating. Cuticle of medium thickness, dense, and durable. Pulp and juice are with pronounced varietal flavor, similar to the aroma of Traminer pink. The sugar content is very high, more than 24%. Clusters of Agapi variety regardless of autumn weather conditions persist for a long time in the bushes. Variety intended for the manufacturing dry white wines of excellent grade and high-quality sparkling wines, dessert and sweet wines; suitable for production of high quality fragrant juices

  8. Effects of Climatic Conditions and Soil Properties on Cabernet Sauvignon Berry Growth and Anthocyanin Profiles

    Directory of Open Access Journals (Sweden)

    Guo Cheng

    2014-09-01

    Full Text Available Climatic conditions and soil type have significant influence on grape ripening and wine quality. The reported study was conducted in two “Cabernet Sauvignon (Vitis vinifera L.V” vineyards located in Xinjiang, a semiarid wine-producing region of China during two vintages (2011 and 2012. The results indicate that soil and climate affected berry growth and anthocyanin profiles. These two localities were within a distance of 5 km from each other and had soils of different physical and chemical composition. For each vineyard, the differences of anthocyanin concentrations, and parameters concerning berry growth and composition between the two years could be explained by different climatic conditions. Soil effect was studied by investigation of differences in berry composition and anthocyanin profiles between the two vineyards in the same year, which could be explained mainly by the different soil properties, vine water and nitrogen status. Specifically, the soils with less water and organic matter produced looser clusters, heavier berry skins and higher TSS, which contributed to the excellent performance of grapes. Compared with 2011, the increases in anthocyanin concentrations for each vineyard in 2012 could be attributed to smaller number of extreme temperature (>35 °C days and rainfall, lower vine water status and N level. The explanation for higher anthocyanin concentrations in grape skins from the soils with less water and organic matter could be the vine status differences, lighter berry weight and heavier skin weight at harvest. In particular, grapes from the soils with less water and organic matter had higher levels of 3′5′-substituded, O-methylated and acylated anthocyanins, which represented a positive characteristic conferring more stable pigmentation to the corresponding wine in the future. The present work clarifies the effects of climate and soil on berry growth and anthocyanin profiles, thus providing guidance for production of

  9. Expression and in situ localization of two major PR proteins of grapevine berries during development and after UV-C exposition.

    Directory of Open Access Journals (Sweden)

    Steven Colas

    Full Text Available In grapevine Vitis vinifera L. cv Pinot noir, the Pathogenesis-Related (PR proteins CHI4D and TL3 are among the most abundant extractable PR proteins of ripe berries and accumulate during berry ripening from véraison until full maturation. Evidence was supplied in favor of the involvement of these two protein families in plant defense mechanisms and plant development. In order to better understand CHI4D and TL3 function in grapevine, we analyzed their temporal and spatial pattern of expression during maturation and after an abiotic stress (UV-C by in situ hybridization (ISH and immunohistolocalization. In ripening berries, CHI4D and TL3 genes were mainly expressed in the exocarp and around vascular bundles of the mesocarp. In UV-C exposed berries, CHI4D and TL3 gene expression was strongly induced before véraison. Corresponding proteins localized in the exocarp and, to a lesser extent, around vascular bundles of the mesocarp. The spatial and temporal accumulation of the two PR proteins during berry maturation and after an abiotic stress is discussed in relation to their putative roles in plant defense.

  10. Análisis de las diferencias en el crecimiento vegetativo, en los componentes del rendimiento y en la composición de las uvas y vinos del cv. cabernet sauvignon (vitis vinifera L.), producidos por el déficit hídrico durante pre-envero y post-envero

    OpenAIRE

    Fernández Gómez, Olga

    2013-01-01

    La presente Tesis Doctoral se realizó con el fin de estimar conjuntamente la respuesta agronómica y fisiológica de la vid (Vitis vinifera L.), así como los efectos sobre la evolución de la maduración, composición y la calidad de la uva y del vino, bajo la aplicación de diferentes déficit hídricos en pre-envero y post-envero, dentro de un marco de referencia de cambio climático. La variación climática que prevén los estudios sobre el cambio climático, resulta un factor decisivo en la eficienc...

  11. Etude des effets du rayonnement UV-B sur la physiologie foliaire et la maturation des baies chez la Vigne (Vitis vinifera L. cv Tempranillo), dans le contexte du changement climatique (déficit hydrique, température et taux de CO2 élevés)

    OpenAIRE

    Martinez Lüscher, Johann

    2014-01-01

    Ce travail de thèse porte sur l’effet du rayonnement UV-B sur la physiologie foliaire et la maturation des baies chez la Vigne (Vitis vinifera L. cv Tempranillo), dans le contexte du changement climatique en cours. Dans ce but, des expériences ont été menées en conditions contrôlées en serre, sur des boutures fructifères. Les plantes ont été exposées à trois doses de rayonnement UV-B biologiquement actifs (0, 5,98 et 9,66 kJ.m-2.jour-1), soit à partir de la nouaison, soit à partir de la vérai...

  12. MIR – NEWEST HIGHT QUALITY BLACK BERRY AROMATIC GRAPE VARIETY WITH COLORED PULP AND JUSE

    Directory of Open Access Journals (Sweden)

    Zamanidi P. C.

    2014-05-01

    Full Text Available Newest wine black berry with painted pulp and juice grape variety called Mir was breeded at Athens Institute of Viticulture (Greece by Zamanidi P., Troshin L. and Radchevsky P. in 2006 by crossing the Ukrainian variety of Odessa black (Alicante Bouschet x Cabernet Sauvignon with new Greek black berry variety Iliad. According to the morphological and physiological characteristics included in the eco-geographical group of Black Sea Coast. Length of production period - 146-155 days. Strong growth of arms (2,1-3,0 m. Percentage of productive shoots - over 90. Productivity is very high: 20-30 t / ha. The average mass of clusters is 260 g. Characterized by high resistance to cold, drought and increased resistance to fungal diseases in comparison with varieties of Vitis vinifera. Lobes, the stamens and fully developed gynoecium. Bunch medium, often with tapered wing, the average density. Berry small, round, blue-black, with a thick waxy coating. The peel is medium thickness, dense, durable. Pulp and juice intensely colored. Sugar content is very high. Prolonged preservation of different crop on bushes. Variety intended for manufacturing intensely colored dry red wines of excellent grade and high-quality sparkling, dessert, sweet and liqueur wines; and is suitable for the manufacture of high quality strong colored juices. When used in blends with other varieties, it enhances color, flavor and improves the bouquet of wine

  13. Solute accumulation differs in the vacuoles and apoplast of ripening grape berries.

    Science.gov (United States)

    Keller, Markus; Shrestha, Pradeep M

    2014-03-01

    Phloem unloading is thought to switch from a symplastic route to an apoplastic route at the beginning of ripening in grape berries and some other fleshy fruits. However, it is unclear whether different solutes accumulate in both the mesocarp vacuoles and the apoplast. We modified a method developed for tomato fruit to extract apoplastic sap from grape berries and measured the changes in apoplastic and vacuolar pH, soluble sugars, organic acids, and potassium in ripening berries of Vitis vinifera 'Merlot' and V. labruscana 'Concord'. Solute accumulation varied by genotype, compartment, and chemical species. The apoplast pH was substantially higher than the vacuolar pH, especially in Merlot (approximately two units). However, the vacuole-apoplast proton gradient declined during ripening and in Merlot, but not in Concord, collapsed entirely at maturity. Hexoses accumulated in both the vacuoles and apoplast but at different rates. Organic acids, especially malate, declined much more in the vacuoles than in the apoplast. Potassium accumulated in the vacuoles and apoplast of Merlot. In Concord, by contrast, potassium increased in the vacuoles but decreased in the apoplast. These results suggest that solutes in the fruit apoplast are tightly regulated and under developmental control. PMID:24310282

  14. Tissue-specific mRNA expression profiling in grape berry tissues

    Directory of Open Access Journals (Sweden)

    Cramer Grant R

    2007-06-01

    Full Text Available Abstract Background Berries of grape (Vitis vinifera contain three major tissue types (skin, pulp and seed all of which contribute to the aroma, color, and flavor characters of wine. The pericarp, which is composed of the exocarp (skin and mesocarp (pulp, not only functions to protect and feed the developing seed, but also to assist in the dispersal of the mature seed by avian and mammalian vectors. The skin provides volatile and nonvolatile aroma and color compounds, the pulp contributes organic acids and sugars, and the seeds provide condensed tannins, all of which are important to the formation of organoleptic characteristics of wine. In order to understand the transcriptional network responsible for controlling tissue-specific mRNA expression patterns, mRNA expression profiling was conducted on each tissue of mature berries of V. vinifera Cabernet Sauvignon using the Affymetrix GeneChip® Vitis oligonucleotide microarray ver. 1.0. In order to monitor the influence of water-deficit stress on tissue-specific expression patterns, mRNA expression profiles were also compared from mature berries harvested from vines subjected to well-watered or water-deficit conditions. Results Overall, berry tissues were found to express approximately 76% of genes represented on the Vitis microarray. Approximately 60% of these genes exhibited significant differential expression in one or more of the three major tissue types with more than 28% of genes showing pronounced (2-fold or greater differences in mRNA expression. The largest difference in tissue-specific expression was observed between the seed and pulp/skin. Exocarp tissue, which is involved in pathogen defense and pigment production, showed higher mRNA abundance relative to other berry tissues for genes involved with flavonoid biosynthesis, pathogen resistance, and cell wall modification. Mesocarp tissue, which is considered a nutritive tissue, exhibited a higher mRNA abundance of genes involved in cell

  15. 葡萄WRKY18基因的克隆及表达特性分析%Gene Cloning and Expression Analysis of WRKY18 in Vitis vinifera

    Institute of Scientific and Technical Information of China (English)

    肖培连; 冯睿杰; 侯丽霞; 吕晓彤; 朱丹; 刘新

    2015-01-01

    Abiotic stress severely restrict the development of grape industry, so it will provide theoretical basis for grape breeding through gene cloning and studying its molecular mechanisms. We cloned the full-length cDNA of VvWRKY18 from leaves of Vitis vinifera cultivar‘Zuoyouhong’ tissue culture seedling. The results showed that VvWRKY18 ampliifed fragment size of 954 bp, encoding a protein of 317 amino acids. Bioinfor-matic analysis indicated that VvWRKY18 with molecular weight 35.2416 kDa, isoelectric point 8.22 and insta-bility coefifcient 48.61, speculating it was unstable protein. Besides it shared high homology with WRKY18 in Oryza sativa Japonica Group, in Sorghum bicolor, in Populus trichocarpa and in Arabidopsis thaliana. Subcel-lular localization result indicated that it was located in nucleus. And it belonged to type II WRKY transcription factor. Real-time PCR analysis indicated that VvWRKY18 expressed in different tissues, especially in lfower. In addition, VvWRKY18 was induced by low temperature (4℃), salt stress, osmotic stress, salicylic acid (SA), ab-scisic acid (ABA), nitric oxide (NO) and hydrogen peroxide (H2O2). Moreover, the expression of VvWRKY18 was highly induced at 6 h by low temperature and the expression pattern of VvWRKY18 under NO were similar to those of low temperature induction, which indicated that NO participated in the signal transduction process of grape response to low temperature stress.%以抗性品种‘左优红’组培苗为材料,克隆得到WRKY18基因,测序结果显示:VvWRKY18基因片段大小为954 bp,编码317个氨基酸序列。生物信息学分析结果显示VvWRKY18蛋白分子量约为35.2416 kDa,等电点为8.22,不稳定系数为48.61,推测为不稳定蛋白;与已知的粳稻、高粱、毛果杨及拟南芥WRKY家族蛋白高度同源;亚细胞定位预测结果显示主要存在于细胞核中,属于第二类WRKY转录因子家族成员。实时荧光定量PCR分析显示, VvWRKY18在葡萄不

  16. VitisNet: "Omics" integration through grapevine molecular networks.

    Directory of Open Access Journals (Sweden)

    Jérôme Grimplet

    Full Text Available BACKGROUND: Genomic data release for the grapevine has increased exponentially in the last five years. The Vitis vinifera genome has been sequenced and Vitis EST, transcriptomic, proteomic, and metabolomic tools and data sets continue to be developed. The next critical challenge is to provide biological meaning to this tremendous amount of data by annotating genes and integrating them within their biological context. We have developed and validated a system of Grapevine Molecular Networks (VitisNet. METHODOLOGY/PRINCIPAL FINDINGS: The sequences from the Vitis vinifera (cv. Pinot Noir PN40024 genome sequencing project and ESTs from the Vitis genus have been paired and the 39,424 resulting unique sequences have been manually annotated. Among these, 13,145 genes have been assigned to 219 networks. The pathway sets include 88 "Metabolic", 15 "Genetic Information Processing", 12 "Environmental Information Processing", 3 "Cellular Processes", 21 "Transport", and 80 "Transcription Factors". The quantitative data is loaded onto molecular networks, allowing the simultaneous visualization of changes in the transcriptome, proteome, and metabolome for a given experiment. CONCLUSIONS/SIGNIFICANCE: VitisNet uses manually annotated networks in SBML or XML format, enabling the integration of large datasets, streamlining biological functional processing, and improving the understanding of dynamic processes in systems biology experiments. VitisNet is grounded in the Vitis vinifera genome (currently at 8x coverage and can be readily updated with subsequent updates of the genome or biochemical discoveries. The molecular network files can be dynamically searched by pathway name or individual genes, proteins, or metabolites through the MetNet Pathway database and web-portal at http://metnet3.vrac.iastate.edu/. All VitisNet files including the manual annotation of the grape genome encompassing pathway names, individual genes, their genome identifier, and chromosome

  17. Resistance evaluation of Chinese wild Vitis genotypes against Botrytis cinerea and different responses of resistant and susceptible hosts to the infection

    OpenAIRE

    Wan, Ran; Hou, Xiaoqing; Wang, Xianhang; Qu, Jingwu; Singer, Stacy D; Wang, Yuejin; Wang, Xiping

    2015-01-01

    The necrotrophic fungus Botrytis cinerea is a major threat to grapevine cultivation worldwide. A screen of 41 Vitis genotypes for leaf resistance to B. cinerea suggested species independent variation and revealed 18 resistant Chinese wild Vitis genotypes, while most investigated V. vinifera, or its hybrids, were susceptible. A particularly resistant Chinese wild Vitis, “Pingli-5” (V. sp. [Qinling grape]) and a very susceptible V. vinifera cultivar, “Red Globe” were selected for further study....

  18. Medna bijela (Vitis vinifera L. - Ampelographic properties

    Directory of Open Access Journals (Sweden)

    Ivan Pezo

    2006-12-01

    Full Text Available Medna bijela is an autochthonous cultivar of the third Adriatic vine-growing subregion. Its synonyms in use are: Buboj, Bumba, Medna, Rizavac, Zložder etc. No detailed ampelographic study has been made to date; based on our research this cultivar is classified in the ecological-geographical group of Convarietas Pontica, Negr. Subconvarietas Balcanica, Provarietas Mesocarpa, Nem., Subprovarietas Dalmatica Nem. It is a medium lush wine cultivar with some 16-17 % of sugar and 6.0-7.0 g/l of total acidity, with a yield of 2.5-3.5 kg of grapes per grapevine and a load of 16 buds per grapevine. The wines are light, acidulous, with a specific fine aroma of honey, which is implied in the very name of the cultivar. It is recommended that the research should be continued, particularly on clonal selection.

  19. A rapid qualitative and quantitative evaluation of grape berries at various stages of development using Fourier-transform infrared spectroscopy and multivariate data analysis.

    Science.gov (United States)

    Musingarabwi, Davirai M; Nieuwoudt, Hélène H; Young, Philip R; Eyéghè-Bickong, Hans A; Vivier, Melané A

    2016-01-01

    Fourier transform (FT) near-infrared (NIR) and attenuated total reflection (ATR) FT mid-infrared (MIR) spectroscopy were used to qualitatively and quantitatively analyse Vitis vinifera L. cv Sauvignon blanc grape berries. FT-NIR and ATR FT-MIR spectroscopy, coupled with spectral preprocessing and multivariate data analysis (MVDA), provided reliable methods to qualitatively assess berry samples at five distinct developmental stages: green, pre-véraison, véraison, post-véraison and ripe (harvest), without any prior metabolite extraction. Compared to NIR spectra, MIR spectra provided more reliable discrimination between the berry samples from the different developmental stages. Interestingly, ATR FT-MIR spectra from fresh homogenized berry samples proved more discriminatory than spectra from frozen homogenized berry samples. Different developmental stages were discriminated by principal component analysis (PCA) and orthogonal partial least squares discriminant analysis (OPLS-DA). In order to generate partial least squares (PLS) models from the MIR/NIR spectral datasets; the major sugars (glucose and fructose) and organic acids (malic acid, succinic acid and tartaric acid) were separated and quantified by high performance liquid chromatography (HPLC) and the data used as a reference dataset. PLS regression was used to develop calibration models to predict the concentration of the major sugars and organic acids in the berry samples from different developmental stages. Our data show that infrared (IR) spectroscopy could provide a rapid, reproducible and cost-effective alternative to the chromatographic analysis of the sugar and organic acid composition of grape berries at various developmental stages, using small sample volumes and requiring limited sample preparation. This provides scope and support for the possible development of hand-held devices to assess quality parameters in field-settings in real-time and non-destructively using IR technologies. PMID:26212968

  20. Preparation and identification of water-soluble calcium-binding protein from grape (Vitis vinifera L.) seeds%葡萄籽中水溶性钙结合蛋白的分离和鉴定

    Institute of Scientific and Technical Information of China (English)

    吕晨艳; 赵广华

    2015-01-01

    Calcium is an essential nutrient required for critical biological functions such as nerve conduction, muscle contraction, mitosis, blood coagulation, and structural support of the skeleton.Dietary calcium intake is of general interest for human beings, particularly for infants and young children, when growth is accelerated. Milk and milk products as effective calcium supplements are generally accepted by human race with their high bioavailability. However, less consumption of milk in industrialized countries leads to inadequate calcium intake. Therefore, it is important to explore an alternate source for calcium supplement. On the other hand, dried grape seeds are likewise rich in lipids (22.07%), carbohydrates (12.51%) and proteins (11.94%) (w/w) and grape seeds as by-product during juice production can be an alternative source of protein. Meanwhile, this study demonstrates that grape seeds are rich in calcium ((5.62±0.01) g/kg for embryonic cells and (6.32± 0.01) g/kg for intact grape seeds), which was identified by ICP-AES. The calcium was mainly distributed in the stroma of the amyloplasts and around the starch granules, which was observed under TEM (Transmission Electron Microscope). Further study indicates that water-soluble protein from grape (Vitis viniferaL.) seeds (WSPG) contained two major components, one of which was 11S globulin-like protein mainly responsible for the binding of calcium in WSPG and the other was a novel protein (Protein A). The calcium contents of protein isolate from each step were identified by ICP-AES as well. When a traditional alkali extraction and acid precipitation method was used for isolation of WSPG, many binding calcium ions were lost. It is worth noting that the protein composition of grape seed protein obtained by both 30%-50% (NH4)2SO4 sediment and the alkali extraction and acid precipitation method was nearly identical, which consisted of protein A and protein B at a ratio of 2 to 3, but the content of calcium in the

  1. HARA – NEWEST WINE HIGH QUALITY AROMATIC GRAPE VERIETY WITH PINK BERRY

    Directory of Open Access Journals (Sweden)

    Zamanidi P. C.

    2014-01-01

    Full Text Available The newest high-tech pink berry aromatic grape variety Hara selected by hybridization at the Athens Institute of Viticulture (Likovrisi, Greece researchers P.K. Zamanidi and L.P. Troshin in 2004 by crossing the Greek varieties Avgulato with Traminer pink. According to the morphological and physiological characteristics related to the eco-geographical group of Black Sea. Growth of shoots is strong (2,1-3,0 m. Degree of ripening vines is very high (over the entire length other than top of shoot. Length of production period from bud burst to harvest 146-155 days. Productivity is very high, 25-30 t/ha. Percentage of productive shoots - 90. The average mass of clusters within 350 g. Characterized by a high winter hardiness, drought and increased resistance to fungal diseases in comparison with varieties Vitis vinifera. Hermaphrodite flower with stamens and fully developed gynoecium. Cluster medium, conical, medium density. Berry medium, spherical, pink color, with a thick waxy coating. Peel of medium thickness, dense, durable. Pulp and juice with pronounced varietal flavor of Gewurztraminer. Sugar content is very high, more than 24%. When overripening dry-curing and continuously stored on the clusters. Variety intended for the manufacture of dry white wines of excellent grade and high-quality dessert and sweet wines; suitable for production of high quality juices, compotes

  2. The Effects of Bud Load and Applied Water Amounts on the Biochemical Composition of the ‘Narince’ Grape Variety (Vitis vinifera L.)

    OpenAIRE

    Serpil GOK TANGOLAR; Semih TANGOLAR; Güzin TARIM; Haşim KELEBEK; TOPÇU, Sevilay

    2015-01-01

    This study evaluated the effects of various bud load and water amounts (WA) on the berry composition of the ‘Narince’ white wine grape variety. Two water amounts (WA-I and WA-II) administered during growth stages or a non-irrigated (rain-fed) control treatment were paired with two different bud loads (K (normal) and 2K (two-fold buds) to assess their effects on sugar, organic acid and  phenolic compound contents, as well as antioxidant capacity of the berries for a white wine grape variety ‘N...

  3. Identification of microRNAs from Amur grape (vitis amurensis Rupr. by deep sequencing and analysis of microRNA variations with bioinformatics

    Directory of Open Access Journals (Sweden)

    Wang Chen

    2012-03-01

    Full Text Available Abstract Background MicroRNA (miRNA is a class of functional non-coding small RNA with 19-25 nucleotides in length while Amur grape (Vitis amurensis Rupr. is an important wild fruit crop with the strongest cold resistance among the Vitis species, is used as an excellent breeding parent for grapevine, and has elicited growing interest in wine production. To date, there is a relatively large number of grapevine miRNAs (vv-miRNAs from cultivated grapevine varieties such as Vitis vinifera L. and hybrids of V. vinifera and V. labrusca, but there is no report on miRNAs from Vitis amurensis Rupr, a wild grapevine species. Results A small RNA library from Amur grape was constructed and Solexa technology used to perform deep sequencing of the library followed by subsequent bioinformatics analysis to identify new miRNAs. In total, 126 conserved miRNAs belonging to 27 miRNA families were identified, and 34 known but non-conserved miRNAs were also found. Significantly, 72 new potential Amur grape-specific miRNAs were discovered. The sequences of these new potential va-miRNAs were further validated through miR-RACE, and accumulation of 18 new va-miRNAs in seven tissues of grapevines confirmed by real time RT-PCR (qRT-PCR analysis. The expression levels of va-miRNAs in flowers and berries were found to be basically consistent in identity to those from deep sequenced sRNAs libraries of combined corresponding tissues. We also describe the conservation and variation of va-miRNAs using miR-SNPs and miR-LDs during plant evolution based on comparison of orthologous sequences, and further reveal that the number and sites of miR-SNP in diverse miRNA families exhibit distinct divergence. Finally, 346 target genes for the new miRNAs were predicted and they include a number of Amur grape stress tolerance genes and many genes regulating anthocyanin synthesis and sugar metabolism. Conclusions Deep sequencing of short RNAs from Amur grape flowers and berries identified 72

  4. Scientific Opinion on the substantiation of a health claim related to Vitis vinifera L. seeds extract and “helps to decrease swollen legs” pursuant to Article 13(5 of Regulation (EC No 1924/2006

    Directory of Open Access Journals (Sweden)

    EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA

    2012-12-01

    Full Text Available Following an application from Nutrilinks Sarl, submitted pursuant to Article 13(5 of Regulation (EC No 1924/2006 via the Competent Authority of Belgium, the Panel on Dietetic Products, Nutrition and Allergies (NDA was asked to deliver an opinion on the scientific substantiation of a health claim related to Vitis vinifera L. seeds extract and “helps to decrease swollen legs”. The Panel considers that the food constituent which is the subject of the health claim is sufficiently characterised. Upon EFSA’s request for clarification, the applicant stated that the claimed effect was “helps to decrease swollen legs”, and that the beneficial physiological effect could be related to “helps to refine legs”. In the context of the references provided for the scientific substantiation of the claim, and in particular of the human intervention study which was conducted with the food constituent that is the subject of the health claim, the Panel notes that the claim refers to the reduction of peripheral oedema in the context of chronic clinical conditions (e.g. chronic venous insufficiency where the reduction of peripheral oedema is a therapeutic target for the treatment of the condition. The Panel considers that the reduction of peripheral oedema in the context of chronic clinical conditions is a therapeutic target for the treatment of the condition and does not comply with the criteria laid down in Regulation (EC No 1924/2006.

  5. Competitive replacement of the native Vitis and Hedera taxa by invasive aliens: morphological, cytological and molecular evidences

    OpenAIRE

    Maria HOHN; Bodor, Péter; Márta BENYEI-HIMMER; Ferenczi, Júlia; Bisztray, György Dénes

    2012-01-01

    We describe here case studies of two woody climber species native to the broadleaf forests of the Carpathian basin. Wild grape (Vitis sylvestris C.C.Gmel.), considered to be one of the ancestors of the domesticated grapevine (Vitis vinifera L.) became a highly threatened species since the introduction of the American grape species as rootstocks for grapevine. Among these, especially, Riparian grape (Vitis riparia Minchx.) escaped from the wine yards and by invading the natural habitats replac...

  6. Influence of Fungal Strain, Temperature, and Wetness Duration on Infection of Grapevine Inflorescences and Young Berry Clusters by Botrytis cinerea.

    Science.gov (United States)

    Ciliberti, Nicola; Fermaud, Marc; Languasco, Luca; Rossi, Vittorio

    2015-03-01

    The effect of temperature and wetness duration on infection of Vitis vinifera inflorescences (from "inflorescence clearly visible" to "end of flowering" stages) and young berry clusters (at "fruit swelling" and "berries groat-sized" stages) by Botrytis cinerea was investigated. Artificial inoculations were carried out using conidial suspensions of eight B. cinerea strains belonging to the transposon genotypes transposa and vacuma. Infection incidence was significantly affected by strain but not by transposon genotype (transposon genotype accounted for only 6.5% of the variance). Infection incidence was also affected by the interaction between strain and growth stage of the inflorescence or berry cluster (overall accounting for approximately 57% of the experimental variance). Thus, under our experimental conditions, the ability to cause infection was a strain rather than a transposon genotype attribute. Across all strains, infection incidence was lowest when inflorescences were clearly visible or fully developed, highest at flowering (from beginning to end of flowering), and intermediate at the postflowering fruit stages (fruit swelling and berries groat-sized). One transposa strain, however, was highly virulent on all grapevine growth stages tested. The effects of temperature and wetness duration on infection incidence were similar for all fungal strains and grapevine growth stages; infection incidence was highest at 20°C and lowest at 30°C, and was also low at 5°C. Similar results were obtained for mycelial growth and conidial germination. Based on the pooled data for all strains and grapevine growth stages, an equation was developed that accounted for the combined effects of temperature and wetness duration on relative infection incidence. This equation should be useful for developing decision-making systems concerning B. cinerea control at early grapevine growth stages. PMID:25354016

  7. Identification of a Plastid-Localized Bifunctional Nerolidol/Linalool Synthase in Relation to Linalool Biosynthesis in Young Grape Berries

    Directory of Open Access Journals (Sweden)

    Bao-Qing Zhu

    2014-12-01

    Full Text Available Monoterpenoids are a diverse class of natural products and contribute to the important varietal aroma of certain Vitis vinifera grape cultivars. Among the typical monoterpenoids, linalool exists in almost all grape varieties. A gene coding for a nerolidol/linalool (NES/LINS synthase was evaluated in the role of linalool biosynthesis in grape berries. Enzyme activity assay of this recombinant protein revealed that it could convert geranyl diphosphate and farnesyl diphosphate into linalool and nerolidol in vitro, respectively, and thus it was named VvRILinNer. However, localization experiment showed that this enzyme was only localized to chloroplasts, which indicates that VvRILinNer functions in the linalool production in vivo. The patterns of gene expression and linalool accumulation were analyzed in the berries of three grape cultivars (“Riesling”, “Cabernet Sauvignon”, “Gewurztraminer” with significantly different levels of monoterpenoids. The VvRILinNer was considered to be mainly responsible for the synthesis of linalool at the early developmental stage. This finding has provided us with new knowledge to uncover the complex monoterpene biosynthesis in grapes.

  8. Transcriptomic and Metabolomic Networks in the Grape Berry Illustrate That it Takes More Than Flavonoids to Fight Against Ultraviolet Radiation

    Science.gov (United States)

    Matus, José Tomás

    2016-01-01

    Plants are constantly challenged by environmental fluctuations. In response, they have developed a wide range of morphological and biochemical adaptations committed to ameliorate the effects of abiotic stress. When exposed to higher solar radiation levels, plants activate the synthesis of a large set of enzymes and secondary metabolites as part of a complex sunscreen and antioxidant defense mechanism. Grapevine (Vitis vinifera L.) has become a widely used system for studying adaptive responses to this type of stress since changes in berry composition, positively influenced by increased ultraviolet (UV) radiation levels, improve the quality of wines subsequently produced. Despite the fact that most of the attention has been directed toward the synthesis of flavonoids, recent transcriptomic and metabolomic studies have shown that stilbenoids and isoprenoids (e.g., terpenes and carotenoids) are also an important part of the grape UV-response machinery. This minireview focuses on the latest findings referring to the metabolic responses of grapes to UV radiation and proposes a model for its transcriptional control. Depending on the berry developmental stage and the type of radiation (i.e., irradiance level, exposure length), increased UV levels activate different metabolic pathways through the activity of master regulators belonging to the basic Leucine Zipper Domain (bZIP) and R2R3-MYB transcription factor families. This transcriptional control is influenced by the interaction of other environmental factors such as light, temperature or soil water availability. In grapevine, phenylpropanoids are part of, but are not the whole story, in the fight against radiation damage.

  9. Using RPAS Multi-Spectral Imagery to Characterise Vigour, Leaf Development, Yield Components and Berry Composition Variability within a Vineyard

    Directory of Open Access Journals (Sweden)

    Clara Rey-Caramés

    2015-10-01

    Full Text Available Implementation of precision viticulture techniques requires the use of emerging sensing technologies to assess the vineyard spatial variability. This work shows the capability of multispectral imagery acquired from a remotely piloted aerial system (RPAS, and the derived spectral indices to assess the vegetative, productive, and berry composition spatial variability within a vineyard (Vitis vinifera L.. Multi-spectral imagery of 17 cm spatial resolution was acquired using a RPAS. Classical vegetation spectral indices and two newly defined normalised indices, NVI1 = (R802 − R531/(R802 + R531 and NVI2 = (R802 − R570/(R802 + R570, were computed. Their spatial distribution and relationships with grapevine vegetative, yield, and berry composition parameters were studied. Most of the spectral indices and field data varied spatially within the vineyard, as showed through the variogram parameters. While the correlations were significant but moderate among the spectral indices and the field variables, the kappa index showed that the spatial pattern of the spectral indices agreed with that of the vegetative variables (0.38–0.70 and mean cluster weight (0.40. These results proved the utility of the multi-spectral imagery acquired from a RPAS to delineate homogeneous zones within the vineyard, allowing the grapegrower to carry out a specific management of each subarea.

  10. Crescimento de bagas de cultivares de uvas apirênicas tratadas com CPPU e GA3 Increase of the cultivars berry apirenic growth of seedless grapes treated with CPPU and GA3

    Directory of Open Access Journals (Sweden)

    Valtemir Gonçalves Ribeiro

    2003-12-01

    Full Text Available As cultivares de uvas apirênicas (Vitis vinifera L., via de regra, possuem bagas de tamanhos reduzidos, necessitando de ajustes no manejo para a melhoria da qualidade dos cachos, sendo a aplicação de reguladores de crescimento um dos tratamentos mais eficazes. Objetivou-se com o presente trabalho avaliar os efeitos do forchlorfenuron (CPPU: 0 e 10 mgL-1 combinado ao ácido giberélico (GA3: 0, 25, 50, 75 e 100 mgL-1 durante o primeiro ciclo de produção das cultivares Centennial Seedless, Flame Seedless e Thompson Seedless. As características avaliadas foram o comprimento, diâmetro e peso de bagas. Para a 'Centennial Seedless', maiores comprimentos, diâmetro e peso de bagas foram obtidos com 100 mgL-1 de GA3; e a concentração de 100 mgL-1 de GA3 adicionada a 10 mgL-1 de CPPU foi a mais responsiva para a 'Flame Seedless' e 'Thompson Seedless', observando-se atrasos na maturação, em termos de sólidos solúveis totais, para todas as cultivares.The Seedless grapes (Vitis vinifera L., have always decrease in berry size, requiring managements to increase cluster quality. The spray with growth regulators is one of most effective the treatment to enlarge berry size. The objective of this work was to determine the effects of Forchlorfenuron (CPPU: 0 e 10mgL-1 associated with Giberelic acid (GA3: 0, 25, 50, 75 e 100 mgL-1 during the first cycle of production of the cultivars Centennial Seedless, Flame Seedless and Thompson Seedless. The appraised characteristics were length, diameter and weight of berries. For Centennial Seedless, larger lengths, diameter and weight of berries were obtained with 100 mL-1 of GA3; and the concentration of 100 mL-1 of GA3 added to 10 mL-1 of CPPU was the most responsive for Flame and Thompson Seedless, being observed delays in maturation, in terms of total soluble solids, for all cultivars.

  11. PIST – IS THE NEWEST BLACK BERRY WINE GRAPE VARIETY WITH COLORED FLESH AND JUICE, FOR THE PRODUCTION GLOBAL BENEFIT RED WINES

    Directory of Open Access Journals (Sweden)

    Zamanidi P. C.

    2014-12-01

    Full Text Available Newest technical black berry variety named Piste (“Faith” in Greek with colored flesh and juice breeded at Athens Institute of Viticulture (Greece by researchers Zamanidi P., L. Troshin and P. Radchevskii in 2007 by crossing the Greek varieties Afoos (Mavrodafni x Alicante Boucher with Ukrainian variety Odessa black (Alicante Bouchet x Cabernet Sauvignon. Duration of production period is 146-155 days. Growth of shoots is strong (2,1-3,0 m. The percentage of productive shoots is more than 90. The yield is very high: 25-30 t / ha. The average weight of clusters is 250 g. It can be characterized by high winter hardiness, drought resistance and increased resistance to fungal diseases in comparison with varieties of Vitis vinifera. Flower is hermaphrodite. Cluster is medium, conical, sometimes with wings, medium density. Berry is small, round, blue-black color with a thick waxy coating. The skin is medium thickness, dense and durable. Pulp and juice are intensely colored. Very high sugar content. Variety is intended for the production of intensely colored dry red wines of excellent class, as well as high-quality sparkling wines, dessert, sweet and liqueur wines; suitable for the manufacture of high-quality strong colored juices. When used in blends with other varieties enhances color, full flavor and enhances the bouquet of the wine

  12. Variation in the chilling requirement and bud burst rate of wild Vitis species

    Science.gov (United States)

    Cultivated grapevine (Vitis vinifera) is one of the most important agricultural fruit crops in the world. In the United States, grapevines are often grown in environments very different than the Mediterranean climate from where the cultivated species was domesticated. Predictions of changing clima...

  13. Desfolha em videiras americanas e viníferas na fase de pré-maturação dos frutos Defoliation of american and vinifera grapevines in the pre ripening of fruits

    Directory of Open Access Journals (Sweden)

    Rafael Anzanello

    2011-07-01

    Full Text Available Foram avaliadas possíveis interferências que a localização da folha removida mediante desfolha em videira apresenta sobre o rendimento e qualidade dos frutos. As cultivares 'Niagara Branca' e 'Concord', ambas Vitis labrusca, e 'Cabernet Sauvignon' e 'Merlot', ambas Vitis vinifera, foram utilizadas em sistema de condução em espaldeira, na safra 2006/2007. O experimento foi conduzido em delineamento de blocos casualizados, com quatro repetições e quatro plantas por parcela, sendo testados 4 tratamentos: T1 (testemunha - sem desfolha, T2 (retirada das folhas localizadas opostas aos cachos, T3 (retirada das folhas do sarmento localizadas abaixo dos cachos e T4 (retirada das folhas do sarmento localizadas abaixo e opostas aos cachos. As cultivares da espécie Vitis labrusca receberam um tratamento adicional T5, constando na retirada das folhas acima dos cachos. A aplicação dos tratamentos foi realizada na fase de mudança de cor das bagas para as cultivares 'Concord', 'Merlot' e 'Cabernet Sauvignon' e início do amolecimento das bagas para a cultivar 'Niagara Branca'. Avaliaram-se, após a colheita, a produção por planta, a massa dos cachos, os teores de sólidos solúveis (SS, a acidez titulável, (AT e o pH dos frutos. Observou-se que a desfolha até a altura do cacho não influenciou na quantidade e na qualidade dos frutos. Porém, quando a desfolha foi realizada acima dos cachos, ocorreu um atraso na maturação das uvas americanas. Essa condição implica não ser necessária a desfolha seletiva até a altura dos cachos nas videiras estudadas, quando realizada na fase início de amadurecimento dos frutos.This study aimed to evaluate the interference that the location of the leaf removed by defolation in grapevine has on fruits quality and yield. Such experiment was performed using Niagara Branca and Concord, both Vitis labrusca, and Cabernet Sauvignon e Merlot, both Vitis vinifera, trained in a unilateral cordon system during the

  14. The relationship between root hydraulics and scion vigour across Vitis rootstocks: what role do root aquaporins play?

    OpenAIRE

    GAMBETTA, G. A.; Manuck, C. M.; Drucker, S. T.; Shaghasi, T.; Fort, K.; Matthews, M A; Walker, M. A.; McElrone, A. J.

    2012-01-01

    Vitis vinifera scions are commonly grafted onto rootstocks of other grape species to influence scion vigour and provide resistance to soil-borne pests and abiotic stress; however, the mechanisms by which rootstocks affect scion physiology remain unknown. This study characterized the hydraulic physiology of Vitis rootstocks that vary in vigour classification by investigating aquaporin (VvPIP) gene expression, fine-root hydraulic conductivity (Lp r ), % aquaporin contribution to Lp r , scion tr...

  15. Transcriptome analyses of the Dof-like gene family in grapevine reveal its involvement in berry, flower and seed development.

    Science.gov (United States)

    da Silva, Danielle Costenaro; da Silveira Falavigna, Vítor; Fasoli, Marianna; Buffon, Vanessa; Porto, Diogo Denardi; Pappas, Georgios Joannis; Pezzotti, Mario; Pasquali, Giancarlo; Revers, Luís Fernando

    2016-01-01

    The Dof (DNA-binding with one finger) protein family spans a group of plant transcription factors involved in the regulation of several functions, such as plant responses to stress, hormones and light, phytochrome signaling and seed germination. Here we describe the Dof-like gene family in grapevine (Vitis vinifera L.), which consists of 25 genes coding for Dof. An extensive in silico characterization of the VviDofL gene family was performed. Additionally, the expression of the entire gene family was assessed in 54 grapevine tissues and organs using an integrated approach with microarray (cv Corvina) and real-time PCR (cv Pinot Noir) analyses. The phylogenetic analysis comparing grapevine sequences with those of Arabidopsis, tomato, poplar and already described Dof genes in other species allowed us to identify several duplicated genes. The diversification of grapevine DofL genes during evolution likely resulted in a broader range of biological roles. Furthermore, distinct expression patterns were identified between samples analyzed, corroborating such hypothesis. Our expression results indicate that several VviDofL genes perform their functional roles mainly during flower, berry and seed development, highlighting their importance for grapevine growth and production. The identification of similar expression profiles between both approaches strongly suggests that these genes have important regulatory roles that are evolutionally conserved between grapevine cvs Corvina and Pinot Noir. PMID:27610237

  16. Sulphur dioxide evokes a large scale reprogramming of the grape berry transcriptome associated with oxidative signalling and biotic defence responses.

    Science.gov (United States)

    Giraud, Estelle; Ivanova, Aneta; Gordon, Colin S; Whelan, James; Considine, Michael J

    2012-02-01

    The grape and wine industries are heavily reliant on sulphite preservatives. However, the view that sulphites act directly on bacterial and fungal pathogens may be simplistic. Mechanisms of sulphur-enhanced defences are largely unknown; many sulphur-rich compounds enhance plant defences and sulphite can also have oxidative consequences via production of H(2)O(2) or sulphitolysis. To investigate the effects of sulphur dioxide (SO(2) ) on fresh table grapes (Vitis vinifera L. 'Crimson Seedless'), transcriptome analysis was carried out on berries treated with SO(2) under commercial conditions for 21 d. We found a broad perturbation of metabolic processes, consistent with a large-scale stress response. Transcripts encoding putative sulphur-metabolizing enzymes indicated that sulphite was directed towards chelation and conjugation, and away from oxidation to sulphate. The results indicated that redox poise was altered dramatically by SO(2) treatment, evidenced by alterations in plastid and mitochondrial alternative electron transfer pathways, up-regulation of fermentation transcripts and numerous glutathione S-transferases, along with a down-regulation of components involved in redox homeostasis. Features of biotic stress were up-regulated, notably signalling via auxin, ethylene and jasmonates. Taken together, this inventory of transcriptional responses is consistent with a long-term cellular response to oxidative stress, similar to the effects of reactive oxygen species. PMID:21689113

  17. Transcriptomic and Metabolomic Networks in the Grape Berry Illustrate That it Takes More Than Flavonoids to Fight Against Ultraviolet Radiation.

    Science.gov (United States)

    Matus, José Tomás

    2016-01-01

    Plants are constantly challenged by environmental fluctuations. In response, they have developed a wide range of morphological and biochemical adaptations committed to ameliorate the effects of abiotic stress. When exposed to higher solar radiation levels, plants activate the synthesis of a large set of enzymes and secondary metabolites as part of a complex sunscreen and antioxidant defense mechanism. Grapevine (Vitis vinifera L.) has become a widely used system for studying adaptive responses to this type of stress since changes in berry composition, positively influenced by increased ultraviolet (UV) radiation levels, improve the quality of wines subsequently produced. Despite the fact that most of the attention has been directed toward the synthesis of flavonoids, recent transcriptomic and metabolomic studies have shown that stilbenoids and isoprenoids (e.g., terpenes and carotenoids) are also an important part of the grape UV-response machinery. This minireview focuses on the latest findings referring to the metabolic responses of grapes to UV radiation and proposes a model for its transcriptional control. Depending on the berry developmental stage and the type of radiation (i.e., irradiance level, exposure length), increased UV levels activate different metabolic pathways through the activity of master regulators belonging to the basic Leucine Zipper Domain (bZIP) and R2R3-MYB transcription factor families. This transcriptional control is influenced by the interaction of other environmental factors such as light, temperature or soil water availability. In grapevine, phenylpropanoids are part of, but are not the whole story, in the fight against radiation damage. PMID:27625679

  18. Competitive replacement of the native Vitis and Hedera taxa by invasive aliens: morphological, cytological and molecular evidences

    Directory of Open Access Journals (Sweden)

    Maria HOHN

    2012-10-01

    Full Text Available We describe here case studies of two woody climber species native to the broadleaf forests of the Carpathian basin. Wild grape (Vitis sylvestris C.C.Gmel., considered to be one of the ancestors of the domesticated grapevine (Vitis vinifera L. became a highly threatened species since the introduction of the American grape species as rootstocks for grapevine. Among these, especially, Riparian grape (Vitis riparia Minchx. escaped from the wine yards and by invading the natural habitats replaced the autochthonous wild grape. In consequence of the competitive exclusion Vitis sylvestris suffered a strong withdrawal along its native habitats. 20 morphological traits, including leaf shape and trichome structure were studied to tackle evidence of the introgressive hybridization among the alien and native taxa. Most of the studied Hungarian habitats were already dominated by hybrid specimens of Vitis taxa. Molecular analysis based on 8 nuclear microsatellites markers supported the morphological results. 

  19. Nitrogen nutrition of the grape-vine (Vitis vinifera spp)

    International Nuclear Information System (INIS)

    A thorough knowledge concerning the nitrogen relationship in the grape-vine is essential in order to appreciate how different patterns of uptake, assimilation, storage and utilisation of nitrogen might be advantageous in particular environmental situations. The 15N-isotope technique has been used to determine the uptake and distribution of nitrogen absorbed during early spring, early summer and autumn. Apart from the total N fraction, protein N and soluble N were determined as well. The utilisation of labelled N applied in the field, was determined for vineyards on heavier and lighter soils

  20. Production Charachteristics of Some Introduced Grape Cultivars (Vitis vinifera L.)

    OpenAIRE

    Jasminka Karoglan Kontić; Edi Maletić; Nikola Mirošević; Bernard Kozina; Jasmina Marić

    2000-01-01

    In order to expand the number of red grape cultivars suitable for Northern Dalmatia subregion experimental vineyard has been planted on the farm 'Bastica' PK Zadar. The large number of red grape cultivar has been introducted. Seven of them are spread in central and southern Italy (Montepulciano, Sangiovese, Malvasia nera di Lecce, Ciliegiolo, Aglianico, Cabernet sauvignon, Moscato rosa), which have similar ecological conditions as the area of Ravni Kotari. During the five years period agrobio...

  1. Development Correlations of the Buds of Grapevine (Vitis vinifera L.

    Directory of Open Access Journals (Sweden)

    Liliana ROTARU

    2010-06-01

    Full Text Available The development characteristics of different buds of the grapevine are mainly related by stimulation and/or inhibition effects, the action of which is still inexplicable. The present study examines the development dynamics of the buds of a one-year old branch after excision of different buds and the application of ?-naphtyl acetic acid (ANA, as well as the growth capacity of each bud individually. We verified the effects of acrotony cited previously by various researchers. These effects are due to different developmental characteristics of which could to lay the groundwork for the improvement of different productions methods.

  2. Aminoacids Profile of cv. Kraljevina (Vitis vinifera L. Clones Candidates

    Directory of Open Access Journals (Sweden)

    Ivana Puhelek

    2015-11-01

    Full Text Available Different clones from a single grape variety can differ in their productive characteristics and their ability to produce wines with different organoleptic characteristics. The ammonium ions and free amino acids are the main sources of nitrogen for Saccharomyces cerevisiae and thus the concentration of nitrogen compounds in the must can significantly affect the wine quality. ‘Kraljevina’ is well known Croatian autochthonous variety traditionally grown in Northwest Croatia. The clonal selection was started in 2003, and in the period 2011-2012 the evaluation of nine clones of ‘Kraljevina’ grape variety (VV-360,VV-482,VV-486, VV- 438, VV-434, VV-479, VV-423, VV-406, VV-483 was conducted. The grapes of the clones tested were harvested on the same day and the obtained juices were filtered and stored for further amino acids analysis. The obtained results pointed to significant diverseness and strong clonal influence on amino acid composition between tested clones. The most abundant amino acid in all clones was arginine ranging from 197.07 to 438.36 mg/L, while the smallest differences were noticed in isoleucine, cysteine, valine and phenylalanine concentrations. The total amino acids concentration ranged from 492.7 mg/L in VV-406 clone to 952.04 mg/L in VV-360 ‘Kraljevina’ clone.

  3. Identification and expression analysis of heat shock transcription factors in the wild Chinese grapevine (Vitis pseudoreticulata).

    Science.gov (United States)

    Hu, Yang; Han, Yong-Tao; Zhang, Kai; Zhao, Feng-Li; Li, Ya-Juan; Zheng, Yi; Wang, Yue-Jin; Wen, Ying-Qiang

    2016-02-01

    Heat shock transcription factors (Hsfs) are known to play pivotal roles in the adaptation of plants to heat stress and other stress stimuli. While grapevine (Vitis vinifera L.) is one of the most important fruit crops worldwide, little is known about the Hsf family in Vitis spp. Here, we identified nineteen putative Hsf genes (VviHsfs) in Vitis spp based on the 12 × grape genome (V. vinifera L.). Phylogenetic analysis revealed three classes of grape Hsf genes (classes A, B, and C). Additional comparisons between grape and Arabidopsis thaliana demonstrated that several VviHsfs genes occurred in corresponding syntenic blocks of Arabidopsis. Moreover, we examined the expression profiles of the homologs of the VviHsfs genes (VpHsfs) in the wild Chinese Vitis pseudoreticulata accession Baihe-35-1, which is tolerant to various environmental stresses. Among the nineteen VpHsfs, ten VpHsfs displayed lower transcript levels under non-stress conditions and marked up-regulation during heat stress treatment; several VpHsfs also displayed altered expression levels in response to cold, salt, and hormone treatments, suggesting their versatile roles in response to stress stimuli. In addition, eight VpHsf-GFP fusion proteins showed differential subcellular localization in V. pseudoreticulata mesophyll protoplasts. Taken together, our data may provide an important reference for further studies of Hsf genes in Vitis spp. PMID:26689772

  4. Characterization of Flavan-3-ols and Expression of MYB and Late Pathway Genes Involved in Proanthocyanidin Biosynthesis in Foliage of Vitis bellula

    Directory of Open Access Journals (Sweden)

    Ke-Gang Li

    2013-03-01

    Full Text Available Proanthocyanidins (PAs are fundamental nutritional metabolites in different types of grape products consumed by human beings. Although the biosynthesis of PAs in berry of Vitis vinifera has gained intensive investigations, the understanding of PAs in other Vitis species is limited. In this study, we report PA formation and characterization of gene expression involved in PA biosynthesis in leaves of V. bellula, a wild edible grape species native to south and south-west China. Leaves are collected at five developmental stages defined by sizes ranging from 0.5 to 5 cm in length. Analyses of thin layer chromatography (TLC and high performance liquid chromatography-photodiode array detector (HPLC-PAD show the formation of (+-catechin, (−-epicatechin, (+-gallocatechin and (−-epigallocatechin during the entire development of leaves. Analyses of butanol-HCl boiling cleavage coupled with spectrometry measurement at 550 nm show a temporal trend of extractable PA levels, which is characterized by an increase from 0.5 cm to 1.5 cm long leaves followed by a decrease in late stages. TLC and HPLC-PAD analyses identify cyanidin, delphinidin and pelargonidin produced from the cleavage of PAs in the butanol-HCl boiling, showing that the foliage PAs of V. bellula include three different types of extension units. Four cDNAs, which encode VbANR, VbDFR, VbLAR1 and VbLAR2, respectively, are cloned from young leaves. The expression patterns of VbANR and VbLAR2 but not VbLAR1 and VbDFR follow a similar trend as the accumulation patterns of PAs. Two cDNAs encoding VbMYBPA1 and VbMYB5a, the homologs of which have been demonstrated to regulate the expression of both ANR and LAR in V. vinifera, are also cloned and their expression profiles are similar to those of VbANR and VbLAR2. In contrast, the expression profiles of MYBA1 and 2 homologs involved in anthocyanin biosynthesis are different from those of VbANR and VbLAR2. Our data show that both ANR and LAR branches are

  5. Identification of microRNAs from Amur grape (vitis amurensis Rupr.) by deep sequencing and analysis of microRNA variations with bioinformatics

    OpenAIRE

    Wang Chen; Han Jian; Liu Chonghuai; Kibet Korir; Kayesh Emrul; Shangguan Lingfei; Li Xiaoying; Fang Jinggui

    2012-01-01

    Abstract Background MicroRNA (miRNA) is a class of functional non-coding small RNA with 19-25 nucleotides in length while Amur grape (Vitis amurensis Rupr.) is an important wild fruit crop with the strongest cold resistance among the Vitis species, is used as an excellent breeding parent for grapevine, and has elicited growing interest in wine production. To date, there is a relatively large number of grapevine miRNAs (vv-miRNAs) from cultivated grapevine varieties such as Vitis vinifera L. a...

  6. Antimicrobial properties of berries

    OpenAIRE

    Puupponen-Pimiä, Riitta

    2007-01-01

    Berries, especially their antimicrobial properties, have been studied intensively at VTT over the past ten years in several research projects. In these in vitro studies phenolic berry extracts of common Nordic berries selectively inhibited the growth of harmful bacteria and human intestinal pathogens, without affecting the growth of beneficial lactic acid bacteria.

  7. Simple Rain-Shelter Cultivation Prolongs Accumulation Period of Anthocyanins in Wine Grape Berries

    OpenAIRE

    Xiao-Xi Li; Fei He; Jun Wang; Zheng Li; Qiu-Hong Pan

    2014-01-01

    Simple rain-shelter cultivation is normally applied during the grape growth season in continental monsoon climates aiming to reduce the occurrence of diseases caused by excessive rainfall. However, whether or not this cultivation practice affects the composition and concentration of phenolic compounds in wine grapes remains unclear. The objective of this study was to investigate the effect of rain-shelter cultivation on the accumulation of anthocyanins in wine grapes (Vitis vinifera L. Cabern...

  8. APOLLON – THE NEW WINE HIGH QUALITY GRAPE VARIETY WITH BLACK BERRY Aполлон – новый высококачественный универсальный черноягодный сорт винограда

    Directory of Open Access Journals (Sweden)

    Zamanidi P. C.

    2012-01-01

    Full Text Available Universal black-berry Apollo grape has been launched in Greece by P.Zamanidi, L.Troshin and A.Isachkin in 2003 with combinative selection - crossing of the Fi-lery Greek variety with the French Cabernet-Sauvignon. The duration of the production period 136-145 days. The strength of growth of arms is strong (2,1-3,0 m, the degree of maturation of the vines is high. Crop yields are very high - 35-40 t/ha. The aver-age mass of clusters is 430 g. It is characterized by high winter hardiness, drought-resistance and high resistance to fungal diseases in comparison with varie-ties of Vitis vinifera. The flower is bisexual. Cluster is big or very big, conical with the wing, loose. Berries are medium or large, oval, blue-black in color, with a thick wax coating. The skin is thick. The pulp and juice - with varietal flavor. Sugar content is high. Notable for long saving the harvest in the bushes, well-kept in the cooler cells. The variety is meant for the fresh consumption and for manufacture of red dry, desert and sweet wines; suitable for production of high-quality juices

  9. Bioactive berry phenolics

    OpenAIRE

    Heinonen, Marina

    2007-01-01

    Compositional data on phenolic compounds in berries has been rapidly accumulating and readily included in the national food composition data base. Among the different bioactive substances in berries, phenolic compounds including flavonoids, tannins, and phenolic acids have received considerable interest due to their effects in food and health.

  10. The Berry's connection

    International Nuclear Information System (INIS)

    A course on the Berry's connection is presented. The main steps leading to the Berry's discovery are reviewed and the obtained equations are examined. Some applications of Berry's formulation are presented. They include diatomic molecules, dipole-quadrupole interaction in spherical mucleus and diabolic pair transfer. The experimental results presented are the spectrum of the Na3 molecule, the propagation of photons in an helical optical fiber and the neutron spin rotation. Non-abelian problems and the Aharonow-Anandan phase are discussed

  11. Supersymmetric Berry index

    CERN Document Server

    Ilinskii, K N; Melezhik, V S; Ilinski, K N; Kalinin, G V; Melezhik, V V

    1994-01-01

    We revise the sequences of SUSY for a cyclic adiabatic evolution governed by the supersymmetric quantum mechanical Hamiltonian. The condition (supersymmetric adiabatic evolution) under which the supersymmetric reductions of Berry (nondegenerated case) or Wilczek-Zee (degenerated case) phases of superpartners are taking place is pointed out. The analogue of Witten index (supersymmetric Berry index) is determined. As the examples of suggested concept of supersymmetric adiabatic evolution the Holomorphic quantum mechanics on complex plane and Meromorphic quantum mechanics on Riemann surface are considered. The supersymmetric Berry indexes for the models are calculated.

  12. Effect of post veraison regulated deficit irrigation in production and berry quality of Autumn Royal and Crimson table grape cultivars

    OpenAIRE

    Faci González, José María; Blanco Alibés, Olga; Medina Pueyo, Eva Teresa; Martínez-Cob, Antonio

    2014-01-01

    A field experiment was performed in drip-irrigated two seedless table grape vineyards (Vitis vinifera L. cv. Autumn Royal and Crimson) from 2007 to 2009 in a semiarid area of north-eastern Spain to evaluate the effect of post veraison regulated deficit irrigation (RDI) on the grape yield and quality. The same experimental layout was used in both cultivars. Two RDI treatments were compared with a full irrigation treatment in both cultivars. The full irrigation treatment (T1) was irrigated a...

  13. Comparative Analysis of Phenolic Content and Profile, Antioxidant Capacity and Anti-inflammatory Bioactivity in Wild Alaskan and Commercial Vaccinium Berries

    OpenAIRE

    Grace, Mary H; Esposito, Debora; Dunlap, Kriya L.; Lila, Mary Ann

    2013-01-01

    Wild Alaskan Vaccinium berries, V. vitis-idaea (lowbush cranberry) and V. uliginosum (bog blueberry), were investigated in parallel to their commercial berry counterparts; V. macrocarpon (cranberry) and V. angustifolium (lowbush blueberry). Lowbush cranberry accumulated about twice the total phenolics (624.4 mg/100 g FW) and proanthocyanidins (278.8 mg/100 g) content as commercial cranberries, but A-type proanthocyanidins were more prevalent in the latter. Bog blueberry anthocyanin and total ...

  14. Life history and assessment of grapevine phylloxera leaf galling incidence on Vitis species in Uruguay.

    Science.gov (United States)

    Vidart, María Valeria; Mujica, María Valentina; Bao, Leticia; Duarte, Felicia; Bentancourt, Carlos María; Franco, Jorge; Scatoni, Iris Beatriz

    2013-12-01

    Grapevine phylloxera, Daktulosphaira vitifoliae (Fitch) (Hemiptera: Phylloxeridae) is a worldwide pest of Vitis species. It has forms that feed on leaves and roots. Root forms predominate on Vitis vinifera (L.) cultivars, while leaf forms predominate on Vitis species from its native American range. Recently, high densities of D. vitifoliae infestations in leaves of V. vinifera in Brazil, Peru, and Uruguay have been reported. The aims of this study were to determine the seasonal development of grape phylloxera, quantify infestation levels on V. vinifera leaves, and compare them with infestation levels on leaves of a rootstock of American origin. Studies were conducted in two vineyards in Uruguay from 2004-2007. Terminal shoots of 3309 C and Cabernet Sauvignon, Chardonnay, Tannat, Viognier, grafted onto resistant rootstock, were sampled weekly and leaves examined for gall presence and insect life stage. First galls were detected in early October; eggs began to appear within two weeks. Two oviposition peaks occurred by the end of December, and they coincided with bursts of shoot growth. On 3309C rootstock, oviposition peaks were more frequent than on the European cultivars. Based on thermal accumulation, D. vitifoliae could complete eight generations a year in Uruguay. Rootstock 3309C suffered the greatest damage but in some cases was similar to the European cultivars. Damage to Chardonnay, Cabernet Sauvignon and Viognier were also high. There were no galls on Tannat. The 2005-2006 season was characterized by low infestation rates caused by a prolonged drought that affected vegetative growth. There were also differences between vineyards, where the vigorous plants suffering more damage. Leaf galling phylloxera incidence and damage were mainly associated to the cultivar but plant vigor and environmental factors also contributed to increase the incidence. PMID:23667822

  15. 葡萄果实分支酸变位酶基因的克隆与表达分析%Cloning and expression of gene encoding chorismate mutase in grape berries

    Institute of Scientific and Technical Information of China (English)

    张晨; 陈灵婧; 李小溪; 王军

    2014-01-01

    莽草酸途径是连接糖代谢和次生代谢的主要桥梁,分支酸变位酶(Chorismate Mutase,CM)是控制碳同化物由莽草酸途径进入苯丙烷代谢途径的入口酶,在葡萄果实酚类物质积累中起着重要作用。本研究以赤霞珠葡萄(Vitis vinifera cv. Cabernet Sauvignon)果实为试材,采用电子克隆和分子克隆相结合技术,获得两个编码分支酸变位酶同源基因,分别命名为VvCM1和VvCM2。这两个基因分别定位于4号和14号染色体上,其编码区全长分别为741 bp和963 bp,编码蛋白含246和320个氨基酸。VvCM1和VvCM2与其他植物中的同类酶在氨基酸水平上具有广泛的同源性。Real-time PCR分析显示,VvCM1和VvCM2基因在葡萄的各器官和组织中均有表达,VvCM1在果实中表达丰度最高,而VvCM2在茎中表达丰度最高。%Shikimate pathway connects primary carbohydrate metabolism with the biosynthesis of most secondary metabolites in plants. Chorismate Mutase (CM) is an entry enzyme from shikimate pathway into phenylpropanoid metabolism, which plays an important role in the accumulation of phenolic compounds in grape berries. In the present study, two CM cDNAs were cloned from grape berries (Vitis vinifera cv. Cabernet Sauvignon) and designated as VvCM1 and VvCM2. The cDNAs of VvCM1 and VvCM2 contained open reading frames of 741 bp and 963 bp, which encoded a polypeptide of 246 and 320 amino acid residues with a molecular mass of 27.06 kDa and 35.2 kDa, respectively. The DNA sequences corresponding to the two isogenes both contain four introns and located on the chromosome 4 and 14, respectively. The sequence homology comparison showed that VvCM1 and VvCM2 had high homology of the amino acid sequences with other plant CM from the GenBank. Analysis by Real time-PCR showed that VvCM1 and VvCM2 were expressed in all the tested tissues. The transcript abundance of VvCM1 was the highest in grape berries and VvCM2 had the highest

  16. Genetic diversity of stilbene metabolism in Vitis sylvestris.

    Science.gov (United States)

    Duan, Dong; Halter, David; Baltenweck, Raymonde; Tisch, Christine; Tröster, Viktoria; Kortekamp, Andreas; Hugueney, Philippe; Nick, Peter

    2015-06-01

    Stilbenes, as important secondary metabolites of grapevine, represent central phytoalexins and therefore constitute an important element of basal immunity. In this study, potential genetic variation in Vitis vinifera ssp. sylvestris, the ancestor of cultivated grapevine, was sought with respect to their output of stilbenes and potential use for resistance breeding. Considerable variation in stilbene inducibility was identified in V. vinifera ssp. sylvestris. Genotypic differences in abundance and profiles of stilbenes that are induced in response to a UV-C pulse are shown. Two clusters of stilbene 'chemovars' emerged: one cluster showed quick and strong accumulation of stilbenes, almost exclusively in the form of non-glycosylated resveratrol and viniferin, while the second cluster accumulated fewer stilbenes and relatively high proportions of piceatannol and the glycosylated piceid. For all 86 genotypes, a time dependence of the stilbene pattern was observed: piceid, resveratrol, and piceatannol accumulated earlier, whereas the viniferins were found later. It was further observed that the genotypic differences in stilbene accumulation were preceded by differential accumulation of the transcripts for chalcone synthase (CHS) and stilbene-related genes: phenylalanine ammonium lyase (PAL), stilbene synthase (StSy), and resveratrol synthase (RS). A screen of the population with respect to susceptibility to downy mildew of grapevine (Plasmopara viticola) revealed considerable variability. The subpopulation of genotypes with high stilbene inducibility was significantly less susceptible as compared with low-stilbene genotypes, and for representative genotypes it could be shown that the inducibility of stilbene synthase by UV correlated with the inducibility by the pathogen. PMID:25873669

  17. The phytoalexin resveratrol regulates the initiation of hypersensitive cell death in Vitis cell.

    Directory of Open Access Journals (Sweden)

    Xiaoli Chang

    Full Text Available Resveratrol is a major phytoalexin produced by plants in response to various stresses and promotes disease resistance. The resistance of North American grapevine Vitis rupestris is correlated with a hypersensitive reaction (HR, while susceptible European Vitis vinifera cv. 'Pinot Noir' does not exhibit HR, but expresses basal defence. We have shown previously that in cell lines derived from the two Vitis species, the bacterial effector Harpin induced a rapid and sensitive accumulation of stilbene synthase (StSy transcripts, followed by massive cell death in V. rupestris. In the present work, we analysed the function of the phytoalexin resveratrol, the product of StSy. We found that cv. 'Pinot Noir' accumulated low resveratrol and its glycoside trans-piceid, whereas V. rupestris produced massive trans-resveratrol and the toxic oxidative δ-viniferin, indicating that the preferred metabolitism of resveratrol plays role in Vitis resistance. Cellular responses to resveratrol included rapid alkalinisation, accumulation of pathogenesis-related protein 5 (PR5 transcripts, oxidative burst, actin bundling, and cell death. Microtubule disruption and induction of StSy were triggered by Harpin, but not by resveratrol. Whereas most responses proceeded with different amplitude for the two cell lines, the accumulation of resveratrol, and the competence for resveratrol-induced oxidative burst differed in quality. The data lead to a model, where resveratrol, in addition to its classical role as antimicrobial phytoalexin, represents an important regulator for initiation of HR-related cell death.

  18. Efeitos do thidiazuron e do ácido giberélico nas características dos cachos e bagos da uva de mesa 'Vênus' na região noroeste do estado de São Paulo Effects of thidiazuron and gibberellic acid on cluster and berry characteristics of 'Vênus' table grape in the Northwestern São Paulo State

    Directory of Open Access Journals (Sweden)

    Renato Vasconcelos Botelho

    2003-04-01

    Full Text Available O uso de reguladores de crescimento está amplamente difundido no cultivo da videira para a melhoria da qualidade das uvas (Vitis vinifera L., visando principalmente ao aumento em tamanho e ao pegamento dos bagos, à descompactação dos cachos e à eliminação de sementes. Nesse contexto, um experimento foi conduzido em vinhedo do cultivar Vênus localizado em Urânia-SP, região noroeste de São Paulo, por dois ciclos consecutivos. Para os tratamentos, utilizam-se thidiazuron a 5 ou 10 mg.L-1 e ácido giberélico a 30 mg.L-1, combinados ou não. Foram avaliadas as seguintes variáveis: comprimento, largura e massa dos cachos e bagos; massa dos engaços; número de bagos; número de sementes-traço; e teor de sólidos solúveis totais, acidez total titulável e relação SST/ATT do mosto. As aplicações de ácido giberélico aumentaram a massa, o comprimento, a largura e o número dos bagos, e reduziram o número de sementes-traço de uvas 'Vênus'. A associação de thidiazuron com ácido giberélico potencializou o efeito desse regulador de crescimento no aumento do pegamento dos frutos e na redução do número de sementes-traço. Aplicações de thidiazuron a 10 mg.L-1, associado ou não ao ácido giberélico, atrasaram a maturação da uva, diminuindo o teor de sólidos solúveis totais e a relação SST/ATT e reduziram a acidez total titulável do mosto. Aplicações de reguladores de crescimento também aumentaram a massa dos cachos e dos engaços.The use of growth regulators is widely diffused in vine crops to improve grapes quality (Vitis vinifera L., aiming mainly the increase of fruit size and set, loosening clusters, and elimination of seeds. In this context, a trial was carried out in a vineyard located at Urânia-SP, Northwestern São Paulo State, during two seasons. It was used thidiazuron at 5 or 10mg.L-1 and gibberellic acid at 30mg.L-1, combined or not. The following variables were evaluated: weight, length and width of

  19. Dicty_cDB: VHE264 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-04 2 BQ793980 |BQ793980.1 EST 2918 Veraison Grape berries Lambda Zap II Library Vitis vinifera cDNA clone ...878.1 EST 2816 Veraison Grape berries Lambda Zap II Library Vitis vinifera cDNA clone TT251B04 3', mRNA sequ...HU(LMS) puzzle sunflower Helianthus paradoxus cDNA clone CHUL1765, mRNA sequence. 44 0.049 2 BQ793878 |BQ793

  20. Dicty_cDB: AFJ178 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available strain AX4, complete sequence. 32 0.56 9 BQ798539 |BQ798539.1 EST 708 Green Grape berries Lambda Zap II Lib...799355.1 EST 1524 Green Grape berries Lambda Zap II Library Vitis vinifera cDNA clone GT181G07 3', mRNA sequ...rary Vitis vinifera cDNA clone GB005C04 3', mRNA sequence. 38 0.73 2 BQ799355 |BQ

  1. Dicty_cDB: AFJ691 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFJ691 (Link to dictyBase) - - - Contig-U16243-1 AFJ691P (Link to Original ... 05315.1 VVC011E10_126660 An expressed sequence tag database ... for abiotic stressed berries of Vitis vinifera var ... 08288.1 VVC055H06_148036 An expressed sequence tag database ... for abiotic stressed berries of Vitis vinifera var ...

  2. BlackBerry For Dummies

    CERN Document Server

    Kao, Robert

    2010-01-01

    Get the most juice out of your BlackBerry handheld!. Feature-rich and complex, the BlackBerry is the number one smartphone in the corporate world is among the most popular handhelds for business users. This new and updated edition includes all the latest and greatest information on new and current BlackBerry mobile devices. Covering a range of valuable how-to topics, this helpful guide explores the BlackBerry's most useful features, techniques for getting the most out of your BlackBerry, and practical information about power usage.: Covers all aspects of the number one smartphone in the corpor

  3. Lesão renal aguda por glicerol: efeito antioxidante da Vitis vinifera L Acute kidney injury by glycerol: antioxidant effect of Vitis vinifera L

    OpenAIRE

    Elisabete Cristina de Oliveira Martim; Carolina Ferreira Pinto; Mirian Watanabe; Maria de Fátima Fernandes Vattimo

    2007-01-01

    JUSTIFICATIVA E OBJETIVOS: A lesão renal aguda (LRA) é a complicação mais grave da rabdomiólise. Nessa síndrome, a liberação do pigmento heme desencadeia uma lesão que se caracteriza por vasoconstrição glomerular e toxicidade celular direta com provável componente oxidante. A renoproteção com antioxidantes tem demonstrado efeito satisfatório. As proantocianidinas são antioxidantes naturais encontradas no extrato da semente da uva. O objetivo deste estudo foi avaliar o efeito antioxidante da V...

  4. Die Untersuchung der Erkennung von Plasmopara viticola durch VRP1 Rezeptoren und der Regulation der Pathogenabwehr durch die Transkriptionsfaktoren VvWRKY33 und VvERF5 in der Weinrebe (Vitis sp.)

    OpenAIRE

    Merz, Patrick Roman

    2014-01-01

    Die Weinrebe (Vitis vinifera L. ssp. vinifera) gehört zu den bedeutendsten Kulturpflanzen weltweit. Ihre hohe Anfälligkeit für eine Vielzahl von Pathogenen, insbesondere dem Echten (Erysiphe necator) und Falschen Mehltau (Plasmopara viticola), ist für den Weinbau eine besondere wirtschaftliche Bedrohung und kann zu erheblichen Ernteausfällen führen. Nicht zuletzt darum werden in Europa zwei Drittel der Gesamtmenge an Fungiziden im Weinbau eingesetzt. Um den Fungizideinsatz zu reduzieren, soll...

  5. Profile of bioactive compounds from grape pomace (Vitis vinifera and Vitis labrusca) by spectrophotometric, chromatographic and spectral analyses.

    Science.gov (United States)

    Ribeiro, L F; Ribani, R H; Francisco, T M G; Soares, A A; Pontarolo, R; Haminiuk, C W I

    2015-12-15

    The aim of this study was to characterize grape pomace (GP) from winemaking byproducts of different grape samples (Cabernet Sauvignon-CS; Merlot-ME; Mix composed of 65% Bordeaux, 25% Isabel and 10% BRS Violet-MI and Terci-TE) with a view to exploiting its potential as a source of bioactive compounds and an alternative to the reuse of waste. Bioactive compounds such as individual phenolic compounds and polyunsaturated fatty acids (PUFA) were identified and quantified by spectrophotometric, chromatographic and spectral analyses. The sample of MI had the highest concentrations for total phenolic compounds and total flavonoids, while TE had the highest content for total monomeric anthocyanins. For all samples it was possible to identify 13 different anthocyanins by high performance liquid chromatography (HPLC) and mass spectrometry (MS). Moreover, the GP samples showed phenolic acids; flavan-3-ols such as catechin; flavonols such as quercetin, rutin and kaempferol; and stilbenes such as trans-resveratrol. Therefore, grape pomace can be considered a source for the recovery of phenolic compounds having antioxidant activity as well as a rich source of PUFA. Thus it can be used as an ingredient in the development of new food products, since it is suitable for human consumption, and a viable alternative both to adding nutritional value to food and to reduce environmental contamination. PMID:26590878

  6. MARIA CALLAS – THE NEW WINE HIGH-GRADE FRAGRANT PINK-BERRY GRAPE BREED Мария Каллас — новый винный высококачественный ароматный розовоягодный сорт винограда

    Directory of Open Access Journals (Sweden)

    Zamanidi P. C.

    2011-06-01

    Full Text Available Maria Callas is the new wine high-grade fragrant pink-berry breed, bred in Greece by Panteley Zamanidi, Leonid Troshin and Alexander Isachkin in 2003 by mating of Greek breed of Roditis with Traminer pink. Under morpho-physiological characteristics, it is included in ecological and geographical group of breeds of the Western Europe. Duration of productive phase is 146-155 days. A breed is strong grown; a degree of ripening of a vine is very high. Productivity is high. The medial mass of racemations is 180 gr. Differs with high winter-hardiness, drought resistance and raised sustainability to fungous diseases in comparison with breeds of Vitis vinifera. The flower is bisexual. A racemation is medial, conic with medial denseness. Bacca is medial, oval, pink color, with a dense wax coating. Peel is tight. Pulp is juicy with strongly expressed high quality flavour. Sugar content is high. Baccas become dry and raisin-like when overrippen and are duratingly maintained on scrubs: sugar content thus attains more than 30 %. The breed is designed for production of dry white wines of excellent quality, and also high-grade dessert and sweet wines; it is applicable for production of high-grade juice, compotes and jam as well; at drying of baccas the raisin of high quality with fragrant tender tang is gained

  7. KORMILITSA LISA - NEW GREEK-RUSSIAN INTEGRATED SUSTAINABLE WHITE BERRY MOSCHATUS GRAPE VARIETY Кормилица Лиза – новый Греко-Российский комплексноустойчивый белоягодный мускатный сорт винограда

    Directory of Open Access Journals (Sweden)

    Zamanidi P. C.

    2013-02-01

    Full Text Available Kormilitsa Lisa grape was created in Greece by P. Zamanidi and L.Troshin in 2003 with crossing the varieties of the Pervenets Maharach with varieties of Muscat white. The duration of the production period is 146-155 days. The yield is high. The average mass of clusters of 250 g. It has winter hardiness, drought-resistance and high resistance to fungal diseases in comparison with varieties of Vitis vinifera; it is also tolerant to phylloxeras. The flower is ambisexual. The bunch is average, cylinder-conic, medium density. The berry is average, oval, green-yellow colour, with a thick wax coating. The skin is thin, thick, and strong. The pulp and juice with a strong Muscat flavor. Sugar content is high with acidity constant. When overripen, it dries long and is stored on the bushes. The variety is meant for manufacture of dry white wine of superior class and high-quality dessert and sweet wines; It is also suitable for the development of high-quality juices and compotes

  8. Berry phase in lattice QCD

    CERN Document Server

    Yamamoto, Arata

    2016-01-01

    We propose the lattice QCD calculation of the Berry phase which is defined by the ground state of a single fermion. We perform the ground-state projection of a single-fermion propagator, construct the Berry link variable on a momentum-space lattice, and calculate the Berry phase. As the first application, the first Chern number of the (2+1)-dimensional Wilson fermion is calculated by the Monte Carlo simulation.

  9. Bioactive constituents in aronia berries

    OpenAIRE

    2014-01-01

    The aim of this thesis was to investigate some of the potential health benefits of aronia berries with main focus on the phenolic substances. Extractions and fractionations of aronia berries were performed to obtain several crude extracts and subfractions. In addition, well known constituents of aronia berries (anthocyanins, procyanidins and phenolic acids) were isolated. The different samples obtained were then tested in various in vitro bioassays to determine their biological activities as ...

  10. Dicty_cDB: SSE805 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available inifera cDNA clone VVA029A07 3, mRNA sequence. 38 0.025 2 BQ798604 |BQ798604.1 EST 773 Green Grape berries L...ambda Zap II Library Vitis vinifera cDNA clone GB006A10 3', mRNA sequence. 38 0.026 2 BQ798639 |BQ798639.1 EST 808 Green Grape...06 3', mRNA sequence. 38 0.026 2 BQ798629 |BQ798629.1 EST 798 Green Grape berries Lambda Zap II Library Viti...s vinifera cDNA clone GB006D07 3', mRNA sequence. 38 0.026 2 BQ799996 |BQ799996.1 EST 2165 Green Grape berri... 0.026 2 BQ799789 |BQ799789.1 EST 1958 Green Grape berries Lambda Zap II Library Vitis vinifera cDNA clone G

  11. Historical introgression of the downy mildew resistance gene Rpv12 from the Asian species Vitis amurensis into grapevine varieties.

    Directory of Open Access Journals (Sweden)

    Silvia Venuti

    Full Text Available The Amur grape (Vitis amurensis Rupr. thrives naturally in cool climates of Northeast Asia. Resistance against the introduced pathogen Plasmopara viticola is common among wild ecotypes that were propagated from Manchuria into Chinese vineyards or collected by Soviet botanists in Siberia, and used for the introgression of resistance into wine grapes (Vitis vinifera L.. A QTL analysis revealed a dominant gene Rpv12 that explained 79% of the phenotypic variance for downy mildew resistance and was inherited independently of other resistance genes. A Mendelian component of resistance-a hypersensitive response in leaves challenged with P. viticola-was mapped in an interval of 0.2 cM containing an array of coiled-coil NB-LRR genes on chromosome 14. We sequenced 10-kb genic regions in the Rpv12(+ haplotype and identified polymorphisms in 12 varieties of V. vinifera using next-generation sequencing. The combination of two SNPs in single-copy genes flanking the NB-LRR cluster distinguished the resistant haplotype from all others found in 200 accessions of V. vinifera, V. amurensis, and V. amurensis x V. vinifera crosses. The Rpv12(+ haplotype is shared by 15 varieties, the most ancestral of which are the century-old 'Zarja severa' and 'Michurinets'. Before this knowledge, the chromosome segment around Rpv12(+ became introgressed, shortened, and pyramided with another downy mildew resistance gene from North American grapevines (Rpv3 only by phenotypic selection. Rpv12(+ has an additive effect with Rpv3(+ to protect vines against natural infections, and confers foliar resistance to strains that are virulent on Rpv3(+ plants.

  12. Historical Introgression of the Downy Mildew Resistance Gene Rpv12 from the Asian Species Vitis amurensis into Grapevine Varieties

    Science.gov (United States)

    Venuti, Silvia; Copetti, Dario; Foria, Serena; Falginella, Luigi; Hoffmann, Sarolta; Bellin, Diana; Cindrić, Petar; Kozma, Pál; Scalabrin, Simone; Morgante, Michele; Testolin, Raffaele; Di Gaspero, Gabriele

    2013-01-01

    The Amur grape (Vitis amurensis Rupr.) thrives naturally in cool climates of Northeast Asia. Resistance against the introduced pathogen Plasmopara viticola is common among wild ecotypes that were propagated from Manchuria into Chinese vineyards or collected by Soviet botanists in Siberia, and used for the introgression of resistance into wine grapes (Vitis vinifera L.). A QTL analysis revealed a dominant gene Rpv12 that explained 79% of the phenotypic variance for downy mildew resistance and was inherited independently of other resistance genes. A Mendelian component of resistance–a hypersensitive response in leaves challenged with P. viticola–was mapped in an interval of 0.2 cM containing an array of coiled-coil NB-LRR genes on chromosome 14. We sequenced 10-kb genic regions in the Rpv12+ haplotype and identified polymorphisms in 12 varieties of V. vinifera using next-generation sequencing. The combination of two SNPs in single-copy genes flanking the NB-LRR cluster distinguished the resistant haplotype from all others found in 200 accessions of V. vinifera, V. amurensis, and V. amurensis x V. vinifera crosses. The Rpv12+ haplotype is shared by 15 varieties, the most ancestral of which are the century-old ‘Zarja severa’ and ‘Michurinets’. Before this knowledge, the chromosome segment around Rpv12+ became introgressed, shortened, and pyramided with another downy mildew resistance gene from North American grapevines (Rpv3) only by phenotypic selection. Rpv12+ has an additive effect with Rpv3+ to protect vines against natural infections, and confers foliar resistance to strains that are virulent on Rpv3+ plants. PMID:23593440

  13. Historical introgression of the downy mildew resistance gene Rpv12 from the Asian species Vitis amurensis into grapevine varieties.

    Science.gov (United States)

    Venuti, Silvia; Copetti, Dario; Foria, Serena; Falginella, Luigi; Hoffmann, Sarolta; Bellin, Diana; Cindrić, Petar; Kozma, Pál; Scalabrin, Simone; Morgante, Michele; Testolin, Raffaele; Di Gaspero, Gabriele

    2013-01-01

    The Amur grape (Vitis amurensis Rupr.) thrives naturally in cool climates of Northeast Asia. Resistance against the introduced pathogen Plasmopara viticola is common among wild ecotypes that were propagated from Manchuria into Chinese vineyards or collected by Soviet botanists in Siberia, and used for the introgression of resistance into wine grapes (Vitis vinifera L.). A QTL analysis revealed a dominant gene Rpv12 that explained 79% of the phenotypic variance for downy mildew resistance and was inherited independently of other resistance genes. A Mendelian component of resistance-a hypersensitive response in leaves challenged with P. viticola-was mapped in an interval of 0.2 cM containing an array of coiled-coil NB-LRR genes on chromosome 14. We sequenced 10-kb genic regions in the Rpv12(+) haplotype and identified polymorphisms in 12 varieties of V. vinifera using next-generation sequencing. The combination of two SNPs in single-copy genes flanking the NB-LRR cluster distinguished the resistant haplotype from all others found in 200 accessions of V. vinifera, V. amurensis, and V. amurensis x V. vinifera crosses. The Rpv12(+) haplotype is shared by 15 varieties, the most ancestral of which are the century-old 'Zarja severa' and 'Michurinets'. Before this knowledge, the chromosome segment around Rpv12(+) became introgressed, shortened, and pyramided with another downy mildew resistance gene from North American grapevines (Rpv3) only by phenotypic selection. Rpv12(+) has an additive effect with Rpv3(+) to protect vines against natural infections, and confers foliar resistance to strains that are virulent on Rpv3(+) plants. PMID:23593440

  14. Nonspecific lipid-transfer protein genes expression in grape (vitis sp.) Cells in response to fungal elicitor treatments

    OpenAIRE

    Gomès, Eric; Sagot, Emeric; Gaillard, Cécile; Laquitaine, Laurent; Poinssot, Benoît; Sanejouand, Yves-Henri; Delrot, Serge; Coutos-Thévenot, Pierre

    2003-01-01

    Nonspecific lipid transfer proteins (nsLTPs) are small, basic cystein-rich proteins believed to be involved in plant defense mechanisms. Three cDNAs coding nsLTPs from grape (Vitis vinifera sp.) were cloned by reverse-transcriptase-polymerase chain reaction (RT-PCR) and PCR. The expression of nsLTP genes was investigated in 41B-rootstock grape cell suspension, in response to various defense-related signal molecules. Ergosterol (a fungi-specific sterol) and a proteinaceous elicitor puri...

  15. Berry fruits: compositional elements, biochemical activities, and the impact of their intake on human health, performance, and disease.

    Science.gov (United States)

    Seeram, Navindra P

    2008-02-13

    An overwhelming body of research has now firmly established that the dietary intake of berry fruits has a positive and profound impact on human health, performance, and disease. Berry fruits, which are commercially cultivated and commonly consumed in fresh and processed forms in North America, include blackberry ( Rubus spp.), black raspberry ( Rubus occidentalis), blueberry ( Vaccinium corymbosum), cranberry (i.e., the American cranberry, Vaccinium macrocarpon, distinct from the European cranberry, V. oxycoccus), red raspberry ( Rubus idaeus) and strawberry ( Fragaria x ananassa). Other berry fruits, which are lesser known but consumed in the traditional diets of North American tribal communities, include chokecherry ( Prunus virginiana), highbush cranberry ( Viburnum trilobum), serviceberry ( Amelanchier alnifolia), and silver buffaloberry ( Shepherdia argentea). In addition, berry fruits such as arctic bramble ( Rubus articus), bilberries ( Vaccinuim myrtillus; also known as bog whortleberries), black currant ( Ribes nigrum), boysenberries ( Rubus spp.), cloudberries ( Rubus chamaemorus), crowberries ( Empetrum nigrum, E. hermaphroditum), elderberries ( Sambucus spp.), gooseberry ( Ribes uva-crispa), lingonberries ( Vaccinium vitis-idaea), loganberry ( Rubus loganobaccus), marionberries ( Rubus spp.), Rowan berries ( Sorbus spp.), and sea buckthorn ( Hippophae rhamnoides), are also popularly consumed in other parts of the world. Recently, there has also been a surge in the consumption of exotic "berry-type" fruits such as the pomegranate ( Punica granatum), goji berries ( Lycium barbarum; also known as wolfberry), mangosteen ( Garcinia mangostana), the Brazilian açaí berry ( Euterpe oleraceae), and the Chilean maqui berry ( Aristotelia chilensis). Given the wide consumption of berry fruits and their potential impact on human health and disease, conferences and symposia that target the latest scientific research (and, of equal importance, the dissemination of

  16. Berry development in relation to Gibberellin(GA_3) treatment and VvSEP3expression of 'Fenghou' grapevine%‘峰后’葡萄果实发育与赤霉素(GA_3)处理以及VvSEP3基因表达的关系

    Institute of Scientific and Technical Information of China (English)

    杨玉艳; 王建楼; 鲁井云; 秦旭冬; 李天忠; 胡建芳

    2012-01-01

    为了探明‘峰后’葡萄赤霉素(GA3)处理后促使果粒变长的原因和VvSEP3基因在果实早期发育中的作用,在开花前利用0.1mg/g GA3处理花序并通过原位杂交分析了VvSEP3基因的表达。结果显示:GA3处理提高了峰后葡萄的坐果,增加了果形指数,从开花后14d开始到开花后56d,GA3处理后的果实纵径始终大于同时期的对照果实,解剖学结构研究表明,中果皮的细胞膨大从开花后7d开始明显大于同时期发育的对照果粒。VvSEP3基因在开花期的柱头、花柱、横膈膜以及胚珠的珠心组织中有表达,开花后主要在子房壁中表达,当幼胚发育时在维管束组织和胚乳组织中有所表达。本研究显示GA3处理后明显增加峰后葡萄的果形指数,同时促进了果肉细胞的纵向生长从而使果粒变长;VvSEP3基因在子房壁细胞分裂与膨大过程中可能发挥重要作用,同时也可能参与了种子的形成和发育过程。%This paper is concerned with The effects of gibberellins(GA3) on berry growth and the possible role of VvSEP3 gene in early berry development of 'Fenghou' grapevine(Vitis vinifera L.).The inflorescences before flowering were treated with 0.1mg/L GA3.The VvSEP3 gene expression pattern during early berry development was studied by in situ hybridization.Our results showed that GA3 treatment increased the fruit setting rate and the fruit form index.The longitudinal diameter of GA3 treatment berry was larger than the control from 14 days after full bloom(DAFB) to 56 DAFB.Anatomical structure of the berry showed that the cell longitudinal diameter of the mesocarp was significantly larger than control berry from 7 DAFB,indicating that berry elongation due to GA3 treatment might be the stimulation of cell vertical growth.The VvSEP3 gene was expressed in the stigma,style,diaphragm and the nucellar tissue of ovules during flowering,in the ovary wall after flowering,and in vascular

  17. Berry Fermi Liquid Theory

    CERN Document Server

    Chen, Jing-Yuan

    2016-01-01

    We develop an extension of the Landau Fermi liquid theory to systems of interacting fermions with non-trivial Berry curvature. We propose a kinetic equation and a constitutive relation for the electromagnetic current that together encode the linear response of such systems to external electromagnetic perturbations, to leading and next-to-leading orders in the expansion over the frequency and wave number of the perturbations. We analyze the Feynman diagrams in a large class of interacting quantum field theories and show that, after summing up all orders in perturbation theory, the current-current correlator exactly matches with the result obtained from the kinetic theory.

  18. «PROFESSOR DAVIDIS» – THE NEW BLACK BERRY HIGH-QUALITY WINE GRAPE WITH COLORED PULP AND JUICE «Профессор Давидис» – новый черноягодный высококачественный винный сорт винограда с окрашенной мякотью и соком

    Directory of Open Access Journals (Sweden)

    Zamanidi P. C.

    2012-10-01

    Full Text Available The grape variety with colored pulp and juice named “Professor Davids” was selected in Greece by P.Zamanidy, L.Troshin and A.Isachkin in 2003 with crossing of the Greek varieties of “Mandilaria” with the French introducent of “Alicant Bushe”. The duration of the production period is 156-165 days. Variety is full-grown. The degree of maturation of the vines is high. Crop yields are very high. The average mass of clusters is 300 gr. Has a high winter hardiness, drought-resistance and high resistance to fungal diseases in comparison with industrial varieties of Vitis vinifera. The female flower, with the stamens. The bunch of average size, cylindroconical, medium density. Berries are medium, round, blue-black in color, with a thick wax coating. The skin is thick, dense. The pulp and juice are intensively painted, with varietal flavour. Sugar content is very high. Notable for long preservation of the harvest in the bushes. The variety is suitable for making intensively painted dry red wines of superior class and high-quality dessert wines and unique juices. Due to its morpho- physiological characteristics it has been included in the eco-geographic group of varieties of the Black sea basin

  19. Resistance evaluation of Chinese wild Vitis genotypes against Botrytis cinerea and different responses of resistant and susceptible hosts to the infection.

    Science.gov (United States)

    Wan, Ran; Hou, Xiaoqing; Wang, Xianhang; Qu, Jingwu; Singer, Stacy D; Wang, Yuejin; Wang, Xiping

    2015-01-01

    The necrotrophic fungus Botrytis cinerea is a major threat to grapevine cultivation worldwide. A screen of 41 Vitis genotypes for leaf resistance to B. cinerea suggested species independent variation and revealed 18 resistant Chinese wild Vitis genotypes, while most investigated V. vinifera, or its hybrids, were susceptible. A particularly resistant Chinese wild Vitis, "Pingli-5" (V. sp. [Qinling grape]) and a very susceptible V. vinifera cultivar, "Red Globe" were selected for further study. Microscopic analysis demonstrated that B. cinerea growth was limited during early infection on "Pingli-5" before 24 h post-inoculation (hpi) but not on Red Globe. It was found that reactive oxygen species (ROS) and antioxidative system were associated with fungal growth. O[Formula: see text] accumulated similarly in B. cinerea 4 hpi on both Vitis genotypes. Lower levels of O[Formula: see text] (not H2O2) were detected 4 hpi and ROS (H2O2 and O[Formula: see text]) accumulation from 8 hpi onwards was also lower in "Pingli-5" leaves than in "Red Globe" leaves. B. cinerea triggered sustained ROS production in "Red Globe" but not in "Pingli-5" with subsequent infection progresses. Red Globe displayed little change in antioxidative activities in response to B. cinerea infection, instead, antioxidative activities were highly and timely elevated in resistant "Pingli-5" which correlated with its minimal ROS increases and its high resistance. These findings not only enhance our understanding of the resistance of Chinese wild Vitis species to B. cinerea, but also lay the foundation for breeding B. cinerea resistant grapes in the future. PMID:26579134

  20. Phenolic compounds in berries and flowers of a natural hybrid between bilberry and lingonberry (Vaccinium × intermedium Ruthe).

    Science.gov (United States)

    Lätti, Anja K; Riihinen, Kaisu R; Jaakola, Laura

    2011-06-01

    Hybridization between species plays an important role in the evolution of secondary metabolites and in the formation of combinations of existing secondary metabolites in plants. We have investigated the content of phenolic compounds in berries and flowers of Vaccinium×intermedium Ruthe, which is a rare natural hybrid between bilberry (Vaccinium myrtillus L.) and lingonberry (Vaccinium vitis-idaea L.). The berries and flowers of the hybrid showed characteristics inherited from both parent species in the distribution and contents of phenolic compounds. Bilberry is known as one of the richest sources of anthocyanins and to have a profile of 15 major forms combining cyanidin, delphinidin, petunidin, peonidin and malvidin with galactose, glucose and arabinose. Lingonberry contains only cyanidin glycosides. Hybrid berries contained all bilberry anthocyanins with pronounced cyanidin content. With regard to proanthocyanidins and flavonol glycosides, the hybrid inherited diverse profiles combining those of both parental species. The distribution of hydroxycinnamic acids was quite uniform in all studied berries. Of the identified compounds, 30 were detected in lingonberry, 46 in bilberry, 53 in hybrid berries and 38 in hybrid flowers. Hence, compared with the parent species, hybrid berries possess a more diverse profile of phenolic compounds and, therefore, can offer interesting material for breeding purposes. PMID:21382629

  1. Qubit rotation and Berry phase

    International Nuclear Information System (INIS)

    A quantized fermion is represented by a scalar particle encircling a magnetic flux line. It has the spinor structure which can be constructed from quantum gates and qubits. We have studied here the role of Berry phase in removing dynamical phase during one qubit rotation of a quantized fermion. The entanglement of two qubits inserting spin-echo to one of them results the trapped Berry phase to measure entanglement. Some effort is given to study the effect of noise on the Berry phase of spinors and their entangled states. (author)

  2. Dicty_cDB: FC-IC1017 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A sequence. 50 2e-04 2 CD802153 |CD802153.1 EST 10028 Ripe Grape Berry Skins Lambda Triplex2 Library Vitis v...ifera var. Chardonnay Vitis vinifera cDNA clone VVB157C10 5, mRNA sequence. 50 2e-04 2 BQ798071 |BQ798071.1 EST 7009 Ripening Grape...0 |BQ796440.1 EST 5378 Ripening Grape berries Lambda Zap II Library Vitis vinifera cDNA clone RT041C07 3', m

  3. Berry's Phase in Noncommutative Spaces

    Institute of Scientific and Technical Information of China (English)

    S. A. Alavi

    2003-01-01

    We discuss the perturbative aspects of noncommutative quantum mechanics. Then we study Berry's phase within the framework of noncommutative quantum mechanics. The results show deviations from the usual quantum mechanics, which depend on the parameter of space/space noncommutativity.

  4. Structure of haze forming proteins in white wines: Vitis vinifera thaumatin-like proteins.

    Directory of Open Access Journals (Sweden)

    Matteo Marangon

    Full Text Available Grape thaumatin-like proteins (TLPs play roles in plant-pathogen interactions and can cause protein haze in white wine unless removed prior to bottling. Different isoforms of TLPs have different hazing potential and aggregation behavior. Here we present the elucidation of the molecular structures of three grape TLPs that display different hazing potential. The three TLPs have very similar structures despite belonging to two different classes (F2/4JRU is a thaumatin-like protein while I/4L5H and H2/4MBT are VVTL1, and having different unfolding temperatures (56 vs. 62°C, with protein F2/4JRU being heat unstable and forming haze, while I/4L5H does not. These differences in properties are attributable to the conformation of a single loop and the amino acid composition of its flanking regions.

  5. Impact of different vinification techniques on the formation of reductive notes in Vitis vinifera cv. Vernatsch

    Directory of Open Access Journals (Sweden)

    Pixner Konrad

    2015-01-01

    Full Text Available The grape variety Vernatsch is prone to the formation of severe reductive notes during alcoholic fermentation (AF, spoiling the fruity aroma characteristic for this variety. We investigated the impact of eight different vinification treatments on the formation of volatile sulfur compounds (VSCs and their impact on the sensorial quality of the wines in this susceptible grape variety. Without the addition of sulfur under the form of potassium metabisulfite (K2S2O5 to the crushed grapes, wines were significant less reductive. The clarification treatment showed promising results for the diminution of reductive notes, but might not be a feasible strategy for commercial wineries. Changing fermentation temperature, adding air, bentonite or copper to fermenting wines increased the appearance of reductive notes. The addition sulfur prior AF increased reductive notes in Vernatsch wines and needs to be considered as a crucial factor for the formation of reductive notes.

  6. Bacterial communities in the rhizosphere of Vitis vinifera L. cultivated under distinct agricultural practices in Argentina.

    Science.gov (United States)

    Vega-Avila, A D; Gumiere, T; Andrade, P A M; Lima-Perim, J E; Durrer, A; Baigori, M; Vazquez, F; Andreote, F D

    2015-02-01

    Plants interact with a myriad of microbial cells in the rhizosphere, an environment that is considered to be important for plant development. However, the differential structuring of rhizosphere microbial communities due to plant cultivation under differential agricultural practices remains to be described for most plant species. Here we describe the rhizosphere microbiome of grapevine cultivated under conventional and organic practices, using a combination of cultivation-independent approaches. The quantification of bacterial 16S rRNA and nifH genes, by quantitative PCR (qPCR), revealed similar amounts of these genes in the rhizosphere in both vineyards. PCR-DGGE was used to detect differences in the structure of bacterial communities, including both the complete whole communities and specific fractions, such as Alphaproteobacteria, Betaproteobacteria, Actinobacteria, and those harboring the nitrogen-fixing related gene nifH. When analyzed by a multivariate approach (redundancy analysis), the shifts observed in the bacterial communities were poorly explained by variations in the physical and chemical characteristics of the rhizosphere. These approaches were complemented by high-throughput sequencing (67,830 sequences) based on the V6 region of the 16S rRNA gene, identifying the major bacterial groups present in the rhizosphere of grapevines: Proteobacteria, Actinobacteria, Firmicutes, Bacteriodetes, Acidobacteria, Cloroflexi, Verrucomicrobia and Planctomycetes, which occur in distinct proportions in the rhizosphere from each vineyard. The differences might be related to the selection of plant metabolism upon distinct reservoirs of microbial cells found in each vineyard. The results fill a gap in the knowledge of the rhizosphere of grapevines and also show distinctions in these bacterial communities due to agricultural practices. PMID:25527391

  7. Drying of Vitis vinifera L. cv “Sultanina” in tunnel solar drier

    Directory of Open Access Journals (Sweden)

    İs̨çi Burçak

    2015-01-01

    The main factor in the drying process is to obtain minimum energy consumption of the product with the desired quality and reach a maximum speed of drying. The results obtained from this research are used in practice compliance.

  8. Antioxidant activity of extract from gamma irradiated red grape (Vitis vinifera) seeds

    International Nuclear Information System (INIS)

    This investigation aims to study the antioxidant activity efficiency of extracts from irradiated defatted red grape seeds at dose levels of 1, 3 and 5 kGy). The non-irradiated and irradiated defatted red grape seeds samples were extracted with acetone: water: acetic acid (90:9.5:0.5) immediately after irradiation and the antioxidant activity were studied. Gas chromatographic-Mass spectrum was applied to identify and quantify the phenolic compounds of extracts and the amino acids composition was determined in all samples under investigation of defatted red grape seeds. The measurements of the antioxidant activity, using a β-carotene-linoleate model system and radical scavenging capacity effect on 2, 2-diphenyl-1- picrylhydrazyl (DPPH) radical was determined in the extracts of defatted red grape seeds. The results indicated that extracts of defatted red grape seeds possess marked antioxidant activities, especially control samples compared with irradiated samples. The analysis by GC /MS led to identification of 41, 31, 33 and 28 components the of extract non-irradiated and irradiated samples at doses 1,3 and 5 kGy, respectively. It appears that grape seeds extract could be very effective in inhibiting lipid oxidation of sunflower oil. Thus, according to the results of this study, the extract of defatted red grape seeds may be used as a new potential source of natural antioxidant for food

  9. Polyphenolic Contents and Antioxidant Activities of Underutilized Grape (Vitis vinifera L.) Pomace Extracts

    OpenAIRE

    Kabir, Faisal; Sultana, Mosammad Shahin; Kurnianta, Heri

    2015-01-01

    Grape pomace is an abundant source of underutilized winery by-products. Polyphenols were extracted from grape pomace using cellulase and gluco-amylase enzymes. 2,2-diphenyl-1-picrylhydrazyl (DPPH) and Folin-Ciocalteu’s assays were used to measure antioxidant activity and total polyphenolic contents. Both cellulase, and gluco-amylase digested grape pomace showed efficient radical scavenging activity. In addition, the total polyphenolic contents of cellulase digested grape pomace showed lower c...

  10. Effect of gamma irradiation on storability of two cultivars of Syrian grapes (Vitis Vinifera)

    International Nuclear Information System (INIS)

    This study was initiated to investigate the effect of gamma irradiation on storability of two local table grape varieties: Baladi and Helwani. The experiments were performed in 1995 and 1996, when both varieties were treated with 0, 0.5, 1.0 and 1.5 kGy in the first year. In the second year two additional doses were used 0.1 and 0.25 kGy for Helwani and 2.0 and 2.5 kGy for Baladi. Irradiated and unirradiated fruits were stored in a refrigerated room (temperature, 1-2 Centigrade). Weight loss, spoilage and total loss were evaluated every 2 and 4 weeks of storage for Baladi and Helwani, respectively. The results have shown that gamma irradiation improved the storability of both varieties. in addition, irradiation prevented molding and prolonged the storage time. The optimum doses for improving the storability were 0.5-1.0 kGy for Halwani and 1.5-2.0 kGy for the storage periods can be extended by 50% using these optimal doses for both varieties. (author)

  11. Effect of gamma irradiation on storability of two cultivars of Syrian grapes Vitis vinifera

    International Nuclear Information System (INIS)

    This study was initiated to investigate the effect of gamma irradiation on storability of two local table grape varieties: Baladi and Helwani. The experiments were performed in 1995 and 1996, when both varieties were treated with 0, 0.5, 1.0 and 1.5 kGy in the first year. In the second year two additional doses were used 0.1 and 0.25 kGy for Helwani and 2.0 and 2.5 kGy for Baladi. Irradiated and unirradiated fruits were stored in a refrigerated room (temperature, 1–2°C). Weight loss, spoilage and total loss were evaluated every 2 and 4 weeks of storage for Baladi and Helwani, respectively. The results have shown that gamma irradiation improved the storability of both varieties. In addition, irradiation prevented molding and prolonged the storage time. The optimum doses for improving the storability were 0.5–1.0 kGy for Helwani and 1.5–2.0 kGy for Baladi, and the storage periods can be extended by 50% using these optimal doses for both varieties

  12. Synonyms and homonyms of 'Malvasía' cultivars (Vitis vinifera L.) existing in Spain

    OpenAIRE

    Rodríguez-Torres, I.; Ibáñez Marcos, Javier; de Andrés, M. Teresa; C. Rubio; Borrego, J.; Cabello, Félix; Zerolo, J.; Muñoz-Organero, G.

    2009-01-01

    [EN] >Malvasia> is a common name for different grape cultivars that have long been grown in Spain. In many cases, these cultivars are noted as being aromatic, sweet, and similar to Muscat in flavour. However, not all grapes that share this name exhibit these characteristics. This study compares the Malvasia cultivars in the Spanish Denominations of Origin with those grape cultivars grown in the grapevine collection of El Encin (Alcala de Henares, Spain) using morphological, isoenzymatic, and ...

  13. Synonyms and homonyms of Malvasia cultivars (Vitis vinifera L.) existing in Spain

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez Torres, I.; Ibanez, J.; Andres, M. T. de; Rubio, C.; Borrego, J.; Cabello, F.; Zerolo, J.; Munoz Organero, G.

    2009-07-01

    Malvasia is a common name for different grape cultivars that have long been grown in Spain. In many cases, these cultivars are noted as being aromatic, sweet, and similar to Muscat in flavour. However, not all grapes that share this name exhibit these characteristics. This study compares the Malvasia cultivars in the Spanish Denominations of Origin with those grape cultivars grown in the grapevine collection of El Encin (Alcala de Henares, Spain) using morphological, iso enzymatic, and micro satellite analysis as well as a large bibliographic search of the studied cultivars. Despite their Malvasia denomination, some cultivars have been identified as synonyms of Macabeo, Alarije, Dona Blanca, Chasselas, or Planta Nova, all included on the official Spanish list of commercial grape cultivars. Malvasia de Sitges and Malvasia de Lanzarote have the characteristic flavour of Malvasia grapes and no synonyms were found among the cultivars grown in Spain, whereas Malvasia Rosada resulted from a colour mutation in Malvasia de Sitges. (Author) 26 refs.

  14. Analyzing 3D xylem networks in Vitis vinifera using High Resolution Computed Tomography (HRCT)

    Science.gov (United States)

    Recent developments in High Resolution Computed Tomography (HRCT) have made it possible to visualize three dimensional (3D) xylem networks without time consuming, labor intensive physical sectioning. Here we describe a new method to visualize complex vessel networks in plants and produce a quantitat...

  15. Influence of Soil Reaction on Phosphorus, Potassium, Calcium and Magnesium Dynamics in Grapevine (Vitis vinifera L.

    Directory of Open Access Journals (Sweden)

    Lepomir Čoga

    2009-03-01

    Full Text Available Influence of soil reaction on phosphorus, potassium, calcium and magnesium dynamics in grapevine was studied on the variety Sauvignon Blanc in 2007, in the Plešivica wine-growing region. Investigations were conducted on three vitisol subtypes: dystric cambisol (pHKCl 3.73-3.76, pseudogley (pHKCl 4.67-4.69 and rendzina on marl (pHKCl 7.21-7.27. To establish the amount and dynamics of P, K, Ca and Mg in plant material, leaf samples were taken three times during the growing period: at the flowering and veraison stages and at the end of the growing period. At all sampling times, significantly higher leaf contents of P, Ca and Mg were found on alkaline soil compared to acid soils, while differences in K levels were not statistically significant. Differences in P contents may be explained by better solubility and thereby better availability of P from Ca-phosphates compared to Al, Mn and Fe-phosphates in acid soils. In addition, the cation ratio K/(Ca+Mg that has a significant influence on grape quality, was also determined in leaves. Compared to optimal values (0.30–0.40, the least favourable ratio K/ (Ca+Mg was recorded at flowering on acid soils (0.38–0.77 and at harvest on calcareous soil (0.12–0.27. Differences in the content of sugar and total acids in must indicate a positive correlation between leaf contents of P, Ca and Mg and sugar content of must, and a negative correlation between leaf contents of P, Ca and Mg and the total acid content of must.

  16. Pedigree reconstruction of the Italian grapevine Aglianico (Vitis vinifera L.) from Campania.

    Science.gov (United States)

    De Lorenzis, Gabriella; Imazio, Serena; Biagini, Barbara; Failla, Osvaldo; Scienza, Attilio

    2013-06-01

    A total of 41 accessions of Aglianico belonging to three different biotypes (Taburno, Taurasi, and Vulture) and 9 accessions of Sirica grapes were sampled from diverse areas of Campania (Italy). All accessions were first genotyped using 21 microsatellite markers (SSR) to evaluate possible homonymies, synonymies, and the genetic structure of each group. A larger dataset was then constructed adding Italian and International cultivars. On the basis of results obtained analyzing the first dataset, further investigations were carried out enlarging the number of investigated loci (up to 43). The addition of 22 SSRs was useful in the definition of likely genetic relationships linking Aglianico biotypes, Sirica and Syrah. According to their SSR allelic profiles, the monophyletic origin of the three Aglianico biotypes was confirmed. Among Aglianico Taburno accessions, eight samples (called Aglianico like-to-type) performed a different SSR allelic profile from Aglianico true-to-type. Sirica and Syrah proved to be synonyms. This work allowed to determine the genetic relationship between Aglianico and the cultivars supposed to be related. The parentage analysis was investigated. The most likely pedigree has been reconstructed; revealing a second-degree relationship between the worldwide cultivated Syrah from the Rhone Valley and Aglianico. Aglianico like-to-type appeared related to Aglianico in a parent-offspring fashion. PMID:23054630

  17. High-throughput-sequencing-based identification of a grapevine fanleaf virus satellite RNA in Vitis vinifera.

    Science.gov (United States)

    Chiumenti, Michela; Mohorianu, Irina; Roseti, Vincenzo; Saldarelli, Pasquale; Dalmay, Tamas; Minafra, Angelantonio

    2016-05-01

    A new satellite RNA (satRNA) of grapevine fanleaf virus (GFLV) was identified by high-throughput sequencing of high-definition (HD) adapter libraries from grapevine plants of the cultivar Panse precoce (PPE) affected by enation disease. The complete nucleotide sequence was obtained by automatic sequencing using primers designed based on next-generation sequencing (NGS) data. The full-length sequence, named satGFLV-PPE, consisted of 1119 nucleotides with a single open reading frame from position 15 to 1034. This satRNA showed maximum nucleotide sequence identity of 87 % to satArMV-86 and satGFLV-R6. Symptomatic grapevines were surveyed for the presence of the satRNA, and no correlation was found between detection of the satRNA and enation symptom expression. PMID:26873812

  18. Kinetic Modelling for Flavonoid Recovery from Red Grape (Vitis vinifera Pomace with Aqueous Lactic Acid

    Directory of Open Access Journals (Sweden)

    Katerina Tzima

    2014-12-01

    Full Text Available This study was undertaken with the aim of establishing a correlation between the extraction yield in total flavonoids from red grape pomace and the extraction temperature, using 0.5% (w/v aqueous lactic acid as the solvent system. Extraction of flavonoids was found to obey second-order kinetics, and on such a basis, the yield in total flavonoids at saturation could be very effectively determined and correlated with temperature using non-linear regression. The results indicated that the extraction yield at saturation is highly correlated with temperature, following a quadratic function. The extract obtained at 40 °C had an optimal predicted total flavonoid yield of 13.27 mg rutin equivalents per gram of dry weight, and it was further analyzed by liquid chromatography-mass spectrometry to characterize its major constituents. The polyphenols detected were flavanols, flavonols and an anthocyanin. The outcome of this study outlined that temperatures above 40 °C are rather unfavorable for flavonoid extraction from red grape pomace, as suggested by the model established through kinetics.

  19. Relative quantification of phosphoproteomic changes in grapevine (Vitis vinifera L.) leaves in response to abscisic acid

    Science.gov (United States)

    Rattanakan, Supakan; George, Iniga; Haynes, Paul A; Cramer, Grant R

    2016-01-01

    In a previous transcriptomic analysis, abscisic acid (ABA) was found to affect the abundance of a number of transcripts in leaves of Cabernet Sauvignon grapevines with roots that had been exposed to 10 μm ABA for 2 h. Other work has indicated that ABA affects protein abundance and protein phosphorylation as well. In this study we investigated changes in protein abundance and phosphorylation of Cabernet Sauvignon grapevine leaves. Protein abundance was assessed by both label-free and isobaric-label quantitive proteomic methods. Each identified common proteins, but also additional proteins not found with the other method. Overall, several thousand proteins were identified and several hundred were quantified. In addition, hundreds of phosphoproteins were identified. Tens of proteins were found to be affected in the leaf after the roots had been exposed to ABA for 2 h, more than half of them were phosphorylated proteins. Many phosphosites were confirmed and several new ones were identified. ABA increased the abundance of some proteins, but the majority of the proteins had their protein abundance decreased. Many of these proteins were involved in growth and plant organ development, including proteins involved in protein synthesis, photosynthesis, sugar and amino-acid metabolism. This study provides new insights into how ABA regulates plant responses and acclimation to water deficits. PMID:27366326

  20. Phenolic compounds, antioxidant activity and insulinotropic effect of extracts prepared from grape (Vitis vinifera L) byproducts

    OpenAIRE

    Doshi, Pooja; Adsule, Pandurang; Banerjee, Kaushik; Oulkar, Dasharath

    2013-01-01

    Grape byproducts are a rich source of phenolics having immense medicinal properties, but usually wasted from juice/wine processing industries. The present study investigates the phenolic antioxidants and the insulinotropic effect of extracts prepared from seed, skin and stems of two red wine grape cultivars: Pusa Navarang and Merlot. Pusa Navarang cultivar has shown high amounts of total phenolics (95.8 mg/ml), flavonoids (30.5 mg/ml) and flavan-3-ols (21.8 mg/ml) in seed extract and total an...

  1. Analysis of fertility on the Merlot clones (Vitis vinifera L.), by applying the method of correlation

    OpenAIRE

    Dimovska, Violeta; Ilieva, Fidanka; Gunova, Natasa; Gunova, Vesna

    2015-01-01

    In this research were included seven clones of the variety Merlot (R-12, R-18, R-3, 181, 184, 348, 346). Fertility of each clone is determined by elements: fertility shoots per vine (%),absolute coefficient (number of clusters per fertile shoot), mass of bunch, and the yield expressed of unit area or kg/m2.The obtained results from this work were statistically processed using the SPSS statistical software package 19, from where it can be measure the frequency, the percentage share of data,...

  2. Cultivation of Vitis vinifera L. in the light of former publications and today in Poland

    Directory of Open Access Journals (Sweden)

    Krystyna Pudelska

    2014-09-01

    Full Text Available In the countries of the Mediterranean Basin viticulture has been dealt with for centuries. It was known to the ancient civilizations of the Middle East and grapevines were widely planted in Greece and Rome. The vineyard was part of the utility garden, usually occupying large areas and at the same time being a connection with the landscape. Creeper vine was also used in decorative gardens as an ornamental plant for various types of buildings and garden structures. The Polish tradition of planting vineyards dates back to the Middle Ages and is mainly associated with the activities of monks, although it was not as common as in the countries of southern Europe. However, in Polish gardening literature and in the literature that describes the development of the art of gardening, you can find lots of tips on how to grow grapevines, their varieties and the descriptions of the vineyards.

  3. Antimicrobial activity and composition profile of grape (Vitis vinifera) pomace extracts obtained by supercritical fluids.

    Science.gov (United States)

    Oliveira, Daniela A; Salvador, Ana Augusta; Smânia, Artur; Smânia, Elza F A; Maraschin, Marcelo; Ferreira, Sandra R S

    2013-04-10

    The possibility of increasing the aggregated value of the huge amount of residues generated by wineries around the world foment studies using the grape pomace - the residue from the wine production, composed by seed, skin and stems - to obtain functional ingredients. Nowadays, consumers in general prefer natural and safe products mainly for food and cosmetic fields, where the supercritical fluid extraction is of great importance due to the purity of the extracts provided. Therefore, the objective of this work is to evaluate the global extraction yield, the antimicrobial activity and the composition profile of Merlot and Syrah grape pomace extracts obtained by supercritical CO2 (SC-CO2) and CO2 added with co-solvent at pressures up to 300 bar and temperatures of 50 and 60 °C. The results were compared with the ones obtained by Soxhlet and by ultrasound-assisted leaching extraction methods. The main components from the extracts, identified by HPLC, were gallic acid, p-OH-benzoic acid, vanillic acid and epicatechin. The antibacterial and antifungal activities of the extracts were evaluated using four strains of bacteria (Staphylococcus aureus, Bacillus cereus, Escherichia coli and Pseudomonas aeruginosa) and three fungi strains (Candida albicans, Candida parapsilosis, Candida krusei). Despite lower extraction yield results, the supercritical fluid extracts presented the highest antimicrobial effectiveness compared to the other grape pomace extracts due to the presence of antimicrobial active compounds. Syrah extracts were less efficient against the microorganisms tested and Merlot extracts were more active against Gram-positive bacteria. PMID:23036924

  4. Structure of Haze Forming Proteins in White Wines: Vitis vinifera Thaumatin-Like Proteins

    OpenAIRE

    Marangon, Matteo; Van Sluyter, Steven C.; Waters, Elizabeth J.; Menz, Robert I.

    2014-01-01

    Grape thaumatin-like proteins (TLPs) play roles in plant-pathogen interactions and can cause protein haze in white wine unless removed prior to bottling. Different isoforms of TLPs have different hazing potential and aggregation behavior. Here we present the elucidation of the molecular structures of three grape TLPs that display different hazing potential. The three TLPs have very similar structures despite belonging to two different classes (F2/4JRU is a thaumatin-like protein while I/4L5H ...

  5. Structure of haze forming proteins in white wines: Vitis vinifera thaumatin-like proteins.

    Science.gov (United States)

    Marangon, Matteo; Van Sluyter, Steven C; Waters, Elizabeth J; Menz, Robert I

    2014-01-01

    Grape thaumatin-like proteins (TLPs) play roles in plant-pathogen interactions and can cause protein haze in white wine unless removed prior to bottling. Different isoforms of TLPs have different hazing potential and aggregation behavior. Here we present the elucidation of the molecular structures of three grape TLPs that display different hazing potential. The three TLPs have very similar structures despite belonging to two different classes (F2/4JRU is a thaumatin-like protein while I/4L5H and H2/4MBT are VVTL1), and having different unfolding temperatures (56 vs. 62°C), with protein F2/4JRU being heat unstable and forming haze, while I/4L5H does not. These differences in properties are attributable to the conformation of a single loop and the amino acid composition of its flanking regions. PMID:25463627

  6. Determination of odorants in varietal wines from international grape cultivars (Vitis vinifera) grown in NW Spain

    OpenAIRE

    Vilanova de la Torre, María del Mar; Genisheva, Z.; Graña, M.; Oliveira, J.M.

    2013-01-01

    This work was carried out to investigate the odorants found in ten varietal wines from different international grape cultivars (Merlot, Cabernet Sauvignon, Pinot noir, Tempranillo, Sauvignon blanc, Riesling, Chardonnay, Pinot gris, Pinot blanc and Gewürztraminer) grown in northwest Spain. Monoterpenes, alcohols, fatty acids, ethyl esters, acetates and volatile phenols were determined by gas chromatography-mass spectrometry (GC-MS). The results showed that Gewürztraminer white wines had the hi...

  7. Influence of gamma rays irradiation to chlorphyriphos insecticides residues in grapes (vitis vinifera L.)

    International Nuclear Information System (INIS)

    Simulation methods to determination of chlorphyriphos insecticides residue in grapes cause effect gamma rays, was done. Fruits of grapes soaked with chlorpyriphos insecticide solution high level concentrated (100 ppm; 200 ppm; and 300 ppm) for 3 (three minutes). The treatment of the sample was direct of extraction after soaks; extract after storage for one week after soak, and extract after soak after storage for one week after irradiation at 0.5 kGy; 1.0 kGy; and 1.5 kGy dose. Extraction methods using ethyl acetate solvent, and using sodium sulphate as to dryed water level in grapes, and then extractan was injected to chromatography gas use electron capture detector. The result indicated that occur of descent of chlorpyrifos residues from eachs soaked consequence at storage for one week was amount 7,55; 8,42; and 18,88% respectively, while of consequence irradiation of gamma ray at 0,5 kGy doses, will be descent of chlorpyrifos residues in amount 13,90; 19,16; and 52,79% respectively, and at 1,0 kGy doses irradiation will be descent in amount 34,45; 36,15 and 49,79%, respectively. (author)

  8. Characterization of grapevine (Vitis vinifera L.) cultivars from northern Portugal using RAPD and microsatellite markers

    OpenAIRE

    Pinto-Carnide, Olinda; MARTÍN, JUAN PEDRO; Leal, Fernanda; Castro, Isaura; Guedes-Pinto, Henrique; Oriz, Jesús María

    2003-01-01

    Twelve grapevine cultivars from northern Portugal were characterized with RAPD and microsatellites. Nine primers were used in the RAPD analysis; 8 of the varieties showed monotypic patterns. With the 6 microsatellite loci a total of 38 alleles was obtained. Relationships among the studied varieties were observed. Both types of molecular markers have proved useful for identification. Existence of synonymies is discussed.

  9. Various Extraction Methods for Obtaining Stilbenes from Grape Cane of Vitis vinifera L.

    OpenAIRE

    Ivo Soural; Naděžda Vrchotová; Jan Tříska; Josef Balík; Štěpán Horník; Petra Cuřínová; Jan Sýkora

    2015-01-01

    Grape cane, leaves and grape marc are waste products from viticulture, which can be used to obtain secondary stilbene derivatives with high antioxidant value. The presented work compares several extraction methods: maceration at laboratory temperature, extraction at elevated temperature, fluidized-bed extraction, Soxhlet extraction, microwave-assisted extraction, and accelerated solvent extraction. To obtain trans-resveratrol, trans-ε-viniferin and r2-viniferin from grape cane of the V. ...

  10. The cluster analysis of clones obtained from authochthonous cultivar Kreaca (Vitis vinifera L.

    Directory of Open Access Journals (Sweden)

    Rakonjac Vera

    2010-01-01

    Full Text Available The purpose of this paper was to characterize the clones obtained from Kreaca, autochthonous grapevine cultivar of Banat. Based on examination of 6 important biological and technological properties, phenotypic and genetic divergence of 28 selected clones was established. The divergence was determined using ANOVA and hierarchical cluster analysis. Using variance analysis, for grape weight, yield, total acid content, sugar content and sugar/acid ratio very significant or significant differences were obtained between clones. The UPGA method was used and the Euclidean distance in order to determine the difference between the groups. Two clone groups were obtained on the dendrogram. The objective of clone differentiation was primarily cluster weight, although other properties were taken into account as well. As the most perspective clones for further investigation and production, that can be recommended, were clones 12/5/5, 56/11/7 and 69/11/7.

  11. Characteristics of Sangiovese grape variety (Vitis vinifera L.) grown in Tikveš vineyards

    OpenAIRE

    Dimovska, Violeta; Ivanova, Violeta; Durakova, S; Neceva, Z; Ilieva, Fidanka; Delic, M

    2014-01-01

    Studies were carried out to the variety Sangiovese of manufacturing plants located in the site Lepovo-Tikveš vineyards and all of this in property of the Bovin Winery. During the period of study (2011-2012 year) the following items were included: realized yields (kg/vine), chemical composition of grape must (sugar content, total acids, pH) and chemical analysis of wine. The results show considerable variation in yield (coefficient of variation was 18.45) which is due to the age of the crop ...

  12. Characteristics of tempranillo grape variety (Vitis vinifera L.), grown in Tikveš's vineyard

    OpenAIRE

    Dimovska, Violeta; Ilieva, Fidanka; Ivanova, Violeta; Sofijanova, Elenica; Naceva, Zaneta

    2015-01-01

    The studies were conducted on the grape variety of Tempranillo on the production plantations located on the site of Lepovo in the Tikveš vineyards, owned by "Bovin" winery. The plantations were planted in 2006 with certified planting material at the distance of 2.4 m between the rows and 1 m between the vines in a row. The applied farming system is the two legged Guyot system by leaving 7 buds per vine. Optimal agro-technical and ampelo-technical measures were applied. The plantations are und...

  13. Characteristics of Petit verdot grape variety (Vitis vinifera L.) grown in Tikveš vineyards

    OpenAIRE

    Dimovska, Violeta; Ilieva, Fidanka; Neceva, Z; Durakova, S; Bogeva, Elena

    2014-01-01

    Research is being performed to the variety of Petit verdot. The vineyards are sited on the Lepovo-Tikveš vineyards, in the property of Bovin winery. Plantation is started in 2008 with certified plantation material, 2.4 m planting distance between rows, and 1.0 m distance between vines in a row. The training system is Guyot two arms, with 20 eyelets leaving the vine. Some optimal agro-technical and ampelo-technical measures are applied. The plantation is under drip irrigation system. During th...

  14. Ampelograpic and agronomic characteristics in different clones of cultivar Albariño (Vitis vinifera L.)

    OpenAIRE

    Boso Alonso, Susana; Santiago Blanco, José Luis; Vilanova de la Torre, María del Mar; Martínez Rodríguez, María del Carmen

    2005-01-01

    [EN] The “Albariño” is one of the most important and interesting cultivars in Galicia (northwest of Spain), however, until the present there were not selected clones of this cultivar. In 1987, in “Consejo Superior de Investigaciones Científicas” prospection of centenary “Albariño” specimens was initiated, in different geographic points in Galicia. Forty centenary “Albariño” specimens were located (source plants) and 11 of them were selected. In 1993, 10 repetitions of each one of the 11 selec...

  15. In vitro extraction and fermentation of polyphenols from grape seeds (Vitis vinifera) by human intestinal microbiota.

    Science.gov (United States)

    Zhou, Li; Wang, Wei; Huang, Jun; Ding, Yu; Pan, Zhouqiang; Zhao, Ya; Zhang, Renkang; Hu, Bing; Zeng, Xiaoxiong

    2016-04-20

    The effects of several parameters on the extraction yield of total polyphenols from grape seeds by pressurized liquid extraction were investigated. The highest recovery of total polyphenols occurred at 80 °C within 5 min, and a single extraction allowed a recovery of more than 97% of total polyphenols. Following the purification with macroporous resin, the effects of grape polyphenols (>94.8%) on human intestinal microbiota were monitored over 36 h incubation by fluorescence in situ hybridization, and short-chain fatty acids (SCFAs) were measured by HPLC. The result showed that the grape polyphenols promoted the changes in the relevant microbial populations and shifted the profiles of SCFAs. Fermentation of grape polyphenols resulted in a significant increase in the numbers of Bifidobacterium spp. and Lactobacillus-Enterococcus group and inhibition in the growth of the Clostridium histolyticum group and the Bacteroides-Prevotella group, with no significant effect on the population of total bacteria. The findings suggest that grape polyphenols have potential prebiotic effects on modulating the gut microbiota composition and generating SCFAs that contribute to the improvements of host health. PMID:26980065

  16. Pruning affects the vegetative balance of the wine grape (vitis vinifera l.)

    OpenAIRE

    Almanza-Merchán, Pedro José; Serrano-Cely, Pablo Antonio; Forero-Ulloa, Fabio Emilio; Arango, Johana; Puerto, Ángela Milena

    2014-01-01

    The cultivation of grapes for the production of wine at altitudes between 2,200 and 2,600 masl started in the department of Boyacá in 1982. Quality wines are produced by the Ain Karim Vineyard in Ricaurte High. It is necessary to have wine grapes that possess suitable organoleptic compounds at harvest in order to guarantee quality grape must that can be converted into wine. For this, it is necessary to have a suitable ratio between the inflows and the outflows and to guarantee production, qua...

  17. Kinetic Modelling for Flavonoid Recovery from Red Grape (Vitis vinifera) Pomace with Aqueous Lactic Acid

    OpenAIRE

    Katerina Tzima; Stamatina Kallithraka; Yorgos Kotseridis; Dimitris P. Makris

    2014-01-01

    This study was undertaken with the aim of establishing a correlation between the extraction yield in total flavonoids from red grape pomace and the extraction temperature, using 0.5% (w/v) aqueous lactic acid as the solvent system. Extraction of flavonoids was found to obey second-order kinetics, and on such a basis, the yield in total flavonoids at saturation could be very effectively determined and correlated with temperature using non-linear regression. The results indicated that the extr...

  18. Roy Fuentes: Fuentes Berry Farms

    OpenAIRE

    Rabkin, Sarah

    2010-01-01

    As president of Fuentes Berry Farms, Rogelio (Roy) Fuentes is one of many independent growers producing organic berries for Driscoll’s—a company that was initiated more than a century ago by two strawberry farmers on California’s Central Coast, and has since evolved into an international concern devoted to research, breeding, production, sales and distribution of conventionally and organically farmed strawberries, raspberries, blackberries and blueberries. Driscoll’s CEO Miles Reiter and his ...

  19. Dicty_cDB: VFG846 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Q798071 |BQ798071.1 EST 7009 Ripening Grape berries Lambda Zap II Library Vitis v...inifera cDNA clone RT094C10 3', mRNA sequence. 50 0.015 1 BQ796440 |BQ796440.1 EST 5378 Ripening Grape berri...es Lambda Zap II Library Vitis vinifera cDNA clone RT041C07 3', mRNA sequence. 50 0.015 1 BQ794649 |BQ794649.1 EST 3587 Veraison Grap...e. 50 0.015 1 CF608073 |CF608073.1 GEMMA01_001608 Grape Bud pSPORT1 Library Vitis... vinifera cDNA 5', mRNA sequence. 50 0.015 1 CD802153 |CD802153.1 EST 10028 Ripe Grape Berry Skins Lambda Tr

  20. Subcellular localization and functional analyses of a PR10 protein gene from Vitis pseudoreticulata in response to Plasmopara viticola infection.

    Science.gov (United States)

    He, Mingyang; Xu, Yan; Cao, Jiangling; Zhu, Ziguo; Jiao, Yuntong; Wang, Yuejin; Guan, Xin; Yang, Yazhou; Xu, Weirong; Fu, Zhenfang

    2013-02-01

    Downy mildew, caused by the oomycete Plasmopara viticola, is a serious fungal disease in the cultivated European grapevines (Vitis vinifera L.). The class 10 of pathogenesis-related (PR) genes in grapevine leaves was reported to be accumulated at mRNA level in response to P. viticola infection. To elucidate the functional roles of PR10 genes during plant-pathogen interactions, a PR10 gene from a fungal-resistant accession of Chinese wild Vitis pseudoreticulata (designated VpPR10.2) was isolated and showed high homology to PR10.2 from susceptible V. vinifera (designated VvPR10.2). Comparative analysis displayed that there were significant differences in the patterns of gene expression between the PR10 genes from the two host species. VpPR10.2 was induced with high level in leaves infected by P. viticola, while VvPR10.2 showed a low response to this inoculation. Recombinant VpPR10.2 protein showed DNase activity against host genomic DNA and RNase activity against yeast total RNA in vitro. Meanwhile, recombinant VpPR10.2 protein inhibited the growth of tobacco fungus Alternaria alternata and over-expression of VpPR10.2 in susceptible V. vinifera enhanced the host resistance to P. viticola. The results from subcellular localization analysis showed that VpPR10.2 proteins were distributed dynamically inside or outside of host cell. Moreover, they were found in haustorium of P. viticola and nucleus of host cell which was associated with a nucleus collapse at 10 days post-inoculation. Taken together, these results suggested that VpPR10.2 might play an important role in host plant defense against P. viticola infection. PMID:22327469

  1. Water dynamics for North Carolina v. Vinifera

    Science.gov (United States)

    As North Carolina wine grape (V. vinifera) production intensifies, the importance of water management must be addressed. Grape yield and composition, and consequently wine quality, are profoundly influenced by the water regime under which the grapes were produced. Despite the importance of water man...

  2. Dicty_cDB: VHD256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QGG23F15, mRNA sequence. 44 2e-04 2 BQ793980 |BQ793980.1 EST 2918 Veraison Grape berries Lambda Zap II Libra...e. 44 0.035 2 BQ793878 |BQ793878.1 EST 2816 Veraison Grape berries Lambda Zap II Library Vitis vinifera cDNA

  3. ENDOGENAL COLONIZATION OF GRAPES BERRIES

    OpenAIRE

    Dana Tančinová; Ľubomír Rybárik; Zuzana Mašková; Soňa Felšöciová; Miroslava Císarová

    2015-01-01

    The aim of study was to detect the microscopic filamentous fungi from wine surface of sterilized grapes berries of Slovak origin. We analyzed 21 samples of grapes, harvested in the year 2012 of various wine-growing regions. For the isolation of species we used the method of direct plating surface-sterilized berries (using 0.4% freshly pre-pared chlorine) on DRBC (Dichloran Rose Bengal Chloramphenicol agar). The cultivation was carried at 25±1°C, for 5 to 7 days. A total number of 2541 fungal ...

  4. Expressão transiente do gene gus, sob regulação de quatro promotores, em diferentes tecidos de mamoeiro (Carica papaya L.) e videira (Vitis sp.) Transient expression of the gus gene, under the regulation of four promoters, on different tissues of papaya (Carica papaya l.) and grape (Vitis sp.)

    OpenAIRE

    Adelar Almeida Pinto; Marly Catarina Felipe Coelho; Manoel Teixeira Souza Jr; Miguel Pedro Guerra

    2002-01-01

    O mamoeiro (Carica papaya L.) e a videira (Vitis vinifera L.) destacam-se entre as fruteiras produzidas no Brasil por serem plantadas em quase todo o território nacional e apresentarem importância econômica e social. A tecnologia de produção de organismos geneticamente modificados, também conhecidos como "transgênicos", tem grande potencial de uso no desenvolvimento de fruteiras melhoradas. Porém, questões de propriedade intelectual limitam o uso da engenharia genética por países em desenvolv...

  5. Berry's phase in noncommutative spaces

    CERN Document Server

    Alavi, S A

    2003-01-01

    We introduce the perturbative aspects of noncommutative quantum mechanics. Then we study the Berry's phase in the framework of noncommutative quantum mechanics. The results show deviations from the usual quantum mechanics which depend on the parameter of space/space noncommtativity.

  6. Study of leaf metabolome modifications induced by UV-C radiations in representative Vitis, Cissus and Cannabis species by LC-MS based metabolomics and antioxidant assays.

    Science.gov (United States)

    Marti, Guillaume; Schnee, Sylvain; Andrey, Yannis; Simoes-Pires, Claudia; Carrupt, Pierre-Alain; Wolfender, Jean-Luc; Gindro, Katia

    2014-01-01

    UV-C radiation is known to induce metabolic modifications in plants, particularly to secondary metabolite biosynthesis. To assess these modifications from a global and untargeted perspective, the effects of the UV-C radiation of the leaves of three different model plant species, Cissus antarctica Vent. (Vitaceae), Vitis vinifera L. (Vitaceae) and Cannabis sativa L. (Cannabaceae), were evaluated by an LC-HRMS-based metabolomic approach. The approach enabled the detection of significant metabolite modifications in the three species studied. For all species, clear modifications of phenylpropanoid metabolism were detected that led to an increased level of stilbene derivatives. Interestingly, resveratrol and piceid levels were strongly induced by the UV-C treatment of C. antarctica leaves. In contrast, both flavonoids and stilbene polymers were upregulated in UV-C-treated Vitis leaves. In Cannabis, important changes in cinnamic acid amides and stilbene-related compounds were also detected. Overall, our results highlighted phytoalexin induction upon UV-C radiation. To evaluate whether UV-C stress radiation could enhance the biosynthesis of bioactive compounds, the antioxidant activity of extracts from control and UV-C-treated leaves was measured. The results showed increased antioxidant activity in UV-C-treated V. vinifera extracts. PMID:25197936

  7. Study of Leaf Metabolome Modifications Induced by UV-C Radiations in Representative Vitis, Cissus and Cannabis Species by LC-MS Based Metabolomics and Antioxidant Assays

    Directory of Open Access Journals (Sweden)

    Guillaume Marti

    2014-09-01

    Full Text Available UV-C radiation is known to induce metabolic modifications in plants, particularly to secondary metabolite biosynthesis. To assess these modifications from a global and untargeted perspective, the effects of the UV-C radiation of the leaves of three different model plant species, Cissus antarctica Vent. (Vitaceae, Vitis vinifera L. (Vitaceae and Cannabis sativa L. (Cannabaceae, were evaluated by an LC-HRMS-based metabolomic approach. The approach enabled the detection of significant metabolite modifications in the three species studied. For all species, clear modifications of phenylpropanoid metabolism were detected that led to an increased level of stilbene derivatives. Interestingly, resveratrol and piceid levels were strongly induced by the UV-C treatment of C. antarctica leaves. In contrast, both flavonoids and stilbene polymers were upregulated in UV-C-treated Vitis leaves. In Cannabis, important changes in cinnamic acid amides and stilbene-related compounds were also detected. Overall, our results highlighted phytoalexin induction upon UV-C radiation. To evaluate whether UV-C stress radiation could enhance the biosynthesis of bioactive compounds, the antioxidant activity of extracts from control and UV-C-treated leaves was measured. The results showed increased antioxidant activity in UV-C-treated V. vinifera extracts.

  8. Construction of a reference linkage map of Vitis amurensis and genetic mapping of Rpv8, a locus conferring resistance to grapevine downy mildew.

    Science.gov (United States)

    Blasi, Paule; Blanc, Sophie; Wiedemann-Merdinoglu, Sabine; Prado, Emilce; Rühl, Ernst H; Mestre, Pere; Merdinoglu, Didier

    2011-06-01

    Downy mildew, caused by the oomycete Plasmopara viticola, is one of the major threats to grapevine. All traditional cultivars of grapevine (Vitis vinifera) are susceptible to downy mildew, the control of which requires regular application of fungicides. In contrast, many sources of resistance to P. viticola have been described in the Vitis wild species, among which is V. amurensis Rupr. (Vitaceae), a species originating from East Asia. A genetic linkage map of V. amurensis, based on 122 simple sequence repeat and 6 resistance gene analogue markers, was established using S1 progeny. This map covers 975 cM on 19 linkage groups, which represent 82% of the physical coverage of the V. vinifera reference genetic map. To measure the general level of resistance, the sporulation of P. viticola and the necrosis produced in response to infection, five quantitative and semi-quantitative parameters were scored 6 days post-inoculation on the S1 progeny. A quantitative trait locus (QTL) analysis allowed us to identify on linkage group 14 a major QTL controlling the resistance to downy mildew found in V. amurensis, which explained up to 86.3% of the total phenotypic variance. This QTL was named 'Resistance to Plasmopara viticola 8' (Rpv8). PMID:21404060

  9. Anatomy of pneumatophore of Mauritia vinifera mart

    Directory of Open Access Journals (Sweden)

    Luiz Alfredo Rodrigues Pereira

    2000-01-01

    Full Text Available Pneumatophores of Mauritia vinifera Mart. were collected from six month-old plants maintained submerged in fresh water to induce pneumatophore formation. Twenty day-old pneumatophores had a quite prominent root cap. The epidermis was composed of hexagonal cells, tangentially distributed along the cylindric surface of the organ. In transverse section these pneumatophores had a simple epidermis over several layers of sclerified parenchyma, which covered an aerenchyma with large intercellular spaces. The endodermal cells had Casparian strips. The vascular cylinder was polyarch, with a pith and surrounded by a unisseriate pericycle. Anatomically the 4 month-old pneumatophores were similar to the younger ones, except for the absence of the epidermis. The epidermis is replaced by a protective tissue, whose lignified and suberized cells projected themselves outwards, giving it a filamentous aspect. There was no accumulation of starch or tannins in the pneumatophores, except for the presence of statoliths in the root cap. No lenticels were observed in pneumatophores of M. vinifera. The main function of the pneumatophores of M. vinifera is to allow gas exchange, facilitating the supply of oxygen to the submerged root portions.Pneumatóforos de Mauritia vinifera Mart. foram coletados de plantas com seis meses de idade mantidas submersas em água com o objetivo de induzir a formação de pneumatóforos. Peumatóforos com 20 dias de idade possuem uma coifa bastante proeminente na raiz. A epiderme é composta de células hexagonais, tangencialmente distribuídas ao longo da superfície cilíndrica do orgão. Em seção transversal os pneumatóforos possuem epiderme simples. O córtex é formado por um parênquima esclerificado, um aerênquima com espaços grandes intercelulares e uma endoderme cujas células possuem estrias de Caspary. O cilindro vascular é poliarco, com medula e cercado por um periciclo unisseriado. Anatomicamente os pneumatóforos com 4

  10. In vitro antiviral activity of a series of wild berry fruit extracts against representatives of Picorna-, Orthomyxo- and Paramyxoviridae.

    Science.gov (United States)

    Nikolaeva-Glomb, Lubomira; Mukova, Luchia; Nikolova, Nadya; Badjakov, Ilian; Dincheva, Ivayla; Kondakova, Violeta; Doumanova, Lyuba; Galabov, Angel S

    2014-01-01

    Wild berry species are known to exhibit a wide range of pharmacological activities. They have long been traditionally applied for their antiseptic, antimicrobial, cardioprotective and antioxidant properties. The aim of the present study is to reveal the potential for selective antiviral activity of total methanol extracts, as well as that of the anthocyanins and the non-anthocyanins from the following wild berries picked in Bulgaria: strawberry (Fragaria vesca L.) and raspberry (Rubus idaeus L.) of the Rosaceae plant family, and bilberry (Vaccinium myrtillis L.) and lingonberry (Vaccinium vitis-idaea L) of the Ericaceae. The antiviral effect has been tested against viruses that are important human pathogens and for which chemotherapy and/or chemoprophylaxis is indicated, namely poliovirus type 1 (PV-1) and coxsackievirus B1 (CV-B1) from the Picornaviridae virus family, human respiratory syncytial virus A2 (HRSV-A2) from the Paramyxoviridae and influenza virus A/H3N2 of Orthomyxoviridae. Wild berry fruits are freeze-dried and ground, then total methanol extracts are prepared. Further the extracts are fractioned by solid phase extraction and the non-anthocyanin and anthocyanin fractions are eluted. The in vitro antiviral effect is examined by the virus cytopathic effect (CPE) inhibition test. The results reveal that the total extracts of all tested berry fruits inhibit the replication of CV-B1 and influenza A virus. CV-B1 is inhibited to the highest degree by both bilberry and strawberry, as well as by lingonberry total extracts, and influenza A by bilberry and strawberry extracts. Anthocyanin fractions of all wild berries strongly inhibit the replication of influenza virus A/H3N2. Given the obtained results it is concluded that wild berry species are a valuable resource of antiviral substances and the present study should serve as a basis for further detailed research on the matter. PMID:24660461

  11. Loss of rachis cell viability is associated with ripening disorders in grapes

    OpenAIRE

    Hall, Geoffrey E.; Bondada, Bhaskar R.; Keller, Markus

    2010-01-01

    Rachises of grape (Vitis vinifera L.) clusters that appeared healthy or displayed symptoms of the ripening disorders berry shrivel (BS) or bunch-stem necrosis (BSN) were treated with the cellular viability stain fluorescein diacetate and examined by confocal microscopy. Clusters with BS and BSN symptoms experienced a decrease of cell viability throughout the rachis, and their berries contained 70–80% less sugar than healthy berries. The xylem-mobile dye basic fuchsin, infiltrated via the cut ...

  12. Accumulation Characteristics of Volatile Compounds in Wine Grape Berries Grown in High Altitude Regions of Yunnan%云南高原区酿酒葡萄果实香气物质的积累规律

    Institute of Scientific and Technical Information of China (English)

    杨晓帆; 高媛; 韩梅梅; 彭振雪; 潘秋红

    2014-01-01

    herbaceous character of these grapes.%【目的】香气是衡量酿酒葡萄及葡萄酒品质的重要因子,地域条件显著地影响果实香气物质的种类和含量,开展云南高原区酿酒葡萄果实香气物质积累规律研究,有助于揭示高原气候区酿酒葡萄香气品质的形成机理,为云南高原区优质酿酒葡萄生产提供指导。【方法】以2010和2011年采自云南省德钦县梅里石(海拔约为2300 m)和说日(海拔约为2900 m)葡萄园的赤霞珠(Vitis vinifera L. cv. Cabernet Sauvignon)果实为试材,采用顶空固相微萃取直接提取葡萄汁中游离态香气物质,依次采用Cleanert PEP-SPE柱分离、糖苷酶AR2000水解和顶空固相微萃取方法提取糖苷结合态香气物质,运用气相色谱与质谱联用技术,分析游离态和糖苷结合态香气物质的种类和含量,根据合成途径,将其分为脂肪酸来源、氨基酸来源和异戊二烯来源的香气物质,探究果实成熟过程中这3种来源的香气物质在年份及产地之间积累规律的异同。【结果】无论是梅里石还是说日,来自同一产地的果实 pH 值变化和可溶性固形物积累受年份影响较小,但香气物质受年份的影响较大。2011年的果实中,脂肪酸来源的游离态直链脂肪醇、酸和酯类,以及异戊二烯代谢产生的游离态、结合态降异戊二烯类和游离态萜烯类物质含量均显著高于2010年;对于氨基酸来源的香气物质,2010年果实中结合态芳香族类香气物质含量显著高于2011年,而游离态芳香族类香气物质则明显低于2011年。年份也影响果实中直链脂肪醛、直链脂肪醇、芳香族类和支链脂肪族类以及萜烯类物质的种类,结合2个年份气象参数的分析,认为较少的降雨量和较长的日照时数有利于降低直链脂肪醛含量、增加萜烯类物质水平。就产地而言,海拔较高的说日葡萄园的果实在

  13. Ants defend coffee from berry borer colonization

    OpenAIRE

    Gonthier, DJ; Ennis, KK; Philpott, SM; Vandermeer, J; Perfecto, I.

    2013-01-01

    Ants frequently prevent herbivores from damaging plants. In agroecosystems they may provide pest control services, although their contributions are not always appreciated. Here we compared the ability of eight ant species to prevent the coffee berry borer from colonizing coffee berries with a field exclusion experiment. We removed ants from one branch (exclusion) and left ants to forage on a second branch (control) before releasing 20 berry borers on each branch. After 24 h, six of eight spec...

  14. Content of trans-Resveratrol in Leaves and Berries of Interspecific Grapevine (Vitis sp.) Varieties

    Czech Academy of Sciences Publication Activity Database

    Bábíková, P.; Vrchotová, Naděžda; Tříska, Jan; Kyseláková, M.

    26 2008, special (2008), s. 13-17. ISSN 1212-1800. [Quality of Moravian and Czech Wine s and their Future. Lednice, 11.09.2008-12.09.2008] R&D Projects: GA ČR GA525/06/1757 Institutional research plan: CEZ:AV0Z60870520 Keywords : trans-resveratrol * HPLC * wine Subject RIV: GM - Food Processing Impact factor: 0.472, year: 2008

  15. Expressão transiente do gene gus, sob regulação de quatro promotores, em diferentes tecidos de mamoeiro (Carica papaya L.) e videira (Vitis sp.)

    OpenAIRE

    Pinto Adelar Almeida; Coelho Marly Catarina Felipe; Souza Jr Manoel Teixeira; Guerra Miguel Pedro

    2002-01-01

    O mamoeiro (Carica papaya L.) e a videira (Vitis vinifera L.) destacam-se entre as fruteiras produzidas no Brasil por serem plantadas em quase todo o território nacional e apresentarem importância econômica e social. A tecnologia de produção de organismos geneticamente modificados, também conhecidos como "transgênicos", tem grande potencial de uso no desenvolvimento de fruteiras melhoradas. Porém, questões de propriedade intelectual limitam o uso da engenharia genética por países em desenvolv...

  16. The Berry phase in frustrated spin glass

    International Nuclear Information System (INIS)

    In this letter we have pointed out that frustration in spin glass is realized through the Berry phase due to the conflict between the spin ordering in the course of parallel transport. We came to the point that the Berry phase depicting the chiral change of helicity of a quantized spinor is prominent only in the presence of frustration. (author)

  17. 21 CFR 145.120 - Canned berries.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Canned berries. 145.120 Section 145.120 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... percent, calculated as calcium, of the weight of the finished canned berries. (iii) Organic acids....

  18. Decision making by Berry's flux

    OpenAIRE

    Sung, Benjamin O.; Lawler, Michael J

    2015-01-01

    Order by disorder is a decision making process for frustrated systems but often leads to simple answers. We study order by disorder in the kagome Kondo model known for its complexity seeking rich decision making capabilities. At half filling and large Kondo coupling to hopping ratio $J_K/t$, the full manifold of 120$^o$ kagome ground states are degenerate at second order in $t/J_K$. We show this degeneracy lifts at sixth order when a fermion can hop around a hexagon and feel the Berry flux in...

  19. Densitometric thin-layer chromatographic determination of aescin in a herbal medicinal product containing Aesculus and Vitis dry extracts.

    Science.gov (United States)

    Apers, Sandra; Naessens, Tania; Pieters, Luc; Vlietinck, Arnold

    2006-04-21

    A thin-layer chromatographic (TLC) method is developed to analyze the total saponin content, also referred to as the aescin content, in a herbal medicinal product (HMP) containing two dry extracts in capsules. The capsules contain 250 mg of Aesculus hippocastanum dry extract, 120 mg of Vitis vinifera dry extract and 50mg of excipients. After a purification step using C(18) solid phase extraction (SPE) cartridges, the samples are analyzed on a silica-gel HPTLC plate with the upper layer of a mixture of acetic acid/water/butanol (10/40/50 v/v/v) as the mobile phase. Spots are visualized by spraying with anisaldehyde reagent and heating the plate for 5-10 min (100-105 degrees C) and measured at a wavelength of 535 nm. This method, applicable for the quality control and stability investigation of both the Aesculus dry extract and HMP capsules thereof containing Vitis dry extract in combination with the Aesculus dry extract, is validated according to the International Conference on Harmonization (ICH) guidelines. The proposed assay method is specific for aescin in the presence of Vitis dry extract and formulation excipients. Analysis of stressed samples in forced degradation tests proves the method to be applicable for stability evaluation. The standard aescin curve is linear (r > 0.99) over a concentration range of 0.16-0.80 microg/spot. Recovery from the HMP capsules is statistically equal to 100%. The precision of the method with respect to time and concentration is acceptable, with relative standard deviation (RSD) values of 1.28 and 1.49%, respectively. PMID:16364347

  20. Distribution of 210Pb and 210Po concentrations in wild berries and mushrooms in boreal forest ecosystems

    International Nuclear Information System (INIS)

    The activity concentrations and distribution of 210Pb and 210Po in wild berries and edible mushrooms were investigated in Finnish forests. The main study areas were located in Scots pine (Pinus sylvestris L.) forests in southern and northern Finland. The activity concentrations of 210Pb and 210Po in blueberry (Vaccinium myrtillus L.) and lingonberry (Vaccinium vitis-idaea L.) samples decreased in the order: stems > leaves > berries (i.e. fruits). The activity ratios of 210Po/210Pb in the wild berry samples were mainly higher than one, indicating elevated activity concentrations of polonium in the samples. In mushrooms the activity concentrations of 210Pb and especially 210Po were higher than in fruits of the wild berries. The highest activity concentration of 210Pb was detected in Cortinarius armillatus L. (16.2 Bq kg-1 d.w.) and the lowest in Leccinum vulpinum L. (1.38 Bq kg-1 d.w.). The 210Po activity concentrations of the whole fruiting bodies ranged from 7.14 Bq kg-1 d.w. (Russula paludosa L.) to 1174 Bq kg-1 d.w. (L. vulpinum L.). In general, the highest activity concentrations of 210Po were recorded in boletes. The caps of mushrooms of the Boletaceae family showed higher activity concentrations of 210Po compared to the stipes. In most of the mushrooms analyzed, the activity concentrations of 210Po were higher than those of 210Pb. 210Po and 210Pb dominate the radiation doses received via ingestion of wild berries and mushrooms in northern Finland, while in southern Finland the ingested dose is dominated by 137Cs from the Chernobyl fallout.

  1. ENDOGENAL COLONIZATION OF GRAPES BERRIES

    Directory of Open Access Journals (Sweden)

    Dana Tančinová

    2015-02-01

    Full Text Available The aim of study was to detect the microscopic filamentous fungi from wine surface of sterilized grapes berries of Slovak origin. We analyzed 21 samples of grapes, harvested in the year 2012 of various wine-growing regions. For the isolation of species we used the method of direct plating surface-sterilized berries (using 0.4% freshly pre-pared chlorine on DRBC (Dichloran Rose Bengal Chloramphenicol agar. The cultivation was carried at 25±1°C, for 5 to 7 days. A total number of 2541 fungal isolates pertaining to 18 genera including Mycelia sterilia were recovered. Isolates of genus Alternaria were found in all of tested samples with the highest relative density 56.4%. The second highest isolation frequency we detected for genus Fusarium (90.48% positive samples, but with low relative density (31 isolates and 2.99% RD. Another genera with higher isolation frequency were Cladosporium (Fr 85.71%, RD 14.6%, Mycelia sterilia (Fr 85.71%, RD 4.25%, Penicillium (Fr 80.95%, RD 13.42%, Botrytis (Fr 71.43%, RD 2.95% Rhizopus (Fr 66.66%, RD 1.34%, Aspergillus (Fr 57.14%, RD 0.87%, Epicoccum (Fr 47.62%, RD 1.22%, Trichoderma (Fr 42.86%, RD 1.26%. Isolation frequency of another eight genera (Arthrinium, Dichotomophtora, Geotrichum, Harzia, Chaetomium, Mucor, Nigrospora and Phoma was less than 10% and relative density less than 0.5%. Chosen isolates of potential producers of mycotoxin (species of Alternaria, Aspergillus, Fusarium and Penicillium were tested for the ability to produce relevant mycotoxins in in vitro conditions using TLC method. None isolate of Aspergillus niger aggregate (13 tested did not produce ochratoxin A – mycotoxin monitored in wine and another products from grapes berries. Isolates of potentially toxigenic species recovered from the samples were found to produce another mycotoxins: aflatoxin B1, altenuene, alternariol, alternariol monomethylether, citrinin, diacetoxyscirpenol, deoxynivalenol, HT-2 patulin, penitrem A and T-2 toxin

  2. Berry Phases and Quantum Phase Transitions

    CERN Document Server

    Hamma, A

    2006-01-01

    We study the connection between Berry phases and quantum phase transitions of generic quantum many-body systems. Consider sequences of Berry phases associated to sequences of loops in the parameter space whose limit is a point. If the sequence of Berry phases does not converge to zero, then the limit point is a quantum critical point. Quantum critical points are associated to failures of adiabaticity. We discuss the remarkable example of the anisotropic XY spin chain in a transverse magnetic field and detect the XX region of criticality.

  3. Expression of structural genes related to anthocyanin biosynthesis of Vitis amurensis

    Institute of Scientific and Technical Information of China (English)

    Quan Zhao; Fei He; Malcolm J Reeves; Qiu-Hong Pan; Chang-Qing Duan; Jun Wang

    2016-01-01

    This research was designed to assess the changes in anthocyanin content in grape skins of Vitis amurensis and to explore mRNA transcriptions of 11 structural genes (PAL, CHS3, CHI1, F3H2, F30H, F3050H, DFR, LDOX, UFGT, OMT and GST) related to anthocyanin biosynthesis during grape berry development, by the use of HPLC-MS/MS and real-time Q-PCR analysis. Accumulation of anthocyanins began at veraison, continued throughout the later berry development and reached a peak at maturity. Veraison is the time when the berries turn from green to purple. Expression of PAL, CHI1, and LDOX were up-regulated from 2 to 4 weeks after flowering (WAF), down-regulated from 6 WAF to veraison, whereas DFR was up-regulated at 8 WAF, and then up-regulated from veraison to maturity. CHS3, F3050H, UFGT, GST, and OMT were down-regulated from 2 WAF to veraison, and then up-regulated from veraison to maturity. The transcriptional expressions of the 11 structural genes also showed positive correlations with the anthocyanin content from veraison to maturity. Positive correlations were also observed between OMT transcrip-tional level and the content of methoxyl-anthocyanins, and between F3050H transcriptional level and the content of delphinidin anthocyanins. F3H2 and F30H expression was up-regulated at 2 WAF. F3H2 expression was down-regu-lated from 4 WAF to veraison and then up-regulated again from veraison to maturity. F30H expression was down-reg-ulated at 4 WAF and then up-regulated again from 6 WAF to maturity. F30H transcriptional level was correlated posi-tively with the cyanidin anthocyanin concentration from veraison to maturity. These results indicate that the onset of anthocyanin synthesis during berry development coincides with a coordinated increase in the expression of a number of genes in the anthocyanin biosynthetic pathway.

  4. Interview with Jo Berry, 6 May 2014

    Directory of Open Access Journals (Sweden)

    2014-09-01

    Full Text Available In the following interview, Jo Berry remembers and reflects on the Brighton bombing which killed her father, Sir Anthony Berry thirty years ago in 1984. She describes her first meeting with one of the bombers, Pat Magee, her growing and unexpected friendship with him and her journey into healing and forgiveness. She elaborates how her understanding of forgiveness has changed and become more nuanced over the years. She also offers reflections on what justice means for her.

  5. Measuring Berry curvature with quantum Monte Carlo

    CERN Document Server

    Kolodrubetz, Michael

    2014-01-01

    The Berry curvature and its descendant, the Berry phase, play an important role in quantum mechanics. They can be used to understand the Aharonov-Bohm effect, define topological Chern numbers, and generally to investigate the geometric properties of a quantum ground state manifold. While Berry curvature has been well-studied in the regimes of few-body physics and non-interacting particles, its use in the regime of strong interactions is hindered by the lack of numerical methods to solve it. In this paper we fill this gap by implementing a quantum Monte Carlo method to solve for the Berry curvature, based on interpreting Berry curvature as a leading correction to imaginary time ramps. We demonstrate our algorithm using the transverse-field Ising model in one and two dimensions, the latter of which is non-integrable. Despite the fact that the Berry curvature gives information about the phase of the wave function, we show that our algorithm has no sign or phase problem for standard sign-problem-free Hamiltonians...

  6. Efeitos do cycocel na fertilidade de gemas e no crescimento dos ramos de videiras cv Itália (Vitis vinifera L. Effects of cycocel on bud fertility and shoot growth of Italia grapevines (Vitis vinifera L.

    Directory of Open Access Journals (Sweden)

    Renato Vasconcelos Botelho

    2004-04-01

    Full Text Available A baixa fertilidade de gemas tem sido um dos fatores limitantes da produção em vinhedos do Estado de São Paulo, estando este problema relacionado, em muitos casos, ao excesso de vigor das plantas. Neste contexto, um experimento foi conduzido em vinhedo comercial da cultivar de uva de mesa Itália, localizado no município de São Miguel Arcanjo (SP. O delineamento experimental foi em blocos casualizados, com 6 tratamentos e 4 repetições. Os ramos foram pulverizados com soluções de cycocel, nas doses de 0; 500; 1.000; 1.500; 2.000 e 2.500 mg.L-1, 60 dias após a poda. As variáveis avaliadas foram: porcentagem de gemas férteis, distribuição das gemas férteis por setor do ramo, porcentagem de gemas mortas, peso, comprimento e diâmetro de entrenós. Aplicações de cycocel aumentaram linearmente a porcentagem de gemas férteis e a proporção de gemas férteis entre a 1ª e a 5ª gema basal. Além disso, este retardador de crescimento reduziu a porcentagem de gemas mortas e o peso dos entrenós, apresentando efeito quadrático para estas variáveis.The low bud fertility has been one of the most limiting factors in vineyards at São Paulo State, and this problem has been correlated, in many cases, to the excess of plant vigor. In this context, a trial was carried out in a commercial vineyard of 'Italia' table grape, located at São Miguel Arcanjo (SP, Brazil. The experimental design was in complete randomized blocks with six treatments and four replications. The vine shoots were sprayed with cycocel at 0, 500, 1000, 1500, 2000 and 2500mg.L-1, 60 days after pruning. The variables evaluated were: percentage of fertile buds; distribution of fertile buds per shoot sector; percentage of bud necrosis; weight, length and diameter of internodes. Applications of cycocel linearly increased the percentage of bud fertility and the proportion of fertile buds between first and fifth basal buds. Furthermore, this growth regulator reduced the incidence of bud necrosis and the weight of internodes, presenting quadratic effect for these variables.

  7. Comparative analysis of phenolic content and profile, antioxidant capacity, and anti-inflammatory bioactivity in wild Alaskan and commercial Vaccinium berries.

    Science.gov (United States)

    Grace, Mary H; Esposito, Debora; Dunlap, Kriya L; Lila, Mary Ann

    2014-05-01

    Wild Alaskan Vaccinium berries, V. vitis-idaea (lowbush cranberry) and V. uliginosum (bog blueberry), were investigated in parallel with their commercial berry counterparts, V. macrocarpon (cranberry) and V. angustifolium (lowbush blueberry). Lowbush cranberry accumulated about twice the total phenolics (624.4 mg/100 g FW) and proanthocyanidins (278.8 mg/100 g) content as commercial cranberries, but A-type proanthocyanidins were more prevalent in the latter. Bog blueberry anthocyanin and total phenolic contents of 220 and 504.5 mg/100 g, respectively, significantly exceeded those of the lowbush blueberry. Chlorogenic acid, however, was quite high in lowbush blueberry (83.1 mg/100 g), but undetected in bog blueberry, and the proanthocyanidins of lowbush blueberry had significantly higher levels of polymerization. Antioxidant capacity (DPPH, APTS, and FRAP) correlated with phenolic content for each berry. A polyphenol-rich fraction from lowbush cranberry exhibited dose-dependent inhibition of LPS-elicited induction of IL-1β in RAW 264.7 cells, indicative of strong anti-inflammatory activity. These results corroborate the historic use of wild Alaskan berries as medicinally important foods in Alaska Native communities. PMID:24219831

  8. Dicty_cDB: AFI793 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available producing significant alignments: (bits) Value N CF604135 |CF604135.1 BACCA01_001462 Grape Berry pSPORT1 Lib...RNA sequence. 58 7e-13 3 CF608926 |CF608926.1 GERMO01_000641 Grape Shoot pSPORT1 Library Vitis vinifera cDNA

  9. BlackBerry All-in-One for Dummies

    CERN Document Server

    Sarigumba, Dante; Petz, William

    2010-01-01

    Go beyond BlackBerry basics and get everything your BlackBerry can deliver. BlackBerry is the leading smartphone for business users, and its popularity continues to explode. When you discover the amazing array of BlackBerry possibilities in this fun and friendly guide, you'll be even happier with your choice of smartphones. BlackBerry All-in-One For Dummies explores every feature and application common to all BlackBerry devices. It explains the topics in depth, with tips, tricks, workarounds, and includes detailed information about cool new third-party applications, accessories, and downloads

  10. Ampelographic evaluation of wild grapevine characters VitisVinifera G. ssp Sylvestris in Vlora’s river valley

    Directory of Open Access Journals (Sweden)

    BARDHOSH FERRAJ

    2014-06-01

    Full Text Available The wild grapevine (Vitisvitifera G. ssp Sylvestris has been growing spontaneously for thousands of years in Vlora’s river valley. It has been growing in the forests and the villages located along this river, starting from the low hills and ending with villages, located at approximately 600 - 700 m above the sea level such as Mesaplik, Brataj, Tërbaç, Vranisht, Kuç, Sevaster, ect. Observing the flower’s characteristics we concluded that 13% of the flowers are hermaphrodites, 41% of the individuals have a functioning male flower and 46 % of the individuals have a functional female flower. The leaf has different dimensions starting from small to medium, it has 5 lobes, a pentagon form and a smaller petiole than the length of the grown leaf. Above the main venations there are no signs of anthocyanin pigmentation. The average length of the blade above the venation N2 is 10.1\\ 9.6=1.05. The grains contain 2-4 seeds with an average length of 4.85 mm and an average width of 4.5mm, the ratio length\\width of the seed is 4.5\\4.85 = 0.92. The pulp of the grain contains 44.5% must, 21% sugar and 13.1% acidity in total. In the forests and the villages of Vlora’s river valley, the wild grapevine is usually accompanied with other plants like, A.unedo L., C.siliquastrum L., C. mas L., E. arboreaL., I.aquifolium L., Q.cerris L., P.alba L., Q.frainetto Ten., P.spina-christi M., O. vulgare L., W. pear, J. oxycedrus L., W.plum, Blackberries, W. rose, etc, and some herbaceous plants that typically grow in this area such as: M.camomila, strawberry, trefoil, rosemary , lavender, B. perennis L., ect.

  11. In Vitro Antimicrobial Activity and Effect on Biofilm Production of a White Grape Juice (Vitis vinifera) Extract.

    Science.gov (United States)

    Filocamo, Angela; Bisignano, Carlo; Mandalari, Giuseppina; Navarra, Michele

    2015-01-01

    Background. The aim of the present study was to evaluate the antimicrobial effect of a white grape juice extract (WGJe) against a range of Gram-positive and Gram-negative bacteria, yeasts, and the fungus Aspergillus niger. WGJe was also tested on the production of bacterial biofilms in vitro. Results. WGJe inhibited in vitro most Gram-positive bacteria tested, Staphylococcus aureus ATCC 6538P being the most sensitive strain (MIC values of 3.9 μg/mL). The effect was bactericidal at the concentration of 500 μg/mL. Amongst the Gram-negative bacteria, Escherichia coli was the only susceptible strain (MIC and MBC of 2000 μg/mL). No effect on the growth of Candida sp. and the fungus Aspergillus niger was detected (MIC values > 2000 μg/mL). WGJe inhibited the biofilms formation of E. coli and Pseudomonas aeruginosa with a dose-dependent effect. Conclusions. WGJe exerted both bacteriostatic and bactericidal activity in vitro. The presented results could be used to develop novel strategies for the treatment of skin infections and against potential respiratory pathogens. PMID:26770255

  12. Nové metody výroby sazenic révy vinné (Vitis vinifera)

    OpenAIRE

    ZUKAL, Radim

    2011-01-01

    My bachelor work deals with the description methods of the propagation of grapevine. Vine can be reproduce vegetatively and generatively. In a generative propagation is described tree breeding maintenance and tree breeding of new varieties. Vegetative propagations deals with the propagation of direct, indirect propagation and propagation in vitro. Described is also a technology of producing grapevine plants.

  13. Effect of gamma irradiation and sulfur dioxide treatment on storability of some grape varieties (Vitis Vinifera L.) in Syria

    International Nuclear Information System (INIS)

    The feasibility of using gamma irradiation and sulfur dioxide to control post-harvest diseases and to extend shelf life of table grapes in cold storage (1-2 C deg) was studied using two local varieties of grapes (Baladi and Helwani). The experiment was conducted for two years (1995 and 1996). In the first year, the clusters of both varieties were subjected to one of the following treatments: Irradiation with 0, 0.5, 1.0 and 1.5 kGy of gamma rays, sulfur dioxide (3 g Na2S2O5/ 5 Kg clusters) or combination of both 1.0 KGy of gamma irradiation and sulfur dioxide. In the second year, two additional doses were applied: 0.1 and 0.25 KGy for Helwani and 2.0 and 2.5 KGy for Baladi. Clusters of both var. were treated with combined treatments (1.5 KGy and sulfur dioxide for Baladi) and (0.5 KGy and sulfur dioxide for Helwani). Treated and untreated clusters were kept in cold storage (temperature, 1 to 2 C deg). Weight loss, spoilage and total loss were evaluated every two and four weeks of storage for Baladi and Helwani, respectively. With the exception of Helwani var. produced in the first year and treated with sulfur dioxide, the results indicated that separate application of sulfur dioxide and gamma radiation reduced the rotting induced by (B. cinerea) and improved the storability of both varieties. Gamma irradiation in combination with sulfur dioxide preserved the two varieties of table grapes. (author)

  14. Influence of kaolin particle film and deficit irrigation on varietal aroma components in Merlot grape (Vitis vinifera L.)

    Science.gov (United States)

    The effect on grape-derived volatile composition of a kaolin-based, foliar reflectant particle film (PF) and differing severities of vine water deficit was investigated in this study over two growing seasons on Merlot grapevines grown in a semi-arid region of southwestern Idaho. Vines were provided ...

  15. Expressão e localização subcelular de aquaporinas SIP de Vitis vinifera e Olea europaea

    OpenAIRE

    Gomes, Dulceneia Maria Eugénia

    2008-01-01

    Dissertação de mestrado em Genética Molecular A existência de uma membrana biológica permeável à água foi proposta há mais de 100 anos antes de ser descoberta a sua estrutura básica. Contudo, a velocidade reduzida da difusão simples da água através da bicamada lipídica sugeriu a existência de uma via adicional mediada, um factor proteico cuja expressão pode variar nos diferentes tipos de células. A descoberta das aquaporinas como canais que aumentam 10 a 100 vezes a permeabilid...

  16. Unsupervised principal component analysis of NMR metabolic profiles for the assessment of substantial equivalence of transgenic grapes (Vitis vinifera).

    Science.gov (United States)

    Picone, Gianfranco; Mezzetti, Bruno; Babini, Elena; Capocasa, Franco; Placucci, Giuseppe; Capozzi, Francesco

    2011-09-14

    Substantial equivalence is a key concept in the evaluation of unintended and potentially harmful metabolic impact consequent to a genetic modification of food. The application of unsupervised multivariate data analysis to the metabolic profiles is expected to improve the effectiveness of such evaluation. The present study uses NMR spectra of hydroalcoholic extracts, as holistic representations of the metabolic profiles of grapes, to evaluate the effect of the insertion of one or three copies of the DefH9-iaaM construct in plants of Silcora and Thompson Seedless cultivars. The comparison of the metabolic profiles of transgenic derivatives with respect to their corresponding natural lines pointed out that the overall metabolic changes occur in the same direction, independent of the host genotype, although the two cultivars are modified to different extents. A higher number of copies not only produces a larger effect but also modifies the whole pattern of perturbed metabolites. PMID:21806070

  17. Deficit Irrigation Promotes Arbuscular Colonization of Fine Roots by Mycorrhizal Fungi in Grapevines (Vitis vinifera L.) in an Arid Climate

    Science.gov (United States)

    Regulated deficit irrigation (RDI) is a common practice applied in irrigated vineyards to control canopy growth and improve fruit quality, but little is known of how imposed water deficits may alter root growth and colonization by beneficial, arbuscular mycorrhizal fungi (AMF). Thus, root growth and...

  18. Isolation of Xylella fastidiosa from Citrus sinensis (L) Osb. And Vitis vinifera and study of genetic diversity in Costa Rica

    International Nuclear Information System (INIS)

    Xylella fastidiosa is a plant pathogenic bacterium that causes diseases in different crops. Symptoms similar to those caused by citrus variegated chlorosis (CVC) were observed in sweet orange trees which served as shade and fences in coffee plantations in Costa Rica, in 2002. A total of 35 citrus trees and 24 vines from eight different districts and 3 respectively were evaluated by 'double antibody sandwich enzyme-linked immunosorbent assay' (DASELISA), resulting in 21 citrus and 19 positive vid. From four citrus trees and six of vines, were obtained six isolates and seven isolates respectively in solid medium, whose morphological and biochemical characteristics coincided with those reported in the literature as characteristic of X. fastidiosa. The identity of the isolates is confirmed by the chain polymerase reaction (PCR) using primers 272-1/272-2int and RST31/RST33. Three isolates from Grecia (Alajuela Province) amplified a band of 500pb using specific primers 272-2int/CVC-1 for strains of X. fastidiosa that cause CVC. The genetic variability of isolates from each other in comparison with isolates of coffee in Costa Rica, U.S. grapes and citrus in Brazil have been studied using techniques of random amplification polymorphism DNA (RAPD) and length polymorphisms of restriction fragments (RFLPs) of the products obtained with primers int/272-2int JB-1/JB-2 and 272-1. The results showed a clear separation between citrus isolates of Costa Rica; and, an association of three of them with the strains of citrus in Brasil. Also, an association between strains of coffee of Costa Rica with grape vines in the U.S. An association of molecular analysis confirmed the data variance. (author)

  19. Grape skins (Vitis vinifera L.) catalyze the in vitro enzymatic hydroxylation of p-coumaric acid to caffeic acid

    DEFF Research Database (Denmark)

    Arnous, Anis; Meyer, Anne S.

    2009-01-01

    The ability of grape skins to catalyze in vitro conversion of p-coumaric acid to the more potent antioxidant caffeic acid was studied. Addition of different concentrations of p-coumaric to red grape skins (Cabernet Sauvignon) resulted in formation of caffeic acid. This caffeic acid formation (Y......) correlated positively and linearly to p-coumaric acid consumption (X): Y = 0.5 X + 9.5; R 2 = 0.96, P <0.0001. The kinetics of caffeic acid formation with time in response to initial p-coumaric acid levels and at different grape skin concentrations, indicated that the grape skins harboured an o......-hydroxylation activity, proposedly a monophenol- or a flavonoid 3′-monooxygenase activity (EC 1.14.18.1 or EC 1.14.13.21). The K m of this crude o-hydroxylation activity in the red grape skin was 0.5 mM with p-coumaric acid....

  20. Determination of some volatile compounds in fruit spirits produced from grapes (Vitis Vinifera L.) and plums (Prunus domestica L.) cultivars

    OpenAIRE

    Kostik, Vesna; Gjorgjeska, Biljana; Angelovska, Bistra; Kovacevska, Ivona

    2014-01-01

    Fruit spirits contain a large array of volatile compounds among which the important role from toxicological aspect besides ethanol has methanol, aliphatic esters and fusel alcohols. This study evaluates the content of ethanol, ethyl acetate, methanol, isopropyl alcohol (2-propanol), n-propyl alcohol (propan-l-ol), isobutyl alcohol (2-methylpropan-1-ol), n-butyl alcohol (1-butanol), isoamyl alcohol (3-methyl-1-butanol) and n-amyl alcohol (pentan-1-ol) in different grapes and plum brandies i...

  1. Characterization of Cold Soak on Vitis vinifera L. cv. Cabernet Sauvignon Grape and Wine Volatiles Using an Electronic Nose System

    OpenAIRE

    Gardner, Denise M.

    2009-01-01

    The use of the electronic nose in the wine industry is an emerging technology. Although electronic nose systems have been used in other industries as tools to monitor fruit maturity or quality control, the use of these systems for wine analysis has been debated. Many electronic nose sensor types exist, but have often been accused of primarily discriminating varying ethanol concentrations of wines as opposed to aroma and flavor volatiles. This study evaluated the use of a commercial conduc...

  2. Determination of volatile compounds and antioxidant activity from Vitis vinifera L. (cv. Pinot Blanc and St. Laurent) during winemaking

    Czech Academy of Sciences Publication Activity Database

    Šťavíková, Lenka; Hohnová, Barbora; Karásek, Pavel; Planeta, Josef; Roth, Michal

    Latvia: Latvian Institute of Organic Synthesis, 2011 - (Kažoka, H.). s. 91 [Nordic Separation Science Society Conference /6./. 24.09.2011-27.09.2011, Riga] R&D Projects: GA ČR(CZ) GAP206/11/0138; GA ČR(CZ) GPP503/11/P523 Institutional research plan: CEZ:AV0Z40310501 Keywords : volatile compounds * antioxidant activity * DPPH Subject RIV: CB - Analytical Chemistry, Separation http://www.nosss.eu

  3. Changes in free and bound fractions of aroma compounds of four Vitis vinifera cultivars at the last ripening stages

    OpenAIRE

    Vilanova, Mar; Genisheva, Zlatina Asenova; Bescansa, Lorenzo; Masa, Antón; Oliveira, J. M.

    2012-01-01

    The volatile composition of white Agudelo, Blanco lexitimo, Godello and red Serradelo cultivars (NW Spain) harvested at two different stages of ripening have been evaluated. C6-compounds, alcohols, volatile fatty acids, monoterpenes, C13-norisoprenoids, volatile phenols and carbonyl compounds were identified and quantified in free and glycosidically bound forms by gas chromatography–mass spectrometry (GC–MS). The total volatile concentration showed a significant increase between the two ri...

  4. Effects of Partial Rootzone Drying on the Growth of Vitis vinifera cv. Malvasia Grafted on Different Rootstocks

    Institute of Scientific and Technical Information of China (English)

    QI Wei; GUAN Xue-qiang; LI En-mao; ZHAI Heng; WANG Xiao-fang; DU Yuan-peng

    2007-01-01

    To lay a biological foundation for rootstocks and alternate irrigation (AI) popularization, the effects of partial rootzone drying (PRD) on the growth of the grapevine Malvasia grafted on different rootstocks were investigated. Biological effects of 1/2 divided root irrigation on three combinations, i.e., Malvasia/420A, Malvasia/3309C, and Malvasia/110R,were studied by wood-boxed plants. All the plants were separated into three groups for different irrigation strategies.Mass growth of new root in alternate-irrigated plants was remarkably promoted by about 7.8-22.2% higher than the wellwatered ones. However, new shoot growth, especially the internode was reduced by alternate irrigation. The average root-shoot ratio of all the three combinations was increased from 1.1 to 1.46. New root growth and internode length were decreased by fixed partial rootzone irrigation (FI) at different amount, M/3309C at 37.9 and 36.9%, M/110R at 18.4 and 22.5%, respectively. Total biomass of all the three combinations under FI decreased at the rate of 19.2-34.3% compared with well-watered ones. Water stress adaptation of grapevine mainly depends on rootstock. 110R is more efficient than3309C and 420A in water stress adaptation. PRD-AI benefited root growth, thus improved the drought-resistant ability of grapevine.

  5. Maqui berry vs Sloe berry--liquor-based beverage for new development.

    Science.gov (United States)

    Gironés-Vilaplana, Amadeo; Moreno, Diego A; García-Viguera, Cristina

    2015-01-01

    "Pacharin" is an aniseed liquor-based beverage made with sloe berry (Prunus spinosa L.) that has been produced in northern Spain. On the other hand, maqui berry (Aristotelia chilensis) is a common edible berry from Chile, and currently under study because of its multiple beneficial effects on health. The aim of this work was to design a new aniseed liquor-based beverage with maqui berry, as an industrial alternative to a traditional alcoholic product with bioactive berries. The characterization of its composition, compared with the traditional "Pacharin", and its evolution during maceration (6 and 12 months) showed that the new maqui liquor had significantly-higher anthocyanin retention over time. More studies on the organoleptic properties and bioactivity are underway. PMID:25920225

  6. CrackBerry The Tales of BlackBerry Use and Abuse

    CERN Document Server

    Michaluk, Kevin J; Trautschold, Martin

    2011-01-01

    A delayed train, a dip in the conversation, an early morning hour with no sleep - during these moments, do you feel an overwhelming urge to grab your BlackBerry? Do you know someone else who does? If the answer is yes, then look no further than this one-of-a-kind book...CrackBerry: True Tales of Blackberry Use and Abuse covers the phenomenon of "BlackBerry Addiction," offering true-life accounts of BlackBerry dependence and mishaps. You'll find comfort and humor in the unbelievable tales of BlackBerry abuse and also learn some valuable tips along the way. * The definitive guide to respons

  7. Water and stress dynamics for North Carolina v. vinifera

    Science.gov (United States)

    As North Carolina wine grape (V. vinifera) production intensifies, the importance of water management must be addressed. Grape yield and composition, and consequently wine quality, are greatly influenced by the water regime under which the grapes were produced. Despite the importance of water manage...

  8. Whole genome comparison between table and wine grapes reveals a comprehensive catalog of structural variants

    OpenAIRE

    Di Genova, Alex; Almeida, Andrea Miyasaka; Muñoz-Espinoza, Claudia; Vizoso, Paula; Travisany, Dante; Moraga, Carol; Pinto, Manuel; Hinrichsen, Patricio; Orellana, Ariel; Maass, Alejandro

    2014-01-01

    Background Grapevine (Vitis vinifera L.) is the most important Mediterranean fruit crop, used to produce both wine and spirits as well as table grape and raisins. Wine and table grape cultivars represent two divergent germplasm pools with different origins and domestication history, as well as differential characteristics for berry size, cluster architecture and berry chemical profile, among others. ‘Sultanina’ plays a pivotal role in modern table grape breeding providing the main source of s...

  9. Northern berries are superfruits - how to increase consumption and appreciation?

    OpenAIRE

    Tahvonen, Raija

    2010-01-01

    Health effects of Northern berries have been studied intensively already for years. Different berries show different health effects. Beneficial effects have been found in weight management, glucose metabolism, liver and eye health, immune function, oxidative metabolism (cancer prevention) and lipid metabolism. However, results of different studies are unanimous due to differences in test materials (whole berries / different berry fractions) and methods (in vitro studies, cell s...

  10. Berry fruits for cancer prevention: current status and future prospects.

    Science.gov (United States)

    Seeram, Navindra P

    2008-02-13

    Overwhelming evidence suggests that edible small and soft-fleshed berry fruits may have beneficial effects against several types of human cancers. The anticancer potential of berries has been related, at least in part, to a multitude of bioactive phytochemicals that these colorful fruits contain, including polyphenols (flavonoids, proanthocyanidins, ellagitannins, gallotannins, phenolic acids), stilbenoids, lignans, and triterpenoids. Studies show that the anticancer effects of berry bioactives are partially mediated through their abilities to counteract, reduce, and also repair damage resulting from oxidative stress and inflammation. In addition, berry bioactives also regulate carcinogen and xenobiotic metabolizing enzymes, various transcription and growth factors, inflammatory cytokines, and subcellular signaling pathways of cancer cell proliferation, apoptosis, and tumor angiogenesis. Berry phytochemicals may also potentially sensitize tumor cells to chemotherapeutic agents by inhibiting pathways that lead to treatment resistance, and berry fruit consumption may provide protection from therapy-associated toxicities. Although a wide variety of berry fruits are consumed worldwide, this paper focuses on those commonly consumed in North America, namely, blackberries, black raspberries, blueberries, cranberries, red raspberries, and strawberries. In addition, a large body of studies on singly purified berry bioactives is available, but this paper focuses on studies of "whole berries" per se, that is, as berry extracts and purified fractions, juices, and freeze-dried powders. Potential mechanisms of anticancer action and bioavailability of berry phenolics, as well as gaps in knowledge and recommendations for future berry research, are also briefly discussed. PMID:18211019

  11. Comparative transcriptome analysis reveals defense-related genes and pathways against downy mildew in Vitis amurensis grapevine.

    Science.gov (United States)

    Li, Xinlong; Wu, Jiao; Yin, Ling; Zhang, Yali; Qu, Junjie; Lu, Jiang

    2015-10-01

    Downy mildew (DM), caused by oomycete Plasmopara viticola (Pv), can lead to severe damage to Vitis vinifera grapevines. Vitis amurensis has generally been regarded as a DM resistant species. However, when V. amurensis 'Shuanghong' were inoculated with Pv strains 'ZJ-1-1' and 'JL-7-2', the former led to obvious DM symptoms (compatible), while the latter did not develop any DM symptoms but exhibited necrosis (incompatible). In order to underlie molecular mechanism in DM resistance, mRNA-seq based expression profiling of 'Shuanghong' was compared at 12, 24, 48 and 72 h post inoculation (hpi) with these two strains. Specific genes and their corresponding pathways responsible for incompatible interaction were extracted by comparing with compatible interaction. In the incompatible interaction, 37 resistance (R) genes were more expressed at the early stage of infection (12 hpi). Similarly, genes involved in defense signaling, including MAPK. ROS/NO, SA, JA, ET and ABA pathways, and genes associated with defense-related metabolites synthesis, such as pathogenesis-related genes and phenylpropanoids/stilbenoids/flavonoids biosynthesizing genes, were also activated mainly during the early stages of infection. On the other hand, Ca(2+) signaling and primary metabolism, such as photosynthesis and fatty acid synthesis, were more repressed after 'JL-7-2' challenge. Further quantification of some key defense-related factors, including phytohormones, phytoalexins and ROS, generally showed much more accumulation during the incompatible interaction, indicating their important roles in DM defense. In addition, a total of 43 and 52 RxLR effectors were detected during 'JL-7-2' and 'ZJ-1-1' infection processes, respectively. PMID:26151858

  12. A sugar-inducible protein kinase, VvSK1, regulates hexose transport and sugar accumulation in grapevine cells

    OpenAIRE

    Lecourieux, Fatma; Lecourieux, David; Vignault, Céline; Delrot, Serge

    2010-01-01

    In grapevine (Vitis vinifera), as in many crops, soluble sugar content is a major component of yield and economical value. This paper identifies and characterizes a Glycogen Synthase Kinase3 protein kinase, cloned from a cDNA library of grape Cabernet Sauvignon berries harvested at the ripening stage. This gene, called VvSK1, was mainly expressed in flowers, berries, and roots. In the berries, it was strongly expressed at postvéraison, when the berries accumulate glucose, fructose, and abscis...

  13. Stem Xylem Characterization for Vitis Drought Tolerance.

    Science.gov (United States)

    Rustioni, Laura; Ciacciulli, Angelo; Grossi, Daniele; Brancadoro, Lucio; Failla, Osvaldo

    2016-07-01

    Together with stomatal conductance and root conductivity, the stem water reserve and transport systems could be regulatory mechanisms able to participate in the regulation of the plant water status. Lianas, such as Vitis spp., minimize the trunk support role, and stems have evolved to improve their ability in water transport. In this work, stems of 10 different Vitis species were studied in relation to their expected drought tolerance using reflectance spectroscopy. Spectra were measured before (T0) and after coloration with Sudan IV dye. The T0 spectral signature showed characteristic species features. The partial least squares (PLS) regression and the self-organizing map (SOM) neural network analysis were able to predict the expected drought tolerance score; thus, reflectance spectroscopy was demonstrated to be a useful technique for drought tolerance phenotyping. These methods could be applied for the preliminary selection of new rootstocks/cultivars. Wood composition variation appeared to be correlated with the water stress susceptibility. To clarify this relationship, the attention was focused on the wood hydrophobicity. Sudan IV is a microscopy dye traditionally used to underline suberin, waxes, and, in general, hydrophobic substances. Differences between rough and colored spectra evidenced the absorption band of Sudan IV with a maximum at 539 nm. The coloration intensity was used to develop a hydrophobicity index. The obtained values were correlated with the expected drought tolerance score. Therefore, hydrophobic compounds seem to play an important role in water use efficiency, and an hydrophobic barrier in the xylem tissue appears to be a protective mechanism against water stress. PMID:27281116

  14. Photon Drag Effect due to Berry Curvature

    Science.gov (United States)

    Kurosawa, Hiroyuki; Sawada, Kei; Ohno, Seigo

    2016-08-01

    A theoretical investigation reveals that the photon drag effect (PDE) is induced in a grating slab with deformation by the Berry curvature in phase space. It drifts the momentum of light, and gives asymmetric PDE signals in momentum space. Large PDE signals are observed even near the Γ point. This characteristic agrees well with our theoretical results.

  15. Berry Phenolics of Grapevine under Challenging Environments

    Directory of Open Access Journals (Sweden)

    Hernâni Gerós

    2013-09-01

    Full Text Available Plant phenolics have been for many years a theme of major scientific and applied interest. Grape berry phenolics contribute to organoleptic properties, color and protection against environmental challenges. Climate change has already caused significant warming in most grape-growing areas of the world, and the climatic conditions determine, to a large degree, the grape varieties that can be cultivated as well as wine quality. In particular, heat, drought and light/UV intensity severely affect phenolic metabolism and, thus, grape composition and development. In the variety Chardonnay, water stress increases the content of flavonols and decreases the expression of genes involved in biosynthesis of stilbene precursors. Also, polyphenolic profile is greatly dependent on genotype and environmental interactions. This review deals with the diversity and biosynthesis of phenolic compounds in the grape berry, from a general overview to a more detailed level, where the influence of environmental challenges on key phenolic metabolism pathways is approached. The full understanding of how and when specific phenolic compounds accumulate in the berry, and how the varietal grape berry metabolism responds to the environment is of utmost importance to adjust agricultural practices and thus, modify wine profile.

  16. The microbial ecology of wine grape berries.

    Science.gov (United States)

    Barata, A; Malfeito-Ferreira, M; Loureiro, V

    2012-02-15

    Grapes have a complex microbial ecology including filamentous fungi, yeasts and bacteria with different physiological characteristics and effects upon wine production. Some species are only found in grapes, such as parasitic fungi and environmental bacteria, while others have the ability to survive and grow in wines, constituting the wine microbial consortium. This consortium covers yeast species, lactic acid bacteria and acetic acid bacteria. The proportion of these microorganisms depends on the grape ripening stage and on the availability of nutrients. Grape berries are susceptible to fungal parasites until véraison after which the microbiota of truly intact berries is similar to that of plant leaves, which is dominated by basidiomycetous yeasts (e.g. Cryptococcus spp., Rhodotorula spp. Sporobolomyces spp.) and the yeast-like fungus Aureobasidium pullulans. The cuticle of visually intact berries may bear microfissures and softens with ripening, increasing nutrient availability and explaining the possible dominance by the oxidative or weakly fermentative ascomycetous populations (e.g. Candida spp., Hanseniaspora spp., Metschnikowia spp., Pichia spp.) approaching harvest time. When grape skin is clearly damaged, the availability of high sugar concentrations on the berry surface favours the increase of ascomycetes with higher fermentative activity like Pichia spp. and Zygoascus hellenicus, including dangerous wine spoilage yeasts (e.g. Zygosaccharomyces spp., Torulaspora spp.), and of acetic acid bacteria (e.g. Gluconobacter spp., Acetobacter spp.). The sugar fermenting species Saccharomyces cerevisiae is rarely found on unblemished berries, being favoured by grape damage. Lactic acid bacteria are minor partners of grape microbiota and while being the typical agent of malolactic fermentation, Oenococcus oeni has been seldom isolated from grapes in the vineyard. Environmental ubiquitous bacteria of the genus Enterobacter spp., Enterococcus spp., Bacillus spp

  17. Protein (Viridiplantae): 225433261 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 8 PREDICTED: mitochondrial import receptor subunit TOM22 homolog 2 Vitis vinifera MAGGSSDSKSNSGLVSRISNSISGSGIMFHGKRAASDAAYVTKKLLRSTGKAAWIAGTTFVILVVPLIIEMDREQQLNDLDLQQATLLGTTPLPARN ...

  18. Protein (Viridiplantae): 359475453 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available PREDICTED: uncharacterized protein LOC100252521 Vitis vinifera MDCKSLLVLGLVCIVFAGVGGQAPAGGPTATPAPPTPTTPAASPPTAVTSPPASSPPPVSAPPPATPP...PATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPP

  19. Protein (Viridiplantae): 359485447 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ncharacterized protein LOC100264389 Vitis vinifera MAMITISTIKERWKLSITASFMGCIIPVLFLNHSHDSTNLSALLGIRMEPSEPSKLN...KHSDSTLQNTSTSPTSFGQFPTPNVEFSQISKLTGFPDSAPQIMNTSVLFSEPPRPNTEFSEPSKPKMEFSGPSKLTDYPS...SALQNTTTSTLSFDQFPRPEMETARPEMEISEPSKPNMDFHEPSKIIENPKLMNHSNEKCDIFDGKWVYDPEGKPLYGPQCPFLHDQVSCRRNGRPDSDYEKWSWQPN...ECEIPRFNVTDMFERLRGKRLIMVGDSLNGNMWASLACLLYSAIPPSRSHIETNRIPRSFRSKDYNCSVEFYMNPFLVQTYVNKTDGTRVLRLDQISDSARRWQGADI...LDEFLLPPFPNSMARIVEGRIRRMRTPVRYLNITKLSQYRKDAHPSIYSSKREKLMINQKQSPDCSHWCLPGLPDTWNMLLYVSMVSSNSSSWHLMV ...

  20. Protein (Viridiplantae): 359474475 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available uncharacterized protein LOC100262584 Vitis vinifera MATHRAVSAVFFVLLSIGICSATRALLTFEGEAGYGTGHGIGGGGGGGSGSGGGFPGGYGGGGGSGGGGGYGAVGGYGSGG...GGGGGGGSGGGYGAGGIHGGGYGSGGGSGGGIGYGAGGEHGGGGGSGGGAGGGVGYGSGGGGSGG...AGGGYPAGPEHGGGYGSGGGQGGGAGYGGGGEHGGGYGGGSGGGGGVGYGAGGEHGGGYGTGEGAGGGGGGGSGGGTGYGAGGEHGGGYGSGGGSGGGTGYGAGGEHGGGYGGGGGSGG...GTGYGDGGDHGAGYGSGGGSGGGIGYGAGGEHGGGYGGGNGGGGGVGYGAGGEHGGGYGRGGGSGGGAGAGSGGGGGGGYGGGYGGGVHGGYIP ...

  1. Protein (Viridiplantae): 359474473 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available uncharacterized protein LOC100245427 Vitis vinifera MATHKIYSIVFFVILGIGISSATRALLTYEGSYGAGHGAGSGSGSGYGGRGGGGGSGGGEGYAAVGDHGAAGYGSGG...GSGSGGGEGYEGGRGGGSGGGGGGGSGGGGGSAYGAGGAGYGSGGGEGSGAGFGGANGGGSGGGGGGGSGG...GGGASYGAGGAHGGGSGSGQGSGSGGGYGAGEGKGGGGGGGSGGGGGGGSGSGGGYGAGEGGGAGGGSGGGGGGGGGGAAYGAGGHGAGSGSGQGSGSGGGYGAGGGKGGGGGGGSGGGGGSGGGAASGAGGEHGVGYGGGSGSGEGGGHGGGYAP ...

  2. Quality Control of Wild Berries Honey Syrup

    Directory of Open Access Journals (Sweden)

    Laura Stan

    2013-11-01

    Full Text Available This paper presents the quality control parameters of wild berries honey syrup . The product was created in laboratory (wild berries: honey, 1:4 w/w and there were no changes recorded in overall quality over 6 months preservation at 1-2°C. Basic quality parameters of the product were evaluated: humidity, pH, acidity, hydroxymethylfurfural, diastase, total sugars and ascorbic acid. Methods developed by Internantional Honey Commission and Romanian Food Quality Standards were applied during this study. The product presented qood quality criteria and it was highly appreciated by consumers who tasted it. This study presents a valuable method to preserve fresh widberries in honey over a long period of time. The economical value of this experiment resides in making these fruits available outside the harvesting season.

  3. Control of virus diseases of berry crops.

    Science.gov (United States)

    Martin, Robert R; Tzanetakis, Ioannis E

    2015-01-01

    Virus control in berry crops starts with the development of plants free of targeted pathogens, usually viruses, viroids, phytoplasmas, and systemic bacteria, through a combination of testing and therapy. These then become the top-tier plants in certification programs and are the source from which all certified plants are produced, usually after multiple cycles of propagation. In certification schemes, efforts are made to produce plants free of the targeted pathogens to provide plants of high health status to berry growers. This is achieved using a systems approach to manage virus vectors. Once planted in fruit production fields, virus control shifts to disease control where efforts are focused on controlling viruses or virus complexes that result in disease. In fruiting fields, infection with a virus that does not cause disease is of little concern to growers. Virus control is based on the use of resistance and tolerance, vector management, and isolation. PMID:25591882

  4. Coffee Berry Borer Resistance in Coffee Genotypes

    OpenAIRE

    Gustavo Hiroshi Sera; Tumoru Sera; Dhalton Shiguer Ito; Claudionor Ribeiro Filho; Amador Villacorta; Fabio Seidi Kanayama1; Clayton Ribeiro Alegre; Leandro Del Grossi

    2010-01-01

    The aim of this study was to evaluate the coffee germplasm of the Paraná Agronomic Institute (IAPAR) for resistance to the coffee-berry-borer. Preliminary field evaluation was performed in August 2004 and the fruits of less damaged genotypes in the field were evaluated under controlled condition with obligated and free choice experiments established in a randomized complete design with three replications. The genotypes were evaluated fifteen days after infestation with one borer per fruit in ...

  5. Real-space Berry phases: Skyrmion soccer (invited)

    Energy Technology Data Exchange (ETDEWEB)

    Everschor-Sitte, Karin, E-mail: karin@physics.utexas.edu; Sitte, Matthias [The University of Texas at Austin, Department of Physics, 2515 Speedway, Austin, Texas 78712 (United States)

    2014-05-07

    Berry phases occur when a system adiabatically evolves along a closed curve in parameter space. This tutorial-like article focuses on Berry phases accumulated in real space. In particular, we consider the situation where an electron traverses a smooth magnetic structure, while its magnetic moment adjusts to the local magnetization direction. Mapping the adiabatic physics to an effective problem in terms of emergent fields reveals that certain magnetic textures, skyrmions, are tailormade to study these Berry phase effects.

  6. Neuroprotective effects of berry fruits on neurodegenerative diseases

    Institute of Scientific and Technical Information of China (English)

    Selvaraju Subash; Musthafa Mohamed Essa; Samir Al-Adawi; Mushtaq A.Memon; hTamilarasan Manivasagam; Mohammed Akbar

    2014-01-01

    Recent clinical research has demonstrated that berry fruits can prevent age-related neurodegen-erative diseases and improve motor and cognitive functions. The berry fruits are also capable of modulating signaling pathways involved in inflammation, cell survival, neurotransmission and enhancing neuroplasticity. The neuroprotective effects of berry fruits on neurodegenerative diseases are related to phytochemicals such as anthocyanin, caffeic acid, catechin, quercetin, kae-mpferol and tannin. In this review, we made an attempt to clearly describe the beneifcial effects of various types of berries as promising neuroprotective agents.

  7. Three elaborations on Berry's connection, curvature and phase

    International Nuclear Information System (INIS)

    The authors discuss how symmetries and conservation laws are affected when Barry's phase occurs in a quantum system: symmetry transformations of coordinates have to be supplemented by gauge transformations of Berry's connection, and consequently constants of motion acquire terms beyond the familiar kinematical ones. They show how symmetries of a problem determine Berry's connection, curvature and, once a specific path is chosen, the phase as well. Moreover, higher order corrections are also fixed. They demonstrate that in some instances Berry's curvature and phase can be removed by a globally well-defined, time-dependent canonical transformation. Finally, the authors describe how field theories anomalies may be viewed as manifestations of Berry's phase

  8. BerryMeat - New market perspectives using herbs and berries in organic meat products. What has been achieved?

    OpenAIRE

    Hansen, Flemming; Jensen, Martin; Grevsen, Kai; Fenger, Morten

    2014-01-01

    The overall objective of the project was to increase the portfolio of organic meat products for the consumer, by supplying new products preserved by organic grown herbs and berries. The consumers will benefit from a growing range of new, attractive, organic meat products, the Danish producers of organic meat products will benefit form a growing market and the producers of organic herbs and berries will experience an increasing demand for organic grown herbs and berries. The project has bee...

  9. The Politics of Thinking About China: 1. Mary Berry on China. 2. Shanker Versus Berry

    Science.gov (United States)

    Berry, Mary; Shanker, Albert

    1978-01-01

    Mary Berry's speech suggesting that America had much to learn from Chinese education prompted a sharply critical letter from Albert Shanker, head of the American Federation of Teachers. Parts of the speech and the subsequent exchange with Shanker are reprinted here. (LBH)

  10. Coffee Berry Borer, Hypothenemus hampei (Ferrari) (Colecptera: Curculiondae: Scolytinae)

    Science.gov (United States)

    The coffee berry borer is the most devastating pest of coffee throughout the world. Eggs are deposited inside coffee berries, and insects feed on the coffee seed, severely reducing yields. Conventional chemical control is a very limited option, and there has been a concerted effort to develop biolo...

  11. Atividade antimicrobiana dos frutos de Syagrus oleracea e Mauritia vinifera Antimicrobial activity of Syagrus oleracea and Mauritia vinifera fruits

    OpenAIRE

    C. S. SILVEIRA; C.M. Pessanha; M.C.S. Lourenço; I. Neves Junior; F.S. Menezes; M.A.C. Kaplan

    2005-01-01

    As espécies pertencentes à família Palmae são muito interessantes do ponto de vista químico e farmacológico. Neste trabalho, foram estudados os frutos de duas espécies da família Palmae, Syagrus oleracea e Mauritia vinifera. Essas palmeiras foram escolhidas por serem espécies brasileiras, abundantes em nosso país, utilizadas popularmente no tratamento de algumas doenças e ainda pouco estudadas. Foram realizados ensaios farmacológicos para avaliação da atividade antimicrobiana dos extratos dos...

  12. Gradient Nonlinear Pancharatnam-Berry Metasurfaces

    CERN Document Server

    Tymchenko, Mykhailo; Lee, Jongwon; Nookala, Nishant; Belkin, Mikhail A; Alù, Andrea

    2015-01-01

    We apply the Pancharatnam-Berry phase approach to plasmonic metasurfaces loaded by highly nonlinear multi-quantum well substrates, establishing a platform to control the nonlinear wavefront at will based on giant localized nonlinear effects. We apply this approach to design flat nonlinear metasurfaces for efficient second-harmonic radiation, including beam steering, focusing, and polarization manipulation. Our findings open a new direction for nonlinear optics, in which phase matching issues are relaxed, and an unprecedented level of local wavefront control is achieved over thin devices with giant nonlinear responses.

  13. Gradient Nonlinear Pancharatnam-Berry Metasurfaces

    Science.gov (United States)

    Tymchenko, Mykhailo; Gomez-Diaz, J. Sebastian; Lee, Jongwon; Nookala, Nishant; Belkin, Mikhail A.; Alù, Andrea

    2015-11-01

    We apply the Pancharatnam-Berry phase approach to plasmonic metasurfaces loaded by highly nonlinear multiquantum-well substrates, establishing a platform to control the nonlinear wave front at will based on giant localized nonlinear effects. We apply this approach to design flat nonlinear metasurfaces for efficient second-harmonic radiation, including beam steering, focusing, and polarization manipulation. Our findings open a new direction for nonlinear optics, in which phase matching issues are relaxed, and an unprecedented level of local wave front control is achieved over thin devices with giant nonlinear responses.

  14. Berry phase transition in twisted bilayer graphene

    Science.gov (United States)

    Rode, Johannes C.; Smirnov, Dmitri; Schmidt, Hennrik; Haug, Rolf J.

    2016-09-01

    The electronic dispersion of a graphene bilayer is highly dependent on rotational mismatch between layers and can be further manipulated by electrical gating. This allows for an unprecedented control over electronic properties and opens up the possibility of flexible band structure engineering. Here we present novel magnetotransport data in a twisted bilayer, crossing the energetic border between decoupled monolayers and coupled bilayer. In addition a transition in Berry phase between π and 2π is observed at intermediate magnetic fields. Analysis of Fermi velocities and gate induced charge carrier densities suggests an important role of strong layer asymmetry for the observed phenomena.

  15. Advances in table grape breeding in Japan.

    Science.gov (United States)

    Yamada, Masahiko; Sato, Akihiko

    2016-01-01

    In Japan, few grape cultivars related to Vitis vinifera existed 200 years ago, on account of Japan's high rainfall. Many V. labruscana and vinifera cultivars were introduced to Japan in the 19th century. Labruscana was grown instead of vinifera, mainly because of severe disease problems and a high incidence of berry cracking. Grape breeding for table use started in the 20th century, with the goal of combining the berry quality of vinifera with the ease of cultivation of labruscana. By 1945, three strategies were used: 1) crossing among introduced diploid vinifera and vinifera-related cultivars of Japanese origin, 2) interspecific crossing in tetraploid cultivars, and 3) interspecific crossing in diploid cultivars, resulting in 'Neo Muscat', 'Kyoho', and 'Muscat Bailey A'. Later, tetraploid interspecific crossing over generations developed many 'Kyoho'-related cultivars, including 'Pione', many of which have large berries, intermediate flesh texture between the two species, a labruscan or neutral flavor, and moderate disease resistance. Interspecific diploid crossing over generations developed 'Shine Muscat' in 2006, with large berries, crispy flesh, a muscat flavor, no cracking, seedless fruit by gibberellin application, and moderate resistance to downy mildew and ripe rot. PMID:27069389

  16. Vääna-Viti hoolekandeküla = Vääna-Viti community setting group home / Tõnu Laigu

    Index Scriptorium Estoniae

    Laigu, Tõnu, 1956-

    2015-01-01

    Vääna-Viti hoolekandeküla Harku vallas Aiba tee 8/7, valminud 2013. Hoonete arhitektid Tõnu Laigu, Koit Ojaliiv, Mari Rass (QP Arhitektid OÜ), sisearhitektid Andres Labi, Janno Roos (Ruumilabor OÜ). 2014. aasta Kultuurkapitali Arhitektuuripreemia kandidaat

  17. Berry Phase Physics in Free and Interacting Fermionic Systems

    CERN Document Server

    Chen, Jing-Yuan

    2016-01-01

    Berry phase plays an important role in many non-trivial phenomena over a broad range of many-body systems. In this thesis we focus on the Berry phase due to the change of the particles' momenta, and study its effects in free and interacting fermionic systems. We start with reviewing the semi-classical kinetic theory with Berry phase for a non-interacting ensemble of fermions -- a Berry Fermi gas -- which might be far-from-equilibrium. We particularly review the famous Berry phase contribution to the anomalous Hall current. We then provide a concrete and general path integral derivation for the semi-classical theory. Then we turn to the specific example of Weyl fermion, which exhibits the profound quantum phenomenon of chiral anomaly; we review how this quantum effect, and its closely related chiral magnetic effect and chiral vortical effect, arise from Berry phase in the semi-classical kinetic theory. We also discuss how Lorentz symmetry in the kinetic theory of Weyl fermion, seemly violated by the Berry phas...

  18. Berry's Phase for Standing Wave Near Graphene Edge

    OpenAIRE

    Sasaki, Ken-ichi; Wakabayashi, Katsunori; Enoki, Toshiaki

    2010-01-01

    Standing waves near the zigzag and armchair edges, and their Berry's phases are investigated. It is suggested that the Berry's phase for the standing wave near the zigzag edge is trivial, while that near the armchair edge is non-trivial. A non-trivial Berry's phase implies the presence of a singularity in parameter space. We have confirmed that the Dirac singularity is absent (present) in the parameter space for the standing wave near the zigzag (armchair) edge. The absence of the Dirac singu...

  19. Paleomagnetism of Rocks from the Island of Viti Levu, Fiji

    OpenAIRE

    YASKAWA, Katsumi; INOKUCHI, Hiroo; MATSUDA, Jun-ichi; TAKAHASHI, Shinji; ISEZAKI, Nobuhiro; MIYATA, Takao; Rao, Bhaskar; Rodda, Peter; ヤスカワ, カツミ; イノクチ, ヒロオ; マツダ, ジュンイチ; タカハシ, シンジ; イセザキ, ノブヒロ; ミヤタ, タカオ

    1985-01-01

    Samples were collected at 19 sites in basalts, andesites, dacites, gabbros, sandstones and limestones in the island of Viti Levu. They were dated at about 4 to 40 Ma. New age data have been added in 2 sites. After partial demagnetization by alternating fields to remove unstable components of magnetization, the directions of magnetization became well grouped except for the rocks from a few sites. Both normal and reversed directions are present. The volume susceptibility of each specimen has al...

  20. Resistance of Some Vitis Rootstocks to Xiphinema index

    OpenAIRE

    Harris, A. R.

    1983-01-01

    Thirty-eight grapevine (Vitis spp.) rootstocks were screened in pots for resistance to the dagger nematode, Xiphinema index, from 1979 to 1981. Resistance ratings were based on visible root symptoms and on changes in the nematode populations over 16 months. Nineteen of the 23 Californian hybrid rootstocks tested were resistant, as were 'Harmony',' 'Freedom,' 'Schwarzmann,' and '3309.' Two hybrids of V. rufotomentosa, '171-52' and '176-9,' were possibly immune to X. index. The rootstocks 'ARG ...

  1. Berry's phase for standing waves near graphene edge

    International Nuclear Information System (INIS)

    Standing waves near zigzag and armchair edges, and their Berry's phases, are investigated. It is suggested that the Berry's phase for the standing wave near the zigzag edge is trivial, while that near the armchair edge is nontrivial. A nontrivial Berry's phase implies the presence of a singularity in parameter space. We have confirmed that Dirac singularity is absent (present) in parameter space for the standing wave near the zigzag (armchair) edge. The absence of Dirac singularity has a direct consequence in the local density of states near the zigzag edge. The transport properties of graphene nanoribbons observed by recent numerical simulations and experiments are discussed from the point of view of Berry's phases for standing waves.

  2. Bioactive Compounds and Antioxidant Activity in Different Types of Berries

    Directory of Open Access Journals (Sweden)

    Sona Skrovankova

    2015-10-01

    Full Text Available Berries, especially members of several families, such as Rosaceae (strawberry, raspberry, blackberry, and Ericaceae (blueberry, cranberry, belong to the best dietary sources of bioactive compounds (BAC. They have delicious taste and flavor, have economic importance, and because of the antioxidant properties of BAC, they are of great interest also for nutritionists and food technologists due to the opportunity to use BAC as functional foods ingredients. The bioactive compounds in berries contain mainly phenolic compounds (phenolic acids, flavonoids, such as anthocyanins and flavonols, and tannins and ascorbic acid. These compounds, either individually or combined, are responsible for various health benefits of berries, such as prevention of inflammation disorders, cardiovascular diseases, or protective effects to lower the risk of various cancers. In this review bioactive compounds of commonly consumed berries are described, as well as the factors influencing their antioxidant capacity and their health benefits.

  3. Bioactive Compounds and Antioxidant Activity in Different Types of Berries.

    Science.gov (United States)

    Skrovankova, Sona; Sumczynski, Daniela; Mlcek, Jiri; Jurikova, Tunde; Sochor, Jiri

    2015-01-01

    Berries, especially members of several families, such as Rosaceae (strawberry, raspberry, blackberry), and Ericaceae (blueberry, cranberry), belong to the best dietary sources of bioactive compounds (BAC). They have delicious taste and flavor, have economic importance, and because of the antioxidant properties of BAC, they are of great interest also for nutritionists and food technologists due to the opportunity to use BAC as functional foods ingredients. The bioactive compounds in berries contain mainly phenolic compounds (phenolic acids, flavonoids, such as anthocyanins and flavonols, and tannins) and ascorbic acid. These compounds, either individually or combined, are responsible for various health benefits of berries, such as prevention of inflammation disorders, cardiovascular diseases, or protective effects to lower the risk of various cancers. In this review bioactive compounds of commonly consumed berries are described, as well as the factors influencing their antioxidant capacity and their health benefits. PMID:26501271

  4. Spin-orbitronics: A new moment for Berry

    KAUST Repository

    Manchon, Aurelien

    2014-04-13

    The standard description of spin-orbit torques neglects geometric phase effects. But recent experiments suggest that the Berry curvature gives rise to an anti-damping torque in systems with broken inversion symmetry.

  5. Inactivation of Enteric Viruses in Minimally Processed Berries and Herbs▿

    OpenAIRE

    Butot, S.; Putallaz, T.; Amoroso, R; Sánchez, G.

    2009-01-01

    Several hepatitis A virus (HAV) and human norovirus (HuNoV) outbreaks due to consumption of contaminated berries and vegetables have recently been reported. Model experiments were performed to determine the effectiveness of freeze-drying, freeze-drying combined with heating, and steam blanching for inactivation of enteric viruses that might be present on the surface of berries and herbs. Inactivation of HAV and inactivation of feline calicivirus, a surrogate for HuNoV, were assessed by viral ...

  6. VARIETY OF MICROORGANISMS GROUPS LIVING ON BERRIES OF GRAPES

    OpenAIRE

    Ageeva N. M.; Suprun I. I.; Prakh A. V.

    2015-01-01

    The wide variety of microorganisms has been identified in many wine-making countries on the berries of grapes. These are yeasts of different families, forms and kinds, bacterium, mold fungi. In the article, we present the results of investigating species composition of microflora of berries of white and red types of grape, which grows in different economies of the Krasnodar region and the republic of Abkhaziya. The sowings onto the elective media were conducted for the development of entire s...

  7. Inspection of the grapevine BURP superfamily highlights an expansion of RD22 genes with distinctive expression features in berry development and ABA-mediated stress responses.

    Directory of Open Access Journals (Sweden)

    José Tomás Matus

    Full Text Available The RESPONSIVE TO DEHYDRATION 22 (RD22 gene is a molecular link between abscisic acid (ABA signalling and abiotic stress responses. Its expression has been used as a reliable ABA early response marker. In Arabidopsis, the single copy RD22 gene possesses a BURP domain also located at the C-terminus of USP embryonic proteins and the beta subunit of polygalacturonases. In grapevine, a RD22 gene has been identified but putative paralogs are also found in the grape genome, possibly forming a large RD22 family in this species. In this work, we searched for annotations containing BURP domains in the Vitis vinifera genome. Nineteen proteins were defined by a comparative analysis between the two genome predictions and RNA-Seq data. These sequences were compared to other plant BURPs identified in previous genome surveys allowing us to reconceive group classifications based on phylogenetic relationships and protein motif occurrence. We observed a lineage-specific evolution of the RD22 family, with the biggest expansion in grapevine and poplar. In contrast, rice, sorghum and maize presented highly expanded monocot-specific groups. The Vitis RD22 group may have expanded from segmental duplications as most of its members are confined to a region in chromosome 4. The inspection of transcriptomic data revealed variable expression of BURP genes in vegetative and reproductive organs. Many genes were induced in specific tissues or by abiotic and biotic stresses. Three RD22 genes were further studied showing that they responded oppositely to ABA and to stress conditions. Our results show that the inclusion of RNA-Seq data is essential while describing gene families and improving gene annotations. Robust phylogenetic analyses including all BURP members from other sequenced species helped us redefine previous relationships that were erroneously established. This work provides additional evidence for RD22 genes serving as marker genes for different organs or stresses

  8. Inspection of the grapevine BURP superfamily highlights an expansion of RD22 genes with distinctive expression features in berry development and ABA-mediated stress responses.

    Science.gov (United States)

    Matus, José Tomás; Aquea, Felipe; Espinoza, Carmen; Vega, Andrea; Cavallini, Erika; Dal Santo, Silvia; Cañón, Paola; Rodríguez-Hoces de la Guardia, Amparo; Serrano, Jennifer; Tornielli, Giovanni Battista; Arce-Johnson, Patricio

    2014-01-01

    The RESPONSIVE TO DEHYDRATION 22 (RD22) gene is a molecular link between abscisic acid (ABA) signalling and abiotic stress responses. Its expression has been used as a reliable ABA early response marker. In Arabidopsis, the single copy RD22 gene possesses a BURP domain also located at the C-terminus of USP embryonic proteins and the beta subunit of polygalacturonases. In grapevine, a RD22 gene has been identified but putative paralogs are also found in the grape genome, possibly forming a large RD22 family in this species. In this work, we searched for annotations containing BURP domains in the Vitis vinifera genome. Nineteen proteins were defined by a comparative analysis between the two genome predictions and RNA-Seq data. These sequences were compared to other plant BURPs identified in previous genome surveys allowing us to reconceive group classifications based on phylogenetic relationships and protein motif occurrence. We observed a lineage-specific evolution of the RD22 family, with the biggest expansion in grapevine and poplar. In contrast, rice, sorghum and maize presented highly expanded monocot-specific groups. The Vitis RD22 group may have expanded from segmental duplications as most of its members are confined to a region in chromosome 4. The inspection of transcriptomic data revealed variable expression of BURP genes in vegetative and reproductive organs. Many genes were induced in specific tissues or by abiotic and biotic stresses. Three RD22 genes were further studied showing that they responded oppositely to ABA and to stress conditions. Our results show that the inclusion of RNA-Seq data is essential while describing gene families and improving gene annotations. Robust phylogenetic analyses including all BURP members from other sequenced species helped us redefine previous relationships that were erroneously established. This work provides additional evidence for RD22 genes serving as marker genes for different organs or stresses in grapevine. PMID

  9. Methods for the Evaluation of Polyphenolic Content in “Uva Di Troia Canosina” Grape and Seeds at the Different Maceration Stages

    OpenAIRE

    Daria Catalano; Sergio Fontana; Gabriella Roda; Lucia Dell'Acqua; Flavia La Forgia; Giuseppe Mustich; Giovanni Sorrenti; Serafino Suriano; Giacomo Luca Visconti; Veniero Gambaro

    2013-01-01

    Seeds and skins derived from the small berries of “uva di Troia canosina” grape, a Vitis vinifera variety autochthonous of Apulia region (South Italy), collected at four different stages (“Tesi” 1–4) of the fermentation process were extracted by means of a maceration. The extracts were purified and analyzed, in order to study the influence of fermentation over grape seed and skin polyphenolic content. Seed extraction was performed by a multistep maceration with two solvents: ethanol and aceto...

  10. Ethanol Vapours to Complement or Replace Sulfur Dioxide Fumigation of Table Grapes

    OpenAIRE

    Chervin, Christian; El-kereamy, Ashraf; Rache, P.; Tournaire, A.; Roger, B.; Westercamp, Pascale; Goubran, F.; Salib, S.; Kreidl, S.; Holmes, R

    2003-01-01

    Recent studies have shown that dipping table grapes in ethanol solutions at harvest improved storage of the fruit. We report here the first results obtained by treating "Chasselas" table grapes (Vitis vinifera) with ethanol vapours over the storage period. We tested the effect of ethanol at 0, 4 and 8 g/kg fruit during cold storage for 2, 4 and 6 weeks. We measured berry shatter, stem browning, Botrytis rot incidence and sensory appreciation by tasting panels. Ethanol vapours r...

  11. Yield and quality responses of Aragonez grapevines under deficit irrigation and different soil management practices in a Mediterranean climate

    OpenAIRE

    Tomaz, Alexandra; Martinez, José Miguel Coleto; Pacheco, Carlos Arruda

    2015-01-01

    In Mediterranean-type climates, increased irrigation efficiency is a key goal for viticulture, as it is for fruit production in general. The objective of the present study was to determine the responses of yield, berry composition, and wine quality to various degrees of irrigation supply and different soil management practices in a vineyard. Data were collected during two years from ‘Aragonez’ grapevines (Vitis vinifera L. syn. ‘Tempranillo’). The experimental site was located in a p...

  12. Transcript and metabolite analysis in Trincadeira cultivar reveals novel information regarding the dynamics of grape ripening

    OpenAIRE

    Martinez- Zapater José M; Grimplet Jerome; Choi Young H; Maltese Federica; Sousa Lisete; Ali Kashif; Silva Marta S; Agudelo-Romero Patricia; Fortes Ana M; Verpoorte Robert; Pais Maria S

    2011-01-01

    Abstract Background Grapes (Vitis vinifera L.) are economically the most important fruit crop worldwide. However, the complexity of molecular and biochemical events that lead to the onset of ripening of nonclimacteric fruits is not fully understood which is further complicated in grapes due to seasonal and cultivar specific variation. The Portuguese wine variety Trincadeira gives rise to high quality wines but presents extremely irregular berry ripening among seasons probably due to high susc...

  13. ABA and GA3 increase carbon allocation in different organs of grapevine plants by inducing accumulation of non-structural carbohydrates in leaves, enhancement of phloem area and expression of sugar transporters.

    Science.gov (United States)

    Murcia, Germán; Pontin, Mariela; Reinoso, Herminda; Baraldi, Rita; Bertazza, Gianpaolo; Gómez-Talquenca, Sebastián; Bottini, Rubén; Piccoli, Patricia N

    2016-03-01

    Grape quality for winemaking depends on sugar accumulation and metabolism in berries. Abscisic acid (ABA) and gibberellins (GAs) have been reported to control sugar allocation in economically important crops, although the mechanisms involved are still unknown. The present study tested if ABA and gibberellin A3 (GA3 ) enhance carbon allocation in fruits of grapevines by modifying phloem loading, phloem area and expression of sugar transporters in leaves and berries. Pot-grown Vitis vinifera cv. Malbec plants were sprayed with ABA and GA3 solutions. The amount of soluble sugars in leaves and berries related to photosynthesis were examined at three points of berry growth: pre-veraison, full veraison and post-veraison. Starch levels and amylase activity in leaves, gene expression of sugar transporters in leaves and berries and phloem anatomy were examined at full veraison. Accumulation of glucose and fructose in berries was hastened in ABA-treated plants at the stage of full veraison, which was correlated with enhancement of Vitis vinifera HEXOSE TRANSPORTER 2 (VvHT2) and Vitis vinifera HEXOSE TRANSPORTER 6 (VvHT6) gene expression, increases of phloem area and sucrose content in leaves. On the other hand, GA3 increased the quantity of photoassimilates delivered to the stem thus increasing xylem growth. In conclusion, stimulation of sugar transport by ABA and GA3 to berries and stems, respectively, was due to build-up of non-structural carbohydrates in leaves, modifications in phloem tissue and modulation in gene expression of sugar transporters. PMID:26411544

  14. Resistance of Some Vitis Rootstocks to Xiphinema index.

    Science.gov (United States)

    Harris, A R

    1983-07-01

    Thirty-eight grapevine (Vitis spp.) rootstocks were screened in pots for resistance to the dagger nematode, Xiphinema index, from 1979 to 1981. Resistance ratings were based on visible root symptoms and on changes in the nematode populations over 16 months. Nineteen of the 23 Californian hybrid rootstocks tested were resistant, as were 'Harmony',' 'Freedom,' 'Schwarzmann,' and '3309.' Two hybrids of V. rufotomentosa, '171-52' and '176-9,' were possibly immune to X. index. The rootstocks 'ARG 1,' ' 110 R,' '1202,' and '1616,' which are used commercially for phylloxera resistance were susceptible. PMID:19295825

  15. Effects of leaf removal and cluster thinning on yield and quality of grapes (vitis vinifera l., riesling × silvaner) in corrales, boyaca (colombia)

    OpenAIRE

    Balaguera López, Helber Enrique; Almanza Merchán, Pedro José; Fischer, Gerhard

    2012-01-01

    The vineyards that are located in the Colombian cool tropicalzone of Corrales (Boyaca department) offer grapes for the production of quality wines; to improve the crop we must know the adequate balance between the quantity of clusters and the leaf area of the plants. In order to determine the effect of leaf removal and cluster thinning on yield and quality of the clonal selection Riesling × Silvaner wine grape, it was used a completely randomized bifactorial design of 2x3. The first factor wa...

  16. Production, Characterization of Tannase from Penicillium montanense URM 6286 under SSF Using Agroindustrial Wastes, and Application in the Clarification of Grape Juice (Vitis vinifera L.

    Directory of Open Access Journals (Sweden)

    Juliana Silva de Lima

    2014-01-01

    Full Text Available Tannase is an enzyme that hydrolyzes esters and lateral bonds of tannins, such as tannic acid, releasing glucose and gallic acid and stands out in the clarification of wines and juices. Fungi of the genera Aspergillus and Penicillium are excellent producers of this enzyme. The search for fungi that produce high levels of tannase as well as new substrates for the enzyme production by the SSF is required. The objectives of this study were to evaluate the production of tannase by Aspergillus and Penicillium species through SSF using leaves and agroindustrial waste barbados cherry and mangaba fruit as substrate, select the best producer, optimize production, characterize the crude enzyme extract, and apply it the clarification of grape juice. Selecting the best producer was performed by planning Placket-Burman and RSM. P. montanense showed highest activity with 41.64 U/mL after 72 h of fermentation residue using barbados cherry, with 3.5% tannic acid and 70% moisture. The enzyme showed the highest activity at pH 9.0 and 50°C. The tannase of P. montanense was stable over a wide pH range and temperature and, when applied to grape juice, showed higher efficiency by reducing 46% of the tannin content after incubation 120 m.

  17. The role of soil biogeochemistry in wine taste: Soil factors influencing grape elemental composition, photosynthetic biomarkers and Cu/Zn isotopic signature of Vitis vinifera

    Science.gov (United States)

    Blotevogel, Simon; Oliva, Priscia; Darrozes, José; Viers, Jérôme; Audry, Stéphane; Courjault-Radé, Pierre; Orgogozo, Laurent; Le Guedard, Marina; Schreck, Eva

    2015-04-01

    Understanding the influence of soil composition in wine taste is of great economic and environmental interest in France and around the world. Nevertheless the impact of soil composition on wine taste is still controversially discussed. Since inorganic soil components do not have a proper taste and do not enter the plant anyway, their influence needs to be induced by nutrient absorption and its impact on plant functioning and grape composition. Indeed recent development of geological tracers of origin proof the existence of soil chemical and isotopic signatures in wine. However, type and scale of the impact of soil composition on wine taste are not well understood yet, and little experimental evidence exists due to the complexity of mechanisms involved. Thus, to provide evidence for the impact of soil composition on grape composition and potentially wine taste, we studied soil and plant material from two relevant vineyards (Soave, Italia). On those two directly adjacent vineyards, two different wines are produced with the same plant material and cultivation techniques. The vineyards only differ by their underlying bedrock - limestone versus basaltic rock - and thus present suitable conditions for investigating the impact of soil composition on grapes and wine. Pedological and mineralogical parameters were analyzed for the two vineyards whereas chemical extractions (citrate, CaCl2) were performed to determine nutrient bioavailability in both soils. Elemental compositions were determined by ICP-MS analyses in different compartments (soils, vine leaves and grapes). Isotopic fractionation of Cu and Zn was investigated in various samples as source tracers and in order to better understand fractionation mechanisms involved. Finally, plant health was studied using the Omega-3 biomarker which determines the fatty acid composition in vine leaves, directly involved in photosynthetic processes. Results show that the vineyards are characterized by two different soil types due to the geological difference. These soils differ in elemental compositions and bioavailability of mineral nutrients, preconditions for a potential influence on plants and wine. Elemental ratios of soils are partly transmitted to leaves and grapes of correspondent plants, including nutrients such as Ca. Plant photosynthetic functioning is significantly better on the limestone vineyard due to lower Cu bioavailability: Omega-3 values are negatively linked to Cu bioavailability in corresponding soils. These observations suggest a difference in organic molecule synthesis depending on the vineyard soil, which might include components relevant for taste and fermentation. Cu and Zn isotopic ratios do not differ between both soils. The main fractionation of Cu and Zn isotopes occurs at the soil-plant interface making those isotopes suitable tracers for uptake mechanisms. As a result Zn isotope ratios reveal a strong recycling of Zn in the soil-plant continuum. Our results show a significant influence of soil composition on grape composition, plant biochemistry and potentially wine taste. Determination of organic and sensorial composition of grapes and wine is ongoing and will be discussed in further communications.

  18. Diagnóstico da área cultivada com uva fina de mesa (Vitis vinifera L sob cobertura plástica e do manejo de pragas

    Directory of Open Access Journals (Sweden)

    Rodrigo Formolo

    2011-03-01

    Full Text Available Neste trabalho, foi realizado o censo das áreas cultivadas com uvas finas de mesa sob cultivo protegido e a identificação das principais espécies de pragas e estratégias de controle empregadas pelos produtores, no município de Caxias do Sul-RS. Na safra de 2007/2008, foram identificados os produtores envolvidos com a atividade no município e através de entrevista presencial e semiestruturada ao estabelecimento produtivo, registrou-se a área cultivada e variedades. Para produtores com cultivo de áreas superiores a 2.000m² da cultivar Itália, com dois anos ou mais de produção, foi aplicado outro questionário na safra de 2008/2009 com o objetivo de levantar as informações referentes: a espécies de insetos e ácaros-praga que danificam as uvas finas de mesa na propriedade, segundo o viticultor; b conhecer a realidade do manejo de insetos e ácaros-praga na cultura; c verificar os parâmetros que o produtor utiliza para a aplicação de inseticidas; d conhecer os produtos aplicados, e e identificar o tipo de assistência técnica recebida pelo viticultor. Foram identificados 43 produtores de uvas finas de mesa sob cultivo protegido com área total cultivada de 30,36 ha, sendo 70,31% desta área da cultivar Itália. As pragas mais importantes mencionadas pelos produtores foram tripes - Frankliniella rodeos Moulton e a mosca-das-frutas-sul-americana Anastrepha fraterculus (Wied. O manejo realizado para controle destas pragas é através da aplicação de inseticidas com os ingredientes ativos acefato e fentiona, respectivamente, com base em calendário. Os principais problemas enfrentados para implementar estratégias de manejo de pragas no cultivo são a falta de assistência técnica, a ausência de metodologias confiáveis para o monitoramento e o reduzido número de inseticidas autorizados para a cultura.

  19. Sequence-based Analysis of the Vitis vinifera L. cv Cabernet Sauvignon Grape Must Mycobiome in Three South African Vineyards Employing Distinct Agronomic Systems

    Science.gov (United States)

    Setati, Mathabatha E.; Jacobson, Daniel; Bauer, Florian F.

    2015-01-01

    Recent microbiomic research of agricultural habitats has highlighted tremendous microbial biodiversity associated with such ecosystems. Data generated in vineyards have furthermore highlighted significant regional differences in vineyard biodiversity, hinting at the possibility that such differences might be responsible for regional differences in wine style and character, a hypothesis referred to as “microbial terroir.” The current study further contributes to this body of work by comparing the mycobiome associated with South African (SA) Cabernet Sauvignon grapes in three neighboring vineyards that employ different agronomic approaches, and comparing the outcome with similar data sets from Californian vineyards. The aim of this study was to fully characterize the mycobiomes associated with the grapes from these vineyards. The data revealed approximately 10 times more fungal diversity than what is typically retrieved from culture-based studies. The Biodynamic vineyard was found to harbor a more diverse fungal community (H = 2.6) than the conventional (H = 2.1) and integrated (H = 1.8) vineyards. The data show that ascomycota are the most abundant phylum in the three vineyards, with Aureobasidium pullulans and its close relative Kabatiella microsticta being the most dominant fungi. This is the first report to reveal a high incidence of K. microsticta in the grape/wine ecosystem. Different common wine yeast species, such as Metschnikowia pulcherrima and Starmerella bacillaris dominated the mycobiome in the three vineyards. The data show that the filamentous fungi are the most abundant community in grape must although they are not regarded as relevant during wine fermentation. Comparison of metagenomic datasets from the three SA vineyards and previously published data from Californian vineyards revealed only 25% of the fungi in the SA dataset was also present in the Californian dataset, with greater variation evident amongst ubiquitous epiphytic fungi. PMID:26648930

  20. In vitro and in vivo evaluation of the antioxidant and prooxidant activity of phenolic compounds obtained from grape (Vitis vinifera) pomace.

    Science.gov (United States)

    Cotoras, Milena; Vivanco, Herman; Melo, Ricardo; Aguirre, María; Silva, Evelyn; Mendoza, Leonora

    2014-01-01

    The antioxidant and/or prooxidant ability of extracts obtained from wine waste were analyzed using in vitro and in vivo assays. Cyclic voltammetry was used as the in vitro assay to determine the antioxidant and/or prooxidant properties and, the in vivo effect on mycelial growth of the fungus Botrytis cinerea was evaluated. In addition, the prooxidant activity was evaluated by intracellular oxidation of compound 2,7-dichlorodihydrofluorescein diacetate (DCFH-DA) in B. cinerea. The extracts used in this study were obtained from grape pomace of Cabernet Sauvignon, Carménère and Syrah varieties from the Misiones de Rengo Vineyard by simple extraction, using methanol/HCl 1% (v/v), ethanol 70% (v/v), or Soxhlet extraction. According to the results obtained, gallic acid was the most represented phenolic compound independent of grape variety and extraction method. In addition, vanillic acid; protocatechuic acid, syringic acid, quercetin and kaempferol were found in the extracts. From this study it was possible concluded that, depending of the method of extraction of the grape residues and the grape variety (Cabernet Sauvignon, Carménère and Syrah), the extracts showed antioxidant and/or prooxidant activity. However, no correlation can be established between the anodic oxidation potentials of the extracts and their effect on the fungus B. cinerea. PMID:25521116

  1. In Vitro and in Vivo Evaluation of the Antioxidant and Prooxidant Activity of Phenolic Compounds Obtained from Grape (Vitis vinifera Pomace

    Directory of Open Access Journals (Sweden)

    Milena Cotoras

    2014-12-01

    Full Text Available The antioxidant and/or prooxidant ability of extracts obtained from wine waste were analyzed using in vitro and in vivo assays. Cyclic voltammetry was used as the in vitro assay to determine the antioxidant and/or prooxidant properties and, the in vivo effect on mycelial growth of the fungus Botrytis cinerea was evaluated. In addition, the prooxidant activity was evaluated by intracellular oxidation of compound 2,7-dichlorodihydrofluorescein diacetate (DCFH-DA in B. cinerea. The extracts used in this study were obtained from grape pomace of Cabernet Sauvignon, Carménère and Syrah varieties from the Misiones de Rengo Vineyard by simple extraction, using methanol/HCl 1% (v/v, ethanol 70% (v/v, or Soxhlet extraction. According to the results obtained, gallic acid was the most represented phenolic compound independent of grape variety and extraction method. In addition, vanillic acid; protocatechuic acid, syringic acid, quercetin and kaempferol were found in the extracts. From this study it was possible concluded that, depending of the method of extraction of the grape residues and the grape variety (Cabernet Sauvignon, Carménère and Syrah, the extracts showed antioxidant and/or prooxidant activity. However, no correlation can be established between the anodic oxidation potentials of the extracts and their effect on the fungus B. cinerea.

  2. In Vitro and in Vivo Evaluation of the Antioxidant and Prooxidant Activity of Phenolic Compounds Obtained from Grape (Vitis vinifera) Pomace

    OpenAIRE

    Milena Cotoras; Herman Vivanco; Ricardo Melo; María Aguirre; Evelyn Silva; Leonora Mendoza

    2014-01-01

    The antioxidant and/or prooxidant ability of extracts obtained from wine waste were analyzed using in vitro and in vivo assays. Cyclic voltammetry was used as the in vitro assay to determine the antioxidant and/or prooxidant properties and, the in vivo effect on mycelial growth of the fungus Botrytis cinerea was evaluated. In addition, the prooxidant activity was evaluated by intracellular oxidation of compound 2,7-dichlorodihydrofluorescein diacetate (DCFH-DA) in B. cinerea. The extracts ...

  3. Efectos de las diferentes estrategias de riego en la composición del vino y su perfil sensorial (Vitis vinifera L., cv. Cabernet sauvignon)

    OpenAIRE

    Fernández Gómez, Olga; Baeza Trujillo, Pilar; Junquera González, Pedro; Lissarrague Garcia-Gutierrez, Jose Ramon

    2013-01-01

    La preocupación por las consecuencias que puede ocasionar a la viticultura el cambio climático, se ven reflejadas en muchos de los estudios que existen en los últimos años. En las actuales zonas de producción, estos cambios podrían tener importantes consecuencias, tanto en la calidad de la uva como en su potencial productivo. El objetivo marcado en este ensayo, consistió en evaluar como el déficit hídrico en climas secos afectó a la calidad y composición de sus vinos. El diseño experimental s...

  4. Minidisk against ring infiltrometer measurements to assess the saturated hydraulic conductivity in Mediterranean vineyards (Vitis vinifera L.) under Tillage and No-Tillage managements

    Science.gov (United States)

    Burguet, Maria; Di Prima, Simone; Prosdocimi, Massimo; Taguas, Encarnación V.; Cerdà, Artemi

    2016-04-01

    Vineyard is one of the main crops in the Mediterranean region and it forms, along with wheat and olive, what it is known as the 'Mediterranean triad'. According to the Food and Agriculture Organization of the United Nations (FAO, 2010), the European Union has 4.5 million hectares of land occupied by vineyards. Out of all, the Mediterranean region has the largest total area of vineyards. France, Italy and Spain together are responsible for 48% of global wine production. In Spain, the total surface occupied by vineyards is 1.048.104 ha (Ministry of Agriculture, Food and Environment, 2009), which is translated in a 13% of world total (Wine Institute, 2014). In terms of environmental factors, vineyards are a source of sediments and water due to the tillage and the soil compaction, the lack of vegetation cover and the soil organic matter depletion (Novara et al., 2011; Lieskovsky' et al., 2014; Rodrigo Comino et al., 2015). The infiltration capacity of soils is a key component of the hydrological cycle that can control the non-sustainable rates of runoff and erosion (Cerdà, 1997,1999). In this way research focused on the soil hydrological properties will bring knowledge on how to control the high erosion rates (Cammeraat et al., 2010). Saturated hydraulic conductivity, ks, is the most determining physical parameter in terms of quantifying the components of the global water balance as it interferes in all those processes which are related with water and solute movement and transport through the soil. ks values are required for an adequate modelling of the infiltration and runoff generation processes. However, it is a variable with high variability when it comes to agricultural soils due to different soil managements and the fact that the soil is not a continuous media (Polo et al., 2003). For instance, Leonard and Andrieux (1998) reported in a study done in untilled vineyards in France high differences in infiltration rates through the use of rainfall simulations, which is also found in forest and degraded soils. The aim of our work was to test two different ks measuring methodologies -the ring infiltrometer and the mini-disc infiltrometer (Decagon Devices, Pullman, WA.2005), in order to check how the differences in measuring affects to the ks calculations. This would give an idea of which methodology would be more appropriate to use regarding the time-consume, effort and costs of the measuring material. The measurements were carried out during November 2015 at El Celler del Roure, a 25-years old vineyard located in Les Alcusses (Moixent, Spain). The soil managements selected for the study were Conventional Tillage (CT) and No Tillage (NT). A total of 18 infiltration measurements were performed (9 for CT and 9 for NT). In order to homogenize the measuring times, the measuring time for each methodology lasted 1 hour. ks values were calculated derived from Green and Ampt's (1911) and Horton's (1941) equations in order to discuss the impact of the methodologies applied. Statistically significant differences (p=.000) were found when applying both methodologies between CT and NT at both time and measures. However, there is still a need to understand how both methodologies influence in the variation of the parameters used for the Green and Ampt's (1911) and Horton's (1941) models. Acknowledgements: The research leading to these results has received funding from the European Union Seventh Framework Programme (FP7/2007-2013) under grant agreement n° 603498 (RECARE project). References: Cammeraat, E., Cerdà, A. and Imeson, A.C. 2010. Ecohydrological adaptation of soils following land abandonment in a semiarid environment. Ecohydrology, 3: 421-430. doi:10.1002/eco.161 Cerdà, A. 1997. Seasonal changes of the infiltration rates in a mediterranean scrubland on limestone. Journal of Hydrology, 198: 209-225. doi:10.1016/S0022-1694(96)03295-7 Cerdà, A. 1999. Seasonal and spatial variations in infiltration rates in badland surfaces under Mediterranean climatic conditions. Water Resources Research, 35 (1): 319-328. doi: 10.1029/98WR01659 Decagon Devices, Inc. 2005. Minidisk Infiltrometer, User's Manual. Food and Agriculture Organization of the United Nations. 2010. Green, W.H. and G. Ampt. 1911. Studies of soil physics, part I - the flow of air and water through soils. J. Ag. Sci. 4:1-24. Horton, R. 1941. An approach toward a physical interpretation of infiltration-capacity. Soil science society of America journal. Leonard, J., Andrieux, P. 1998. Infiltration characteristics of soils in Mediterranean vineyards in Southern France. Catena, 32: 209-223. doi:10.1016/S0341-8162(98)00049-6 Lieskovský, J., Kenderessy, P. 2014. Modelling the effect of vegetation cover and different tillage practices on soil erosion in vineyards: A case study in vráble (Slovakia) using WATEM/SEDEM. Land Degradation and Development, 25 (3): 288-296. doi: 10.1002/ldr.2162 Ministry of Agriculture, Food and Environment. 2015. http://www.magrama.gob.es/es/ Novara, A., Gristina, L., Saladino, S.S., Santoro, A., Cerdà, A. 2011. Soil erosion assessment on tillage and alternative soil managements in a Sicilian vineyard. Soil & Tillage Research, 117: 140-147. doi:10.1016/j.still.2011.09.007 Polo, M.J., Lafuente, P., Giráldez, J.V. 2003. Variabilidad espacial de la conductividad hidráulica saturada en suelos de olivar y su influencia en el balance hidrológico global. Estudios de la Zona No Saturada del Suelo, Vol. VI, 209. Rodrigo Comino, J., Brings, C., Lassu, T., Iserloh, T., Senciales, J. M., Martínez Murillo, J.F., Ruiz Sinoga, J.D., Seeger, M., Ries, J.B. 2015. Rainfall and human activity impacts on soil losses and rill erosion in vineyards (Ruwer Valley, Germany). Solid Earth 6: 823-837. doi:10.5194/se-6-823-2015 Wine Institute. 2014. http://www.wineinstitute.org/

  5. Role of grape seed proanthocyanidins extract (GSPE) (VITIS VINIFERA) in the modulation of radiation-induced structural and oxidative damage in spleen and lung tissues of rats

    International Nuclear Information System (INIS)

    The present study was designed to determine the possible protective effect of grape seed proanthocyanidins extract (GSPE) against oxidative organ damage induced by gamma irradiation. Rats were treated daily, by gavage, with 100 mg/kg GSPE for 8 days before whole body exposure at 7 Gy and for 6 consecutive days after gamma irradiation. Animals were sacrificed 7 days after gamma irradiation. Histological examination of sections of the spleen and lung tissues through light microscope showed that exposure to ionizing irradiation has provoked severe architectural damage in both tissues as necrotic lesions and atrophied follicles in spleen and inflammation and disruption of bronchioles, destruction of respiratory portion in lung and dilating, widening of blood vessels in both spleen and lung. Histological damage was associated with significant alteration in the antioxidant status of both tissues, which was reflected by a significant increase in the level of lipid peroxides measured as thiobarbituric acid reactive substances (TBARS) and a significant decrease in superoxide dismutase (SOD) and catalase (CAT) activities. GSPE treated-irradiated rats showed significant regeneration in lymphatic nodules and significant amelioration in inflammation, regeneration of bronchioles shape, alveolar sacs and improved pattern of blood vessels. Tissue regeneration was associated with significant improvement in the activities of the antioxidant enzymes SOD and CAT and significant reduction in lipid peroxidation by products. It could be concluded that GSPE might be capable to attenuate radiation-induced oxidative and structural organ injury

  6. Expression of ABA synthesis and metabolism genes under different irrigation strategies and atmospheric VPDs is associated with stomatal conductance in grapevine (Vitis vinifera L. cv Cabernet Sauvignon)

    OpenAIRE

    Speirs, Jim; Binney, Allan; Collins, Marisa; Edwards, Everard; Loveys, Brian

    2013-01-01

    The influence of different levels of irrigation and of variation in atmospheric vapour pressure deficit (VPD) on the synthesis, metabolism, and transport of abscisic acid (ABA) and the effects on stomatal conductance were examined in field-grown Cabernet Sauvignon grapevines. Xylem sap, leaf tissue, and root tissue were collected at regular intervals during two seasons in conjunction with measurements of leaf water potential (Ψleaf) and stomatal conductance (gs). The different irrigation leve...

  7. ASSESSMEN OF THE REDUCING EFFECTS IN MIXTURES OF GRAPE (VITIS VINIFERA SEED EXTRACTS WITH α-TOCOPHEROL USING RESPONSE SURFACE METHODOLOGY

    Directory of Open Access Journals (Sweden)

    Evangelia Karvela

    2012-10-01

    Full Text Available The efficiency of grape seed extracts to express reducing power was assessed using two different approaches and the TPTZ as the chromophore probe. Further to that, the mixture effects when the extracts were combined with α-tocopherol (α-Tcp were also evaluated. The approaches included a simple linear regression analysis between the response (reducing power and concentration, but also a response surface methodology, which permitted the monitoring of the response upon simultaneous variation of both the concentration of the total polyphenols (TP of α-Tcp. The outcome of the study indicated that the deployment of linear regression poses important constrains with regard to concentration ranges, whereas the response surface methodology might be a valuable statistical tool for similar assessments and credible modeling of binary mixtures of antioxidants. In all combinations tested it was found that an antagonism is manifested, presumably as a result of α-Tcp regeneration by the extract polyphenols, at the expense of the latter.

  8. ASSESSMEN OF THE REDUCING EFFECTS IN MIXTURES OF GRAPE (VITIS VINIFERA) SEED EXTRACTS WITH α-TOCOPHEROL USING RESPONSE SURFACE METHODOLOGY

    OpenAIRE

    Evangelia Karvela; Dimitris P. Makris

    2012-01-01

    The efficiency of grape seed extracts to express reducing power was assessed using two different approaches and the TPTZ as the chromophore probe. Further to that, the mixture effects when the extracts were combined with α-tocopherol (α-Tcp) were also evaluated. The approaches included a simple linear regression analysis between the response (reducing power) and concentration, but also a response surface methodology, which permitted the monitoring of the response upon simultaneous variation o...

  9. Implementation of response surface methodology to assess the antiradical behaviour in mixtures of ascorbic acid and α-tocopherol with grape (Vitis vinifera) stem extracts.

    Science.gov (United States)

    Karvela, Evangelia; Makris, Dimitris P; Karathanos, Vaios T

    2012-05-01

    The efficiency of grape stem extracts to express antiradical activity was assessed using two different approaches and DPPH as the radical probe. In addition, the mixture effects when the extracts were combined with ascorbic acid (AA) and α-tocopherol (α-Tcp) were also evaluated. The approaches included a simple linear regression analysis between the response (antiradical activity) and concentration, but also a response surface methodology, which permitted the monitoring of the response upon simultaneous variation of both the concentration of the total polyphenols of the extracts and either of the antioxidants (AA and α-Tcp). The deployment of linear regression poses important constraints with regard to concentration ranges, whereas response surface methodology might be a valuable statistical tool for similar assessments and credible modelling of binary mixtures of antioxidants. In all combinations tested it was found that an antagonism was manifested, presumably as a result of AA and α-Tcp regeneration by the extract polyphenols, at the expense of the latter. PMID:26434301

  10. Metabolic consequences of infection of grapevine (Vitis vinifera L. cv. ‘Modra frankinja’ with flavescence dorée phytoplasma

    Directory of Open Access Journals (Sweden)

    Nina ePrezelj

    2016-05-01

    Full Text Available Flavescence dorée, caused by the quarantine phytoplasma FDp, represents the most devastating of the grapevine yellows diseases in Europe. In an integrated study we have explored the FDp–grapevine interaction in infected grapevines of cv. ‘Modra frankinja’ under natural conditions in the vineyard. In FDp-infected leaf vein-enriched tissues, the seasonal transcriptional profiles of 14 genes selected from various metabolic pathways showed an FDp-specific plant response compared to other grapevine yellows and uncovered a new association of the SWEET17a vacuolar transporter of fructose with pathogens. Non-targeted metabolome analysis from leaf vein-enriched tissues identified 22 significantly changed compounds with increased levels during infection. Several metabolites corroborated the gene expression study. Detailed investigation of the dynamics of carbohydrate metabolism revealed significant accumulation of sucrose and starch in the mesophyll of FDp-infected leaves, as well as significant up-regulation of genes involved in their biosynthesis. In addition, infected leaves had high activities of ADP-glucose pyrophosphorylase and, more significantly, sucrose synthase. The data support the conclusion that FDp infection inhibits phloem transport, resulting in accumulation of carbohydrates and secondary metabolites that provoke a source-sink transition and defence response status.

  11. 葡萄EST-SNP位点的信息与特征%Information and characteristics of EST-SNP loci in grape (Vitis vinifera L.)

    Institute of Scientific and Technical Information of China (English)

    李猛; 郭大龙; 刘崇怀; 张国海; 侯小改

    2012-01-01

    Aiming to mine candidate single nucleotide polymorphism (SNP) loci by aligning homologous expressed sequence tags (EST) using bioinformatics software, 42 493 EST sequences were retrieved from different tissues of nine different grape genotypes in NCBI dbEST database and assembled into 6 126 contigs by CAP3 software, then candidate SNP loci of the contigs were screened by QualitySNP software. Meanwhile, in order to improve the reliability of mined candidate SNP and reduce false positive in small contig sires and false negative in large contig sizes, the minor allele frequency was set at least 30% in a candidate SNP locus, and the SNP flanking sequences were perfect matching at least in 5 bp. The results showed that only 1 195 contigs contained candidate SNP loci. A total of 5 032 candidate SNPs were identified, and the amount of trans versions, transitions and one base indel were 1 800, 2 896 and 336 respectively, and the average frequency of SNP occurrence was at 4. 2 SNP.contig-1. CAPS (cleaved amplified polymorphic sequences) molecular markers and re-sequencing methods were used to validate the selected candidate SNP loci. The validation results indicated that they were corresponded with the manual filtration principle, and those from small contig sizes showed better validation results with highest reliability.%为了从不同基因型葡萄组织的表达序列标签(EST)中得到候选单核苷酸多态性(SNP)位点,从NCBI的dbEST数据库中下载来源于9个不同葡萄基因型的不同组织EST序列42493条,利用CAP3软件拼接得到6126个重叠群(contig),将拼接结果导入QualitySNP进行SNP筛选;同时,为提高候选SNP位点的可靠度,降低小规格contig开发SNP的假阳性率和大规格contig开发SNP的假阴性率,设置候选SNP位点的次要等位基因频率至少为30%,SNP侧翼序列保守度至少为5 bp.结果表明:仅在1195个contig中存在候选SNP位点,共5032个,其中包括1800个颠换类型,2896个转换类型,336个单碱基的插入与缺失(indel),SNP的平均出现频率为4.2 SNP·contig-1.利用CAPS(酶切扩增多态序列)分子标记和重测序方法对其中几个候选SNP位点进行验证表明,符合人工筛选原则且来自于小规格contig的候选SNP位点检测结果较好,可靠度最高.

  12. Mature seeds for in vitro sanitation of the Grapevine leafroll associated virus (GLRaV-1andGLRaV-3 from grape (Vitis vinifera L.

    Directory of Open Access Journals (Sweden)

    Rosa Peiró

    2015-06-01

    Full Text Available The conservation of old grapevine varieties is important since they are adapted to specific climate conditions and may carry genes interesting to breeders. As virus infection is common in grapevine varieties, the use of virus free materials is of great importance. In this work, we used somatic embryogenesis for the sanitation of GLRaV-1 and GLRaV-3 viruses that were found after analyzing the putative presence of the five most common, economically important grape viruses by real-time multiplex RT-PCR in the old cultivar “Grumet Negre”. Unopened and opened inflorescences, fecundated ovaries, and, also, mature seeds were used as starting explants. Explants were cultured on plates with two embryogenesis induction media (Nitsch & McCown Woody plant medium that contained the growth regulator thidiazuron and differed in their salt and vitamin compositions. One half of each kind of explant was cut prior to being cultured. After five months of culture, embryos had only developed from seeds that were cut previous to sowing. To the best of our knowledge, this is the first time that mature seeds have been used for inducing embryogenesis in grape. A total of 42% of the embryos transferred to tubes for germination regenerated into normal plantlets. The absence of both the GLRaV-1 and GLRaV-3 viruses in all regenerated plants was confirmed by real-time uniplex RT-PCR. So, this protocol can be used for sanitation and also for micropropagation.

  13. Tratamiento enzimático en la extracción de aceite de pipa de uva, Vitis vinifera, por prensado en frío

    Directory of Open Access Journals (Sweden)

    Zúñiga, M. E.

    2003-03-01

    Full Text Available The effect of enzyme incorporation is analyzed over the yield of grapeseed oil extraction by cold pressing. By this type of process the objective is to preserve grapeseed active compounds and to diminish the environmental impact in comparison to oil extraction conventional methods which use higher temperatures. The enzymatic hydrolysis takes place with a commercial enzyme previous to pressing stage. Its effectiveness is compared to a control without the biocatalyst. An oil extraction yield of 72 % d.b. is obtained with an enzymatic pre-treatment for 4 hours at 50 ºC, and 60 % of moisture, increasing in 26 % the control result. It is concluded that the incorporation of an enzymatic processing would be a feasible alternative to extract grapeseed oil under softener process conditions improving the yield of extraction in comparison to the same type of methodology without an enzyme.Se analiza el efecto de la incorporación de enzimas sobre el rendimiento de extracción de aceite por prensado en frío. Con el prensado en frío se busca preservar los compuestos activos de la pipa de uva y minimizar el impacto medioambiental en comparación con los métodos convencionales de extracción de aceite que utilizan altas temperaturas. El tratamiento enzimático se efectúa previo al prensado con una enzima comercial y su efectividad se compara con un control sin catalizador. Un rendimiento de extracción de aceite del 72 % b.s. se logra con un pre-tratamiento enzimático durante 4 horas a 50 ºC, y 60 % de humedad, superando en un 26 % al control. Se concluye que la incorporación de un tratamiento enzimático sería una alternativa factible para extraer el aceite de pipa de uva bajo condiciones suaves de proceso mejorando el rendimiento de extracción en comparación con el mismo tipo de proceso sin enzima.

  14. Effect of duration of culture of grape (Vitis vinifera L.) microcuttings on medium with zeatin riboside on shoot tip recovery after cryopreservation

    OpenAIRE

    Markovic, Zvjezdana; Chatelet, Philippe; Sylvestre, Isabelle; Karoglan-Kontić, Jasminka; Engelmann, Florent

    2012-01-01

    Cryopreservation is the only method currently available for the safe, cost-effective, long-term conservation of vegetatively propagated plant species such as grapevine. Cryopreservation protocols have been established for shoot tips sampled from grapevine in vitro plantlets (Plessis et al 1993; Wang et al 2000; Zhao et al 2001; Matsumoto and Sakai 2003). An important parameter for successful cryopreservation is the physiological state of the plant material, and buds taken at different levels ...

  15. Results of two consecutive years on mould prevention in viticulture by means of UV C application of vines (Vitis vinifera L.

    Directory of Open Access Journals (Sweden)

    Berkelmann-Löhnertz Beate

    2015-01-01

    Full Text Available In the last decade, impacts of climate change on cool climate viticulture were most obvious concerning cluster infections caused by Botrytis cinerea, the causal agent of grey mould. The control of primary and secondary fungal pathogens is economically most important since bunch rot may severely affect the annual harvest with regard to quality and quantity. Trials with UV C applications, a new approach to control bunch rot, were conducted in 2013 and 2014, representing years with intensive bunch rot epidemics. UV C irradiation was applied by a prototype at an experimental site of Hochschule Geisenheim University. At both canopy sides, leaves and cluster zones were irradiated repeatedly at a dose of ≤160 mWs/cm2 alone or in combination with chemical control. The results of our experiments indicated that irradiation with UV C, in addition to fungicide treatments at reduced number of applications, was able to significantly decrease infection with grey mould to a degree of efficiency of 82% compared to standard chemical treatment that achieved 51% efficiency in 2014. Accordingly, the new technology is suitable for reducing cluster infection with mould fungi allowing a prolonged grape ripening time, which leads to a better harvest quality and a decreased yield loss.

  16. Impact of Leaf Removal, Applied Before and After Flowering, on Anthocyanin, Tannin, and Methoxypyrazine Concentrations in 'Merlot' (Vitis vinifera L.) Grapes and Wines.

    Science.gov (United States)

    Sivilotti, Paolo; Herrera, Jose Carlos; Lisjak, Klemen; Baša Česnik, Helena; Sabbatini, Paolo; Peterlunger, Enrico; Castellarin, Simone Diego

    2016-06-01

    The development and accumulation of secondary metabolites in grapes determine wine color, taste, and aroma. This study aimed to investigate the effect of leaf removal before flowering, a practice recently introduced to reduce cluster compactness and Botrytis rot, on anthocyanin, tannin, and methoxypyrazine concentrations in 'Merlot' grapes and wines. Leaf removal before flowering was compared with leaf removal after flowering and an untreated control. No effects on tannin and anthocyanin concentrations in grapes were observed. Both treatments reduced levels of 3-isobutyl-2-methoxypyrazine (IBMP) in the grapes and the derived wines, although the after-flowering treatment did so to a greater degree in the fruit specifically. Leaf removal before flowering can be used to reduce cluster compactness, Botrytis rot, and grape and wine IBMP concentration and to improve wine color intensity but at the expense of cluster weight and vine yield. Leaf removal after flowering accomplishes essentially the same results without loss of yield. PMID:27180819

  17. Tolerancia aL NaCI de plantas andaluzas de vid silvestre (Vitis vinifera L., ssp sylvestris (sylvestris (Gmelin) Hegi)

    OpenAIRE

    Rivasplata, Paula E.

    2005-01-01

    Entre las causas principales que afectan al crecimiento de las plantas, se encuentra el estrés generado por diferentes factores de naturaleza tanto biótica como abiótica, de tal manera que la planta no puede desarrollarse debidamente y, en consecuencia, reproducirse en forma adecuada. El estrés salino es uno de las factores abióticos más extendidos, que, además, como es bien conocido, es uno de los máximos responsables de la limitación e incluso de la inhibición del desarrollo de las plantas....

  18. The Effect of Hydro-Alcoholic Extract of Grape Seed (Vitis vinifera on Sugar and Lipids in Serum of Diabetic Rats

    Directory of Open Access Journals (Sweden)

    Zohre Ganjali

    2012-06-01

    Full Text Available Nowadays, no-drug treatments (medicinal plants are novel therapeutic approaches in the treatment of diabetes. This study aimed at assessing the effect of Grape Seed extract on the blood glucose and lipid profile in diabetic rats. Thirty male adult rats were randomly selected and divided into three groups as nondiabetic control; diabetic control; diabetic rats treated with hydroalcoholic extract of grape seed. In diabetic groups, alloxan monohydrate (120 mg/kg was injected intraperitoneally to develop diabetes. Then the Test group received intraperitoneal injection of hydro-alcoholic extract of grape seed (100 mg/kg. At last, glucose, cholesterol, triglyceride, HDL, VLDL, LDL and insulin contents of the rats' serum sample were determined. Diabetic rats treated with extract showed a significant decrease in blood glucose level (p<0.05. Furthermore, compared diabetic group, in the extract-treated rats, there was a significant decrease in serum contents of total cholesterol (TC ,LDL,VLDL and TG, but a significant increase in insulin level and HDL (p<0.05. These results show that the hydroalcoholic extract of Grape Seed may be effective in the treatment of diabetes. This effect can be due to the presence of flavonoides and their antioxidant features.

  19. Evaluación de la incidencia a enfermedades fúngicas en diferentes clones del cv. Albariño (Vitis vinifera L.)

    OpenAIRE

    Boso Alonso, Susana; Santiago Blanco, José Luis; Alonso-Villaverde Iglesias, Virginia; Gago Montaña, Pilar; Martínez Rodríguez, María del Carmen; Rodríguez, E.

    2009-01-01

    Se estudió la susceptibilidad a enfermedades criptogámicas (Mildiu, oídio y Botrytis), en diferentes clones de la variedad Albariño. Los resultados obtenidos demostraron que la enfermedad que más afectó al cultivar Albariño fue el mildiu. El oídio fue la enfermedad que tuvo menor importancia. Se observó también, la existencia de variabilidad interclonal en el nivel de susceptibilidad a mildiu y Botrytis. Además de una correlación negativa entre P. viticola y B. cinerea.

  20. A review of research and literature related to the origin and identity of the cultivars Plavac mali, Zinfandel and Primitivo (Vitis vinifera L.

    Directory of Open Access Journals (Sweden)

    Nikola Mirošević

    2000-03-01

    Full Text Available The origin of Zinfandel, the important California wine cultivar, has been a question for several decades. Although Zinfandel has been linked to both Primitivo, grown in southern Italy, and to Plavac mali in Croatia, the puzzle of its origin has never been solved. Many scientists and writers have applied themselves to this question. Many hypotheses have been proposed and some erroneous ideas have been widely accepted. Much of the controversy will now be ended as a result of recent scientific research (Pejić and co-workers, 2000. Here we review the research and written documentation about Plavac mali, Zinfandel and Primitivo and their relationships and we present the results of recent research.