Chemistry of berkelium: a review
International Nuclear Information System (INIS)
Hobart, D.E.; Peterson, J.R.
1985-01-01
Element 97 was first produced in December 1949, by the bombardment of americium-241 with accelerated alpha particles. This new element was named berkelium (Bk) after Berkeley, California, the city of its discovery [Thompson, Ghiorso, and Seaborg, Phys. Rev. 77, 838 (1950); 80, 781 (1950)]. In the 36 years since the discovery of Bk, a substantial amount of knowledge concerning the physicochemical properties of this relatively scarce transplutonium element has been acquired. All of the Bk isotopes of mass numbers 240 and 242 through 251 are presently known, but only berkelium-249 (β - decay, 0.125 MeV, t/sub 1/2/ = 325 days) is available in sufficient quantities for bulk chemical studies. About 0.7 gram of this isotope has been isolated at the HFIR/TRU Complex in Oak Ridge, Tennessee in the last 18 years. Over the same time period, the scale of experimental work using berkelium-249 has increased from the tracer level to bulk studies at the microgram level to solution and solid state investigations with milligram quantities. Extended knowledge of the physicochemical behavior of berkelium is important in its own right, because Bk is the first member of the second half of the actinide series. In addition, such information should enable more accurate extrapolations to the predicted behavior of heavier elements for which experimental studies are severely limited by lack of material and/or by intense radioactivity
Citric complexes of trivalent cerium and berkelium
International Nuclear Information System (INIS)
Boulhassa, S.
1977-01-01
The extraction by thenoyltrifluoroacetone (TTA) in benzene of trivalent cerium, berkelium and californium, at the indicator scale, hydrolysis and complexation by citric acid of these cations are studied. The radionuclides used were 144 Ce, 249 Bk and 249 Cf respectively γ, β and α emitters. The solvent extraction technique of the elements by TTA in benzene from a perchloric medium at the ionic stength 0.1 was employed. The distribution coefficients D were measured by the γ, β or α radiometry. Cerium and berkelium, which have a comparable redox behavior, show in solution a relatively stable valency IV. Therefore the study by solvent extraction of their trivalent form required the standing up of complete reducing conditions of these elements and their stabilization in solution at the valency III. The thermodynamic data obtained for berkelium and californium contribute to understand the chemistry of these elements and permit to complete the third 'tetrad branch' of 5f elements from Cm 3+ to Es 3+ . This tetrad effect is a manifestation of thermodynamic consequence of the 'nephelauxetic effect'. As for Ce(III), the data confirm the pronounced acid property and may be show no neglected ligand effect for f 1 configuration [fr
Berkelium (4) and cerium (4) extraction with tertiary amines
International Nuclear Information System (INIS)
Milyukova, M.S.; Malikov, D.A.; Myasoedov, B.V.
1978-01-01
Oxidation of indicator quantities of berkelium and cerium by a mixture of silver nitrate and ammonium persulfate in the solutions of nitric and sulfuric acid has been examined. The stability of the elements in a tetravalent state and their extraction by the solutions of ternary amines have been investigated. It has been established that berkelium and cerium oxidation under these conditions occurs under the effect of ions of divalent silver which is formed owing to oxidation of monovalent silver by peroxide sulfate ions. The following supposition has been put forward: a difference in the behaviour of tetravalent berkelium and cerium during their extraction by ternary amines is explained by their different stability in this state, but not by the formation of complex compounds with nitrate ions
Chelation and stabilization of berkelium in oxidation state +IV
Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.
2017-09-01
Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.
International Nuclear Information System (INIS)
Payne, G.F.; Peterson, J.R.
1987-01-01
It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species
Trabesinger, Andreas
2017-09-01
The first new element produced after the Second World War has led a rather peaceful life since entering the period table -- until it became the target of those producing superheavy elements, as Andreas Trabesinger describes.
27 CFR 44.254 - Shipping containers.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Shipping containers. 44.254 Section 44.254 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Requirements § 44.254 Shipping containers. Each shipping case, crate, or other container, in which cigars are...
7 CFR 254.1 - General purpose.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose. 254.1 Section 254.1 Agriculture... GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION ADMINISTRATION OF THE FOOD DISTRIBUTION PROGRAM FOR INDIAN HOUSEHOLDS IN OKLAHOMA § 254.1 General purpose. This part sets the requirement under which...
20 CFR 632.254 - Program startup.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Program startup. 632.254 Section 632.254 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR INDIAN AND NATIVE AMERICAN EMPLOYMENT AND TRAINING PROGRAMS Summer Youth Employment and Training Programs § 632.254 Program startup...
36 CFR 254.6 - Segregative effect.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Segregative effect. 254.6... ADJUSTMENTS Land Exchanges § 254.6 Segregative effect. (a) If a proposal is made to exchange Federal lands... segregative effect terminates as follows: (1) Automatically, upon issuance of a patent or other document of...
36 CFR 254.10 - Bargaining; arbitration.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Bargaining; arbitration. 254.10 Section 254.10 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE... determine values. Bargaining or any other process must be based on an objective analysis of the valuation in...
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Definitions. 254.2 Section 254.2 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE... (25 CFR part 81 et. seq.). (b) FNS service area means the areas over which FNS has approved the food...
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Department of Defense DD Form 254, Contract Security Classification Specification. 53.303-DD-254 Section 53.303-DD-254 Federal... Illustrations of Forms 53.303-DD-254 Department of Defense DD Form 254, Contract Security Classification...
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHK254 (Link to dictyBase) - - - Contig-U16260-1 VHK254P (Link to Original site) VHK2...54F 616 VHK254Z 744 VHK254P 1340 - - Show VHK254 Library VH (Link to library) Clone ID VHK2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-C/VHK254Q.Seq.d/ Representative seq. ID VHK2...54P (Link to Original site) Representative DNA sequence >VHK254 (VHK254Q) /CSM/VH/VHK2-C/VHK2...BJ446805 ) Dictyostelium discoideum cDNA clone:ddv63k21, 3' ... 1455 0.0 1 ( BJ446732 ) Dictyostelium discoi
36 CFR 254.15 - Title standards.
2010-07-01
...) Conveyances of lands from the United States are made by patent, quitclaim deed, or deed and without express or implied warranties, except as to hazardous substances pursuant to § 254.3 of this subpart. (c) Title... of the existing use(s) authorized under the terms of the grant, permit, easement, or lease. The non...
2010-10-01
..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.254... greatest extent practicable, adverse impacts on marine mammal species and stocks and their habitats. When...
7 CFR 254.4 - Application by an ITO.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Application by an ITO. 254.4 Section 254.4 Agriculture... INDIAN HOUSEHOLDS IN OKLAHOMA § 254.4 Application by an ITO. (a) Application to FNS Regional Office. An ITO which desires to participate in the Food Distribution Program shall file an application with the...
7 CFR 254.3 - Administration by an ITO.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration by an ITO. 254.3 Section 254.3... FOR INDIAN HOUSEHOLDS IN OKLAHOMA § 254.3 Administration by an ITO. (a) Applicability of part 253. All... any claim and to settle and adjust any claim against an ITO. (d) ITO administration. The ITO, acting...
36 CFR 254.42 - Valuation of tracts.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Valuation of tracts. 254.42 Section 254.42 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LANDOWNERSHIP ADJUSTMENTS Conveyance of Small Tracts § 254.42 Valuation of tracts. (a) Approximately equal value shall be...
36 CFR 254.4 - Agreement to initiate an exchange.
2010-07-01
... exchange. 254.4 Section 254.4 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LANDOWNERSHIP ADJUSTMENTS Land Exchanges § 254.4 Agreement to initiate an exchange. (a) Exchanges may be proposed by the Forest Service or by any person, State, or local government. Initial exchange proposals...
4 CFR 25.4 - Preservation of property.
2010-01-01
... 4 Accounts 1 2010-01-01 2010-01-01 false Preservation of property. 25.4 Section 25.4 Accounts GOVERNMENT ACCOUNTABILITY OFFICE GENERAL PROCEDURES CONDUCT IN THE GOVERNMENT ACCOUNTABILITY OFFICE BUILDING AND ON ITS GROUNDS § 25.4 Preservation of property. The improper disposal of rubbish in the GAO...
36 CFR 254.11 - Exchanges at approximately equal value.
2010-07-01
... equal value. 254.11 Section 254.11 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LANDOWNERSHIP ADJUSTMENTS Land Exchanges § 254.11 Exchanges at approximately equal value. (a) The authorized officer may exchange lands which are of approximately equal value upon a determination that: (1...
29 CFR 1910.254 - Arc welding and cutting.
2010-07-01
... 29 Labor 5 2010-07-01 2010-07-01 false Arc welding and cutting. 1910.254 Section 1910.254 Labor... OCCUPATIONAL SAFETY AND HEALTH STANDARDS Welding, Cutting and Brazing § 1910.254 Arc welding and cutting. (a... following limits shall not be exceeded: (i) Alternating-current machines (A) Manual arc welding and cutting...
International Nuclear Information System (INIS)
Samhoun, K.
1976-01-01
The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr
Uretritis masculina Estudio prospectivo de 254 casos
Directory of Open Access Journals (Sweden)
Federico Diaz G.
1983-06-01
Full Text Available La uretritis no gonocócica (UNG fue la forma predominante (78,0% en una serie de 254 hombres con síndrome de uretritis, estudiados prospectivamente en 1982. La Trichomonas vaginalis estuvo presente en el 4.0% de los casos de UNG. Con base en la comparación entre los pacientes de uretritis gonocócica (UG y los de UNO, puede proponerse un perfil de los segundo que oriente al médico en su sospecha diagnóstica: mayor probabilidad de no hallar secreción uretral o de que Ésta sea escasa y de las modalidades acuosa, mucoide o mixta; también mayor probabilidad de un período de incubación por encima de 9 días y de una evolución superior a un mes. A pesar de tales indicios hay mucha superposición clínica entre las dos formas de uretritis por lo que sigue siendo valedera la recomendación de recurrir al Gram como procedimiento confiable y económico para establecer el diagnóstico diferencial. Se llama la atención hacia la necesidad de disponer de datos sobre uretritis en otros grupos socioeconómicos y de investigar aspectos como la frecuencia en nuestro medio del síndrome de uretritis postgonocócica (U PG.
30 CFR 254.41 - Training your response personnel.
2010-07-01
... procedures; (3) Oil-spill trajectory analysis and predicting spill movement; and (4) Any other... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Training your response personnel. 254.41 Section 254.41 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL...
36 CFR 254.34 - Mineral survey fractions.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Mineral survey fractions. 254... LANDOWNERSHIP ADJUSTMENTS Conveyance of Small Tracts § 254.34 Mineral survey fractions. (a) Mineral survey fractions subject to conveyance under this subpart are limited to those tracts which: (1) Cannot be...
40 CFR 52.254 - Organic solvent usage.
2010-07-01
... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Organic solvent usage. 52.254 Section...) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS California § 52.254 Organic solvent usage. (a) This... (d) of this section and the architectural coatings and solvent disposal emission limitations...
Structure and formation mechanism of the transfermium isotope 254No
International Nuclear Information System (INIS)
Reiter, P.
1998-01-01
The ground-state band of the Z=102 isotope 254 No has been identified up to spin 14, indicating that the nucleus is deformed. The deduced quadruple deformation, β = 0.27, is in agreement with theoretical predictions. These observations confirm that the shell-correction energy responsible for the stability of transfermium nuclei is partly derived from deformation. The survival of 254 No up to spin 14 means that its fission barrier persists at least up to that spin
Susceptibility to Stress Corrosion Cracking of 254SMO SS
Directory of Open Access Journals (Sweden)
De Micheli Lorenzo
2002-01-01
Full Text Available The susceptibility to stress corrosion cracking (SCC of solubilized and sensitized 254SMO SS was studied in sodium chloride, and sodium fluoride solutions at 80 °C and sulfuric acid solutions in presence of sodium chloride at 25 °C. The influence of salt concentration, pH values and the addition of thiosulfate was examined. The susceptibility to SCC was evaluated by Slow Strain Rate Tests (SSRT, at 1.5 x 10-6 s-1 strain rate. The behavior of 254SMO was compared to those of AISI 316L SS and Hastelloy C276. 254SMO showed an excellent resistance to SCC in all conditions, except in the more acidic solutions (pH <= 1 where, in the sensitized conditions, intergranular stress corrosion cracking occurred.
High transfer cross sections from reactions with 254Es
International Nuclear Information System (INIS)
Schaedel, M.; Bruechle, W.; Bruegger, M.; Gaeggeler, H.; Moody, J.; Schardt, D.; Suemmerer, K.; Hulet, E.K.; Dougan, A.D.; Dougan, R.J.; Landrum, J.H.; Lougheed, R.W.; Wild, J.F.; O'Kelly, G.D.
1985-08-01
We report radiochemically determined cross sections for the heaviest known actinides produced in transfer reactions of 101 MeV 16 O, 98 MeV 18 O and 127 MeV 22 Ne with 254 Es as a target. A comparison with data for similar transfers from 248 Cm targets is made. Transfer cross sections are extrapolated for the production of unknown, neutron-rich isotopes of elements 101 through 105, and the unique potential of 254 Es as a target to make these exotic nuclei accessible is demonstrated. (orig.)
36 CFR 254.33 - Road rights-of-way.
2010-07-01
... parcels subject to conveyance under this subpart are limited to those which are substantially surrounded by lands not owned by the United States. (b) Forest Service officials shall consider public road... Section 254.33 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LANDOWNERSHIP...
40 CFR 264.254 - Monitoring and inspection.
2010-07-01
... Waste Piles § 264.254 Monitoring and inspection. (a) During construction or installation, liners (except in the case of existing portions of piles exempt from § 264.251(a)) and cover systems (e.g... increase in the permeability of the liner or cover. (b) While a waste pile is in operation, it must be...
36 CFR 254.12 - Value equalization; cash equalization waiver.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Value equalization; cash... AGRICULTURE LANDOWNERSHIP ADJUSTMENTS Land Exchanges § 254.12 Value equalization; cash equalization waiver. (a..., either with or without adjustments of relative values as compensation for various costs, the parties to...
24 CFR 221.254 - Mortgage insurance premiums.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage insurance premiums. 221... Cost Homes § 221.254 Mortgage insurance premiums. (a) All of the provisions of §§ 203.260 through 203.295 of this chapter relating to mortgage insurance premiums shall apply to mortgages insured under...
In-beam spectroscopy of 253,254No
International Nuclear Information System (INIS)
Herzberg, R.D.; Amzal, N.; Bastin, J.E.; Brew, P.M.T.; Butler, P.A.; Chewter, A.J.C.; Hammond, N.J.; Humphreys, R.D.; Jones, G.D.; Becker, F.; Hauschild, K.; Houry, M.; Huerstel, A.; Cocks, J.F.C.; Dorvaux, O.; Greenlees, P.T.; Eskola, K.; Gerl, J.; Hessberger, F.; Helariutta, K.; Jones, P.M.; Julin, R.; Juutinen, S.; Kankaanpaeae, H.; Kettunen, H.; Khoo, T.L.; Korten, W.; Kuusiniemi, P.; Le Coz, Y.; Leino, M.; Leppaenen, C.J.; Lister, A.P.; Lucas, R.; Muikku, M.; Nieminen, P.; Page, R.D.; Page, T.; Rahkila, P.; Reiter, P.; Schlegel, Ch.; Scholey, C.; Sletten, G.; Stezowski, O.; Theisen, Ch.; Trzaska, W.H.; Uusitalo, J.; Wollersheim, H.J.
2002-01-01
In-beam conversion electron spectroscopy experiments have been performed on the transfermium nuclei 253, 254 No using the conversion electron spectrometer SACRED in nearly collinear geometry in conjunction with the gas-filled separator RITU at the University of Jyvaeskylae. The experimental setup is discussed and the spectra are compared to Monte Carlo simulations. The implications for the ground-state configuration of 253 No are discussed. (orig.)
17 CFR 230.254 - Solicitation of interest document for use prior to an offering statement.
2010-04-01
... subject to the antifraud provisions of the federal securities laws. No solicitation or acceptance of money... document for use prior to an offering statement. 230.254 Section 230.254 Commodity and Securities Exchanges...-Conditional Small Issues Exemption § 230.254 Solicitation of interest document for use prior to an offering...
47 CFR 1.254 - Nature of the hearing; burden of proof.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Nature of the hearing; burden of proof. 1.254 Section 1.254 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL PRACTICE AND PROCEDURE Hearing Proceedings Hearing and Intermediate Decision § 1.254 Nature of the hearing; burden of proof. Any hearing upon...
3C 254: the alignment effect and unification schemes
Bremer, M. N.
1997-01-01
3C 254 is a radio-loud quasar at z=0.734. Optical line and continuum emission from the underlying galaxy is clearly extended and aligned with the radio axis; the object shows the so-called `alignment effect' which is often seen in powerful radio galaxies. This is the clearest case yet of the continuum alignment effect in a radio-loud quasar. The object is one of the most lobe-dominated 3C quasars; the significance of the aligned emission in this source is discussed in terms of orientation-based unification schemes for radio-loud quasars and radio galaxies. 3C 254 is a very asymmetric radio source and it is shown that the radio structure on the side with the shortest nucleus-hotspot distance is interacting with the emission-line gas surrounding the quasar. It is also shown that the quasar is surrounded by an overdensity of faint objects, consistent with a cluster or group of galaxies around the object.
Human Factors evaluation of LCS 254 and 255
International Nuclear Information System (INIS)
Goffe, L.; Held, J.E.
1993-01-01
This report includes the results of the Human Factors evaluation of the local control stations (LCS) 254 and 255 performed by Savannah River Technology Center (SRTC) Human Factors. Recommendations are included in order that the panel designs will be upgraded to comply with human engineering design guidelines. Figures 1 and 2 are included as examples of recommended changes. Also, consideration was given to including the proposed engineering changes which are currently on-going for LCS 255. Appendix A identifies the human engineering requirements from NUREG-0700 which were used in the evaluation process, and the areas of the design which do not comply with the guidelines. Those areas of the panel design which fail to comply with the human engineering guidelines are label location, label content, location aids, panel layout, and control display integration. Each of these design deficiencies and proposed corrections are described in this report
Photooxidation of polystyrene: irradiation at 254 and 365 nm
International Nuclear Information System (INIS)
Otocka, E.P.; Curran, S.; Porter, R.S.
1983-01-01
Studies have been made of the near surface photooxidation of atactic polystyrene films prepared in the absence of air. The samples were photooxidized on exposure to air at two frequencies, 254 and 365 nm, using a calibrated mercury irradiation source with filters. Most studies were made at 40 0 C and as a function of irradiation time with the reactions characterized by changes in molecular weight and composition. The former was evaluated by gel permeation chromatography and the latter by transmission Fourier transform infrared ir spectroscopy and by multiple-internal-reflectance ir spectra using different angles and different crystals to evaluate compositions as a function of film depth. Species identified in photooxidation include the generation of hydroperoxides and the appearance of carbonyl bands with the latter identified by the spectral shift associated with the exposure of the photooxidized polystyrene surface to ammonia. These results suggest that principal products of near-surface oxidation of polystyrene are carboxylic acids. 6 figures, 1 table
75 FR 6319 - Proposed Amendment of Low Altitude Area Navigation Route T-254; Houston, TX
2010-02-09
... Amendment of Low Altitude Area Navigation Route T-254; Houston, TX AGENCY: Federal Aviation Administration... altitude Area Navigation (RNAV) route T-254 in the Houston, TX, terminal area by eliminating the segment... safety and the efficient use of the navigable airspace in the Houston, TX, terminal area. DATES: Comments...
75 FR 18047 - Amendment of Low Altitude Area Navigation Route T-254; Houston, TX
2010-04-09
...-254; Houston, TX AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule. SUMMARY: This action amends low altitude Area Navigation (RNAV) route T-254 in the Houston, TX, terminal area by... Houston, TX, terminal area. DATES: Effective Dates: 0901 UTC, June 3, 2010. The Director of the Federal...
37 CFR 2.54 - Requirements for drawings submitted on paper.
2010-07-01
... submitted on paper. 2.54 Section 2.54 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK... drawings submitted on paper. The drawing must meet the requirements of § 2.52. In addition, in a paper submission, the drawing should: (a) Be on non-shiny white paper that is separate from the application; (b) Be...
48 CFR 53.204-1 - Safeguarding classified information within industry (DD Form 254, DD Form 441).
2010-10-01
... information within industry (DD Form 254, DD Form 441). 53.204-1 Section 53.204-1 Federal Acquisition....204-1 Safeguarding classified information within industry (DD Form 254, DD Form 441). The following... specified in subpart 4.4 and the clause at 52.204-2: (a) DD Form 254 (Department of Defense (DOD)), Contract...
37 CFR 254.2 - Definition of coin-operated phonorecord player.
2010-07-01
...-OPERATED PHONORECORD PLAYERS § 254.2 Definition of coin-operated phonorecord player. As used in this part..., currency, tokens, or other monetary units or their equivalent; (b) Is located in an establishment making no...
Structure and formation mechanism of the transfermium isotope {sup 254}No.
Energy Technology Data Exchange (ETDEWEB)
Reiter, P.
1998-12-17
The ground-state band of the Z=102 isotope {sup 254}No has been identified up to spin 14, indicating that the nucleus is deformed. The deduced quadruple deformation, {beta} = 0.27, is in agreement with theoretical predictions. These observations confirm that the shell-correction energy responsible for the stability of transfermium nuclei is partly derived from deformation. The survival of {sup 254}No up to spin 14 means that its fission barrier persists at least up to that spin.
cdc-25.4, a Caenorhabditis elegans Ortholog of cdc25, Is Required for Male Mating Behavior
Directory of Open Access Journals (Sweden)
Sangmi Oh
2016-12-01
Full Text Available Cell division cycle 25 (cdc25 is an evolutionarily conserved phosphatase that promotes cell cycle progression. Among the four cdc25 orthologs in Caenorhabditis elegans, we found that cdc-25.4 mutant males failed to produce outcrossed progeny. This was not caused by defects in sperm development, but by defects in male mating behavior. The cdc-25.4 mutant males showed various defects during male mating, including contact response, backing, turning, and vulva location. Aberrant turning behavior was the most prominent defect in the cdc-25.4 mutant males. We also found that cdc-25.4 is expressed in many neuronal cells throughout development. The turning defect in cdc-25.4 mutant males was recovered by cdc-25.4 transgenic expression in neuronal cells, suggesting that cdc-25.4 functions in neurons for male mating. However, the neuronal morphology of cdc-25.4 mutant males appeared to be normal, as examined with several neuronal markers. Also, RNAi depletion of wee-1.3, a C. elegans ortholog of Wee1/Myt1 kinase, failed to suppress the mating defects of cdc-25.4 mutant males. These findings suggest that, for successful male mating, cdc-25.4 does not target cell cycles that are required for neuronal differentiation and development. Rather, cdc-25.4 likely regulates noncanonical substrates in neuronal cells.
Ground-State Band and Deformation of the Z = 102 Isotope N 254
International Nuclear Information System (INIS)
Reiter, P.; Khoo, T.L.; Lister, C.J.; Seweryniak, D.; Ahmad, I.; Alcorta, M.; Carpenter, M.P.; Cizewski, J.A.; Davids, C.N.; Gervais, G.; Greene, J.P.; Henning, W.F.; Janssens, R.V.; Lauritsen, T.; Siem, S.; Sonzogni, A.A.; Sullivan, D.; Uusitalo, J.; Wiedenhoever, I.; Amzal, N.; Butler, P.A.; Chewter, A.J.; Greenlees, P.T.; Herzberg, R.; Jones, G.D.; Cizewski, J.A.; Ding, K.Y.; Fotiades, N.; Fox, J.D.; Korten, W.; Leino, M.; Vetter, K.; Siem, S.
1999-01-01
The ground-state band of the Z=102 isotope 254 No has been identified up to spin 14, indicating that the nucleus is deformed. The deduced quadrupole deformation, β=0.27 , is in agreement with theoretical predictions. These observations confirm that the shell-correction energy responsible for the stability of transfermium nuclei is partly derived from deformation. The survival of 254 No up to spin 14 means that its fission barrier persists at least up to that spin. copyright 1999 The American Physical Society
Optical and near-infrared study of the AM Herculis-type binary CW 1103 + 254
Energy Technology Data Exchange (ETDEWEB)
Bailey, J [Anglo-Australian Observatory, Epping (Australia); Watts, D J [Tasmania Univ., Sandy Bay (Australia). Dept. of Physics; Sherrington, M R [Leicester Univ. (UK). Dept. of Astronomy
1985-07-15
The AM Herculis-type binary CW 1103+254 has been observed using optical and near-infrared photometry and polarimetry, and optical spectroscopy and spectropolarimetry. It is found that from such a set of observations it is relatively easy to distinguish all the main components of the system.
6 CFR 25.4 - Designation of qualified anti-terrorism technologies.
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Designation of qualified anti-terrorism... REGULATIONS TO SUPPORT ANTI-TERRORISM BY FOSTERING EFFECTIVE TECHNOLOGIES § 25.4 Designation of qualified anti-terrorism technologies. (a) General. The Under Secretary may Designate as a Qualified Anti-Terrorism...
Enhanced escape rate for Hg 254 nm resonance radiation in fluorescent lamps
International Nuclear Information System (INIS)
Lawler, James E; Raizen, Mark G
2013-01-01
The potential of the low-cost MAGIS isotopic separation method to improve fluorescent lamp efficacy is explored using resonance radiation transport simulations. New Hg isotopic mixes are discovered that yield escape rates for 254 nm Hg I resonance radiation equal to 117% to 122% of the rate for a natural isotopic mix under the same lamp conditions. (paper)
Coulomb dissociation of {sup 8}B at 254 A MeV
Energy Technology Data Exchange (ETDEWEB)
Suemmerer, K; Boue, F; Baumann, T; Geissel, H; Hellstroem, M; Koczon, P; Schwab, E; Schwab, W; Senger, P; Surowiecz, A [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany); Iwasa, N; Ozawa, A [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany); [RIKEN Institute of Physical and Chemical Research, Saitama (Japan); Surowka, G [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany); [Jagiellonian Univ., Krakow (Poland). Inst. of Physics; Blank, B; Czajkowski, S; Marchand, C; Pravikoff, M S [Centre d` Etudes Nucleaires de Bordeaux-Gradignan, 33 (France); Foerster, A; Lauer, F; Oeschler, H; Speer, J; Sturm, C; Uhlig, F; Wagner, A [Technische Univ. Darmstadt (Germany); Gai, M [Connecticut Univ., Storrs, CT (United States). Dept. of Physics; Grosse, E [Inst. fuer Kern- und Hadronenphysik, Forschungszentrum Rossendorf, Dresden (Germany); Kohlmeyer, B [Philipps Univ., Marburg (Germany). Fachbereich Physik; Kulessa, R; Walus, W [Jagiellonian Univ., Krakow (Poland). Inst. of Physics; Motobayashi, T [Rikkyo Univ., Tokyo (Japan). Dept. of Physics; Teranishi, T [RIKEN Institute of Physical and Chemical Research, Saitama (Japan)
1998-06-01
As an alternative method for determining the astrophysical S-factor for the {sup 7}Be(p,{gamma}){sup 8}B reaction we have measured the Coulomb dissociation of {sup 8}B at 254 A MeV. From our preliminary results, we obtain good agreement with both the accepted direct-reaction measurements and the low-energy Coulomb dissociation study of Iwasa et al. performed at about 50 A MeV. (orig.)
Ferric ion mediated photochemical decomposition of perfluorooctanoic acid (PFOA) by 254 nm UV light
International Nuclear Information System (INIS)
Wang Yuan; Zhang Pengyi; Pan Gang; Chen Hao
2008-01-01
The great enhancement of ferric ion on the photochemical decomposition of environmentally persistent perfluorooctanoic acid (PFOA) under 254 nm UV light was reported. In the presence of 10 μM ferric ion, 47.3% of initial PFOA (48 μM) was decomposed and the defluorination ratio reached 15.4% within 4 h reaction time. While the degradation and defluorination ratio greatly increased to 80.2% and 47.8%, respectively, when ferric ion concentration increased to 80 μM, and the corresponding half-life was shortened to 103 min. Though the decomposition rate was significantly lowered under nitrogen atmosphere, PFOA was efficiently decomposed too. Other metal ions like Cu 2+ and Zn 2+ also slightly improved the photochemical decomposition of PFOA under irradiation of 254 nm UV light. Besides fluoride ion, other intermediates during PFOA decomposition including formic acid and five shorter-chain perfluorinated carboxylic acids (PFCAs) with C7, C6, C5, C4 and C3, respectively, were identified and quantified by IC or LC/MS. The mixture of PFOA and ferric ion had strong absorption around 280 nm. It is proposed that PFOA coordinates with ferric ion to form a complex, and its excitation by 254 nm UV light leads to the decomposition of PFOA in a stepwise way
Koika, Vasiliki; Varnavas, Petros; Valavani, Helen; Sidis, Yisrael; Plummer, Lacey; Dwyer, Andrew; Quinton, Richard; Kanaka-Gantenbein, Christine; Pitteloud, Nelly; Sertedaki, Amalia; Dacou-Voutetakis, Catherine; Georgopoulos, Neoklis A
2013-03-01
FGFR1 mutations have been identified in both Kallmann syndrome and normosmic HH (nIHH). To date, few mutations in the FGFR1 gene have been structurally or functionally characterized in vitro to identify molecular mechanisms that contribute to the disease pathogenesis. We attempted to define the in vitro functionality of two FGFR1 mutants (R254W and R254Q), resulting from two different amino acid substitutions of the same residue, and to correlate the in vitro findings to the patient phenotypes. Two unrelated GnRH deficient probands were found to harbor mutations in FGFR1 (R254W and R254Q). Mutant signaling activity and expression levels were evaluated in vitro and compared to a wild type (WT) receptor. Signaling activity was determined by a FGF2/FGFR1 dependent transcription reporter assay. Receptor total expression levels were assessed by Western blot and cell surface expression was measured by a radiolabeled antibody binding assay. The R254W maximal receptor signaling capacity was reduced by 45% (p<0.01) while R254Q activity was not different from WT. However, both mutants displayed diminished total protein expression levels (40 and 30% reduction relative to WT, respectively), while protein maturation was unaffected. Accordingly, cell surface expression levels of the mutant receptors were also significantly reduced (35% p<0.01 and 15% p<0.05, respectively). The p.R254W and p.R254Q are both loss-of-function mutations as demonstrated by their reduced overall and cell surface expression levels suggesting a deleterious effect on receptor folding and stability. It appears that a tryptophan substitution at R254 is more disruptive to receptor structure than the more conserved glutamine substitution. No clear correlation between the severity of in vitro loss-of-function and phenotypic presentation could be assigned. Copyright © 2012 Elsevier B.V. All rights reserved.
Liu, H L; Walker, P M
2012-01-01
Total Routhian surface calculations have been performed to investigate rapidly rotating transfermium nuclei, the heaviest nuclei accessible by detailed spectroscopy experiments. The observed fast alignment in $^{252}$No and slow alignment in $^{254}$No are well reproduced by the calculations incorporating high-order deformations. The different rotational behaviors of $^{252}$No and $^{254}$No can be understood for the first time in terms of $\\beta_6$ deformation that decreases the energies of the $\
Coulomb dissociation of 8B at 254 MeV/u
International Nuclear Information System (INIS)
Surowka, G.; Iwasa, N.; Boue, F.
1999-01-01
As an alternative method to determine the cross section of 7 Be (p, γ) 8 B, the Coulomb dissociation reaction 8 B → 7 Be + p at E inc = 254 MeV/u was measured. Our preliminary results show the dominant role of the dipole excitation in the Coulomb break-up process. The extracted astrophysical S 17 factor is consistent with the lower-value results both of the direct-capture studies, and the RIKEN Coulomb-dissociation experiment at ∼ 50 MeV/u. (author)
Crítica textual y estilo: nota a Farsalia I 254
Directory of Open Access Journals (Sweden)
Antonio Holgado Redondo
1981-12-01
Full Text Available Almost every Lucan's manuscript has in Pharsalia I 254 the variant furentem (only one gives ruentem, but almost every one of the editors prefers ruentem. The acceptance of ruentem is due to the nearby presence of a furentum and a furoris. Here we maintain furentem as the right reading, on grounds of Lucan's familiar stylistic procedure of repetition of the key terms of a passage. The poetic value of this repetition is endorsed in modern times by R. Jakobson and S. R. Levin.
The O-GlcNAc Transferase Intellectual Disability Mutation L254F Distorts the TPR Helix.
Gundogdu, Mehmet; Llabrés, Salomé; Gorelik, Andrii; Ferenbach, Andrew T; Zachariae, Ulrich; van Aalten, Daan M F
2018-05-17
O-linked β-N-acetyl- D -glucosamine (O-GlcNAc) transferase (OGT) regulates protein O-GlcNAcylation, an essential post-translational modification that is abundant in the brain. Recently, OGT mutations have been associated with intellectual disability, although it is not understood how they affect OGT structure and function. Using a multi-disciplinary approach we show that the L254F OGT mutation leads to conformational changes of the tetratricopeptide repeats and reduced activity, revealing the molecular mechanisms contributing to pathogenesis. Copyright © 2018 The Authors. Published by Elsevier Ltd.. All rights reserved.
Decay and Fission Hindrance of Two- and Four-Quasiparticle K Isomers in ^{254}Rf.
David, H M; Chen, J; Seweryniak, D; Kondev, F G; Gates, J M; Gregorich, K E; Ahmad, I; Albers, M; Alcorta, M; Back, B B; Baartman, B; Bertone, P F; Bernstein, L A; Campbell, C M; Carpenter, M P; Chiara, C J; Clark, R M; Cromaz, M; Doherty, D T; Dracoulis, G D; Esker, N E; Fallon, P; Gothe, O R; Greene, J P; Greenlees, P T; Hartley, D J; Hauschild, K; Hoffman, C R; Hota, S S; Janssens, R V F; Khoo, T L; Konki, J; Kwarsick, J T; Lauritsen, T; Macchiavelli, A O; Mudder, P R; Nair, C; Qiu, Y; Rissanen, J; Rogers, A M; Ruotsalainen, P; Savard, G; Stolze, S; Wiens, A; Zhu, S
2015-09-25
Two isomers decaying by electromagnetic transitions with half-lives of 4.7(1.1) and 247(73) μs have been discovered in the heavy ^{254}Rf nucleus. The observation of the shorter-lived isomer was made possible by a novel application of a digital data acquisition system. The isomers were interpreted as the K^{π}=8^{-}, ν^{2}(7/2^{+}[624],9/2^{-}[734]) two-quasineutron and the K^{π}=16^{+}, 8^{-}ν^{2}(7/2^{+}[624],9/2^{-}[734])⊗8^{-}π^{2}(7/2^{-}[514],9/2^{+}[624]) four-quasiparticle configurations, respectively. Surprisingly, the lifetime of the two-quasiparticle isomer is more than 4 orders of magnitude shorter than what has been observed for analogous isomers in the lighter N=150 isotones. The four-quasiparticle isomer is longer lived than the ^{254}Rf ground state that decays exclusively by spontaneous fission with a half-life of 23.2(1.1) μs. The absence of sizable fission branches from either of the isomers implies unprecedented fission hindrance relative to the ground state.
Liu, Yiqing; He, Xuexiang; Fu, Yongsheng; Dionysiou, Dionysios D
2016-03-15
Oxytetracycline (OTC), an important broad-spectrum antibiotic, has been detected extensively in various environmental systems, which may have a detrimental impact on ecosystem and human health through the development of drug resistant bacteria and pathogens. In this study, the degradation of OTC was evaluated by UV-254nm activated persulfate (PS). The observed UV fluence based pseudo first-order rate constant (kobs) was found to be the highest at near neutral pH conditions (pH 5.5-8.5). Presence of various natural water constituents had different effects on OTC degradation, with a significant enhancement in the presence of bicarbonate or Cu(2+). Limited elimination of total organic carbon (TOC) and PS was observed during the mineralization of OTC. Transformation byproducts in the presence and absence of hydroxyl radical scavenging agent tert-butanol (t-BuOH) were identified using ultra-high definition accurate-mass quadrupole time-of-flight liquid chromatography/mass spectrometer (LC-QTOF/MS). Potential OTC degradation mechanism was subsequently proposed revealing four different reaction pathways by SO4(-) reaction including hydroxylation (+16Da), demethylation (-14Da), decarbonylation (-28Da) and dehydration (-18Da). This study suggests that UV-254nm/PS is a promising treatment technology for the control of water pollution caused by emerging contaminants such as OTC. Copyright © 2015 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Dubois, J.; Chapman, S.K.; Mathews, F.S.; Reid, G.A.; Lederer, F.
1990-01-01
A role for Tyr254 in L-lactate dehydrogenation catalyzed by flavocytochrome b2 has recently been proposed on the basis of the known active-site structure and of studies that had suggested a mechanism involving the initial formation of a lactate carbanion. This role is now examined after replacement of Tyr254 with phenylalanine. The kcat is decreased about 40-fold, Km for lactate appears unchanged, and the mainly rate-limiting step is still alpha-hydrogen abstraction, as judged from the steady-state deuterium isotope effect. Modeling studies with lactate introduced into the active site indicate two possible substrate conformations with different hydrogen-bonding partners for the substrate hydroxyl. If the hydrogen bond is formed with Tyr254, as was initially postulated, the mechanism must involve removal by His373 of the C2 hydrogen, with carbanion formation. If, in the absence of the Tyr254 phenol group, the hydrogen bond is formed with His373 N3, the substrate is positioned in such a way that the reaction must proceed by hydride transfer. Therefore the mechanism of the Y254F enzyme was investigated so as to distinguish between the two mechanistic possibilities. 2-Hydroxy-3-butynoate behaves with the mutant as a suicide reagent, as with the wild-type enzyme. Similarly, the mutant protein also catalyzes the reduction and the dehydrohalogenation of bromopyruvate under transhydrogenation conditions
Alimentation impact of treatments of 254 oropharyngeal cancers (1998-2003).
Buiret, Guillaume; Daveau, Clémentine; Landry, Guillaume; Colin, Carole; Pignat, Jean-Christian; Poupart, Marc
2011-01-01
Objective. To analyze the functional impact of the various possible treatments of oropharyngeal squamous cell carcinomas to find the main prognostic factors of dysphagia induced by these treatments. Patients. Clinical data from 254 patients treated for squamous cell carcinoma of the oropharynx between 1998 and 2003 were retrospectively analyzed. A multivariate model enabled us to evaluate the role of each potentially harmful factor on swallowing. Main Outcome Measures. The significant factors influencing the consumption of liquid, pasty, and normal food were the same: the initial T stage and the type of treatment. Conclusion. Whatever the possible and selected treatment was, the impact on the functional capacities, and thus, the quality of life of the patients was considerable. Even though we could not significantly demonstrate exclusive radiotherapy caused more long-term undesirable effects than surgery followed by radiotherapy, our daily practice has shown that we should favour the latter.
Stability of trans-fermium elements at high spin: Measuring the fission barrier of 254No
International Nuclear Information System (INIS)
Henning, Greg
2012-01-01
Super heavy nuclei provide opportunities to study nuclear structure near three simultaneous limits: in charge Z, spin I and excitation energy E*. These nuclei exist only because of a fission barrier, created by shell effects. It is therefore important to determine the fission barrier and its spin dependence B f (I), which gives information on the shell energy E(shell)(I). Theoretical calculations predict different fission barrier heights from B f (I = 0) = 6.8 MeV for a macro-microscopic model to 8.7 MeV for Density Functional Theory calculations using the Gogny or Skyrme interactions. Hence, a measurement of B f provides a test for theories.To investigate the fission barrier, an established method is to measure the rise of fission with excitation energy, characterized by the ratio of decay widths Γ(fission)/Γ(total), using transfer reactions. However, for heavy elements such as 254 No, there is no suitable target for a transfer reaction. We therefore rely on the complementary decay widths ratio Γ γ /Γ(fission) and its spin dependence, deduced from the entry distribution (I, E*).Measurements of the gamma-ray multiplicity and total energy for 254 No have been performed with beam energies of 219 and 223 MeV in the reaction 208 Pb( 48 Ca,2n) at ATLAS (Argonne Tandem Linac Accelerator System). The 254 No gamma rays were detected using the Gammasphere array as a calorimeter - as well as the usual high resolution γ-ray detector. Coincidences with evaporation residues at the Fragment Mass Analyzer focal plane separated 254 No gamma rays from those from fission fragments, which are ≥ 10 6 more intense. From this measurement, the entry distribution - i.e. the initial distribution of I and E* - is constructed. Each point (I,E*) of the entry distribution is a point where gamma decay wins over fission and, therefore, gives information on the fission barrier. The measured entry distributions show an increase in the maximum spin and excitation energy from 219 to 223 Me
Printed wax masks for 254 nm deep-UV pattering of PMMA-based microfluidics
Fan, Yiqiang
2012-01-13
This paper reports a new technique for masking deep-UV exposure of poly(methyl methacrylate) (PMMA) using a printed wax mask. This technique provides an inexpensive and bulk fabrication method for PMMA structures. The technique involves the direct printing of the mask onto a polymer sheet using a commercial wax printer. The wax layer was then transferred to a PMMA substrate using a thermal laminator, exposed using deep-UV (with a wavelength of 254 nm), developed in an IPA:water solution, and completed by bonding on a PMMA cap layer. A sample microfluidic device fabricated with this method is also presented, with the microchannel as narrow as 50 μm. The whole process is easy to perform without the requirement for any microfabrication facilities. © 2012 IOP Publishing Ltd.
Radiochemical search for neutron-rich isotopes of nielsbohrium in the (16)O + (254)Es reaction
International Nuclear Information System (INIS)
Schaedel, M.; Jaeger, E.; Bruechle, W.; Suemmerer, K.; Hulet, E.K.; Wild, J.F.; Lougheed, R.W.; Dougan, R.J.; Moody, K.J.
1994-09-01
We have used on-line gas chromatography to search for new isotopes of element 107 near the deformed sub-shell at N = 162 and Z = 108. Enhanced nuclear stability is predicted for this region. 254g Es was irradiated with 16 O at barrier energies to minimize the fusion hindrance in the entrance channel and to reduce the excitation energy of the compound nucleus to a minimum value. For half-lives between roughly two seconds and two minutes no signal for a positive identification of a new isotope of element 107 was detected. Consequently, only an upper cross-section limit of a few nanobarns was obtained. While this cross-section limit was too high to probe the influence of the predicted enhanced nuclear ground-state stability on the survival probability in the fission/evaporation competition, a very large cross-section enhancement would have been detectable. (orig.)
Printed wax masks for 254 nm deep-UV pattering of PMMA-based microfluidics
International Nuclear Information System (INIS)
Fan, Yiqiang; Liu, Yang; Li, Huawei; Foulds, Ian G
2012-01-01
This paper reports a new technique for masking deep-UV exposure of poly(methyl methacrylate) (PMMA) using a printed wax mask. This technique provides an inexpensive and bulk fabrication method for PMMA structures. The technique involves the direct printing of the mask onto a polymer sheet using a commercial wax printer. The wax layer was then transferred to a PMMA substrate using a thermal laminator, exposed using deep-UV (with a wavelength of 254 nm), developed in an IPA:water solution, and completed by bonding on a PMMA cap layer. A sample microfluidic device fabricated with this method is also presented, with the microchannel as narrow as 50 µm. The whole process is easy to perform without the requirement for any microfabrication facilities. (technical note)
de Oliveira, Dirce Martins; Cavalcante, Rodrigo Pereira; da Silva, Lucas de Melo; Sans, Carme; Esplugas, Santiago; de Oliveira, Silvio Cesar; Junior, Amilcar Machulek
2018-02-09
This paper reports the degradation of 10 mg L -1 Ametryn solution with different advanced oxidation processes and by ultraviolet (UV 254 ) irradiation alone with the main objective of reducing acute toxicity and increase biodegradability. The investigated factors included Fe 2+ and H 2 O 2 concentrations. The effectiveness of the UV 254 and UV 254 /H 2 O 2 processes were investigated using a low-pressure mercury UV lamp (254 nm). Photo-Fenton process was explored using a blacklight blue lamp (BLB, λ = 365 nm). The UV 254 irradiation process achieved complete degradation of Ametryn solution after 60 min. The degradation time of Ametryn was greatly improved by the addition of H 2 O 2 . It is worth pointing out that a high rate of Ametryn removal was attained even at low concentrations of H 2 O 2 . The kinetic constant of the reaction between Ametryn and HO ● for UV 254 /H 2 O 2 was 3.53 × 10 8 L mol -1 s -1 . The complete Ametryn degradation by the Fenton and photo-Fenton processes was observed following 10 min of reaction for various combinations of Fe 2+ and H 2 O 2 under investigation. Working with the highest concentration (150 mg L -1 H 2 O 2 and 10 mg L -1 Fe 2+ ), around 30 and 70% of TOC removal were reached within 120 min of treatment by Fenton and photo-Fenton processes, respectively. Although it did not obtain complete mineralization, the intermediates formed in the degradation processes were hydroxylated and did not promote acute toxicity of Vibrio fischeri. Furthermore, a substantial improvement of biodegradability was obtained for all studied processes.
Energy Technology Data Exchange (ETDEWEB)
Liu, Yiqing [Faculty of Geosciences and Environmental Engineering, Southwest Jiaotong University, Chengdu 611756 (China); Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); He, Xuexiang [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); Fu, Yongsheng [Faculty of Geosciences and Environmental Engineering, Southwest Jiaotong University, Chengdu 611756 (China); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States)
2016-03-15
Highlights: • The most effective destruction of OTC by UV/PS was achieved at near neutral pH. • Deprotonated HOTC{sup −} had the highest second-order rate constant with SO{sub 4}·{sup −}. • Presence of HCO{sub 3}{sup −} or Cu{sup 2+} enhanced the removal of OTC in UV/PS system. • Total organic carbon was degraded slowly during the mineralization of OTC. • Studies on the degradation mechanism revealed four different reaction pathways. - Abstract: Oxytetracycline (OTC), an important broad-spectrum antibiotic, has been detected extensively in various environmental systems, which may have a detrimental impact on ecosystem and human health through the development of drug resistant bacteria and pathogens. In this study, the degradation of OTC was evaluated by UV-254 nm activated persulfate (PS). The observed UV fluence based pseudo first-order rate constant (k{sub obs}) was found to be the highest at near neutral pH conditions (pH 5.5–8.5). Presence of various natural water constituents had different effects on OTC degradation, with a significant enhancement in the presence of bicarbonate or Cu{sup 2+}. Limited elimination of total organic carbon (TOC) and PS was observed during the mineralization of OTC. Transformation byproducts in the presence and absence of hydroxyl radical scavenging agent tert-butanol (t-BuOH) were identified using ultra-high definition accurate-mass quadrupole time-of-flight liquid chromatography/mass spectrometer (LC-QTOF/MS). Potential OTC degradation mechanism was subsequently proposed revealing four different reaction pathways by SO{sub 4}·{sup −} reaction including hydroxylation (+16 Da), demethylation (−14 Da), decarbonylation (−28 Da) and dehydration (−18 Da). This study suggests that UV-254 nm/PS is a promising treatment technology for the control of water pollution caused by emerging contaminants such as OTC.
International Nuclear Information System (INIS)
Liu, Yiqing; He, Xuexiang; Fu, Yongsheng; Dionysiou, Dionysios D.
2016-01-01
Highlights: • The most effective destruction of OTC by UV/PS was achieved at near neutral pH. • Deprotonated HOTC"− had the highest second-order rate constant with SO_4·"−. • Presence of HCO_3"− or Cu"2"+ enhanced the removal of OTC in UV/PS system. • Total organic carbon was degraded slowly during the mineralization of OTC. • Studies on the degradation mechanism revealed four different reaction pathways. - Abstract: Oxytetracycline (OTC), an important broad-spectrum antibiotic, has been detected extensively in various environmental systems, which may have a detrimental impact on ecosystem and human health through the development of drug resistant bacteria and pathogens. In this study, the degradation of OTC was evaluated by UV-254 nm activated persulfate (PS). The observed UV fluence based pseudo first-order rate constant (k_o_b_s) was found to be the highest at near neutral pH conditions (pH 5.5–8.5). Presence of various natural water constituents had different effects on OTC degradation, with a significant enhancement in the presence of bicarbonate or Cu"2"+. Limited elimination of total organic carbon (TOC) and PS was observed during the mineralization of OTC. Transformation byproducts in the presence and absence of hydroxyl radical scavenging agent tert-butanol (t-BuOH) were identified using ultra-high definition accurate-mass quadrupole time-of-flight liquid chromatography/mass spectrometer (LC-QTOF/MS). Potential OTC degradation mechanism was subsequently proposed revealing four different reaction pathways by SO_4·"− reaction including hydroxylation (+16 Da), demethylation (−14 Da), decarbonylation (−28 Da) and dehydration (−18 Da). This study suggests that UV-254 nm/PS is a promising treatment technology for the control of water pollution caused by emerging contaminants such as OTC.
International Nuclear Information System (INIS)
Bartels, U.
1988-01-01
Organic compounds are mostly neglected within deposition measurement programs because their determination is expensive and complicated. A very simple and rapid estimation of total organic carbon (TOC) is possible by determination of the spectral absorption coefficient in the range of ultraviolet radiation at 254 nm wave-length (SAC 254 ): TOC (mg/1) = 0,5 SAC 254 (m −1 ) - 0,15 (author) [de
Clofibric acid degradation in UV254/H2O2 process: effect of temperature.
Li, Wenzhen; Lu, Shuguang; Qiu, Zhaofu; Lin, Kuangfei
2010-04-15
The degradation of clofibric acid (CA) in UV(254)/H(2)O(2) process under three temperature ranges, i.e. T1 (9.0-11.5 degrees C), T2 (19.0-21.0 degrees C) and T3 (29.0-30.0 degrees C) was investigated. The effects of solution constituents including NO(3)(-) and HCO(3)(-) anions, and humic acid (HA) on CA degradation were evaluated in Milli-Q waters. CA degradation behaviors were simulated with the pseudo-first-order kinetic model and the apparent rate constant (k(ap)) and half-life time (t(1/2)) were calculated. The results showed that higher temperature would favor CA degradation, and CA degradation was taken place mostly by indirect oxidation through the formation of OH radicals in UV(254)/H(2)O(2) process. In addition, the effects of both NO(3)(-) and HCO(3)(-) anions at two selected concentrations (1.0x10(-3) and 0.1 mol L(-1)) and HA (20 mg L(-1)) on CA degradation were investigated. The results showed that HA had negative effect on CA degradation, and this effect was much more apparent under low temperature condition. On the other hand, the inhibitive effect on CA degradation at both lower and higher concentrations of bicarbonate was observed, and this inhibitive effect was much more apparent at higher bicarbonate concentration and lower temperature condition. While, at higher nitrate concentration the inhibitive effect on CA degradation under three temperature ranges was observed, and with the temperature increase this negative effect was apparently weakened. However, at lower nitrate concentration a slightly positive effect on CA degradation was found under T2 and T3 conditions. Moreover, when using a real wastewater treatment plant (WWTP) effluent spiked with CA over 99% of CA removal could be achieved under 30 degrees C within only 15 min compared with 40 and 80 min under 20 and 10 degrees C respectively, suggesting a significant promotion in CA degradation under higher temperature condition. Therefore, it can be concluded that temperature plays an
30 CFR 254.26 - What information must I include in the “Worst case discharge scenario” appendix?
2010-07-01
... and environmental importance, if any, specified in the appropriate Area Contingency Plan(s). (d) A... COAST LINE Oil-Spill Response Plans for Outer Continental Shelf Facilities § 254.26 What information... Control Systems for Use on Water, and ASTM F818-93, Standard Definitions Relating to Spill Response...
Badalamenti, Jonathan P; Erickson, Joshua D; Salomon, Christine E
2016-04-14
We sequenced and annotated the complete 7,170,504-bp genome of a novel secondary metabolite-producingStreptomycesstrain,Streptomyces albusSM254, isolated from copper-rich subsurface fluids at ~220-m depth within the Soudan Iron Mine (Soudan, MN, USA). Copyright © 2016 Badalamenti et al.
International Nuclear Information System (INIS)
Obi, C.M.
2000-01-01
The Area 25 Reactor Maintenance, Assembly, and Disassembly Decontamination Facility is identified in the Federal Facility Agreement and Consent Order (FFACO) as Corrective Action Unit (CAU) 254. CAU 254 is located in Area 25 of the Nevada Test Site and consists of a single Corrective Action Site CAS 25-23-06. CAU 254 will be closed, in accordance with the FFACO of 1996. CAU 254 was used primarily to perform radiological decontamination and consists of Building 3126, two outdoor decontamination pads, and surrounding soil within an existing perimeter fence. The site was used to decontaminate nuclear rocket test-car hardware and tooling from the early 1960s through the early 1970s, and to decontaminate a military tank in the early 1980s. The site characterization results indicate that, in places, the surficial soil and building materials exceed clean-up criteria for organic compounds, metals, and radionuclides. Closure activities are expected to generate waste streams consisting of nonhazardous construction waste. petroleum hydrocarbon waste, hazardous waste, low-level radioactive waste, and mixed waste. Some of the wastes exceed land disposal restriction limits and will require off-site treatment before disposal. The recommended corrective action was revised to Alternative 3- ''Unrestricted Release Decontamination, Verification Survey, and Dismantle Building 3126,'' in an addendum to the Correction Action Decision Document
2010-07-01
... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Standards for coal processing and conveying equipment, coal storage systems, transfer and loading systems, and open storage piles. 60.254... (CONTINUED) STANDARDS OF PERFORMANCE FOR NEW STATIONARY SOURCES Standards of Performance for Coal Preparation...
Nuclear structure data from in beam and decay studies around 254No
International Nuclear Information System (INIS)
Jones, P.
2005-01-01
The study of trans-fermium nuclei, the heaviest nuclei for which in-beam spectroscopy studies are possible has provided over recent years a rich tapestry of data. These have enhanced the mean field theories important for the prediction of nuclear properties at the limits of the nuclear chart. Developments in spectrometer and data-acquisition techniques at the Department of Physics, University of Jyvaskyla have further enhanced the studies. Utilising the RITU gas-filled spectrometer, the GREAT focal plane spectrometer, the identification recoils and their subsequent decay modes (alpha-, fission-, and gamma-ray decay) have been studied. The JUROGAM gamma-ray array of 43 Compton-suppressed HPGe detectors has been employed in the in-beam spectroscopy of the trans-fermium region. In-beam gamma-ray spectroscopy studies of trans-fermium nuclei 253 No, 254 No, 250 Fm, 251 Md, 253 No and 255 Lr have been performed, as well as detailed focal plane spectroscopy. Selected highlights of the work will be presented
Cold valleys in the radioactive decay of 248-254Cf isotopes
International Nuclear Information System (INIS)
Biju, R.K.; Sahadevan, Sabina; Santhosh, K.P.; Joseph, Antony
2008-01-01
Based on the concept of cold valley in cold fission and fusion, we have investigated the cluster decay process in 248-254 Cf isotopes. In addition to alpha particle minima, other deep minima occur for S, Ar and Ca clusters. It is found that inclusion of proximity potential does not change the position of minima but minima become deeper. Taking Coulomb and proximity potential as interacting barrier for post-scission region, we computed half-lives and other characteristics for various clusters from these parents. Our study reveals that these parents are stable against light clusters and unstable against heavy clusters. Computed half-lives for alpha decay agree with experimental values within two orders of magnitude. The most probable clusters from these parents are predicted to be 46 Ar, 48,50 Ca which indicate the role of doubly or near doubly magic clusters in cluster radioactivity. Odd A clusters are found to be favorable for emission from odd A parents. Cluster decay model is extended to symmetric region and it is found that symmetric fission is also probable which stresses the role of doubly or near doubly magic 132 Sn nuclei. Geiger-Nuttal plots were studied for various clusters and are found to be linear with varying slopes and intercepts. (author)
A prospective study on time to recovery in 254 injured novice runners.
Directory of Open Access Journals (Sweden)
Rasmus Oestergaard Nielsen
Full Text Available Describe the diagnoses and the time to recovery of running-related injuries in novice runners.Prospective cohort study on injured runners.This paper is a secondary data analysis of a 933-person cohort study (DANO-RUN aimed at characterizing risk factors for injury in novice runners. Among those sustaining running-related injuries, the types of injuries and time to recovery is described in the present paper. All injured runners were diagnosed after a thorough clinical examination and then followed prospectively during their recovery. If they recovered completely from injury, time to recovery of each injury was registered.A total of 254 runners were injured. The proportion of runners diagnosed with medial tibial stress syndrome was 15%, 10% for patellofemoral pain, 9% for medial meniscal injury, 7% for Achilles tendinopathy and 5% for plantar fasciitis. Among the 220 runners (87% recovering from their injury, the median time to recovery was 71 days (minimum = 9 days, maximum = 617 days.Medial tibial stress syndrome was the most common injury followed by patellofemoral pain, medial meniscal injury and Achilles tendinopathy. Half of the injured runners were unable to run 2×500 meters without pain after 10 weeks. Almost 5% of the injured runners received surgical treatment.
Critical pitting temperature for Type 254 SMO stainless steel in chloride solutions
International Nuclear Information System (INIS)
Abd El Meguid, E.A.; Abd El Latif, A.A.
2007-01-01
The variation with time of the open circuit potential of high molybdenum containing stainless steel (Type 254 SMO) was measured in 4% sodium chloride solution in the temperatures range 30-100 deg. C. The plot of steady state potentials as function of temperature showed an inflection at 50 deg. C, attributed to the decrease of oxygen solubility in test solution above 50 deg. C. Potentiodynamic cycling anodic polarization technique was used to determine the critical pitting potential (E pit ) and the critical protection potential (E prot ) of the steel in 4-30% NaCl solutions at temperatures between 30 and 100 deg. C. By plotting the two values versus solution temperature, the corresponding critical pitting (CPT) and the critical protection (CPrT) temperatures were determined. Both parameters decreased with increasing chloride content. Above the CPT, E pit and E prot decreased linearly with log[Cl - ]. The addition of bromide ions to the solution shifted both E pit and E prot towards positive values. In 4% NaCl, E pit increased linearly with pH in the range 1-10. The combined effect of chloride ion concentration and pH on the morphology of the pits was examined by scanning electron microscopy (SEM) following potentiodynamic cycling anodic polarization
Joint Institute for Nuclear Research Data Analysis Guide - Berkelium Edition
International Nuclear Information System (INIS)
Henderson, R.A.
2009-01-01
This is a data analysis guide to the JINR system developed by Roger Henderson. It is intended as a complete guide to the data format and the calibration parameters utilized for the analysis of the data. This guide will provide the basic structure of the data files, the description of the individual data items, and the basic equations developed for the calculation of the results. Currently (7/17/2009), calculation of the calibration parameters is not a covered topic. It is intended that this will be covered in a future update
Chelation and stabilization of berkelium in oxidation state +IV
Czech Academy of Sciences Publication Activity Database
Deblonde, G. J.-P.; Sturzbecher-Hoehne, M.; Rupert, P. B.; An, D. D.; Illy, M.-C.; Ralston, C. Y.; Brabec, Jiří; de Jong, W. A.; Strong, R. K.; Abergel, R. J.
2017-01-01
Roč. 9, č. 9 (2017), s. 843-849 ISSN 1755-4330 Institutional support: RVO:61388955 Keywords : bioorganic chemistry * chemical bonding * mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 25.870, year: 2016
2010-04-01
... up costs” incurred after the effective date of rescission? Yes. ... 25 Indians 2 2010-04-01 2010-04-01 false May the contractor be reimbursed for actual and reasonable âwind up costsâ incurred after the effective date of rescission? 900.254 Section 900.254 Indians...
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Special requirements for ancillary terrestrial components operating in the 1610-1626.5 MHz/2483.5-2500 MHz bands. 25.254 Section 25.254 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical...
International Nuclear Information System (INIS)
Turner, M.A.; Webb, R.B.
1981-01-01
Comparative mutagenesis and possible synergistic interaction between broad-spectrum (313- to 405-nm) near-ultraviolet (black light bulb [BLB]) radiation and 254-nm radiation were studied in Escherichia coli strains WP2 (wild type), WP2s (uvrA), WP10 (recA), WP6 (polA), WP6s (polA uvrA), WP100 (uvrA recA), and WP5 (lexA). With BLB radiation, strains WP2s and WP6s demonstrated a high level of mutagenesis, whereas strains WP2, WP5, WP6, WP10, and WP100 did not demonstrate significant mutagenesis. In contrast, 254-nm radiation was mutagenic in strains WP2, WP2s, WP6, and WP6s, but strains WP5, WP10, and WP100 were not significantly mutated. The absence of mutagenesis by BLB radiation in lexA and recA strains WP10, WP5, and WP100 suggests that lex + rec + repair may play a major role in mutagenesis by both BLB and 254-nm radiation. The hypothesis that BLB radiation selectively inhibits rec + lex + repair was tested by sequential BLB-254 nm radiation. With strain WP2, a fluence of 30 J/m 2 at 254 nm induced trp + revertants at a frequency of 15 x 10 -6 . However, when 10 5 J/m 2 or more BLB radiation preceded the 254-nm exposure, no trp + revertants could be detected. A similar inhibition of 254-nm mutagenesis was observed with strain WP6 (polA). However, strains WP2s (uvrA) and WP6s (polA uvrA) showed enhanced 254-nm mutagenesis when a prior exposure to BLB radiation was given
Daraiseh, Susan I; Kassardjian, Ari; Alexander, Karen E; Rizkallah, Raed; Hurt, Myra M
2018-05-25
Yin Yang 1 (YY1) is a multifunctional transcription factor that can activate or repress transcription depending on the promotor and/or the co-factors recruited. YY1 is phosphorylated in various signaling pathways and is critical for different biological functions including embryogenesis, apoptosis, proliferation, cell-cycle regulation and tumorigenesis. Here we report that YY1 is a substrate for c-Abl kinase phosphorylation at conserved residue Y254 in the spacer region. Pharmacological inhibition of c-Abl kinase by imatinib, nilotinib and GZD824, knock-down of c-Abl using siRNA, and the use of c-Abl kinase-dead drastically reduces tyrosine phosphorylation of YY1. Both radioactive and non-radioactive in vitro kinase assays, as well as co-immunoprecipitation in different cell lines, show that the target of c-Abl phosphorylation is tyrosine residue 254. c-Abl phosphorylation has little effect on YY1 DNA binding ability or cellular localization in asynchronous cells. However, functional studies reveal that c-Abl mediated phosphorylation of YY1 regulates YY1's transcriptional ability in vivo. In conclusion, we demonstrate the novel role of c-Abl kinase in regulation of YY1's transcriptional activity, linking YY1 regulation with c-Abl tyrosine kinase signaling pathways. Copyright © 2018. Published by Elsevier B.V.
International Nuclear Information System (INIS)
Skoutelis, Charalambos G.; Vlastos, Dimitris; Kortsinidou, Marianna C.; Theodoridis, Ioannis T.; Papadaki, Maria I.
2011-01-01
Highlights: ► 2-Hydroxypyridine (2-HPY) is the major metabolite of 2-halogenated pyridines photolysis. ► We examine the genotoxicity of 2-HPY in cultured human lymphocytes applying the micronucleus assay. ► 2-HPY was found to be genotoxic. ► Aqueous solutions of 2-HPY were irradiated by UV at 254 nm. ► Solution genotoxicity can be completely removed after prolonged phototreatment. - Abstract: 2-Hydroxypyridine (2-HPY) is a major first-stage product formed upon the photolytic destruction of 2-halogenated pyridines. Genotoxicity of 2-HPY in water was studied as a function of concentration. Aqueous solutions of 2-HPY were irradiated by ultraviolet (UV) at 254 nm. 2-HPY concentration, solution total organic carbon (TOC) concentration and solution genotoxicity were measured as a function of treatment time and their profile as a function of time is presented in this work. 2-HPY was found to be genotoxic at all concentrations in the range of 5–400 μg ml −1 . 2-HPY mineralises completely upon prolonged UV irradiation. All untreated and irradiated solution samples, taken at different photo-treatment times, were tested in cultured human lymphocytes applying the cytokinesis block micronucleus (CBMN) assay. The genotoxicity of the solution was reduced near to the control level after prolonged UV irradiation.
International Nuclear Information System (INIS)
Calkins, J.; Wheeler, J.S.; Keller, C.I.; Colley, E.; Hazle, J.D.
1988-01-01
The action spectra of five eukaryotic organisms and the prokaryote, Escherichia coli, were examined over the wavelength range, 254-320 nm. Both the repair competent and three repair defective strains (E. coli, Caenorhabditis elegans, Saccharomyces) were examined. Tetrahymena pyriformis action spectra were performed with and without the excision repair inhibitor caffeine present. Others have observed that lethality, mutation, and the production of pyrimidine dimers show much the same wavelength dependence as DNA absorption. The results presented here demonstrate several action spectra which deviate from the DNA absorption spectra. Ultraviolet sensitization ratios (repair competent/repair defective) were also examined and were shown to change over the wavelength range. These findings suggest that DNA may not be the only important chromophore leading to cell death in the uv wavelength range studied. Since uv-B is of major importance in solar uv damage, these findings may also yield important implications for solar uv studies
Energy Technology Data Exchange (ETDEWEB)
G. N. Doyle
2002-02-01
Corrective Action Unit (CAU) 254 is located in Area 25 of the Nevada Test Site (NTS), approximately 100 kilometers (km) (62 miles) northwest of Las Vegas, Nevada. The site is located within the Reactor Maintenance, Assembly and Disassembly (R-MAD) compound and consists of Building 3126, two outdoor decontamination pads, and surrounding areas within an existing fenced area measuring approximately 50 x 37 meters (160 x 120 feet). The site was used from the early 1960s to the early 1970s as part of the Nuclear Rocket Development Station program to decontaminate test-car hardware and tooling. The site was reactivated in the early 1980s to decontaminate a radiologically contaminated military tank. This Closure Report (CR) describes the closure activities performed to allow un-restricted release of the R-MAD Decontamination Facility.
Energy Technology Data Exchange (ETDEWEB)
Watanabe, Masaki; Takahashi, Akira (Nagoya Univ. (Japan). Faculty of Medicine); Arahata, Yutaka; Motegi, Yoshimasa; Furuse, Masahiro
1993-11-01
A total of 254 patients who were proved to have pontine high intensity areas on T[sub 2]-weighted magnetic resonance imaging (MRI) were analyzed in relation to brain stem semiology. A comparative study on MRI and MR angiography was made between 254 patients with pontine high signals and 276 control cases showing no abnormality either on T[sub 1] or T[sub 2]-weighted images. Of the 254 patients, 62 had transient subjective complaints such as vertigo-dizziness. Supratentorial high signals, basilar artery tortuousness and vertebral artery asymmetry on MR angiography were seen more frequently in patients with pontine high signals than in the controls. In conclusion, pontine high signals may result from diffuse arteriosclerosis and MR angiography is considered to be a useful screening method. (author).
International Nuclear Information System (INIS)
2000-01-01
This Corrective Action Decision Document identifies and rationalizes the US Department of Energy, Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 254, R-MAD Decontamination Facility, under the Federal Facility Agreement and Consent Order. Located in Area 25 at the Nevada Test Site in Nevada, CAU 254 is comprised of Corrective Action Site (CAS) 25-23-06, Decontamination Facility. A corrective action investigation for this CAS as conducted in January 2000 as set forth in the related Corrective Action Investigation Plan. Samples were collected from various media throughout the CAS and sent to an off-site laboratory for analysis. The laboratory results indicated the following: radiation dose rates inside the Decontamination Facility, Building 3126, and in the storage yard exceeded the average general dose rate; scanning and static total surface contamination surveys indicated that portions of the locker and shower room floor, decontamination bay floor, loft floor, east and west decon pads, north and south decontamination bay interior walls, exterior west and south walls, and loft walls were above preliminary action levels (PALs). The investigation-derived contaminants of concern (COCs) included: polychlorinated biphenyls, radionuclides (strontium-90, niobium-94, cesium-137, uranium-234 and -235), total volatile and semivolatile organic compounds, total petroleum hydrocarbons, and total Resource Conservation and Recovery Act (Metals). During the investigation, two corrective action objectives (CAOs) were identified to prevent or mitigate human exposure to COCs. Based on these CAOs, a review of existing data, future use, and current operations at the Nevada Test Site, three CAAs were developed for consideration: Alternative 1 - No Further Action; Alternative 2 - Unrestricted Release Decontamination and Verification Survey; and Alternative 3 - Unrestricted
Bialy, C; Horne, K; Dendle, C; Kanellis, J; Littlejohn, G; Ratnam, I; Woolley, I
2015-06-01
Our primary aim was to determine the rate of overseas travel in immunocompromised individuals attending appropriate clinics at an Australian tertiary care hospital. We also aimed to characterise health-seeking behaviour prior to travel and investigated sources of pre-travel advice, compared travel patterns and activities between three specific immunosuppressed groups, and examined pre-immunosuppression patient serology. We implemented a cross-sectional survey of patients between February and August 2012. This survey was implemented among three outpatient populations at Monash Medical Centre, an Australian tertiary care hospital. We recruited 254 immunosuppressed adults from three patient populations: human immunodeficiency virus-positive individuals, renal transplant patients and rheumatology patients requiring immunosuppressive therapy. No clinical intervention was performed. In the 10 years preceding the survey, 153 (60.2%) participants reported international travel. Of these, 105 (68.6%) were immunosuppressed at the time of travel. These patients were 47.6% male and 60% Australian born. Forty per cent were visiting friends and relatives as part of their travel. Fifty-four per cent of those immunocompromised at the time of travel were going to high-risk destinations. Pathology files indicated that serological screening was frequently not performed prior to immunosuppression in the renal transplant and rheumatology groups. Immunocompromised patients often travel to high-risk destinations with limited or inadequate pre-travel preparations. Doctors caring for the immunocompromised should be aware of travel risks, suitable vaccination protocols and when to refer to specialist travel clinics. © 2015 Royal Australasian College of Physicians.
Czech Academy of Sciences Publication Activity Database
Sysalová, J.; Kučera, Jan; Fikrle, Marek; Drtinová, B.
2013-01-01
Roč. 110, SEP (2013), s. 691-694 ISSN 0026-265X R&D Projects: GA ČR GAP503/12/0682; GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:61389005 Keywords : Mercury * contaminated soils * AMA-254 * RNAA Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.583, year: 2013
48 CFR 15.403-4 - Requiring certified cost or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b).
2010-10-01
... or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b). 15.403-4 Section 15.403-4 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 15.403-4 Requiring certified cost or pricing data (10 U.S.C. 2306a and 41 U.S.C...
Study of the average charge states of 188Pb and 252,254No ions at the gas-filled separator TASCA
International Nuclear Information System (INIS)
Khuyagbaatar, J.; Ackermann, D.; Andersson, L.-L.; Ballof, J.; Brüchle, W.; Düllmann, Ch.E.; Dvorak, J.; Eberhardt, K.; Even, J.; Gorshkov, A.; Graeger, R.; Heßberger, F.-P.; Hild, D.; Hoischen, R.; Jäger, E.; Kindler, B.
2012-01-01
The average charge states of 188 Pb and 252,254 No ions in dilute helium gas were measured at the gas-filled recoil separator TASCA. Hydrogen gas was also used as a filling gas for measurements of the average charge state of 254 No. Helium and hydrogen gases at pressures from 0.2 mbar to 2.0 mbar were used. A strong dependence of the average charge state on the pressure of the filling gases was observed for both, helium and hydrogen. The influence of this dependence, classically attributed to the so-called “density effect”, on the performance of TASCA was investigated. The average charge states of 254 No ions were also measured in mixtures of helium and hydrogen gases at low gas pressures around 1.0 mbar. From the experimental results simple expressions for the prediction of average charge states of heavy ions moving in rarefied helium gas, hydrogen gas, and in their mixture were derived.
Martignac, Marion; Balayssac, Stéphane; Gilard, Véronique; Benoit-Marquié, Florence
2015-06-18
We have investigated the removal of bortezomib, an anticancer drug prescribed in multiple myeloma, using the photochemical advanced oxidation process of V-UV/UV (185/254 nm). We used two complementary analytical techniques to follow the removal rate of bortezomib. Nuclear magnetic resonance (NMR) is a nonselective method requiring no prior knowledge of the structures of the byproducts and permits us to provide a spectral signature (fingerprinting approach). This untargeted method provides clues to the molecular structure changes and information on the degradation of the parent drug during the irradiation process. This holistic NMR approach could provide information for monitoring aromaticity evolution. We use liquid chromatography, coupled with high-resolution mass spectrometry (LC-MS), to correlate results obtained by (1)H NMR and for accurate identification of the byproducts, in order to understand the mechanistic degradation pathways of bortezomib. The results show that primary byproducts come from photoassisted deboronation of bortezomib at 254 nm. A secondary byproduct of pyrazinecarboxamide was also identified. We obtained a reliable correlation between these two analytical techniques.
International Nuclear Information System (INIS)
Drakakis, E.; Karabourniotis, D.
2012-01-01
For developing low-wattage high intensity discharge (HID) lamps, a better understanding of the relatively unexplored nonequilibrium phenomena is essential. This needs interpretation of diagnostic results by methods free from equilibrium assumptions. In this paper, the atomic temperature is determined from the simulation of a quasistatic broadened resonance line by distinguishing between atomic temperature and excitation temperature in the equation of radiative transfer. The proposed method is applied to the red wing of the resonance mercury line 254 nm emitted from a HID lamp working on ac. The experimental results show severe deviation from local thermodynamic equilibrium. More than one thousand degrees difference was obtained between atomic and electron temperatures at the maximum current phase.
Energy Technology Data Exchange (ETDEWEB)
Drakakis, E. [Technological Educational Institute, Department of Electrical Engineering, 71004 Heraklion (Greece); Karabourniotis, D. [Institute of Plasma Physics, Department of Physics, University of Crete, 71003 Heraklion (Greece)
2012-09-01
For developing low-wattage high intensity discharge (HID) lamps, a better understanding of the relatively unexplored nonequilibrium phenomena is essential. This needs interpretation of diagnostic results by methods free from equilibrium assumptions. In this paper, the atomic temperature is determined from the simulation of a quasistatic broadened resonance line by distinguishing between atomic temperature and excitation temperature in the equation of radiative transfer. The proposed method is applied to the red wing of the resonance mercury line 254 nm emitted from a HID lamp working on ac. The experimental results show severe deviation from local thermodynamic equilibrium. More than one thousand degrees difference was obtained between atomic and electron temperatures at the maximum current phase.
International Nuclear Information System (INIS)
Tarvainen, A.-M.
2011-08-01
Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of shallow drillholes ONK-PP223, ONK-PP226, ONK-PP254, ONKPP259, ONK-PP260 and ONK-PP261 at ONKALO in the investigation niche ONKTKU- 3 (POSE) between December 2009 and June 2010. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)
Directory of Open Access Journals (Sweden)
Emrah Peşman
2011-04-01
Full Text Available ABSTRACT As it is known, mechanical pulp papers include significant amount of lignin and carbohydrates as well as cellulose. Thus, when these lignin reach papers irradiated with short wave UV light they could not protect their color. In this study, bleaching of ONP/OMG recycled pulps with hydrogen peroxide, sodium percarbonate, sodium dithyonite, sodium borohydride and formamidin sulfunic acid were performed. Then the test papers of these pulps were irradiated with 254-366nm UV light and changes in the ISO Brightness, CIE L*a*b*, yellowness (YI and whiteness (WI values were observed. At the result of study, all bleaching agents were determined as insufficient in the respect of color stability. But if they compared with each other, the two stages sodium percarbonate-sodium borohydride bleaching sequence was gave the best results against to color reversion. Keywords: Old news/old magazine papers (ONP/OMG, Bleaching, Color Stability, UV Irradiation
International Nuclear Information System (INIS)
Kamchatova, I.E.; Chunaev, A.S.; Bronnikov, V.A.
1987-01-01
In experiments on related Chlamidomonas reinhardii strains of similar mating type a study was made of sensitivity of cells with different carotenoid content to UV-radiation of 254 nm. Mutants having a lower, as opposed to the wild type strain, content of carotenoids exhibited an increased radiosensitivity. A carotenoid-free mutant was found to possess a higher sensitivity to UV-radiation which was typical of the strain with the impaired excision repair system. The studied subclone of the UV-radiosensitive strain CC-888 was unable to photoreactivate the UV-induced damages which was typical of the wild-type strain. The content of carotenoids in cells of this subnuclone exceeded that in cells of mutants with the reduced pigmentation
Projecto 254 - Produção de suínos ao ar livre : unidade de demonstração Programa AGRO
Marinho, M.C.; Dias, S.F.; Rodrigues, J.P.V.
2006-01-01
A produção de suínos ao ar livre pode contribuir para a preservação e valorização das raças autóctones e dos produtos delas derivados, evitando assim a sua extinção. O projecto, Produção de suínos ao ar livre – Unidade de demonstração, cujo período de execução vai de setembro de 2004 a dezembro de 2006, tem como principal objectivo demonstrar a tecnologia de produção de leitões ao ar livre. Programa AGRO - Projecto 254, Medida 8.1.
Dau, Phuong D; Vasiliu, Monica; Peterson, Kirk A; Dixon, David A; Gibson, John K
2017-12-06
Actinyl chemistry is extended beyond Cm to BkO 2 + and CfO 2 + through transfer of an O atom from NO 2 to BkO + or CfO + , establishing a surprisingly high lower limit of 73 kcal mol -1 for the dissociation energies, D[O-(BkO + )] and D[O-(CfO + )]. CCSD(T) computations are in accord with the observed reactions, and characterize the newly observed dioxide ions as linear pentavalent actinyls; these being the first Bk and Cf species with oxidation states above IV. Computations of actinide dioxide cations AnO 2 + for An=Pa to Lr reveal an unexpected minimum for D[O-(CmO + )]. For CmO 2 + , and AnO 2 + beyond EsO 2 + , the most stable structure has side-on bonded η 2 -(O 2 ), as An III peroxides for An=Cm and Lr, and as An II superoxides for An=Fm, Md, and No. It is predicted that the most stable structure of EsO 2 + is linear [O=Es V =O] + , einsteinyl, and that FmO 2 + and MdO 2 + , like CmO 2 + , also have actinyl(V) structures as local energy minima. The results expand actinide oxidation state chemistry, the realm of the distinctive actinyl moiety, and the non-periodic character towards the end of the periodic table. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Total neutron cross sections of berkelium-249 and californium-249 below 100 eV
International Nuclear Information System (INIS)
Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.
1979-01-01
The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data
Energy Technology Data Exchange (ETDEWEB)
Abdelraheem, Wael H.M. [Chemistry Department, Faculty of Science, Sohag University, Sohag 82524 (Egypt); Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); He, Xuexiang; Duan, Xiaodi [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); NIREAS-International Water Research Center, University of Cyprus, Nicosia 1678 (Cyprus); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); NIREAS-International Water Research Center, University of Cyprus, Nicosia 1678 (Cyprus)
2015-01-23
Graphical abstract: - Highlights: • UV-254 nm/H{sub 2}O{sub 2} AOP was utilized for the degradation and mineralization of PBSA and BSA. • Promotion of k{sub obs} with [H{sub 2}O{sub 2}]{sub 0} ≤ 4 mM and inhibition at higher [H{sub 2}O{sub 2}]{sub 0} were observed. • The S and N were released and monitored as SO{sub 4}{sup 2−} and NH{sub 4}{sup +}, respectively. • Br{sup −} inhibited both the degradation and mineralization much more significantly than Cl{sup −}. • There was an increase in [NH{sub 4}{sup +}] at higher [H{sub 2}O{sub 2}]{sub 0} and its further destruction at higher UV fluence. - Abstract: Various studies have revealed the non-biodegradable and endocrine disrupting properties of sulfonated organic UV absorbers, directing people's attention toward their risks on ecological and human health and hence their removal from water. In this study, UV-254 nm/H{sub 2}O{sub 2} advanced oxidation process (AOP) was investigated for degrading a model UV absorber compound 2-phenylbenzimidazole-5-sulfonic acid (PBSA) and a structurally similar compound 1H-benzimidazole-2-sulfonic acid (BSA), with a specific focus on their mineralization. At 4.0 mM [H{sub 2}O{sub 2}]{sub 0}, a complete removal of 40.0 μM parent PBSA and 25% decrease in TOC were achieved with 190 min of UV irradiation; SO{sub 4}{sup 2−} was formed and reached its maximum level while the release of nitrogen as NH{sub 4}{sup +} was much lower (around 50%) at 190 min. Sulfate removal was strongly enhanced by increasing [H{sub 2}O{sub 2}]{sub 0} in the range of 0–4.0 mM, with slight inhibition in 4.0–12.0 mM. Faster and earlier ammonia formation was observed at higher [H{sub 2}O{sub 2}]{sub 0}. The presence of Br{sup −} slowed down the degradation and mineralization of both compounds while a negligible effect on the degradation was observed in the presence of Cl{sup −}. Our study provides important technical and fundamental results on the HO{sup ·} based degradation and
Kwon, Minhwan; Yoon, Yeojoon; Kim, Seonbaek; Jung, Youmi; Hwang, Tae-Mun; Kang, Joon-Wun
2018-05-15
The aim of this study is to evaluate the micropollutant removal capacity of a 275 nm light-emitting diode (LED)-UV/chlorine system. The sulfamethoxazole, ibuprofen, and nitrobenzene removal efficiencies of this system were compared with those of a conventional 254 nm low-pressure (LP)-UV system as a function of the UV dose. In a direct photolysis system, the photon reactivity of sulfamethoxazole is higher than that of nitrobenzene and ibuprofen at both wavelengths. The molar absorption coefficients and quantum yields of each micropollutant were as follows: sulfamethoxazole (ε SMX, 275 nm protonated = 17,527 M -1 cm -1 , Φ SMX, 275 nm protonated = 0.239, ε SMX, 275 nm deprotonated = 8430 M -1 cm -1 , and Φ SMX, 275 nm deprotonated = 0.026), nitrobenzene (ε NB, 275 nm = 7176 M -1 cm -1 and Φ NB, 275 nm = 0.057), and ibuprofen (ε NB, 275 nm = 200 M -1 cm -1 and Φ IBF, 275 nm = 0.067). The photon reactivity of chlorine species, i.e., HOCl and OCl-, were determined at 275 nm (ε HOCl, 275 nm = 28 M -1 cm -1 , Φ HOCl, 275 nm = 1.97, ε OCl-, 275 nm = 245 M -1 cm -1 , and Φ OCl-, 275 nm = 0.8), which indicate that the decomposition rate of OCl - is higher and that of HOCl is lower by 275 nm photolysis than that by 254 nm photolysis (ε HOCl, 254 nm = 60 M -1 cm -1 , Φ HOCl, 254 nm = 1.46, ε OCl-, 254 nm = 58 M -1 cm -1 , and Φ OCl-, 254 nm = 1.11). In the UV/chlorine system, the removal rates of ibuprofen and nitrobenzene were increased by the formation of OH and reactive chlorine species. The 275-nm LED-UV/chlorine system has higher radical yields at pH 7 and 8 than the 254 nm LP-UV/chlorine system. Copyright © 2018 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Gurzadyan, G.G.; Goerner, H.
1994-01-01
Photoreactions, such as base release and decomposition of the base moeity, induced by either 20 ns laser pulses at 193 nm or continuous 254 nm irradiation, were studied for a series of uracil and adenine derivatives in neutral aqueous solution. The quantum yield of chromophore loss (Φ cl ) depends significantly on the nature of the nucleic acid constituent and the saturating gas (Ar, N 2 O or O 2 ). In the case of polynucleotides the destruction of nucleotides was measured by high-performance liquid chromatography after hydrolysis; the quantum yields (Φ dn ) are comparable to those of chromophore loss or larger. The Φ cl and Φ dn of 0.04-0.1 for poly(U) and poly(dU), obtained for both wavelengths of irradiation, are due to processes originating from the lowest excited singlet state, i.e. formation of photohydrates and photodimers, and a second part from photoionization using λ irr = 193 nm. Irradiation at 193 nm effectively splits pyrimidine dimers and thus reverts them into monomers. (author)
Energy Technology Data Exchange (ETDEWEB)
Nasuhoglu, Deniz; Yargeau, Viviane [Department of Chemical Engineering, McGill University, 3610 University Street, Montreal, Quebec, H3A 2B2 (Canada); Berk, Dimitrios, E-mail: dimitrios.berk@mcgill.ca [Department of Chemical Engineering, McGill University, 3610 University Street, Montreal, Quebec, H3A 2B2 (Canada)
2011-02-15
In this study, photolytic and photocatalytic removal of the antibiotic sulfamethoxazole (SMX) under UVC radiation ({lambda} = 254 nm) was investigated. The light intensity distribution inside the batch photoreactor was characterized by azoxybenzene actinometry. The intensity of incident radiation was found to be a strong function of position inside the reactor. 12 mg L{sup -1} of SMX was completely removed within 10 min of irradiation under UVC photolysis, compared to 30 min under TiO{sub 2} photocatalysis. COD measurement was used as an indication of the mineralization efficiency of both processes and higher COD removal with photocatalysis was shown. After 6 h of reaction with photolysis and photocatalysis, 24% and 87% removal of COD was observed, respectively. Two of the intermediate photo-products were identified as sulfanilic acid and 3-amino-5-methylisoxazole by direct comparison of the HPLC chromatograms of standards to those of treated solutions. Ecotoxicity of treated and untreated solutions of SMX towards Daphnia magna was also investigated. It was found that a 3:1 ratio of sample to standard freshwater and a high initial concentration of 60 mg L{sup -1} of SMX were used to obtain reliable and reproducible results. The photo-products formed during photocatalytic and photolytic processes were shown to be generally more toxic than the parent compound.
International Nuclear Information System (INIS)
Hoffman, D.C.
1976-01-01
Recent measurements have shown that 259 Fm gives the highest total kinetic energy release and the most symmetric mass division so far observed for spontaneous fission. These results continue the trends observed previously in the fermium isotopes toward higher total kinetic energies and more symmetric mass division with increasing mass of the fermium isotopes. The transition from asymmetric mass division ( 254 Fm) to highly favored symmetric mass division ( 259 Fm) now appears to have been completed. These features are consistent with the simple postulate that the more neutron-rich fermium isotopes show an increase in the yield of symmetric fragments and in the total kinetic energy because symmetric mass division of fermium (Z = 100) nuclei results in two fragments which have the magic proton number of 50 and are close to the magic neutron number of 82. The proximity of the fragments to the doubly magic configuration seems to have a profound effect on the mass division and total kinetic energy release in fission
International Nuclear Information System (INIS)
Nasuhoglu, Deniz; Yargeau, Viviane; Berk, Dimitrios
2011-01-01
In this study, photolytic and photocatalytic removal of the antibiotic sulfamethoxazole (SMX) under UVC radiation (λ = 254 nm) was investigated. The light intensity distribution inside the batch photoreactor was characterized by azoxybenzene actinometry. The intensity of incident radiation was found to be a strong function of position inside the reactor. 12 mg L -1 of SMX was completely removed within 10 min of irradiation under UVC photolysis, compared to 30 min under TiO 2 photocatalysis. COD measurement was used as an indication of the mineralization efficiency of both processes and higher COD removal with photocatalysis was shown. After 6 h of reaction with photolysis and photocatalysis, 24% and 87% removal of COD was observed, respectively. Two of the intermediate photo-products were identified as sulfanilic acid and 3-amino-5-methylisoxazole by direct comparison of the HPLC chromatograms of standards to those of treated solutions. Ecotoxicity of treated and untreated solutions of SMX towards Daphnia magna was also investigated. It was found that a 3:1 ratio of sample to standard freshwater and a high initial concentration of 60 mg L -1 of SMX were used to obtain reliable and reproducible results. The photo-products formed during photocatalytic and photolytic processes were shown to be generally more toxic than the parent compound.
Energy Technology Data Exchange (ETDEWEB)
Quici, Natalia; Vera, Maria L.; Choi, Hyeok; Puma, Gianluca Li; Dionysiou, Dionysios D.; Litter, Marta I.; Destaillats, Hugo
2009-07-01
The effect of key experimental parameters on the removal of toluene under 254 + 185 nm irradiation was investigated using a benchtop photocatalytic flow reactor. Toluenewas introduced at low concentrations between 10 and 500 ppbv, typical of indoorenvironments, and reacted on TiO2-coated Raschig rings. Two different TiO2-coated rings were prepared: in one case, by dip-coating using a P25 aqueous suspension and, on the other, using an organic/inorganic sol-gel method that produced thin films of mesoporous anatase. Flow rates in the photoreactor varied between 4 L min-1 and 125 mL min-1, leading to residence times in the range 100 ms< tau< 2 s. For these conditions, toluene removal efficiencies were between 30 and 90percent, indicating that the system did not achieve total conversion in any case. For each air flow rate, the conversion oftoluene was significantly higher when the reactor length was 10 cm, as compared with 5 cm; however, only marginal increases in conversions were achieved in the two reactor lengths at equal residence time and different concentration of toluene, suggesting that that the reactor is effectively behaving as an ideal reactor and that the reaction is first-order in the concentration of toluene. Experiments were carried out between 0 and 66percent relative humidity (RH), the fastest reaction rate being observed at moderately low humidity conditions (10percent RH), with respect to both dry air and higher humidity levels. Formaldehyde was formed as a partial oxidation byproduct at low and at high residence times (240 and 960 ms), although higher formaldehyde molar yields (up to 20percent) were observed at low tau (240 ms) and moderate humidity conditions (10 and 33percent), suggesting that both tau and RH can be optimized toreduce the formation of harmful intermediates. Toluene removal efficiency increased with the TiO2 thickness (i.e., mass) until a maximum value of 500 nm, beyond which the removal efficiency decreased. This should be
Directory of Open Access Journals (Sweden)
Asha V. Chate
2012-01-01
Full Text Available A series of novel 2-(5-(4-(allyloxy-3-methoxyphenyl-1H-pyrazol-3-ylphenols derivatives have been synthesized via the ring opening of 2-(4-(allyloxy-3-methoxyphenyl-4H-chromen-4-ones in ethanol and hydrazine hydrate under reflux condition. The synthesized compounds were screened for antibacterial and antifungal activity against bacteria Staphylococcus aureus (MRSA E710 and Escherichia coli (ATCC 25922 and fungi Candida albicans and Aspergillus fumigates respectively. Some of the tested compounds showed significant antimicrobial activity. 1H NMR, IR, Mass spectral data and elemental analysis elucidated the structures of the all newly synthesized compounds.
Diwaker
2014-07-01
The electronic, NMR, vibrational, structural properties of a new pyrazoline derivative: 2-(5-(4-Chlorophenyl)-3-(pyridine-2-yl)-4,5-dihydropyrazol-1-yl)benzo[d]thiazole has been studied using Gaussian 09 software package. Using VEDA 4 program we have reported the PED potential energy distribution of normal mode of vibrations of the title compound. We have also reported the 1H and 13C NMR chemical shifts of the title compound using B3LYP level of theory with 6-311++G(2d,2p) basis set. Using time dependent (TD-DFT) approach electronic properties such as HOMO and LUMO energies, electronic spectrum of the title compound has been studied and reported. NBO analysis and MEP surface mapping has also been calculated and reported using ab initio methods.
International Nuclear Information System (INIS)
Belanova, T.S.
1994-12-01
Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs
da Costa, Marianges Zadrozny Gouvêa; Pires, Júlia Glória Lucatelli; Nasser, Paulo Dominguez; Ferreira, Camila da Silva; Teixeira, Ana Cristina de Sá; Paranaguá-Vezozzo, Denise Cerqueira; Guarita, Dulce Reis; Carrilho, Flair José; Ono, Suzane Kioko
2016-10-01
This study aimed to investigate the association between chronic pancreatitis and smoking or genetic mutations. The study sample comprised 148 patients with chronic pancreatitis, 110 chronic alcoholic subjects without pancreatic disease, and 297 volunteer blood donors. Of the patients with chronic pancreatitis, 74% had alcoholic etiology and 26% had idiopathic pancreatitis. The frequency of smoking was 91.4% in patients with alcoholic pancreatitis, higher than 73.3% in alcoholic subjects without pancreatitis (P pancreatitis and blood donors. The N34S mutation of serine peptidase inhibitor, Kazal type 1 (SPINK1) was found in 2.7% of patients with chronic alcoholic pancreatitis, in 5.3% of patients with idiopathic pancreatitis, and in 0.4% of blood donors (P = 0.02). The P55S mutation of SPINK1 was found in 2.7% of patients with alcoholic pancreatitis and in 0.7% of blood donors (P = 0.12). The R254W mutation of chymotrypsin C was found in 0.9% of patients with alcoholic pancreatitis, in 0.9% of chronic alcoholic subjects without pancreatitis, and in 0.4% of blood donors (P = 0.75). In all cases, the mutations were heterozygous. Smoking and the N34S mutation of SPINK1 were positively correlated with chronic pancreatitis.
2010-01-01
... corporate charter to operate or license to do business as a school and should not be used unless the represented “approval” has been affirmatively required or authorized by State or Federal law. (c) Industry...
2010-07-01
... dangerous or impossible to respond to a spill. Area Contingency Plan means an Area Contingency Plan prepared... Contingency Plan means the National Oil and Hazardous Substances Pollution Contingency Plan prepared and... Comprehensive Environmental Response Compensation and Liability Act (42 U.S.C. 9605). National Contingency Plan...
Publications | Page 254 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Madagascar, the world's fourth largest island, is home to an astonishing range of life forms found nowhere else on the planet. Much of this biodiversity is highly vulnerable to climate change. So too are ... Blood on the Stone Ian Smillie in his own words. Below, Ian Smillie traces his involvement in the struggle to halt conflict ...
Reference: 254 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available plant cell growth and identify a plant S-acyl transferase, an essential research tool if we are to unders...tand how this important, reversible lipid modification operates in plant cells. The
2010-07-01
... of fish and wildlife habitats, cultural resources, watersheds, and wilderness and aesthetic values... use of the conveyed Federal land will not substantially conflict with established management... human health and the environment with respect to any such substances remaining on the property has been...
2010-07-01
..., use, physical characteristics, and other amenities. Arbitration is a process to resolve a disagreement... public domain for national forest purposes and the Geothermal Steam Act of 1970 (30 U.S.C. 1001 et seq.... Resource values means any of the various commodity values or non-commodity values, such as wildlife habitat...
2010-07-01
....9 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LANDOWNERSHIP... contributory value of any interest in land such as water rights, minerals, or timber, to the extent they are... the physical characteristics of the land being appraised; a statement of all encumbrances; title...
Publications | Page 254 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
restricted access). India''s trade policy has seen a marked shift towards regional trade agreements (RTAs). However, results of this survey show that a Generalized Scheme of Preferences (GSP) is a better preference-giving scheme than all of India''s ...
7 CFR 1944.254 - Program costs.
2010-01-01
... Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... supplies (including food) necessary to provide services; (iv) Operational costs of a transportation service... development of the application and plan of operations before the effective date of CHSP grant award; (vi...
He, Xuexiang; de la Cruz, Armah A; Hiskia, Anastasia; Kaloudis, Triantafyllos; O'Shea, Kevin; Dionysiou, Dionysios D
2015-05-01
Hepatotoxic microcystins (MCs) are the most frequently detected group of cyanobacterial toxins. This study investigated the degradation of common MC variants in water, MC-LR, MC-RR, MC-YR and MC-LA, by UV-254 nm-based processes, UV only, UV/H2O2, UV/S2O8(2-) and UV/HSO5(-). Limited direct photolysis of MCs was observed, while the addition of an oxidant significantly improved the degradation efficiency with an order of UV/S2O8(2-) > UV/HSO5(-) > UV/H2O2 at the same initial molar concentration of the oxidant. The removal of MC-LR by UV/H2O2 appeared to be faster than another cyanotoxin, cylindrospermopsin, at either the same initial molar concentration or the same initial organic carbon concentration of the toxin. It suggested a faster reaction of MC-LR with hydroxyl radical, which was further supported by the determined second-order rate constant of MCs with hydroxyl radical. Both isomerization and photohydration byproducts were observed in UV only process for all four MCs; while in UV/H2O2, hydroxylation and diene-Adda double bond cleavage byproducts were detected. The presence of a tyrosine in the structure of MC-YR significantly promoted the formation of monohydroxylation byproduct m/z 1061; while the presence of a second arginine in MC-RR led to the elimination of a guanidine group and the absence of double bond cleavage byproducts. It was therefore demonstrated in this study that the variable amino acids in the structure of MCs influenced not only the degradation kinetics but also the preferable reaction mechanisms. Copyright © 2015 Elsevier Ltd. All rights reserved.
Miguel Tolosa Igualada
2016-01-01
Daniel Gallego-Hernández (ed.). Current Approaches to Business and Institutional Translation. Proceedings of the International Conference on Economic, Business, Financial and Institutional Translation / Enfoques actuales en traducción económica e institucional. Actas del Congreso Internacional de Traducción Económica, Comercial, Financiera e Institucional. Suíça: Peter Lang, 2015, 254 páginas. ISBN 978-3-0343-1656-9.
Directory of Open Access Journals (Sweden)
Miguel Tolosa Igualada
2016-05-01
Full Text Available http://dx.doi.org/10.5007/2175-7968.2016v36n2p291 Daniel Gallego Hernández (Ed.. Enfoques actuales en traducción económica e institucional. Actas del Congreso Internacional de Traducción Económica, Comercial, Financiera e Institucional. Suiça: Editorial Peter Lang, 2015. 254 p.
Energy Technology Data Exchange (ETDEWEB)
He, Xuexiang [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); Department of Civil and Environmental Engineering and Nireas-International Water Research Centre, School of Engineering, University of Cyprus, PO Box 20537, 1678 Nicosia (Cyprus); Mezyk, Stephen P. [Department of Chemistry and Biochemistry, California State University Long Beach, 1250 Bellflower Blvd., Long Beach, CA 90840 (United States); Michael, Irene; Fatta-Kassinos, Despo [Department of Civil and Environmental Engineering and Nireas-International Water Research Centre, School of Engineering, University of Cyprus, PO Box 20537, 1678 Nicosia (Cyprus); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); Department of Civil and Environmental Engineering and Nireas-International Water Research Centre, School of Engineering, University of Cyprus, PO Box 20537, 1678 Nicosia (Cyprus)
2014-08-30
Graphical abstract: - Highlights: • Removal efficiency was comparable at different UV fluence rates but same fluence. • Reducing pH to 3 or 2 did not inhibit the removal of nitrobenzene by UV/S{sub 2}O{sub 8}{sup 2−}. • 1.84 × 10{sup −14} M [HO{sup •} ]{sub ss} and 3.10 × 10{sup −13} M [SO{sub 4}{sup •} {sup −}]{sub ss} in UV/S{sub 2}O{sub 8}{sup 2−} were estimated. • HO{sup •} reacted faster with the β-lactams than SO{sub 4}{sup •} {sup −} but sharing similar byproducts. • Transformation pathways included hydroxylation, hydrolysis and decarboxylation. - Abstract: The extensive production and usage of antibiotics have led to an increasing occurrence of antibiotic residuals in various aquatic compartments, presenting a significant threat to both ecosystem and human health. This study investigated the degradation of selected β-lactam antibiotics (penicillins: ampicillin, penicillin V, and piperacillin; cephalosporin: cephalothin) by UV-254 nm activated H{sub 2}O{sub 2} and S{sub 2}O{sub 8}{sup 2−} photochemical processes. The UV irradiation alone resulted in various degrees of direct photolysis of the antibiotics; while the addition of the oxidants improved significantly the removal efficiency. The steady-state radical concentrations were estimated, revealing a non-negligible contribution of hydroxyl radicals in the UV/S{sub 2}O{sub 8}{sup 2−} system. Mineralization of the β-lactams could be achieved at high UV fluence, with a slow formation of SO{sub 4}{sup 2−} and a much lower elimination of total organic carbon (TOC). The transformation mechanisms were also investigated showing the main reaction pathways of hydroxylation (+16 Da) at the aromatic ring and/or the sulfur atom, hydrolysis (+18 Da) at the β-lactam ring and decarboxylation (–44 Da) for the three penicillins. Oxidation of amine group was also observed for ampicillin. This study suggests that UV/H{sub 2}O{sub 2} and UV/S{sub 2}O{sub 8}{sup 2−} advanced
International Nuclear Information System (INIS)
He, Xuexiang; Mezyk, Stephen P.; Michael, Irene; Fatta-Kassinos, Despo; Dionysiou, Dionysios D.
2014-01-01
Graphical abstract: - Highlights: • Removal efficiency was comparable at different UV fluence rates but same fluence. • Reducing pH to 3 or 2 did not inhibit the removal of nitrobenzene by UV/S 2 O 8 2− . • 1.84 × 10 −14 M [HO • ] ss and 3.10 × 10 −13 M [SO 4 • − ] ss in UV/S 2 O 8 2− were estimated. • HO • reacted faster with the β-lactams than SO 4 • − but sharing similar byproducts. • Transformation pathways included hydroxylation, hydrolysis and decarboxylation. - Abstract: The extensive production and usage of antibiotics have led to an increasing occurrence of antibiotic residuals in various aquatic compartments, presenting a significant threat to both ecosystem and human health. This study investigated the degradation of selected β-lactam antibiotics (penicillins: ampicillin, penicillin V, and piperacillin; cephalosporin: cephalothin) by UV-254 nm activated H 2 O 2 and S 2 O 8 2− photochemical processes. The UV irradiation alone resulted in various degrees of direct photolysis of the antibiotics; while the addition of the oxidants improved significantly the removal efficiency. The steady-state radical concentrations were estimated, revealing a non-negligible contribution of hydroxyl radicals in the UV/S 2 O 8 2− system. Mineralization of the β-lactams could be achieved at high UV fluence, with a slow formation of SO 4 2− and a much lower elimination of total organic carbon (TOC). The transformation mechanisms were also investigated showing the main reaction pathways of hydroxylation (+16 Da) at the aromatic ring and/or the sulfur atom, hydrolysis (+18 Da) at the β-lactam ring and decarboxylation (–44 Da) for the three penicillins. Oxidation of amine group was also observed for ampicillin. This study suggests that UV/H 2 O 2 and UV/S 2 O 8 2− advanced oxidation processes (AOPs) are capable of degrading β-lactam antibiotics decreasing consequently the antibiotic activity of treated waters
Energy Technology Data Exchange (ETDEWEB)
Corringer, P J; Durieux, C; Ruiz-Gayo, M; Roques, B P [UA498 CNRS, U266 INSERM, UFR des Sciences Pharmaceutiques et Biologiques, 75 - Paris (France)
1992-06-01
Among the CCK-B receptor agonists reported to date, the two modified peptides BC 264 and BC 254 display a high affinity and selectivity for this binding site and are highly protected from enzymatic degradation. Recently, we reported the biological properties of a tritiated analog of this agonist, [[sup 3]H]pBC 264, which fullfils all the criteria required for in vitro as well as in vivo studies of the CCK-B receptor. On the other hand, BC 254 displays a high affinity for the CCK-B binding sites in the guinea-pig (K[sub i] = 0.56 nM) while its affinity in the rat is more than 60-fold lower, a difference which could be due to the occurrence of CCK-B receptor subtypes. In the present paper, we report the synthesis of [[sup 3]H]pBC 264 and of the new tritiated ligand [[sup 3]H]pBC 254 using [[sup 3]H] NPS (N-succinimidyl[2,3-[sup 3]H]propionate) as labelling agent. These two probes have high specific activity (70-100 Ci/mmol) and will enable extensive studies of the CCK-B receptors to be carried out. (author).
Reactor production of 252Cf and transcurium isotopes
International Nuclear Information System (INIS)
Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.
1990-01-01
Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs
Polarimetry of ST LMi (CW1103+254)
Energy Technology Data Exchange (ETDEWEB)
Cropper, M
1986-10-15
White-light simultaneous photometry and linear and circular polarimetry is presented for the AM Her type variable ST LMi. Linear polarization evident throughout the faint phase is tentatively attributed to electron scattering from gas in the accretion column at heights greater than 5 Rsub(wd) above the surface. The values of inclination and magnetic dipole offset are revised to take into account the height and extent of the cyclotron emission regions which are also determined. A model of two closely connected emitting regions is proposed to account for the asymmetries observed in the light curve and polarization data for this and other AM Her systems. The size of the soft X-ray pole cap is calculated. Various parameters such as masses, accretion rates and luminosities are calculated for the system.
Lifescience Database Archive (English)
Full Text Available IXIXIIX*xfyxilk*lviivshs lxpyisxxckgyd*ixxklfitrfmmvvxvhgqinhchlvvrasqvwwcfxsclqcxxcs gkecxiqrllvvfvkrygflkx...iihn**lllh*hnnkliq*lyhh *enqmllkhgwkl*ecv--- ---XLXPVQVXEPNFQMXXFHFXLXLETXFXXDFRRIXIXIIX*xfyxilk*lviivshs lxpyisxxc
36 CFR 254.20 - Purpose and scope.
2010-07-01
..., needed by a community, may be sold under the Townsite Act, for fair market value if those lands would serve indigenous community objectives that outweigh the public objectives and values of retaining the... projects that would change the character of the local community. ...
16 CFR 254.0 - Scope and application.
2010-01-01
..., business, or clerical skills, or that is for the purpose of enabling a person to improve his appearance..., marketing, and sale of courses or programs of instruction offered by private vocational or distance...
All projects related to | Page 254 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2012-02-10
related Violence in Mexico. Project. Violent conflict related to drug trafficking in Mexico has had a profound impact on the quality of life and health of affected communities. Start Date: February 10, 2012. End Date: May 10, 2014. Topic: NARCOTICS ...
7 CFR 1710.254 - Alternative sources of power.
2010-01-01
... proposals on an economic, present-value basis, giving consideration to cost-effectiveness, reliability of... reliability problems. (Approved by the Office of Management and Budget under control number 0572-0032) [57 FR...
Lifescience Database Archive (English)
Full Text Available (All Frames) Frame A: ---xxxxxxxxxxxxxxxxvxxxxxxxrxxxxxxxxxxxxxxxkvxxxxxkxxfxxvxnx xmvvlxxittfkrnplsi*ssd*ev...vckflskpslvrllhxklkvlitlrmlkpksktkk vfhqinnvsfspvnnwrmvvlslittfkrnplsi*fsd*evvckfl*klslvkplhsklk vvttlrm*kqkfktkkvshq Frame B: ---xxx...xxxxxxxxxxxxwxxxxxxsxgxxxxxxcxxxxxxxxryxxxxxxxxfxw*xix x
7 CFR 1220.254 - Patents, copyrights, inventions, and publications.
2010-01-01
...) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF..., franchising, or other uses of such patents, copyrights, inventions, or publications, inure to the benefit of...
40 CFR 180.254 - Carbofuran; tolerances for residues.
2010-07-01
...) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances... than 1 ppm is carbamates) 2 12/31/09 Pumpkin (of which not more than 0.6 ppm is carbamates) 0.8 12/31...
24 CFR 92.254 - Qualification as affordable housing: Homeownership.
2010-04-01
... residents, percentage of owner-occupants) in relation to housing and incomes in the housing market area. An... public facilities and services. If a participating jurisdiction in preparing a neighborhood revitalization strategy under § 91.215(e)(2) of its consolidated plan or Empowerment Zone or Enterprise Community...
42 CFR 403.254 - Calculation of premiums.
2010-10-01
... rate credits. (4) Unearned premium reserve means the portion of gross premiums due that provide for...) Written premiums for the period; plus— (ii) The total premium reserve at the beginning of the period; less— (iii) The total premium reserve at the end of the period. (2) Written premiums in a period means— (i...
40 CFR 25.4 - Information, notification, and consultation responsibilities.
2010-07-01
... participation in all significant decisions covered by § 25.2(a), particularly where alternative courses of... shall highlight significant issues that will be the subject of decision-making. Whenever possible... distribution of information and must occur sufficiently in advance of decision-making to allow the agency to...
18 CFR 367.2540 - Account 254, Other regulatory liabilities.
2010-04-01
... accounts, imposed on the service company by the ratemaking actions of regulatory agencies. (See Definitions § 367.1(a)(38).) (b) The amounts included in this account are to be established by those credits which... authorized to charge for its services; or refunds to customers, not provided for in other accounts, will be...
42 CFR 422.254 - Submission of bids.
2010-10-01
... principles. (i) A qualified actuary must certify the plan's actuarial valuation (which may be prepared by others under his or her direction or review). (ii) To be deemed a qualified actuary, the actuary must be a member of the American Academy of Actuaries. (iii) Applicants may use qualified outside actuaries...
Directory of Open Access Journals (Sweden)
Julia Bock
2016-10-01
Full Text Available Csapody, Tamás. 2014. Bortól Szombathelyig - Tanulmányok a bori munkaszolgálatról és a bori munkaszolgálatosok részleges névlistája ('From Bor to Szombathely- Studies on the Forced Labor Service at Bor Camp and the Partial List of the Forced Laborers in Bor'. Budapest: Zrinyi Kadó. 254 pp. ; Csapody, Tamás. 2015. A Cservenkai tömeggyilkosság ('The Mass Murder at Cservenka'. Budapest: Zsidó Tudományok Szabadegyeteme Alapítvány. 150 pp. (e-book; a shorter version is accessible at: http://zsido.com/konyvek/a-cservenkai-tomeggyilkossag/.
People and things. CERN Courier, May 1985, v. 25(4)
Energy Technology Data Exchange (ETDEWEB)
Anon.
1985-05-15
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A workshop is being arranged to discuss the potential of the CERN SPS proton-antiproton Collider for the early 90s in view of the then simultaneous operation of the Tevatron at Fermilab, LEP at CERN and HERA at DESY, and to evaluate the need for a new Collider detector.
Spectroscopy of odd-proton nuclei in the region of 254No
International Nuclear Information System (INIS)
Ketelhut, S.; Greenlees, P. T.; Eeckhaudt, S.; Jones, P.; Julin, R.; Juutinen, S.; Kettunen, H.; Leino, M.; Leppaenen, A.-P.; Nieminen, P.; Nyman, M.; Perkowski, J.; Rahkila, P.; Saren, J.; Scholey, C.; Uusitalo, J.; Chatillon, A.; Bouchez, E.; Clement, E.; Goergen, A.
2008-01-01
Two rotational bands have been found in the transfermium nuclei 251 Md and 255 Lr, the latter being the heaviest nucleus so far studied in-beam. Both are assigned to a [521]1/2 - Nilsson state by comparison to theory. The experiments have been carried out in the Accelerator Laboratory of the University of Jyvaeskylae (JYFL), where the array of germanium detectors JUROGAM was used in conjunction with the recoil-seperator RITU and the focal-plane setup GREAT for gamma-spectroscopic studies
Feasibility and desirability of employing the thorium fuel cycle for power generation - 254
International Nuclear Information System (INIS)
Sehgal, B.R.
2010-01-01
Thorium fuel cycle for nuclear power generation has been considered since the very start of the nuclear power era. In spite of a very large amount of research, experimentation, pilot scale and prototypic scale installations, the thorium fuel was not adopted for large scale power generation [1,2]. This paper reviews the developments over the years on the front and the back-end of the thorium fuel cycle and describes the pros and cons of employing the thorium fuel cycle for large generation of nuclear power. It examines the feasibility and desirability of employing the thorium fuel cycle in concert with the uranium fuel cycle for power generation. (authors)
Printed wax masks for 254 nm deep-UV pattering of PMMA-based microfluidics
Fan, Yiqiang; Liu, Yang; Li, Huawei; Foulds, Ian G.
2012-01-01
This paper reports a new technique for masking deep-UV exposure of poly(methyl methacrylate) (PMMA) using a printed wax mask. This technique provides an inexpensive and bulk fabrication method for PMMA structures. The technique involves the direct
S. Afr. J. Anim. Sci. I I , 247- 254 ( I 981 ) PRACTICAL ...
African Journals Online (AJOL)
In the case of sheep the treatment of OF-collected samples (total extrusa vs. solid frac- tion) had a significant ... of laboratory drying equipment, is discussed. Oesophageally ..... Chemistry of browning reactions in model system. J. Agric. Food ...
SSC 254 Screen-Based Word Processors: Production Tests. The Lanier Word Processor.
Moyer, Ruth A.
Designed for use in Trident Technical College's Secretarial Lab, this series of 12 production tests focuses on the use of the Lanier Word Processor for a variety of tasks. In tests 1 and 2, students are required to type and print out letters. Tests 3 through 8 require students to reformat a text; make corrections on a letter; divide and combine…
16 CFR 254.3 - Misrepresentation of extent or nature of accreditation or approval.
2010-01-01
...) Misrepresent that students successfully completing a course or program of instruction can transfer the credit... subject of unsolicited testimonials or endorsements from former students. It is deceptive for an industry member to use testimonials or endorsements that do not accurately reflect current practices of the school...
40 CFR 421.254 - Standards of performance for new sources.
2010-07-01
... property Maximum for any 1 day Maximum for monthly average mg/troy ounce of gold and silver smelted Lead 0... Pollutant or pollutant property Maximum for any 1 day Maximum for monthly average mg/troy ounce of silver... average mg/troy ounce of gold refined electrolytically Lead 5.544 2.574 Mercury 2.970 1.188 Silver 5.742 2...
30 CFR 254.7 - How do I submit my response plan to the MMS?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I submit my response plan to the MMS... do I submit my response plan to the MMS? You must submit the number of copies of your response plan that the appropriate MMS regional office requires. If you prefer to use improved information technology...
30 CFR 254.47 - Determining the volume of oil of your worst case discharge scenario.
2010-07-01
... break. You must calculate this volume as follows: (1) Add the pipeline system leak detection time to the... the total volume of oil that would leak from the pipeline after it is shut in. Calculate this volume... lines on the facility. Flow line volume may be estimated; and (2) The volume of oil calculated to leak...
International Nuclear Information System (INIS)
Capeluto, W.; Campos, T. de los
2010-01-01
The aim of this paper is to analyze the distribution of textural statistical parameters and spatial variation in the morphology of the sediment areas. The geology of the area comprises alluvial and alluvial deposits of variable thicknesses overlying deposits of Fray Bent os, Salto and Guichon formations that occasionally emerge in the river bed
40 CFR 98.254 - Monitoring and QA/QC requirements.
2010-07-01
...) Standard Test Method for Heat of Combustion of Liquid Hydrocarbon Fuels by Bomb Calorimeter (incorporated... methods. (1) ASTM D4809-06 Standard Test Method for Heat of Combustion of Liquid Hydrocarbon Fuels by Bomb...) Method 18 at 40 CFR part 60, appendix A-6. (2) ASTM D1945-03 Standard Test Method for Analysis of Natural...
30 CFR 254.42 - Exercises for your response personnel and equipment.
2010-07-01
..., communication, and decisionmaking in managing a response. You must not reveal the spill scenario to team members... the complete 3-year exercise cycle. Records should be maintained at the facility or at a corporate...
TASK 2.5.4 DEVELOPMENT OF AN ENERGY SAVINGS CALCULATOR
Energy Technology Data Exchange (ETDEWEB)
Miller, William A [ORNL; New, Joshua Ryan [ORNL; Desjarlais, Andre Omer [ORNL; Huang, Joe [Lawrence Berkeley National Laboratory (LBNL); Erdem, Ender [Lawrence Berkeley National Laboratory (LBNL); Ronnen, Levinson [Lawrence Berkeley National Laboratory (LBNL)
2010-03-01
California s major energy utilities and the California Energy Commission (CEC) are seeking to allocate capital that yields the greatest return on investment for energy infrastructure that meets any part of the need for reliable supplies of energy. The utilities are keenly interested in knowing the amount of electrical energy savings that would occur if cool roof color materials are adopted in the building market. To meet this need the Oak Ridge National Laboratory and the Lawrence Berkeley National Laboratory (LBNL) have been collaborating on a Public Interest Energy Research (PIER) project to develop an industry-consensus energy-savings calculator. The task was coordinated with an ongoing effort supported by the DOE to develop one calculator to achieve both the DOE and the EPA objectives for deployment of cool roof products. Recent emphasis on domestic building energy use has made the work a top priority by the Department of Energy s (DOE) Building Technologies Program. The Roof Savings Calculator (RSC) tool is designed to help building owners, manufacturers, distributors, contractors and practitioners easily run complex simulations. The latest web technologies and usability design were employed to provide an easy input interface to an annual simulation of hour-by-hour, whole-building performance using the world-class simulation tools DOE-2.1E and AtticSim. Building defaults were assigned based on the best available statistical evidence and can provide energy and cost savings after the user selects nothing more than the building location. A key goal for the tool is to promote the energy benefits of cool color tile, metal and asphalt shingle roof products and other energy saving systems. The RSC tool focuses on applications for the roof and attic; however, the code conducts a whole building simulation that puts the energy and heat flows of the roof and attic into the perspective of the whole house. An annual simulation runs in about 30 sec. In addition to cool reflective roofs, the RSC tool will simulate high- medium- and low-slope roofs, and has a custom selection for the user whose house has a unique inclination. There is an option for above sheathing ventilation, which is prevalent in tile and stone-coated metal roof assemblies. The tool also accommodates the effects of radiant barriers and low-emittance surfaces in the inclined air space above the sheathing. The practitioner can select to have air-conditioning ducts either in the conditioned space or in the attic. If in the attic, the user can select one of three air leakage options. Option 1 is an inspected duct having 4% leakage and code level of duct insulation; option 2 is a poorly insulated duct having 14% air leakage; and option 3 is a custom leakage rate specified by the user. The practitioner can setup multiple layers of ceiling insulation. AtticSim is benchmarked against the field data acquired for Ft. Irwin located near Barstow, CA, first as a standalone simulation program and then again integrated within the DOE-2.1E program. The standalone benchmark was very useful to determining how well AtticSim replicates the building physics of an attic. The coupled benchmark was useful to verify that the DOE-2.1E/AtticSim code is modeling correctly the dynamic relationship between the attic and the occupied space below, as well as the interactions between the attic and the HVAC system, in particular when the ducts are located in the attic.
50 CFR 14.254 - What are the requirements contained in these regulations?
2010-10-01
... IMPORTATION OF WILDLIFE AND PLANTS IMPORTATION, EXPORTATION, AND TRANSPORTATION OF WILDLIFE Captive Wildlife... exemption in § 14.255, an accredited wildlife sanctuary must maintain complete and accurate records of any..., sold, or otherwise transferred; and the dates of these transactions. The accredited wildlife sanctuary...
: tous les projets | Page 254 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
La production de petits mils, en dépit des vertus nutritionnelles de cette céréale, de sa capacité de croître dans des conditions difficiles et de sa facilité de stockage, a toujours été négligée par les politiques agricoles déployées en Asie du Sud. Ces dernières, en effet, ont privilégié les cultures de rente et les céréales comme ...
International Nuclear Information System (INIS)
Jani, S
2014-01-01
Purpose For certain highly conformal treatment techniques, changes in patient anatomy due to weight loss and/or tumor shrinkage can result in significant changes in dose distribution. Recently, the Pinnacle treatment planning system added a Dynamic Planning module utilizing Deformable Image Registration (DIR). The objective of this study was to evaluate the effectiveness of this software in adapting to altered anatomy and adjusting treatment plans to account for it. Methods We simulated significant tumor response by changing patient thickness and altered chin positions using a commercially-available head and neck (H and N) phantom. In addition, we studied 23 CT image sets of fifteen (15) patients with H and N tumors and eight (8) patients with prostate cancer. In each case, we applied deformable image registration through Dynamic Planning module of our Pinnacle Treatment Planning System. The dose distribution of the original CT image set was compared to the newly computed dose without altering any treatment parameter. Result was a dose if we did not adjust the plan to reflect anatomical changes. Results For the H and N phantom, a tumor response of up to 3.5 cm was correctly deformed by the Pinnacle Dynamic module. Recomputed isodose contours on new anatomies were within 1 mm of the expected distribution. The Pinnacle system configuration allowed dose computations resulting from original plans on new anatomies without leaving the planning system. Original and new doses were available side-by-side with both CT image sets. Based on DIR, about 75% of H and N patients (11/15) required a re-plan using new anatomy. Among prostate patients, the DIR predicted near-correct bladder volume in 62% of the patients (5/8). Conclusions The Dynamic Planning module of the Pinnacle system proved to be an accurate and useful tool in our ability to adapt to changes in patient anatomy during a course of radiotherapy
30 CFR 254.23 - What information must I include in the “Emergency response action plan” section?
2010-07-01
... response operations on your behalf. You must describe the team's organizational structure as well as the... include the number and types of personnel available from each identified labor source. (d) A planned... primary and secondary radio frequencies that will be used. (e) A listing of the types and characteristics...
2009-07-01
Rec~ td <if J)ecision (ROD) Final step:in the EIS process. It iS a concise_ public doctunent that sets fNth the.decisioll, identifies the...associated with a site to cnsme Lh<lt 1 111 111 I ui p11i li!l\\’.111 d u lliJ ’·’·’IJI d.u llJ lll iutlut.lL iLtluu li ll ~~.•udu lLJ u JJJLLJ JuguJ i11 u
International Nuclear Information System (INIS)
Bataille, Ch.; Birraux, C.
2006-03-01
The abatement of CO 2 emissions is a huge technical and economical challenge. Fossil fuels, which represent 88% of the world primary energy consumption, are the main source of the 25 billions of CO 2 released each year in the atmosphere. The mastery of CO 2 emissions cannot come from a single technology but must result from the simultaneous implementation of several means, like the development of carbon-free energies and the mastery of fossil fuel emissions. The opportunities of progress are numerous and compatible with the economic development. This document presents, first, the different greenhouse gases, the CO 2 emissions per country and the main sources of CO 2 emissions (power and heat generation, transports). Then it presents different ways of abatement of CO 2 emissions: clean coal technologies, gas combined cycles, CO 2 sequestration, reduction of fuel consumption in transports, development of carbon-free energies: wind power, solar photovoltaic for decentralized power generation, nuclear energy for a competitive power generation and for CO 2 abatement, biofuels of 2. generation and fuel cells. The conclusion stresses on the investments needed for the renewal and increase of energy capacities, and on the necessary visibility and moderation of emission abatement mechanisms (carbon trading and CO 2 prices). (J.S.)
2010-04-23
... additive, or color additive) was subject to regulatory review by FDA before the item was marketed. Under...). VIMPAT injection is indicated as adjunctive therapy in the treatment of partial-onset seizures in...
Energy Technology Data Exchange (ETDEWEB)
Badkul, R; Doke, K; Pokhrel, D; Aguilera, N; Lominska, C [University of Kansas Medical Center, Kansas City, KS (United States)
2016-06-15
Purpose: Lung and heart doses and associated toxicity are of concern in radiotherapy for esophageal cancer. This study evaluates the dosimetry of deep-inspiration-breath-hold (DIBH) technique as compared to freebreathing( FB) using 3D-conformal treatment(3D-CRT) of esophageal cancer. Methods: Eight patients were planned with FB and DIBH CT scans. DIBH scans were acquired using Varian RPM system. FB and DIBH CTs were contoured per RTOG-1010 to create the planning target volume(PTV) as well as organs at risk volumes(OAR). Two sets of gross target volumes(GTV) with 5cm length were contoured for each patient: proximal at the level of the carina and distal at the level of gastroesophageal junction and were enlarged with appropriate margin to generate Clinical Target Volume and PTV. 3D-CRT plans were created on Eclipse planning system for 45Gy to cover 95% of PTV in 25 fractions for both proximal and distal tumors on FB and DIBH scans. For distal tumors celiac nodes were covered electively. DVH parameters for lung and heart OARs were generated and analyzed. Results: All DIBH DVH parameters were normalized to FB plan values. Average of heart-mean and heart-V40 was 0.70 and 0.66 for proximal lesions. For distal lesions ratios were 1.21 and 2.22 respectively. For DIBH total lung volume increased by 2.43 times versus FB scan. Average of lung-mean, V30, V20, V10, V5 are 0.82, 0.92, 0.76, 0.77 and 0.79 for proximal lesions and 1.17,0.66,0.87,0.93 and 1.03 for distal lesions. Heart doses were lower for breath-hold proximal lesions but higher for distal lesions as compared to free-breathing plans. Lung doses were lower for both proximal and distal breath-hold lesions except mean lung dose and V5 for distal lesions. Conclusion: This study showed improvement of OAR doses for esophageal lesions at mid-thoracic level utilizing DIBH vs FB technique but did not show consistent OAR sparing with DIBH for distal lesions.
International Nuclear Information System (INIS)
Badkul, R; Doke, K; Pokhrel, D; Aguilera, N; Lominska, C
2016-01-01
Purpose: Lung and heart doses and associated toxicity are of concern in radiotherapy for esophageal cancer. This study evaluates the dosimetry of deep-inspiration-breath-hold (DIBH) technique as compared to freebreathing( FB) using 3D-conformal treatment(3D-CRT) of esophageal cancer. Methods: Eight patients were planned with FB and DIBH CT scans. DIBH scans were acquired using Varian RPM system. FB and DIBH CTs were contoured per RTOG-1010 to create the planning target volume(PTV) as well as organs at risk volumes(OAR). Two sets of gross target volumes(GTV) with 5cm length were contoured for each patient: proximal at the level of the carina and distal at the level of gastroesophageal junction and were enlarged with appropriate margin to generate Clinical Target Volume and PTV. 3D-CRT plans were created on Eclipse planning system for 45Gy to cover 95% of PTV in 25 fractions for both proximal and distal tumors on FB and DIBH scans. For distal tumors celiac nodes were covered electively. DVH parameters for lung and heart OARs were generated and analyzed. Results: All DIBH DVH parameters were normalized to FB plan values. Average of heart-mean and heart-V40 was 0.70 and 0.66 for proximal lesions. For distal lesions ratios were 1.21 and 2.22 respectively. For DIBH total lung volume increased by 2.43 times versus FB scan. Average of lung-mean, V30, V20, V10, V5 are 0.82, 0.92, 0.76, 0.77 and 0.79 for proximal lesions and 1.17,0.66,0.87,0.93 and 1.03 for distal lesions. Heart doses were lower for breath-hold proximal lesions but higher for distal lesions as compared to free-breathing plans. Lung doses were lower for both proximal and distal breath-hold lesions except mean lung dose and V5 for distal lesions. Conclusion: This study showed improvement of OAR doses for esophageal lesions at mid-thoracic level utilizing DIBH vs FB technique but did not show consistent OAR sparing with DIBH for distal lesions.
Czech Academy of Sciences Publication Activity Database
Rössler, D.; Krüger, F.; Pšenčík, Ivan; Rümpker, G.
2008-01-01
Roč. 52, č. 2 (2008), s. 285-286 ISSN 0039-3169 Institutional research plan: CEZ:AV0Z30120515 Keywords : West Bohemia * tensile faulting * seismic anisotropy * seismic source Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.770, year: 2008
Feng, Xin; Qian, Zenghui; Liu, Peng; Zhang, Baorui; Wang, Luyao; Guo, Erkang; Wen, Xiaolong; Xu, Wenjuan; Jiang, Chuhan; Wu, Zhongxue; Li, Youxiang; Liu, Aihua
2018-01-01
To compare the rates of recanalization and in-stent stenosis between the Enterprise (EP) and low-profile visualized intraluminal support (LVIS) stent deployments for intracranial aneurysms (IAs), and the factors associated therein. Between June 2014 and July 2016, 142 patients with a total of 161 IAs were treated by LVIS stent-assisted coiling and 111 patients with a total of 142 IAs were treated by EP stent-assisted coiling at our institution. Procedure-related complications, angiographic follow-up results, and clinical outcomes were analyzed statistically. The rates of initially complete and near-complete IA occlusion immediately after the procedure were similar in the LVIS and EP groups (94.3% vs. 89.9%; P = 0.275). On follow-up, complete and near-complete occlusion rates and recanalization rates were also similar in the 2 groups (96.6% vs. 92.1%; P =0.330 and 8.0% vs. 13.5%; P = 0.245, respectively). On logistic regression analysis, a higher size ratio (SR) was significantly associated with the recanalization of aneurysms in the EP group, but not in the LVIS group. The rate of moderate to severe in-stent stenosis was lower in the LVIS group (10.2%) than in the EP group (16.8%), but the difference was not statistically significant (P = 0.198). Our data show acceptable rates of complete and near-complete occlusion with both the LVIS and EP stents. LVIS stents were associated with lower rates of recanalization and in-stent stenosis, but the difference was not significant. Higher SR (≥2) was a significant predictor of recanalization in IAs treated with EP stents, but not in those treated with LVIS stents. Copyright © 2017. Published by Elsevier Inc.
Wang, Junli; Song, Mingrui; Chen, Baiyang; Wang, Lei; Zhu, Rongshu
2017-10-01
In order to achieve better removal and analyses of three dissolved inorganic nitrogen (DIN) species via ultraviolet-activated hydrogen peroxide (UV/H 2 O 2 ) process, this study systematically investigated the rates of photo-oxidations of ammonia/ammonium (NH 3 /NH 4 + ) and nitrite (NO 2 - ) as well as the photo-reduction of nitrate (NO 3 - ) at varying pH and H 2 O 2 conditions. The results showed that the mass balances of nitrogen were maintained along irradiation despite of interconversions of DIN species, suggesting that no nitrogen gas (N 2 ) or other nitrogen-containing compound was formed. NH 3 was more reactive than NH 4 + with hydroxyl radical (OH), and by a stepwise H 2 O 2 addition method NH 3 /NH 4 + can be completely converted to NO x - ; NO 2 - underwent rapid oxidation to form NO 3 - when H 2 O 2 was present, suggesting that it is an intermediate compound linking NH 3 /NH 4 + and NO 3 - ; but once H 2 O 2 was depleted, NO 3 - can be gradually photo-reduced back to NO 2 - at high pH conditions. Other than H 2 O 2 , the transformation kinetics of DINs were all dependent on pH, but to varying aspects and extents: the NH 3 photo-oxidation favored a pH of 10.3, which fell within the pK a values of NH 4 + (9.24) and H 2 O 2 (11.6); the NO 3 - photo-reduction increased with increasing pH provided that it exceeds the pK a of peroxynitrous acid (6.8); while the NO 2 - photo-oxidation remained stable unless the pH neared the pK a of H 2 O 2 (11.6). The study thereby demonstrates a picture of the evolutions of DIN species together during UV/H 2 O 2 irradiation process, and for the first time presents a method to achieve complete conversion of NH 4 + to NO 3 - with UV/H 2 O 2 process. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Joel T. Mague
2016-04-01
Full Text Available The title compound, C24H20ClN5O2S·0.5H2O, has three independent molecules in the asymmetric unit and two water molecules of crystallization, one of which is equally disordered over two sites. The three unique organic molecules differ in the conformations of the substituents on the pyrazole ring. In the crystal, extensive O—H...O, O—H...N, N—H...O and C—H...O hydrogen bonding generates a three-dimensional network and C—H...π interactions are also observed.
Mattia, F.P. de; Savelkoul, P.J.M.; Kamsteeg, E.J.; Konings, I.B.M.; Sluijs, P. van der; Mallmann, R.; Oksche, A.; Deen, P.M.T.
2005-01-01
Water homeostasis in humans is regulated by vasopressin, which induces the translocation of homotetrameric aquaporin-2 (AQP2) water channels from intracellular vesicles to the apical membrane of renal principal cells. For this process, phosphorylation of AQP2 at S256 by cAMP-dependent protein kinase
N-(2-Chlorophenyl-2-({5-[4-(methylsulfanylbenzyl]-4-phenyl-4H-1,2,4-triazol-3-yl}sulfanylacetamide
Directory of Open Access Journals (Sweden)
Hoong-Kun Fun
2011-08-01
Full Text Available In the title molecule, C24H21ClN4OS2, the central 1,2,4-triazole ring forms dihedral angles of 89.05 (9, 86.66 (9 and 82.70 (10° with the chloro-substituted benzene ring, the methylsulfanyl-substituted benzene ring and the phenyl ring, respectively. In the crystal, molecules are linked into sheets parallel to (100 by intermolecular N—H...N and weak C—H...O hydrogen bonds.
5-Bromo-2-[5-(4-nitrophenyl-3-phenyl-4,5-dihydro-1H-pyrazol-1-yl]pyrimidine
Directory of Open Access Journals (Sweden)
B. Kalluraya
2009-12-01
Full Text Available In the title pyrazoline compound, C19H14BrN5O2, the essentially planar pyrazoline and pyrimidine rings [maximum deviations = 0.013 (1 and 0.009 (1 Å, respectively] are inclined slightly to one another, making a dihedral angle of 10.81 (10°. The nitrobenzene unit is almost perpendicular to the attached pyrazoline ring, as indicated by the dihedral angle of 84.61 (8°. In the crystal structure, intermolecular C—H...N contacts link the molecules into dimers in an antiparallel manner. These dimers are further linked into one-dimensional chains along the b axis via C—H...O contacts. The crystal structure is consolidated by three different intermolecular π–π interactions [range of centroid–centroid distances = 3.5160 (11–3.6912 (11 Å].
N,N-Diethyl-2-[5-(4-methoxybenzylidene-2,4-dioxo-1,3-thiazolidin-3-yl]acetamide
Directory of Open Access Journals (Sweden)
Vijayan Viswanathan
2017-05-01
Full Text Available In the title compound, C17H20N2O4S, the thiazolidine (r.m.s. deviation = 0.022 Å and phenyl rings (major and minor occupancies are inclined to one another by 6.3 (3 and 10.5 (3°, respectively. The molecular conformation is stabilized by an intramolecular C—H...S interaction. In the crystal, molecules are linked by C—H...O hydrogen bonds, which generate R22(18, R22(24 and R21(7 ring motifs. Aromatic π–π stacking interactions are also observed.
Stablité des Eléments Trans-ferminums à Haut Spin : Mesure de la barrière de fission de 254No
Henning , Gregoire
2012-01-01
Super heavy nuclei provide opportunities to study nuclear structure near three simultaneous limits: in charge Z, spin I and excitation energy E∗. These nuclei exist only because of a fission barrier, created by shell effects. It is therefore important to determine the fission barrier and its spin dependence Bf(I), which gives information on the shell energy Eshell(I). Theoretical calculations predict different fission barrier heights from Bf(I = 0) = 6.8 MeV for a macro-microscopic model to 8...
International Nuclear Information System (INIS)
NSTec Environmental Restoration
2007-01-01
Errata Sheet--The survey map referenced on Page F-10 is a draft. This errata sheet replaces the map with a final version. All recipients of this errata sheet shall replace Page F-10 with the attached map
International Nuclear Information System (INIS)
Le Guen, Jean-Marie
2012-01-01
After an introduction evoking the different parts of the finance bill project, its main programs and endowments, this report sets the associated national strategy within the context of the European and world agenda with respect to the protection of the environment, to climate change, and to international negotiations (Rio protocol, Durban conference, biodiversity). It outlines three main challenges: the international conference on climate of 2015 France has proposed to organize, the creation of European community on energy, and solving the current difficulties of the carbon trading scheme
Energy Technology Data Exchange (ETDEWEB)
Kurosu, K [Department of Radiation Oncology, Osaka University Graduate School of Medicine, Osaka (Japan); Department of Medical Physics ' Engineering, Osaka University Graduate School of Medicine, Osaka (Japan); Takashina, M; Koizumi, M [Department of Medical Physics ' Engineering, Osaka University Graduate School of Medicine, Osaka (Japan); Das, I; Moskvin, V [Department of Radiation Oncology, Indiana University School of Medicine, Indianapolis, IN (United States)
2014-06-01
Purpose: Monte Carlo codes are becoming important tools for proton beam dosimetry. However, the relationships between the customizing parameters and percentage depth dose (PDD) of GATE and PHITS codes have not been reported which are studied for PDD and proton range compared to the FLUKA code and the experimental data. Methods: The beam delivery system of the Indiana University Health Proton Therapy Center was modeled for the uniform scanning beam in FLUKA and transferred identically into GATE and PHITS. This computational model was built from the blue print and validated with the commissioning data. Three parameters evaluated are the maximum step size, cut off energy and physical and transport model. The dependence of the PDDs on the customizing parameters was compared with the published results of previous studies. Results: The optimal parameters for the simulation of the whole beam delivery system were defined by referring to the calculation results obtained with each parameter. Although the PDDs from FLUKA and the experimental data show a good agreement, those of GATE and PHITS obtained with our optimal parameters show a minor discrepancy. The measured proton range R90 was 269.37 mm, compared to the calculated range of 269.63 mm, 268.96 mm, and 270.85 mm with FLUKA, GATE and PHITS, respectively. Conclusion: We evaluated the dependence of the results for PDDs obtained with GATE and PHITS Monte Carlo generalpurpose codes on the customizing parameters by using the whole computational model of the treatment nozzle. The optimal parameters for the simulation were then defined by referring to the calculation results. The physical model, particle transport mechanics and the different geometrybased descriptions need accurate customization in three simulation codes to agree with experimental data for artifact-free Monte Carlo simulation. This study was supported by Grants-in Aid for Cancer Research (H22-3rd Term Cancer Control-General-043) from the Ministry of Health, Labor and Welfare of Japan, Grants-in-Aid for Scientific Research (No. 23791419), and JSPS Core-to-Core program (No. 23003). The authors have no conflict of interest.
Energy Technology Data Exchange (ETDEWEB)
Bataille, Ch; Birraux, C
2006-03-15
The abatement of CO{sub 2} emissions is a huge technical and economical challenge. Fossil fuels, which represent 88% of the world primary energy consumption, are the main source of the 25 billions of CO{sub 2} released each year in the atmosphere. The mastery of CO{sub 2} emissions cannot come from a single technology but must result from the simultaneous implementation of several means, like the development of carbon-free energies and the mastery of fossil fuel emissions. The opportunities of progress are numerous and compatible with the economic development. This document presents, first, the different greenhouse gases, the CO{sub 2} emissions per country and the main sources of CO{sub 2} emissions (power and heat generation, transports). Then it presents different ways of abatement of CO{sub 2} emissions: clean coal technologies, gas combined cycles, CO{sub 2} sequestration, reduction of fuel consumption in transports, development of carbon-free energies: wind power, solar photovoltaic for decentralized power generation, nuclear energy for a competitive power generation and for CO{sub 2} abatement, biofuels of 2. generation and fuel cells. The conclusion stresses on the investments needed for the renewal and increase of energy capacities, and on the necessary visibility and moderation of emission abatement mechanisms (carbon trading and CO{sub 2} prices). (J.S.)
Energy Technology Data Exchange (ETDEWEB)
Bataille, Ch.; Birraux, C
2006-03-15
The abatement of CO{sub 2} emissions is a huge technical and economical challenge. Fossil fuels, which represent 88% of the world primary energy consumption, are the main source of the 25 billions of CO{sub 2} released each year in the atmosphere. The mastery of CO{sub 2} emissions cannot come from a single technology but must result from the simultaneous implementation of several means, like the development of carbon-free energies and the mastery of fossil fuel emissions. The opportunities of progress are numerous and compatible with the economic development. This document presents, first, the different greenhouse gases, the CO{sub 2} emissions per country and the main sources of CO{sub 2} emissions (power and heat generation, transports). Then it presents different ways of abatement of CO{sub 2} emissions: clean coal technologies, gas combined cycles, CO{sub 2} sequestration, reduction of fuel consumption in transports, development of carbon-free energies: wind power, solar photovoltaic for decentralized power generation, nuclear energy for a competitive power generation and for CO{sub 2} abatement, biofuels of 2. generation and fuel cells. The conclusion stresses on the investments needed for the renewal and increase of energy capacities, and on the necessary visibility and moderation of emission abatement mechanisms (carbon trading and CO{sub 2} prices). (J.S.)
Safety analysis report for packaging: neutron shipping cask, model 0.5T
International Nuclear Information System (INIS)
Peterson, R.T.
1976-01-01
The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual
Directed evolution of the periodic table: probing the electronic structure of late actinides.
Marsh, M L; Albrecht-Schmitt, T E
2017-07-25
Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.
Directory of Open Access Journals (Sweden)
Sergio Rogerio Junqueira
2013-03-01
Full Text Available Este artigo objetiva traçar o itinerário da educação libertadora na realidade social brasileira e refletir sobre a necessidade de se repensar a ação dessa modalidade de educação nos dias atuais. Ao se articular a realidade da época do surgimento da educação libertadora, que pretendia responder aos apelos de libertação dos povos Latino-Americanos, com a realidade dos tempos atuais e suas implicações, este artigo busca respostas às questões postas por essa educação libertadora na atualidade. Para abordar as funções do processo educativo dentro do contexto de uma sociedade, é preciso situar as abordagens em sua realidade, contemporizando e adequando as suas ações. Essa temática representa um grande desafio, pois a concepção libertadora de educação extrapola os ambientes acadêmicos, visando sobretudo o bem comum do ser humano e o seu pleno desenvolvimento. Para a realização deste trabalho foram realizadas pesquisas bibliográficas e estudo da realidade desta época informatizada em que estamos inseridos, assim como suas consequências. Palavras-chave: Conscientização. Emancipação. Informatização. Educação Libertadora. Abstract This article aims to trace the route of liberating education in Brazilian social reality and reflect on the need to rethink the action of this type of education these days. In order to articulate the onset of liberating education that intended to respond to calls for liberation of Latin American peoples with the reality of the present time and its implications, this article seeks to answer to the questions posed by this liberating education today. To address the functions of the educational process within the context of a society, one must situate the approaches in their reality, compromising and adapting their actions. This theme represents a great challenge because the conception of such liberating education goes beyond the academic environments, seeking above all, the common good of the human being and its full development. The methodology used in this paper consisted of bibliographical research and a study of the reality of this computerized era in which we operate. Keywords: Awareness Empowerment. Information Technology. Liberating Education.
Håkanson, Lars
2008-01-01
This work describes how general methods and models for sustainable coastal ecosystem management at local to regional scales may be used to address key questions in coastal management and threshold science. The general, process-based mass-balance model (CoastMab) for substances transported to, within and from for coastal areas may be used as a tool to: 1. Combat eutrophication, 2. Rank nutrient fluxes, 3. Estimate the system response related to nutrient reductions and 4. Estimate realistic val...
International Nuclear Information System (INIS)
Zhang, H; Wang, J; Chuong, M; D’Souza, W; Choi, W; Lu, W; Latifi, K; Hoffe, S; Moros, E; Saeed, Nadia; Tan, S; Shridhar, R
2015-01-01
Purpose: To evaluate the role of mid-treatment and post-treatment FDG-PET/CT in predicting progression-free survival (PFS) and distant metastasis (DM) of anal cancer patients treated with chemoradiotherapy (CRT). Methods: 17 anal cancer patients treated with CRT were retrospectively studied. The median prescription dose was 56 Gy (range, 50–62.5 Gy). All patients underwent FDG-PET/CT scans before and after CRT. 16 of the 17 patients had an additional FDG-PET/CT image at 3–5 weeks into the treatment (denoted as mid-treatment FDG-PET/CT). 750 features were extracted from these three sets of scans, which included both traditional PET/CT measures (SUVmax, SUVpeak, tumor diameters, etc.) and spatialtemporal PET/CT features (comprehensively quantify a tumor’s FDG uptake intensity and distribution, spatial variation (texture), geometric property and their temporal changes relative to baseline). 26 clinical parameters (age, gender, TNM stage, histology, GTV dose, etc.) were also analyzed. Advanced analytics including methods to select an optimal set of predictors and a model selection engine, which identifies the most accurate machine learning algorithm for predictive analysis was developed. Results: Comparing baseline + mid-treatment PET/CT set to baseline + posttreatment PET/CT set, 14 predictors were selected from each feature group. Same three clinical parameters (tumor size, T stage and whether 5-FU was held during any cycle of chemotherapy) and two traditional measures (pre- CRT SUVmin and SUVmedian) were selected by both predictor groups. Different mix of spatial-temporal PET/CT features was selected. Using the 14 predictors and Naive Bayes, mid-treatment PET/CT set achieved 87.5% accuracy (2 PFS patients misclassified, all local recurrence and DM patients correctly classified). Post-treatment PET/CT set achieved 94.0% accuracy (all PFS and DM patients correctly predicted, 1 local recurrence patient misclassified) with logistic regression, neural network or support vector machine model. Conclusion: Applying radiomics approach to either midtreatment or post-treatment PET/CT could achieve high accuracy in predicting anal cancer treatment outcomes. This work was supported in part by the National Cancer Institute Grant R01CA172638
Energy Technology Data Exchange (ETDEWEB)
Allison, M.L.
1995-12-08
Strip logs for 491 wells were produced from a digital subsurface database of lithologic descriptions of the Ferron Sandstone Member of the Mancos Shale. This subsurface database covers wells from the parts of Emery and Sevier Counties in central Utah that occur between Ferron Creek on the north and Last Chance Creek on the south. The lithologic descriptions were imported into a logging software application designed for the display of stratigraphic data. Strip logs were produced at a scale of one inch equals 20 feet. The strip logs were created as part of a study by the Utah Geological Survey to develop a comprehensive, interdisciplinary, and qualitative characterization of a fluvial-deltaic reservoir using the Ferron Sandstone as a surface analogue. The study was funded by the U.S. Department of Energy (DOE) under the Geoscience/Engineering Reservoir Characterization Program.
Energy Technology Data Exchange (ETDEWEB)
Zhang, H; Wang, J; Chuong, M; D’Souza, W; Choi, W; Lu, W [University of Maryland School of Medicine, Baltimore, MD (United States); Latifi, K; Hoffe, S; Moros, E [Moffitt Cancer Center, Tampa, FL (United States); Saeed, Nadia [Brwon University, Providence, RI (United States); Tan, S [Huazhong University of Science & Technology, Wuhan (China); Shridhar, R [Florida Hospital, Orlando, FL (United States)
2015-06-15
Purpose: To evaluate the role of mid-treatment and post-treatment FDG-PET/CT in predicting progression-free survival (PFS) and distant metastasis (DM) of anal cancer patients treated with chemoradiotherapy (CRT). Methods: 17 anal cancer patients treated with CRT were retrospectively studied. The median prescription dose was 56 Gy (range, 50–62.5 Gy). All patients underwent FDG-PET/CT scans before and after CRT. 16 of the 17 patients had an additional FDG-PET/CT image at 3–5 weeks into the treatment (denoted as mid-treatment FDG-PET/CT). 750 features were extracted from these three sets of scans, which included both traditional PET/CT measures (SUVmax, SUVpeak, tumor diameters, etc.) and spatialtemporal PET/CT features (comprehensively quantify a tumor’s FDG uptake intensity and distribution, spatial variation (texture), geometric property and their temporal changes relative to baseline). 26 clinical parameters (age, gender, TNM stage, histology, GTV dose, etc.) were also analyzed. Advanced analytics including methods to select an optimal set of predictors and a model selection engine, which identifies the most accurate machine learning algorithm for predictive analysis was developed. Results: Comparing baseline + mid-treatment PET/CT set to baseline + posttreatment PET/CT set, 14 predictors were selected from each feature group. Same three clinical parameters (tumor size, T stage and whether 5-FU was held during any cycle of chemotherapy) and two traditional measures (pre- CRT SUVmin and SUVmedian) were selected by both predictor groups. Different mix of spatial-temporal PET/CT features was selected. Using the 14 predictors and Naive Bayes, mid-treatment PET/CT set achieved 87.5% accuracy (2 PFS patients misclassified, all local recurrence and DM patients correctly classified). Post-treatment PET/CT set achieved 94.0% accuracy (all PFS and DM patients correctly predicted, 1 local recurrence patient misclassified) with logistic regression, neural network or support vector machine model. Conclusion: Applying radiomics approach to either midtreatment or post-treatment PET/CT could achieve high accuracy in predicting anal cancer treatment outcomes. This work was supported in part by the National Cancer Institute Grant R01CA172638.
Directory of Open Access Journals (Sweden)
Alexandre Hideki Okano
2012-05-01
Full Text Available The present study determined the neuromuscular fatigue threshold (NFT using four different time-periods of analysis of the electromyographic signal and compared these estimations with critical power (CP. Fifteen healthy young men (73.6 ± 5.1 kg, 177.8 ± 7.0 cm, 23.4 ± 5.2 years performed 3-4 different severe constant workload trials until exhaustion on a cycle ergometer with simultaneous SEMG signals acquisition. The obtained data permitted NFT estimation with four different periods of analysis as follows: initial 30s (T30, 1min (T1, 2min (T2 and total time (TT, as well as CP. T30 and T1 were significantly higher than TT and CP and, T2 and TT did not differ between each other, and both were significantly higher than CP. In addition, TT was significantly correlated to CP (0.72; P < 0.05 and to T2 (0.58; P < 0.05. We conclude that NFT overestimates CP, independent of the time-period analysis used for its determination.
Energy Technology Data Exchange (ETDEWEB)
Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert
1976-07-01
This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.
International Nuclear Information System (INIS)
Haynes, C.E.
1976-01-01
The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research
Composition containing transuranic elements for use in the homeopathic treatment of aids
International Nuclear Information System (INIS)
Lustig, D.
1996-01-01
A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
Safety analysis report for packaging: neutron shipping cask, model 4T
International Nuclear Information System (INIS)
Peterson, R.T.
1977-01-01
This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials
Energy Technology Data Exchange (ETDEWEB)
Albrecht-Schmitt, Thomas
2012-03-01
This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available YYWRICASKGVKILLLGEYVLNLFFKEIENLPSNMVAEQSE 60 ... Query: 121 FANSLPKSPKNPPVFEIDGIKIAPLFGYEAHFDEFWLKFKRLDVDLALIPSAS...TFDSLNR 180 ... FANSLPKSPKNPPVFEIDGIKIAPLFGYEAHFDEFWLKFKRLDVDLALIPSASTFD...SLNR Sbjct: 121 FANSLPKSPKNPPVFEIDGIKIAPLFGYEAHFDEFWLKFKRLDVDLALIPSASTFDSLNR 180 ... Query: 241 XXXXXXXXXIRRSW 254 ... IRRSW Sbjct: 241 ELDQGYLEEIRRSW 254
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 309 ... Query: 254 LRPGEQVQIDTTRLDIMAILEDGSLGRPELTIAVDVATRSILAAVLRPYSTKAVDAALLL 313 ... LRPGEQVQIDTTRLDIMAIL...EDGSLGRPELTIAVDVATRSILAAVLRPYSTKAVDAALLL Sbjct: 1 ... LRPGEQVQIDTTRLDIMAILEDGSLGRPELTIAVDVA
ORF Alignment: NC_004461 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available AIVKGYFADQLQQYFLSHGVSSAIIDLGGNVLTIGRQPETLE 180 ... Query: 254 ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSV...LMTSKMQKY 311 ... ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSVLMTSKMQKY Sbjct: 241 ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSVLMTSKMQKY 298
ORF Alignment: NC_006350 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 98 ... Query: 254 IVAAARDYVLAHRSRPVGVPELCEQLHVSRRTLQYCFQDVLGMAPATYLRALRLNGVRRD 313 ... IVAAARDYVLAHRSRP...VGVPELCEQLHVSRRTLQYCFQDVLGMAPATYLRALRLNGVRRD Sbjct: 1 ... IVAAARDYVLAHRSRPVGVPELCEQLHVSRRTLQYCFQDVLGMAPATYLRALRLNGVRRD 60 ...
International Nuclear Information System (INIS)
Ouerfelli, N.
2014-01-01
Ionic self-diffusion coefficients (D) for trivalent radiotracers, lanthanide and actinide ions have been determined in concentrated aqueous solutions of supporting electrolytes of Gd(NO 3 ) 3 -HNO 3 or Nd(ClO 3 ) 4 -HClO 4 up to 1.5 mol L -1 at 298.15 K and pH 2.50 by the open-end capillary method. The data obtained in large range of concentrations, allow to derive the limiting value D deg, the validity of the Onsager limiting law and a more extended law. This study contributes to demonstrate similarities in transport and structure properties between 4f and 5f trivalent ions explained by a similar electronic configuration, ionic radius and hydration number. An empirical equation is suggested for predicting ionic hydration number with a good precision. (author)
International Nuclear Information System (INIS)
Ouerfelli, N.; Latrous, H.; Ammar, M.; Das, D.; Oliver, J.
2013-01-01
The open-end capillary method is used for the determination of ionic self-diffusion coefficients (D) for trivalent radiotracer, lanthanide and actinide ions are reported in concentrated aqueous solutions of supporting electrolytes of Gd(NO 3 ) 3 -HNO 3 or Nd(ClO 3 ) 4 -HClO 4 up to 1.5 mol.L -1 at 298.15 K and pH 2.50. The data obtained in large range of concentrations, allow deriving the limiting value D°, the validity of the Onsager limiting law and a more extended law. This study contributes to demonstrate similarities in transport and structure properties between 4f and 5f trivalent ions explained by a similar electronic configuration, ionic radius and hydration number. (author)
Department of the Interior — This dataset contains stable isotope (δ13C) and radioisotope (Δ14C) compositions of dissolved inorganic carbon, dissolved organic carbon, particulate organic carbon,...
Zhao, Bin; Wang, Qilei; Zhang, Cunrui
2017-08-01
This article has been retracted: please see Elsevier Policy on Article Withdrawal (http://www.elsevier.com/locate/withdrawalpolicy) This article has been retracted at the request of the Editor-in-Chief. The authors have plagiarized part of a paper that had already appeared in Ceram. Int., 39 (2013) 2317-2322, http://dx.doi.org/10.1016/j.ceramint.2012.08.079.
Boinovich, L. B.; Emelyanenko, A. M.; Emelyanenko, K. A.; Domantovsky, A. G.; Shiryaev, A. A.
2016-08-01
Nowadays the problem of design of durable ecologically friendly superhydrophobic surfaces is of great importance for science and technology. A recent paper in Applied Surface Science reports the method of fabricating the superhydrophobic metallic surfaces by infrared nanosecond laser surface texturing without using hydrophobic agents. Since this method of surface texturing can be considered as one of the most suitable for various industrial applications, the nature of superhydrophobic state of surfaces produced by laser texturing in the abovementioned paper deserves to be analyzed in detail. Authors of the commented paper attributed the change in wettability to the partial deoxidation of CuO into Cu2O on the surface during storage in atmosphere. However, such interpretation of the results contradicts to the basic notions in the theory of wetting and to more accurate and detailed data. In our Comment we discuss these contradictions point by point.
International Nuclear Information System (INIS)
Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.
1980-01-01
Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures
Nuclear fission and the transuranium elements
International Nuclear Information System (INIS)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs
Nuclear fission and the transuranium elements
Energy Technology Data Exchange (ETDEWEB)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.
ORF Alignment: NC_000921 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NLVVLQELNPYSYFCQSENPKFFDLGEYFEEDKAFFS 60 ... Query: 134 DLGFEPIATSVGKLGLMVCWDQWYPEAARIMALKGAEILIYPSAIGFLEEDSNEE...KKRQQ 193 ... DLGFEPIATSVGKLGLMVCWDQWYPEAARIMALKGAEILIYPSAIGFLEEDSNEEKKRQQ... Sbjct: 121 DLGFEPIATSVGKLGLMVCWDQWYPEAARIMALKGAEILIYPSAIGFLEEDSNEEKKRQQ 180 ... Query: 254 EEILYAEIELERTEEVRRM
ORF Alignment: NT_033777 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Query: 134 SDCHELDEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHENF 193 ... SDCHELDEGVRVDGVYRFLVP...ERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHENF Sbjct: 1 ... SDCHELDEGVRVDGVYRFLVPERNEVQRDL...YERYCAFATDGPAWTVIQSRGGSFDPHENF 60 ... Query: 254 SYNYQLSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQ 3
Indian Academy of Sciences (India)
Specialization: Magnetism & Superconductivity, Vortex State Studies in Superconductors, Strongly Correlated Systems Address: Vice Chancellor, Panjab University, Chandigarh 160 014, U.T.. Contact: Office: (0172) 254 1945. Residence: (0172) 254 1428. Fax: (0172) 254 1022. Email: vc@pu.ac.in, arunkgrover@gmail.com.
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC254 (Link to dictyBase) - - - Contig-U15456-1 VFC254P (Link... to Original site) VFC254F 509 VFC254Z 569 VFC254P 1078 - - Show VFC254 Library VF (Link to library) Clone ID VFC254 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N Y16962 |Y16962.1 Dictyostel...ium discoideum mRNA for cathepsin D. 910 0.0 3 AJ243946 |AJ243946.1 Dictyostelium
2016-09-01
excitation of a sensor by independently calculable means may be possible. For example, pistonphones and electrostatic actuators are common devices for...the model RE-254, shown in Figure 17, which is manufactured by Audio Components DIY in Latvia. The RE-254 employs an aluminum foil, 2.5 microns thick...Aug. 7, 2016. [8] RE-254 ribbon microphone motor for DIY mic project. (n.d.); DiY Audio Components. [Online]. Available: http
Characterization of a Viking Blade Fabricated by Traditional Forging Techniques
Vo, H.; Frazer, D.; Bailey, N.; Traylor, R.; Austin, J.; Pringle, J.; Bickel, J.; Connick, R.; Connick, W.; Hosemann, P.
2016-12-01
A team of students from the University of California, Berkeley, participated in a blade-smithing competition hosted by the Minerals, Metals, and Materials Society at the TMS 2015 144th annual meeting and exhibition. Motivated by ancient forging methods, the UC Berkeley team chose to fabricate our blade from historical smithing techniques utilizing naturally-occurring deposits of iron ore. This approach resulted in receiving the "Best Example of a Traditional Blade Process/Ore Smelting Technique" award for our blade named "Berkelium." First, iron-enriched sand was collected from local beaches. Magnetite (Fe3O4) was then extracted from the sand and smelted into individual high- and low-carbon steel ingots. Layers of high- and low-carbon steels were forge-welded together, predominantly by hand, to form a composite material. Optical microscopy, energy dispersive spectroscopy, and Vickers hardness mechanical testing were conducted at different stages throughout the blade-making process to evaluate the microstructure and hardness evolution during formation. It was found that the pre-heat-treated blade microstructure was composed of ferrite and pearlite, and contained many nonmetallic inclusions. A final heat treatment was performed, which caused the average hardness of the blade edge to increase by more than a factor of two, indicating a martensitic transformation.
Nuclear Chemistry Institute, Mainz University. Annual Report 1995
International Nuclear Information System (INIS)
Denschlag, H.O.
1996-03-01
The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR) [de
The Transplutonium. The superheavy nuclei found in the micas of Madagascar and their interests
International Nuclear Information System (INIS)
Raoelina Andriambololona
1976-01-01
Since June 1976, evidence for the existence of superheavy elements is discussed about. After having recalled artificial elements with atomic numbers Z of wich go from Z=95 (Americium) to Z=107 (built in 1976), superheavy elements having Z greater than 110 are considered. They have been discovered by american searchers in giant halos seen in Madagascar micas. The samples have been recoked in the Fort-Dauphin region (Haut Mandrare). The corresponding numbers Z are 114, 115, 116, 124, 125, 125, 126, 127. It seems that the existence of Z=126 element should be accepted with a greater degree of confidence. But different experiences done by other groups seem to show the evidence of superheavy elements in micas looks weaker. Nevertheless, it is interesting to investigate the evidence or the non-evidence of those elements. We estimate the mass numbers A of those superheavy elements in the liquid drop model if we assume that they are stable versus β. The results thus obtained agree with the shell-model ones within 4 % approximation. We propose if the evidence of superheavies is confirmed to give the name of madagascarium to one of them (Z=126) by similitude with francium, lutetium, polonium, berkelium, americium, europium, ...Their evidence was first conjectured in Madagascar micas in 1976. Superheavy nuclei are to be distinguished from hypernuclei. [fr
Identification of the new isotope sup 2 sup 4 sup 1 Bk
Asai, M; Ichikawa, S; Nagame, Y; Nishinaka, I; Akiyama, K; Toyoshima, A; Kaneko, T; Sakama, M; Haba, H; Oura, Y; Kojima, Y; Shibata, M
2003-01-01
A new neutron-deficient berkelium isotope sup 2 sup 4 sup 1 Bk produced in the sup 2 sup 3 sup 9 Pu( sup 6 Li, 4n) reaction has been identified using a gas-jet coupled on-line isotope separator. Cm K and L X-rays associated with the EC decay of sup 2 sup 4 sup 1 Bk were observed in the mass-241 fraction, and three gamma transitions were attributed to the EC decay of sup 2 sup 4 sup 1 Bk through X-gamma coincidences. The half-life of sup 2 sup 4 sup 1 Bk was determined to be 4.6+-0.4 min which is 1/2-1/4 of that of theoretical predictions. The half-life value and the observed gamma transitions can be consistently explained as a consequence of the allowed EC transition of pi 7/2 sup + [633] -> nu 7/2 sup + [624]. (orig.)
International Nuclear Information System (INIS)
Armbruster, P.; Hessberger, F.P.
1998-01-01
In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)
Energy Technology Data Exchange (ETDEWEB)
Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling
2016-07-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
International Nuclear Information System (INIS)
Behrens, R.G.; Roth, S.B.; Jones, S.R.
1991-01-01
Los Alamos National Laboratory is a multidisciplinary R ampersand D organization and, as such, its nuclear materials inventory is diverse. Accordingly, major inventories of isotopes such as Pu-238, Pu-239, Pu-242, U-235, Th, tritium, and deuterium, and lesser amounts of isotopes of Am, Cm, Np and exotic isotopes such as berkelium must be managed in accordance with Department of Energy Orders and Laboratory policies. Los Alamos also acts as a national resource for many one-of-a-kind materials which are supplied to universities, industry, and other government agencies within the US and throughout the world. Management of these materials requires effective interaction and communication with many nuclear materials custodians residing in over forty technical groups as well as effective interaction with numerous outside organizations. This paper discusses the role, philosophy, and organizational structure of Nuclear Materials Management at Los Alamos and also briefly presents results of two special nuclear materials management projects: 1- Revision of Item Description Codes for use in the Los Alamos nuclear material data base and 2- The recommendation of new economic discard limits for Pu-239. 2 refs., 1 fig
Extraction of transplutonium elements from carbonate solutions by alkylpyrocatechol
International Nuclear Information System (INIS)
Karalova, Z.K.; Myasoedov, B.F.; Rodionova, L.M.; Kuznetsova, V.S.
1983-01-01
Extraction of americium, berkelium as well as Ce, Eu, Th, U, Zr, Cs, Fe with solution of 4(α, α-dioctylethyl)pyrocatechol (DOP) in toluene from carbonate solutions to determine conditions of their separation has been studied. It is established that americium extraction is quite sensitive to the changes of potassium carbonate concentration. The maximum extraction of americium (R >90%) is observed in the case of 0.1-0.5 mol/l of K 2 CO 3 solutions and the minimum one (R=2.5%) - in the case of 8 mol/l K 2 CO 3 . Americium extraction increases sharply when sodium hydroxide is introduced in carbonate solutions. It is shown that varying sodium hydroxide concentration it is possible to achieve qualitative extraction of americium even from saturated solution of potassium carbonate. Reextraction of TPE is easily realized with 3 mol/l HCl solution. The system K 2 CO 3 (KOH)-DOP proved to be perspective for Am separation from Bk, Ce, Cs, actinoid elements as well as from Fe
International Nuclear Information System (INIS)
Brown, Paul L.; Ekberg, Christian
2016-01-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter
International Nuclear Information System (INIS)
Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A.
2000-01-01
Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided
Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter
Energy Technology Data Exchange (ETDEWEB)
Gobrecht, J; Gaeggeler, H; Herlach, D; Junker, K; Kettle, P -R; Kubik, P; Zehnder, A [eds.
2000-07-01
lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.
International Nuclear Information System (INIS)
Moeser, Christina
2010-01-01
The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.
Fluorescence and excitation spectra of Bk3+, Cf3+, and Es3+ ions in single crystals of LaCl3
International Nuclear Information System (INIS)
Hessler, J.P.; Caird, J.A.; Carnall, W.T.; Crosswhite, H.M.; Sjoblom, R.K.; Wagner, F. Jr.
1978-01-01
Dye laser techniques have been used to study the energy level structure of the heavier actinides in single crystals of lanthanum chloride. In the case of einsteinium, fluorescence was detected and measured from the following manifolds: J = 5 at 0.984 μm -1 , J = 4 at 1.572 μm -1 , J = 6 at 2.930 μm -1 . This fluorescence was observed to the five lowest manifolds: J = 8, 5, 7, 2, 6. For californium, fluorescence has been detected from the manifolds: J = 11/2 at 1.190 μm -1 , J = 7/2 at 1.389 μm -1 , J = 5/2 at 1.977 μm -1 . This fluorescence was observed to the three lowest manifolds: J = 15/2, 9/2, 11/2. The fluorescence manifolds of berkelium are J = 6 at 1.540 μm -1 , and J = 4 at 1.953 μm -1 . The three lowest manifolds, J = 6, 5, and 4, have been observed in fluorescence. Absorption spectra data have yielded crystal-field splitting measurements in the higher manifolds of Es + . The location of the manifolds in general confirmed earlier approximate free-ion level structure calculations based on assumed regularities in the energy level parameters derived from spectra of the actinide ions through Cf + . 2 figures
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... palustris CGA009] ... Length = 77 ... Query: 195 NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDS...MMKTARPPP 254 ... NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDSMMKTA...RPPP Sbjct: 1 ... NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDSMMKTARPPP 60 ...
ORF Alignment: NT_037436 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... gb|AAM10986.1| AT04143p [Drosophila melanogaster] ... Length = 254 ... Query: 12 ... STALRLLGANVEL...FGVLTRNPTYRMILDDLEQRGIDISHCTFTDASPPFSTIVQDRWTRR 71 ... STALRLLGANVELFGVLT...RNPTYRMILDDLEQRGIDISHCTFTDASPPFSTIVQDRWTRR Sbjct: 1 ... STALRLLGANVELFGVLTRNPTYRMILDDLEQRGIDISHCTFTDASPPFSTIVQ
Systema Naturae. Classification of living things.
Alexey Shipunov
2007-01-01
Original classification of living organisms containing four kingdoms (Monera, Protista, Vegetabilia and Animalia), 60 phyla and 254 classes, is presented. The classification is based on latest available information.
DEFF Research Database (Denmark)
Strange, Michael Stewart
2009-01-01
Book Review: John M. Hobson and Leonard Seabrooke (2007) (eds) Everyday Politics of the World Economy (Cambridge: Cambridge University Press), 254pp. Udgivelsesdato: 2009......Book Review: John M. Hobson and Leonard Seabrooke (2007) (eds) Everyday Politics of the World Economy (Cambridge: Cambridge University Press), 254pp. Udgivelsesdato: 2009...
Smart ampholytic ABC block copolypeptide
Czech Academy of Sciences Publication Activity Database
Schlaad, H.; Sun, J.; Černoch, Peter; Ruokolainen, J.
2017-01-01
Roč. 254, 20 August (2017), s. 79 ISSN 0065-7727. [ACS National Meeting & Exposition /254./. 20.08.2017-24.08.2017, Washington] Institutional support: RVO:61389013 Keywords : block copolypeptide * smart ampholytic Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science
Czech Academy of Sciences Publication Activity Database
Dušková-Smrčková, Miroslava; Sadakbayeva, Zhansaya; Steinhart, Miloš; Šturcová, Adriana; Pfleger, Jiří; Dušek, Karel
2017-01-01
Roč. 254, 20 August (2017), s. 40 ISSN 0065-7727. [ACS National Meeting & Exposition /254./. 20.08.2017-24.08.2017, Washington] Institutional support: RVO:61389013 Keywords : IPN * poly(2-hydroxyethyl methacrylate) * hydrogel Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science
Learning Preference Models for Autonomous Mobile Robots in Complex Domains
2010-12-01
templates,” in IEEE/RSJ International Conference on Intelligent Robots and Systems, pp. 167–172, 2009. 128, 153 [254] J. Z. Kolter , P. Abbeel, and A. Y...92] Knepper, R. A. [246] Koller, D. [234] Kolter , J. Z. [254] Konolige, K. [148] Koutsougeras, C. [32] Krotkov, E. [96, 123, 178] Kuffner, J. [252
78 FR 9056 - Agency Information Collection Activities: Proposed Collection; Comment Request
2013-02-07
... agent/brokers provided during training will be used to record their training history through CMS LMS... small business health options plan (SHOP) employers/employees through the Exchange. Additionally, CMS...: Private Sector: Business or other for-profits; Number of Respondents: 254,095; Total Annual Responses: 254...
Czech Academy of Sciences Publication Activity Database
Filippov, Sergey K.; Kaberov, Leonid; Zhang, X.; Niebuur, B.-J.; Chytil, Petr; Etrych, Tomáš; Wieland, F.; Velychkivska, Nadiia; Starovoytova, Larisa; Svergun, D.; Papadakis, C.
2017-01-01
Roč. 254, 20 August (2017), s. 455 ISSN 0065-7727. [ACS National Meeting & Exposition /254./. 20.08.2017-24.08.2017, Washington] R&D Projects: GA ČR(CZ) GC15-10527J Institutional support: RVO:61389013 Keywords : HPMA * human serum albumin * SAXS Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry
Swelling of cross-linked polymers: interpretations and misinterpretations
Czech Academy of Sciences Publication Activity Database
Dušek, Karel; Dušková-Smrčková, Miroslava
2017-01-01
Roč. 254, 20 August (2017), s. 102 ISSN 0065-7727. [ACS National Meeting & Exposition /254./. 20.08.2017-24.08.2017, Washington] Institutional support: RVO:61389013 Keywords : swelling * cross-linked polymer Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science
Czech Academy of Sciences Publication Activity Database
Uzagalieva, Ainura
-, č. 254 (2005), s. 1-46 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : seigniorage * monetary integration * transition economies Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp254.pdf
IDENTITY THEFT SERVICES: Services Offer Some Benefits but Are Limited in Preventing Fraud
2017-03-01
17-254 Identity Theft Services standards. Those standards require that we plan and perform the audit to obtain sufficient, appropriate evidence to... audited financial statements. Page 34 GAO-17-254 Identity Theft Services Although the websites of many identity theft services ...reasonable assurance that significant decisions on the use of identity theft services are appropriately documented. We provided a draft of this
ORF Alignment: NC_003305 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003305 gi|17938192 >1v7zA 16 254 17 254 3e-36 ... ref|NP_534981.1| creatinine amid...ohydrolase [Agrobacterium tumefaciens str. C58] ... gb|AAL45297.1| creatinine amidohydrolase [Agrobac... C58] pir||AC3110 ... creatinine amidohydrolase [imported] - Agrobacterium
ORF Alignment: NC_003063 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003063 gi|15890482 >1v7zA 16 254 17 254 3e-36 ... ref|NP_534981.1| creatinine amid...ohydrolase [Agrobacterium tumefaciens str. C58] ... gb|AAL45297.1| creatinine amidohydrolase [Agrobac... C58] pir||AC3110 ... creatinine amidohydrolase [imported] - Agrobacterium
Czech Academy of Sciences Publication Activity Database
Kaberov, Leonid; Verbraeken, B.; Riabtseva, Anna; Brus, Jiří; Štěpánek, Petr; Hoogenboom, R.; Filippov, Sergey K.
2017-01-01
Roč. 254, 20 August (2017), s. 304 ISSN 0065-7727. [ACS National Meeting & Exposition /254./. 20.08.2017-24.08.2017, Washington] R&D Projects: GA ČR(CZ) GC15-10527J Institutional support: RVO:61389013 Keywords : poly-2-oxazolines * triblocks * fluorinated Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry
Actinide production in the reaction of heavy ions with curium-248
International Nuclear Information System (INIS)
Moody, K.J.
1983-07-01
Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined
Radiochemical studies of neutron deficient actinide isotopes
International Nuclear Information System (INIS)
Williams, K.E.
1978-04-01
The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, 242 Bk, was produced with a cross-section of approximately 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, αxn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,αxn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z 1 + Z 2 = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,αxn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of 228 Pu, 230 Pu, 232 Cm, or 238 Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes
Radiochemical studies of neutron deficient actinide isotopes
Energy Technology Data Exchange (ETDEWEB)
Williams, K.E.
1978-04-01
The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, /sup 242/Bk, was produced with a cross-section of approximately 10 ..mu..b in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, ..cap alpha..xn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,..cap alpha..xn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z/sub 1/ + Z/sub 2/ = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,..cap alpha..xn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of /sup 228/Pu, /sup 230/Pu, /sup 232/Cm, or /sup 238/Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes.
Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter
Energy Technology Data Exchange (ETDEWEB)
Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.
2000-07-01
lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.
Minor Actinides Recycling in PWRs
International Nuclear Information System (INIS)
Delpech, M.; Golfier, H.; Vasile, A.; Varaine, F.; Boucher, L.; Greneche, D.
2006-01-01
Recycling of minor actinides in current and near future PWR is considered as one of the options of the general waste management strategy. This paper presents the analysis of this option both from the core physics and fuel cycle point of view. A first indicator of the efficiency of different neutron spectra for transmutation purposes is the capture to fission cross sections ratio which is less favourable by a factor between 5 to 10 in PWRs compared to fast reactors. Another indicator presented is the production of high ranking isotopes like Curium, Berkelium or Californium in the thermal or epithermal spectrum conditions of PWR cores by successive neutron captures. The impact of the accumulation of this elements on the fabrication process of such PWR fuels strongly penalizes this option. The main constraint on minor actinides loadings in PWR (or fast reactors) fuels are related to their direct impact (or the impact of their transmutation products) on the reactivity coefficients, the reactivity control means and the core kinetics parameters. The main fuel cycle physical parameters like the neutron source, the alpha decay power, the gamma and neutrons dose rate and the criticality aspects are also affected. Recent neutronic calculations based on a reference core of the Evolutionary Pressurized Reactor (EPR), indicates typical maximum values of 1 % loadings. Different fuel design options for minor actinides transmutation purposes in PWRs are presented: UOX and MOX, homogeneous and heterogeneous assemblies. In this later case, Americium loading is concentrated in specific pins of a standard UOX assembly. Recycling of Neptunium in UOX and MOX fuels was also studied to improve the proliferation resistance of the fuel. The impact on the core physics and penalties on Uranium enrichment were underlined in this case. (authors)
International Nuclear Information System (INIS)
King, L.J.; Bigelow, J.E.; Collins, E.D.
1976-10-01
Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity 248 Cm, were separated from 252 Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown 248 Cm and the residual 252 Cf. Eight pellets, each containing 100 μg of high-purity 248 Cm were prepared for irradiation in HFIR to study the production of 250 Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated
International Nuclear Information System (INIS)
1994-01-01
The Director General received notes verbales dated 15 and 22 March 1994 from the Permanent Mission of South Africa providing information on the nuclear export policies and practices of the Government of South Africa. These notes verbales contain, in their attachments, copies of the relevant legislation and other documentation pertaining to South Africa's policy to act in accordance with the provisions of INFCIRC/254/Rev.1/Part 1 and INFCIRC/254/Rev.1/Part 1/Mod.1 and INFCIRC/254/Rev.1/Part 2 as amended. The documents are available on request from the Secretariat of the IAEA
2010-07-07
... Manistee Iron Works Machine Shop, 254 River St., Manistee, 10000477 Wayne County Rosedale Gardens Historic... Berry Morot Car Service Building, (Auto-Related Resources of St. Louis, Missouri [[Page 39041
Genetic diversity and population structure in Meconopsis ...
African Journals Online (AJOL)
STORAGESEVER
2010-05-24
May 24, 2010 ... The location and main ecological characteristics of sample sites are shown in ..... suggest that this is wind-pollinated and allogamous plant species ... (Teleostei, Characidae) from an urban stream, Hydrobiology, 553: 245-254 ...
Czech Academy of Sciences Publication Activity Database
Juchelka, Jiří
2009-01-01
Roč. 50, 1-2 (2009), s. 254 ISSN 1211-7250 Institutional research plan: CEZ:AV0Z80010507 Keywords : Czech Silesia * Cultur of linear potter * archaeological research Subject RIV: AC - Archeology, Anthropology, Ethnology
2018-05-09T14:12:40Z https://www.ajol.info/index.php/all/oai oai:ojs ...
African Journals Online (AJOL)
... by upper respiratory tract (catarrh) 28.3%, typhoid 25.4%, roundworm 14.1% and ... all the girls expressed in terms of standard deviation (Z-score) below median ... including reprints, photographic reproduction and translation are published.
Indian Academy of Sciences (India)
Date of birth: 21 September 1953. Specialization: Plant Biotechnology, Genetic Engineering and Molecular Biology, Secondary Metabolism Address: Senior Research Adviser, University Institute of Engineering & Technology, Panjab University, Sector 25, Chandigarh 160 014, Panjab Contact: Office: (0172) 254 4107
Assessment of Phaseolus vulgaris L and Vigna unguiculata (L ...
African Journals Online (AJOL)
SAM
2014-04-09
Apr 9, 2014 ... searching natural compounds with biological activity. .... remain permanently open access under the terms of the Creative Commons Attribution License 4.0 ... (TLC) plate silica gel 60 F254 (Merck 2 × 6 cm), each plate was.
76 FR 12364 - Agency Information Collection Activities: Bonded Warehouse Regulations
2011-03-07
... respondents or record keepers from the collection of information (a total capital/ startup costs and... Total Annual Responses: 9,254. Estimated Time per Response: 32 minutes. Estimated Total Annual Burden...
Magnetically responsive biological materials and their applications
Czech Academy of Sciences Publication Activity Database
Šafařík, Ivo; Pospíšková, K.; Baldíková, E.; Šafaříková, Miroslava
2016-01-01
Roč. 7, č. 4 (2016), s. 254-261 ISSN 0976-3961 Institutional support: RVO:60077344 Keywords : adsorbents * biological materials * carriers * magnetic modification * whole-cell biocatalyst Subject RIV: EI - Biotechnology ; Bionics
Enforcement and Effectiveness of Consumer Law in the Czech Republic
Czech Academy of Sciences Publication Activity Database
Pauknerová, Monika; Skalská, H.
2017-01-01
Roč. 7, č. 4 (2017), s. 243-254 ISSN 1805-8396 Institutional support: RVO:68378122 Keywords : consumer law * enforcement * alternative dispute resolution Subject RIV: AG - Legal Sciences OBOR OECD: Law
Antagonistic effects of three species of Trichoderma sp. on ...
African Journals Online (AJOL)
Francis
This research was funded by a grant (Project No. 247) from National ... quantities of protein utilizing the principle of protein-dye binding, Analytical Biochemistry 72, 248-254. ... Innovative approaches to plant disease control. John Wiley &.
African Journals Online (AJOL)
Items 151 - 200 of 254 ... Vol 28, No 3-4 (2016), Nutrition knowledge of young, post-year one, ... Obstructive Adenoid Hypertrophy in the Adult: A Case Report ... OA Egwuonwu, SNC Anyanwu, EC Ihekwoaba, GU Chianakwana, IBC Iloabachie.
Czech Academy of Sciences Publication Activity Database
Dal Moro, Giancarlo
2015-01-01
Roč. 254, JUL 1 (2015), s. 338-349 ISSN 0019-1035 Institutional support: RVO:67985891 Keywords : moon * Regoliths * geophysics * surface- wave Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.383, year: 2015
Gender differences in seasonal movement of dice snakes in Histria, southeastern Romania
Czech Academy of Sciences Publication Activity Database
Kärvemo, S.; Carlsson, M.; Tudor, M.; Sloboda, M.; Mihalca, A. D.; Ghira, I.; Bel, L.; Modrý, David
2011-01-01
Roč. 18, 20 September 2011 (2011), s. 245-254 ISSN 0934-6643 Institutional support: RVO:60077344 Keywords : Squamata * Natrix tessellata * dice snake * seasonal movements * activity patterns * sex ratio Subject RIV: EG - Zoology
ORF Alignment: NT_033779 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available n-like protein CL3 [Periplaneta americana] ... Length = 128 ... Query: 1 ... MVLDNQEDKLLTTTFLKSMGLSFTQSWHH... NT_033779 gi|21357645 >1qddA 26 143 127 254 1e-07 ... dbj|BAA82266.1| Cockroach lecti
Arno Rafael Cederberg ja Eesti ajalooteadus / Hans Kruus
Kruus, Hans, 1891-1976
2005-01-01
Soome ajalooprofessorist Arno Rafael Cederbergist (1885-1948). Tartu Ülikoolis töötades oli tema peamine õppe-ja uurimisaine Eesti ja Põhjamaade ajalugu. Ilm.: Eesti Kirjandus, 1935, nr. 6., lk. 254-255
Czech Academy of Sciences Publication Activity Database
Drahota, P.; Kulakowski, O.; Culka, A.; Knappová, M.; Rohovec, Jan; Veselovský, F.; Racek, M.
2018-01-01
Roč. 89, February (2018), s. 243-254 ISSN 0883-2927 Institutional support: RVO:67985831 Keywords : soil * mining waste * pharmacosiderite * yukonite * arseniosiderite Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Mineralogy Impact factor: 2.581, year: 2016
ISSN 2073-9990 East Cent Afr J Surg
African Journals Online (AJOL)
Appendicular perforation (25.4%) and gangrenous intussusception (23.8%) were the ... Successful management of peritonitis requires timely surgical intervention to ... perforations (especially peptic ulcer perforations) are more common in ...
Changes in endogenous hormone concentrations during ...
African Journals Online (AJOL)
Administrator
2011-09-14
Sep 14, 2011 ... The flowering initiation of pineapple plants is affected by the plant weight, ... mediate growth response on external factors such as light and temperature. ... vvv), and the detecting wavelength was 254 nm. Standards of ABA,.
Czech Academy of Sciences Publication Activity Database
Těšínská, Emilie
2015-01-01
Roč. 60, č. 3 (2015), s. 239-254 ISSN 0032-2423 Institutional support: RVO:68378114 Keywords : general theory of relativity * Albert Einstein * history of science * Viktor Trkal Subject RIV: AB - History
2010-01-01
... the air by a single occupant; (b) Is used or intended to be used for recreation or sport purposes only... than 155 pounds; or (e) If powered: (1) Weighs less than 254 pounds empty weight, excluding floats and...
African Journals Online (AJOL)
Ayodele Azeez A
Sample of gypsum from the site was obtained and its physical and chemical properties were determined. It was o ... of sisal fiber showed lower rate of 25.4% water absorbency. The result confirmed ..... Crystal System Habit. Cleavage. Lusture.
(Catharanthus roseus) tissue culture
African Journals Online (AJOL)
STORAGESEVER
2008-08-18
Aug 18, 2008 ... Abbreviations: NAA, Naphthalen acetic acid; Kin, Kinetin; MS,. Murashige and .... Acidic phase was isolated by sulphuric acid (5%) and ... reaction with Ceric Ammonium Sulfate (CAS) and Ultra violet (UV) detection (λ=254 ...
Johannes Müller, Exile Memories and the Dutch Revolt: The Narrated Diaspora, 1550-1750
Directory of Open Access Journals (Sweden)
C.A. (Annemieke Romein
2017-10-01
Full Text Available Johannes Müller, Exile Memories and the Dutch Revolt: The Narrated Diaspora, 1550-1750 (Dissertation Leiden University 2014; Leiden/ Boston: Brill. 2016, 254 pp., ISBN 9789004315914.
Glia: the fulcrum of brain diseases
Czech Academy of Sciences Publication Activity Database
Giaume, C.; Kirchhoff, F.; Matute, C.; Reichenbach, A.; Verkhratsky, Alexei
2007-01-01
Roč. 14, - (2007), s. 1324-1335 ISSN 1350-9047 Institutional research plan: CEZ:AV0Z50390512 Keywords : Glia * Astrocyte * Oligodendrocyte Subject RIV: FH - Neurology Impact factor: 8.254, year: 2007
CAMEX-4 NOAA LYMAN-ALPHA HYGROMETER V1
National Aeronautics and Space Administration — Ozone is measured in situ using a photometer consisting of a mercury lamp, two sample chambers and two detectors. The detectors measure the 254nm radiation...
2018-05-13T09:08:56Z https://www.ajol.info/index.php/all/oai oai:ojs ...
African Journals Online (AJOL)
... carbon footprint, green and blue water, human nutrition, production systems, ... is a major contributor to global warming resulted mainly from the FAO publication, ... animal production, from environment to human health; 247-254 2221-4062 ...
KWIC Index of nuclear codes (1975 edition)
International Nuclear Information System (INIS)
Akanuma, Makoto; Hirakawa, Takashi
1976-01-01
It is a KWIC Index for 254 nuclear codes in the Nuclear Code Abstracts (1975 edition). The classification of nuclear codes and the form of index are the same as those in the Computer Programme Library at Ispra, Italy. (auth.)
Johansen, Kasper; Sallam, Nader; Robson, Andrew; Samson, Peter; Chandler, Keith; Derby, Lisa; Eaton, Allen; Jennings, Jillian
2017-01-01
mapping approaches suitable for risk mapping. The GEOBIA mapping approach for canegrub damage detection was evaluated over three selected study sites in Queensland, covering a total of 254 km2 and included five main steps developed in the e
75 FR 74608 - Airworthiness Directives; CENTRAIR Models 101, 101A, 101P, and 101AP Gliders
2010-12-01
....societe.com . You may review copies of the referenced service information at the FAA, Small Airplane..., France; telephone: +33 (0)254 370796; fax: +33 (0)54. 374864; Internet: http://www.societe.com . (3) You...
48 CFR 3025.7002-3 - Specific application of trade agreements.
2010-10-01
...-discriminatory treatment under the World Trade Organization Agreement on Government Procurement (WTO GPA), or any... the WTO GPA, or any FTA listed in (FAR) 48 CFR subpart 25.4, apply the restrictions of (HSAR) 48 CFR...
Czech Academy of Sciences Publication Activity Database
Polívka, Tomáš; Chábera, P.; Kerfeld, C.A.
2013-01-01
Roč. 1827, č. 3 (2013), s. 248-254 ISSN 0005-2728 Institutional support: RVO:60077344 Keywords : orange-carotenoid protein * excited states * photoprotection Subject RIV: BO - Biophysics Impact factor: 4.829, year: 2013
Protective effects of two Astragalus species on ulcerative colitis in rats
African Journals Online (AJOL)
management of UC are corticosteroids, 5- ... toothache, and neck pain, or orally for treating .... Macroscopic assessment of ulcerative colitis ... (version 8) software package (SPSS Inc, USA). ..... University Press, Edinburgh, 1970: 49–254. 6.
Czech Academy of Sciences Publication Activity Database
Harris, N.; Kogan, F. Y.; Ilková, G.; Juhás, Štefan; Lahmy, O.; Gregor, Y. I.; Koppel, J.; Zhuk, R.; Gregor, P.
2014-01-01
Roč. 1840, č. 1 (2014), s. 245-254 ISSN 0304-4165 Institutional support: RVO:67985904 Keywords : heparan sulfate * heparin binding protein * glycosaminoglycan Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.381, year: 2014
2013-01-22
... following sites: Site 1 (1,830 acres)--Rivergate Industrial Park, Port Terminal Nos. 5 and 6, and the... Way and NE Alderwood Road, Portland; Site 3 (254 acres)--Portland Ship Repair Yard, 5555 N. Channel...
Zero-ODP Refrigerants for Low Tonnage Centrifugal Chiller Systems
National Research Council Canada - National Science Library
Gui, Fulin
1996-01-01
..., HFC-236cb, HFC-236fa, HFC-245cb, and HFC-254cb, for centrifugal chiller applications. We took into account the thermodynamic properties of the refrigerant and aerodynamic properties of the impeller compression process to this evaluation...
Czech Academy of Sciences Publication Activity Database
Michiels, J.; Skřivanová, E.; Missotten, J.; Ovyn, A.; Mrázek, Jakub; De Smet, S.; Dierick, N.
2012-01-01
Roč. 96, č. 6 (2012), s. 1101-1111 ISSN 0931-2439 Institutional support: RVO:67985904 Keywords : antioxidant * gut function * weaning piglets Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition Impact factor: 1.254, year: 2012
African Journals Online (AJOL)
HP
. 254 responses or injuries to asphyxia. (Shakespare, 2012). Although overwhelming aspiration of regurgitated contents had been considered a potential cause of instant death in mature bovines (Lopez, 2012, Shakespare,. 2012; McEwen ...
The Association between Oxidative Stress and Metabolic Syndrome in Adults
Chung, So-Won; Kang, Sung-Goo; Rho, Jun-Seung; Kim, Ha-Na; Song, In-Sun; Lee, Yun-Ah; Heo, Soo-Jeong; Song, Sang-Wook
2013-01-01
Background In this Study, we investigated the effects of lifestyle and metabolic syndrome on free oxygen radical levels in men and women in Korea. Methods A total of 254 adults were included in this study from February 2011 to June 2012 at a health promotion center. Information of the lifestyles and presence of metabolic syndrome factors was obtained. Biochemical markers were measured and free oxygen radicals test (FORT) was performed on the blood. Results Of the 254 subjects, 86 (33.9%) had ...
Time resolution measurements with an improved discriminator and conical scintillators
International Nuclear Information System (INIS)
McGervey, J.D.; Vogel, J.; Sen, P.; Knox, C.
1977-01-01
A new constant fraction discriminator with improved stability and walk characteristics is described. The discriminator was used with RCA C31024 photomultiplier tubes to test scintillators of conical and cylindrical shapes. Conical scintillators of 2.54 cm base diameter, 1.0 cm top diameter, and 2.54 cm height gave a fwhm of 155 ps for 60 Co gamma rays; larger conical scintillators gave an improvement of 10-15% in fwhm over cylindrical scintillators of equal volume. (Auth.)
Antony Finto; Lewis Jordan; Laurence R. Schimleck; Alexander Clark; Ray A. Souter; Richard F. Daniels
2011-01-01
Modulus of elasticity (MOE), modulus of rupture (MOR), and specific gravity (SG) are important properties for determining the end-use and value of a piece of lumber. This study addressed the variation in MOE, MOR, and SG with physiographic region, tree height, and wood type. Properties were measured from two static bending samples (dimensions 25.4 mm à 25.4 mm à 406.4...
UV-radiation and the flavonoid content in callus culture of Ononis arvensis L
International Nuclear Information System (INIS)
Tumowa, L.; Psotowa, R.
1998-01-01
The paper discussed a possible influence on the production of secondary metabolites - the flavonoids, by the method of elicitation in the callus cultures of Ononis arvensis L., the elicitor employed being the UV 254 and 366 nm and the sun-lamp. In some cases there was an increase in the production of flavonoids particularly 60, 120, 240 and 300 s after sun-lamp irradiation and in case of 15 and 30 min irradiation with UV-254 nm
Iranian Influence in Iraqi Shi’a Groups
2012-06-01
Movement in Iraq, 254. 60 Jabar, The Shīʻite Movement in Iraq, 254. 61 Robert Fisk, The Great War For Civilisation : the Conquest of the Middle East...by Iran in 62 Fisk, The Great War For Civilisation : the Conquest of the Middle East, 647. 63 John...U.S. soldier missing in Iraq. AAH sources indicated that the group was not behind the killing but rather just mediators in the process of returning
Therapeutic Efficacy of the Small Molecule GS-5734 against Ebola virus in Rhesus Monkeys
2016-03-02
culture. The diastereomeric mixture at phosphorous 858 containing GS-5734 was incubated continuously for 72 h at 1 µM and levels of intracellular NTP...constants (J) in Hertz. Analytical thin–layer chromatography was performed using Merck KGaA Silica gel 60 F254 glassplates with UV visualization. Preparative...trifluoroacetic acid in water and 0.1% trifluoroacetic acid in acetonitrile; flow rate, 2 mL/min; acquisition time, 6 min; wavelength, UV 214 and 254 nm
Crevice Corrosion Behavior of 45 Molybdenum-Containing Stainless Steels in Seawater.
1981-12-01
Armco, Avesta Jernverks, Cabot, Carpenter Technology, Crucible, Eastern, Firth-Brown, Huntington, Jessup, Langley Alloys, and Uddeholm. 16...Department of Energy, Report ANL/OTEC-BCM-022. 7. Wallen, B., and M. Liljas, " Avesta 254 SMO - A New, High Molybdenum Stainless Steel," presented at NKM8...1977).; 11. Wallen, B., " Avesta 254 SMO - A Stainless Steel for Seawater Service," presented at the Advanced Stainless Steels for Turbine Condensors
Pagès, Jean; Torréton, Jean-Pascal; Sempéré, Richard
1997-06-01
Two surveys were carried out on ten atolls in the Tuamotu archipelago (French Polynesia, Pacific Ocean). In vitro UV (250-400 nm) spectra of water samples gave absorption at 254 nm, A 254, and spectrum slope, S ⋆ (computed from In A λ versus λ).These two descriptors are negatively correlated, and data points are arrayed along a hyperbola spanned between an oceanic pole (high S ⋆, low A 254) and a confined pole (low 5 ⋆, high A 254). Dissolved organic carbon (DOC) concentrations, [C], as assessed by HTCO, exhibit a narrow range (0.7-1.0 mg C.L -1 for most lagoons) contrasting with the wide diversity of optical characteristics. [C] and A 254 are positively correlated, with a significant intercept (0.5 mg C.L -1) representing non-chromophoric DOC. Carbon-specific absorption, ɛ 254 increases (from 0.4 to 1.3 m 2.g -1) with increasing [C], mainly according to the literature) owing to increased average molecular weight (MW) of the chromophoric DOC fraction, which also lowers S ⋆. Our optical data thus illustrate a gradient of confinement (or residence time) that corresponds to a continuum in DOC nature, especially in MW and hence in bioavailability. Optical methods are confirmed as quick and effective means of assessing DOM distribution.
Dimeric Structure of the Blue Light Sensor Protein Photozipper in the Active State.
Ozeki, Kohei; Tsukuno, Hiroyuki; Nagashima, Hiroki; Hisatomi, Osamu; Mino, Hiroyuki
2018-02-06
The light oxygen voltage-sensing (LOV) domain plays a crucial role in blue light (BL) sensing in plants and microorganisms. LOV domains are usually associated with the effector domains and regulate the activities of effector domains in a BL-dependent manner. Photozipper (PZ) is monomeric in the dark state. BL induces reversible dimerization of PZ and subsequently increases its affinity for the target DNA sequence. In this study, we report the analyses of PZ by pulsed electron-electron double resonance (PELDOR). The neutral flavin radical was formed by BL illumination in the presence of dithiothreitol in the LOV-C254S (without the bZIP domain) and PZ-C254S mutants, where the cysteine residue responsible for adduct formation was replaced with serine. The magnetic dipole interactions of 3 MHz between the neutral radicals were detected in both LOV-C254S and PZ-C254S, indicating that these mutants are dimeric in the radical state. The PELDOR simulation showed that the distance between the radical pair is close to that estimated from the dimeric crystal structure in the "light state" [Heintz, U., and Schlichting, I. (2016) eLife 5, e11860], suggesting that in the radical state, LOV domains in PZ-C254S form a dimer similar to that of LOV-C254S, which lacks the bZIP domain.
Adaptive changes in NAD+ metabolism in ultraviolet light-irradiated murine lymphoma cells
International Nuclear Information System (INIS)
Kleczkowska, H.E.; Szumiel, I.; Althaus, F.R.
1990-01-01
We have determined the ability of UV254nm-irradiated murine lymphoma cells to adapt their NAD+ metabolism to the increased NAD+ consumption for the poly ADP-ribosylation of chromatin proteins. Two murine lymphoma sublines with differential UV-sensitivity and poly(ADP-ribose) turnover were used as a model system. The first subline, designated LY-R is UV254nm-sensitive and tumorigenic in DBA/2 mice. The second subline, LY-S is UV254nm-resistant and nontumorigenic. Following treatment of these cells with 2 mM benzamide, an inhibitor of the NAD(+)-utilizing enzyme poly(ADP-ribose) polymerase, NAD+ levels slowly increased up to about 160% of control levels after 3 hours. When benzamide was added to these cultures 20 min after UV254nm irradiation, a dramatic transient increase of NAD+ levels was observed within 4 min in LY-R cells and more moderately in LY-S cells. At later times after UV254nm irradiation, the NAD+ levels increased in both sublines reaching up to 200% of the concentrations prior to benzamide treatment. These results demonstrate an adaptative response of NAD+ metabolism to UV254nm irradiation. In parallel, we observed a differential repartitioning of ADP-ribosyl residues between the NAD+ and poly(ADP-ribose) pools of LY-R and LY-S cells that correlates with the differential UV sensitivity of these cells
Directory of Open Access Journals (Sweden)
Víctor Alfonso Solarte
Full Text Available Oral squamous cell carcinoma is the fifth most common epithelial cancer in the world, and its current clinical treatment has both low efficiency and poor selectivity. Cationic amphipathic peptides have been proposed as new drugs for the treatment of different types of cancer. The main goal of the present work was to determine the potential of LfcinB(20-254, a tetrameric peptide based on the core sequence RRWQWR of bovine lactoferricin LfcinB(20-25, for the treatment of OSCC. In brief, OSCC was induced in the buccal pouch of hamsters by applying 7,12-Dimethylbenz(aanthracene, and tumors were treated with one of the following peptides: LfcinB(20-254, LfcinB(20-25, or vehicle (control. Lesions were macroscopically evaluated every two days and both histological and serum IgG assessments were conducted after 5 weeks. The size of the tumors treated with LfcinB(20-254 and LfcinB(20-25 was smaller than that of the control group (46.16±4.41 and 33.92±2.74 mm3 versus 88.77±10.61 mm3, respectively. Also, LfcinB(20-254 caused acellularity in the parenchymal tumor compared with LfcinB(20-25 and vehicle treatments. Furthermore, our results demonstrated that both LfcinB(20-254 and LfcinB(20-25 induced higher degree of apoptosis relative to the untreated tumors (75-86% vs 8%, respectively. Moreover, although the lowest inflammatory response was achieved when LfcinB(20-254 was used, this peptide appeared to induce higher levels of IgG antibodies relative to the vehicle and LfcinB(20-25. In addition the cellular damage and selectivity of the LfcinB(20-254 peptide was evaluated in vitro. These assays showed that LfcinB(20-254 triggers a selective necrotic effect in the carcinoma cell line. Cumulatively, these data indicate that LfcinB(20-254 could be considered as a new therapeutic agent for the treatment of OSCC.
Directory of Open Access Journals (Sweden)
Robert D Lagow
2007-04-01
Full Text Available Both constitutive secretion and Ca(2+-regulated exocytosis require the assembly of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE complexes. At present, little is known about how the SNARE complexes mediating these two distinct pathways differ in structure. Using the Drosophila neuromuscular synapse as a model, we show that a mutation modifying a hydrophobic layer in syntaxin 1A regulates the rate of vesicle fusion. Syntaxin 1A molecules share a highly conserved threonine in the C-terminal +7 layer near the transmembrane domain. Mutation of this threonine to isoleucine results in a structural change that more closely resembles those found in syntaxins ascribed to the constitutive secretory pathway. Flies carrying the I254 mutant protein have increased levels of SNARE complexes and dramatically enhanced rate of both constitutive and evoked vesicle fusion. In contrast, overexpression of the T254 wild-type protein in neurons reduces vesicle fusion only in the I254 mutant background. These results are consistent with molecular dynamics simulations of the SNARE core complex, suggesting that T254 serves as an internal brake to dampen SNARE zippering and impede vesicle fusion, whereas I254 favors fusion by enhancing intermolecular interaction within the SNARE core complex.
The pin pixel detector--neutron imaging
Bateman, J E; Derbyshire, G E; Duxbury, D M; Marsh, A S; Rhodes, N J; Schooneveld, E M; Simmons, J E; Stephenson, R
2002-01-01
The development and testing of a neutron gas pixel detector intended for application in neutron diffraction studies is reported. Using standard electrical connector pins as point anodes, the detector is based on a commercial 100 pin connector block. A prototype detector of aperture 25.4 mmx25.4 mm has been fabricated, giving a pixel size of 2.54 mm which matches well to the spatial resolution typically required in a neutron diffractometer. A 2-Dimensional resistive divide readout system has been adapted to permit the imaging properties of the detector to be explored in advance of true pixel readout electronics. The timing properties of the device match well to the requirements of the ISIS-pulsed neutron source.
A preliminary parasitological survey of hepatozoon spp. Infection in dogs in mashhad, iran.
Amoli, Aa Rahmani; Khoshnegah, J; Razmi, Ghr
2012-01-01
We attempted to determine the prevalence of Hepatozoon spp. infection in Mashhad, northeast of Iran, via blood smear parasitology. The prevalence was investigated by examination of blood smear parasitology, using blood samples collected from 254 dogs (51 strays and 203 privately owned-dogs). Two stray dogs (2/51; 3.92%) and two privately-owned dogs (2/203; 0.98%) were infected with Hepatozoon spp. Therefore, as per blood smear parasitology, the prevalence of Hepatozoon spp. infection was 1.57% (4/254). Sixteen out of 254 dogs (6.29%) were infested with ticks; all of which were Rhipicephalus sanguineus. One of the dogs infected with Hepatozoon spp. exhibited ticks at the time of examination. Concurrent infection with Ehrlichia canis and Leishmania infantum was not detected in the four Hepatozoon spp. infected dogs. This is the first epidemiological study on the prevalence of Hepatozoon spp. infection in dogs in Iran.
Maximum permissible concentration (MPC) values for spontaneously fissioning radionuclides
International Nuclear Information System (INIS)
Ford, M.R.; Snyder, W.S.; Dillman, L.T.; Watson, S.B.
1976-01-01
The radiation hazards involved in handling certain of the transuranic nuclides that exhibit spontaneous fission as a mode of decay were reaccessed using recent advances in dosimetry and metabolic modeling. Maximum permissible concentration (MPC) values in air and water for occupational exposure (168 hr/week) were calculated for 244 Pu, 246 Cm, 248 Cm, 250 Cf, 252 Cf, 254 Cf, /sup 254m/Es, 255 Es, 254 Fm, and 256 Fm. The half-lives, branching ratios, and principal modes of decay of the parent-daughter members down to a member that makes a negligible contribution to the dose are given, and all daughters that make a significant contribution to the dose to body organs following inhalation or ingestion are included in the calculations. Dose commitments for body organs are also given
Stretchable microelectrode array using room-temperature liquid alloy interconnects
International Nuclear Information System (INIS)
Wei, P; Ziaie, B; Taylor, R; Chung, C; Higgs, G; Pruitt, B L; Ding, Z; Abilez, O J
2011-01-01
In this paper, we present a stretchable microelectrode array for studying cell behavior under mechanical strain. The electrode array consists of gold-plated nail-head pins (250 µm tip diameter) or tungsten micro-wires (25.4 µm in diameter) inserted into a polydimethylsiloxane (PDMS) platform (25.4 × 25.4 mm 2 ). Stretchable interconnects to the outside were provided by fusible indium-alloy-filled microchannels. The alloy is liquid at room temperature, thus providing the necessary stretchability and electrical conductivity. The electrode platform can withstand strains of up to 40% and repeated (100 times) strains of up to 35% did not cause any failure in the electrodes or the PDMS substrate. We confirmed biocompatibility of short-term culture, and using the gold pin device, we demonstrated electric field pacing of adult murine heart cells. Further, using the tungsten microelectrode device, we successfully measured depolarizations of differentiated murine heart cells from embryoid body clusters
Nuclear reactions and the synthesis of new species
International Nuclear Information System (INIS)
Anon.
1983-01-01
Targets of relatively short-lived, neutron-rich transplutonium isotopes, such as 254 Es, which are produced by the HFIR/TRU, when combined with the capabilities of modern heavy-ion accelerators, offer a unique possibility to expand our knowledge of chemical elements and atomic nuclei toward the limits of nuclear stability. This knowledge should enable us to delineate the forces that eventually terminate the periodic table at its upper end. Specifically, the panel concludes that significant research opportunities exist in several areas, which are highlighted below: Nucleon-transfer reactions between light heavy-ion projectiles (such as 18 O, 22 Ne, or 48 Ca) and 254 Es targets will give access to a completely uncharted region of neutron-rich isotopes. Cold-fusion reactions of 48 Ca projectiles with /sup 254,255/Es targets should yield superheavy nuclei with neutron numbers very close to the predicted closed neutron shell at N = 184
Fu, Jie; Lee, Wan-Ning; Coleman, Clark; Meyer, Melissa; Carter, Jason; Nowack, Kirk; Huang, Ching-Hua
2017-01-01
A pilot study employing two parallel trains of two-stage biofiltration, i.e., a sand/anthracite (SA) biofilter followed by a biologically-active granular activated carbon (GAC) contactor, was conducted to test the efficiency, feasibility and stability of biofiltration for removing natural organic matter (NOM) after coagulation in a drinking water treatment plant. Results showed the biofiltration process could effectively remove turbidity (24% of dissolved organic carbon (DOC), >57% of UV 254 , and >44% of SUVA 254 ), where the SA biofilters showed a strong capacity for turbidity removal, while the GAC contactors played the dominant role in NOM removal. The vertical profile of water quality in the GAC contactors indicated the middle-upper portion was the critical zone for the removal of NOM, where relatively higher adsorption and enhanced biological removal were afforded. Fluorescence excitation-emission matrix (EEM) analysis of NOM showed that the GAC contactors effectively decreased the content of humic-like component, while protein-like component was refractory for the biofiltration process. Nutrients (NH 4 -N and PO 4 -P) supplementation applied upstream of one of the two-stage biofiltration trains (called engineered biofiltration) stimulated the growth of microorganisms, and showed a modest effect on promoting the biological removal of small non-aromatic compositions in NOM. Redundancy analysis (RDA) indicated influent UV 254 was the most explanatory water quality parameter for GAC contactors' treatment performance, and a high load of UV 254 would result in significantly reduced removals of UV 254 and SUVA 254 . Copyright © 2016 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Hesketh, K.; Porsch, D.; Rimpault, G.; Taiwo, T.; Worrall, A.
2013-01-01
The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238 U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for
International Nuclear Information System (INIS)
2012-01-01
The Director General has received a note verbale dated 15 June 2012 from the Permanent Mission of Mexico to the International Atomic Energy Agency providing information on the decision of the Government of Mexico to act in accordance with the 'Guidelines for the Export of Nuclear Material, Equipment and Technology', issued as document INFCIRC/254/Rev.10/Part 1, including its Annexes, and with the 'Guidelines for Transfers of Nuclear-Related Dual-Use Equipment, Material, Software and Related Technology', issued as document INFCIRC/254/Rev.8/Part 2
International Nuclear Information System (INIS)
2012-01-01
The Director General has received a note verbale dated 15 June 2012 from the Permanent Mission of Mexico to the International Atomic Energy Agency providing information on the decision of the Government of Mexico to act in accordance with the 'Guidelines for the Export of Nuclear Material, Equipment and Technology', issued as document INFCIRC/254/Rev.10/Part 1, including its Annexes, and with the 'Guidelines for Transfers of Nuclear-Related Dual-Use Equipment, Material, Software and Related Technology', issued as document INFCIRC/254/Rev.8/Part 2
The pin pixel detector--X-ray imaging
Bateman, J E; Derbyshire, G E; Duxbury, D M; Marsh, A S; Simmons, J E; Stephenson, R
2002-01-01
The development and testing of a soft X-ray gas pixel detector, which uses connector pins for the anodes is reported. Based on a commercial 100 pin connector block, a prototype detector of aperture 25.4 mm centre dot 25.4 mm can be economically fabricated. The individual pin anodes all show the expected characteristics of small gas detectors capable of counting rates reaching 1 MHz per pin. A 2-dimensional resistive divide readout system has been developed to permit the imaging properties of the detector to be explored in advance of true pixel readout electronics.
Test Methods for Measuring Material Properties of Composite Materials in all Three Material Axes
2012-01-24
eccentricities in the test setup. Therefore, the research team purchased a special test fixture for performing out-of-plane tension testing in which the...coated wheels as shown in Figure 6. The 15.2 cm long by 2.54 cm thick blocks were separated into five pieces, each with a length of 2.67 cm using the...composite plate. Figure 6. Blocks reduced to a thickness of 2.54 cm using surface grinder and custom electro plated diamond coated wheels Figure 7
Bacterial growth in humic waters exposed to UV-radiation and simulated sunlight
DEFF Research Database (Denmark)
Corin, N.; Backlund, P.; Wiklund, T.
1998-01-01
Sterile filtered (0.45 mu m) humic lake water was exposed to simulated sunlight (300-800 nm) or W-radiation (254 run)for various periods of times and the dissolved organic carbon content, absorbance at 254 and 460 nm and PH were recorded. The irradiated water was inoculated with a natural bacterial...... assemblage and the number of viable bacteria war estimated 3 and 5 days after the inoculation using the plate count technique. The number of viable bacteria increased with the irradiation time indicating that the chemical changes of the humus macromolecules observed during irradiation resulted...
International Nuclear Information System (INIS)
2012-01-01
The Director General has received a note verbale dated 28 September 2012 from the Permanent Mission of Serbia to the International Atomic Energy Agency providing information on the decision of the Government of Serbia to adhere to the 'Guidelines for the Export of Nuclear Material, Equipment and Technology', issued as document INFCIRC/254/Rev.10/Part 1, including its Annexes, and with the 'Guidelines for Transfers of Nuclear-Related Dual-Use Equipment, Material, Software and Related Technology', issued as document INFCIRC/254/Rev.8/Part 2 [fr
Energy Technology Data Exchange (ETDEWEB)
NONE
2012-06-19
The Director General has received a note verbale dated 15 June 2012 from the Permanent Mission of Mexico to the International Atomic Energy Agency providing information on the decision of the Government of Mexico to act in accordance with the 'Guidelines for the Export of Nuclear Material, Equipment and Technology', issued as document INFCIRC/254/Rev.10/Part 1, including its Annexes, and with the 'Guidelines for Transfers of Nuclear-Related Dual-Use Equipment, Material, Software and Related Technology', issued as document INFCIRC/254/Rev.8/Part 2.
Energy Technology Data Exchange (ETDEWEB)
NONE
2012-06-19
The Director General has received a note verbale dated 15 June 2012 from the Permanent Mission of Mexico to the International Atomic Energy Agency providing information on the decision of the Government of Mexico to act in accordance with the 'Guidelines for the Export of Nuclear Material, Equipment and Technology', issued as document INFCIRC/254/Rev.10/Part 1, including its Annexes, and with the 'Guidelines for Transfers of Nuclear-Related Dual-Use Equipment, Material, Software and Related Technology', issued as document INFCIRC/254/Rev.8/Part 2.
International Nuclear Information System (INIS)
2012-01-01
The Director General has received a note verbale dated 28 September 2012 from the Permanent Mission of Serbia to the International Atomic Energy Agency providing information on the decision of the Government of Serbia to adhere to the 'Guidelines for the Export of Nuclear Material, Equipment and Technology', issued as document INFCIRC/254/Rev.10/Part 1, including its Annexes, and with the 'Guidelines for Transfers of Nuclear-Related Dual-Use Equipment, Material, Software and Related Technology', issued as document INFCIRC/254/Rev.8/Part 2 [es
Mycological studies housed in the Apollo 16 microbial ecology evaluation device
Volz, P. A.
1973-01-01
Survival, death, and phenotype count have yielded variation in the number of fungi recovered from the controls and the flight exposed cuvettes during preliminary analysis of postflight first phase data. Also the preliminary analysis was indicative that fungi exposed to specific space flight conditions demonstrated variable survival rates and phenotype counts. Specific space flight conditions included full light space exposure for Chaetomium globosum, exposure at 300- and 254-nanometer wavelengths for Rhodotorula rubra, full light and 280-nanometer wavelength exposure for Trichophyton terrestre, and 254-nanometer wavelength exposure for Saccharomyces cerevisiae. In general, phenotype counts for flight cuvettes and survival rates for control cuvettes were higher compared with the remaining cuvettes.
Conversion electron spectroscopy in transfermium nuclei
International Nuclear Information System (INIS)
Herzberg, R.D.
2003-01-01
Conversion electron spectroscopy is an essential tool for the spectroscopy of heavy deformed nuclei. The conversion electron spectrometer SACRED has been used in conjunction with the gas-filled recoil separator RITU to study conversion electron cascades in 254 No. The spectra reveal the ground state rotational bands down to low spin. A detailed analysis of the background seen for 254 No shows that approximately 40% of the decay path goes via excited high K bands which may be built on an isomer. (orig.)
Reflective optical imaging system for extreme ultraviolet wavelengths
Viswanathan, V.K.; Newnam, B.E.
1993-05-18
A projection reflection optical system has two mirrors in a coaxial, four reflection configuration to reproduce the image of an object. The mirrors have spherical reflection surfaces to provide a very high resolution of object feature wavelengths less than 200 [mu]m, and preferably less than 100 [mu]m. An image resolution of features less than 0.05-0.1 [mu]m, is obtained over a large area field; i.e., 25.4 mm [times] 25.4 mm, with a distortion less than 0.1 of the resolution over the image field.
Miyazato, Itsuki; Tanaka, Yuzuru; Takahashi, Keisuke
2018-02-01
Two-dimensional (2D) magnets are explored in terms of data science and first principle calculations. Machine learning determines four descriptors for predicting the magnetic moments of 2D materials within reported 216 2D materials data. With the trained machine, 254 2D materials are predicted to have high magnetic moments. First principle calculations are performed to evaluate the predicted 254 2D materials where eight undiscovered stable 2D materials with high magnetic moments are revealed. The approach taken in this work indicates that undiscovered materials can be surfaced by utilizing data science and materials data, leading to an innovative way of discovering hidden materials.
AAS determination of total mercury content in environmental samples
International Nuclear Information System (INIS)
Moskalova, M.; Zemberyova, M.
1997-01-01
Two methods for determination of total mercury content in environmental samples soils, and sediments, were compared. Dissolution procedure of soils, sediments, and biological material under elevated pressure followed by determination of mercury by cold vapour atomic absorption spectrometry using a MHS-1 system and direct total mercury determination without any chemical pretreatment from soil samples using a Trace Mercury Analyzer TMA-254 were compared. TMA-254 was also applied for the determination of mercury in various further standard reference materials. Good agreement with certified values of environmental reference materials was obtained. (authors)
International Nuclear Information System (INIS)
2012-01-01
The Director General has received a note verbale dated 28 September 2012 from the Permanent Mission of Serbia to the International Atomic Energy Agency providing information on the decision of the Government of Serbia to adhere to the 'Guidelines for the Export of Nuclear Material, Equipment and Technology', issued as document INFCIRC/254/Rev.10/Part 1, including its Annexes, and with the 'Guidelines for Transfers of Nuclear-Related Dual-Use Equipment, Material, Software and Related Technology', issued as document INFCIRC/254/Rev.8/Part 2
Lifescience Database Archive (English)
Full Text Available QT75075 Solanum lycopersicum Solanaceae ... Seed quality_germination rate mean germination... rate (reciprocal of the mean germination time; MGT-1) 2 ... Chr12 49.5-63.0 2.54 ... 10.1111/j.1365-3040.2011.02463.x 22074055
Experimental handling of sugar beets in the alcohol plant at Lipetsk. [USSR
Energy Technology Data Exchange (ETDEWEB)
Grachev, B K
1958-01-01
After introducing several technical improvements in the plant layout (flow scheme presented), especially in the cutting units which shred the beets, it is easily possible now by fermenting with strain XII or strain M to attain production with an EtOH of 87.2% by volume, which contains 0.05% andehydes, 254 mg/1 ester, and 21 mg/1 acid.
African Journals Online (AJOL)
2009-06-02
Jun 2, 2009 ... magnetic resonance imaging (MRI) of the brain and full- thickness skin ... South Africa, and also suggests that skin electron microscopy is useful, despite recent .... gait was broad-based with a tendency to invert the right foot. Renal, liver and .... 39(3): 247-254. 2. Tournier-Lasserve E, Joutel A, Melki J, et al.
Prevalent Diseases Identified in Semi-Industrial Poultry Farming in ...
African Journals Online (AJOL)
This study was conducted in 2003-2007 with the aim of identifying prevalent diseases in modern poultry farming in Mali. It covered 22 modern layer farms located in the suburban areas of Bamako District and of Sikasso and Segou towns. Analyses focused on a total of 536 samples, 260 sera, 254 eggs, 149 organ samples, ...
ORF Alignment: NC_002570 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002570 gi|15612789 >1v7zA 3 254 1 238 1e-53 ... dbj|BAB03945.1| creatinine amidohy...drolase [Bacillus halodurans C-125] ... ref|NP_241092.1| creatinine amidohydrolase [Bacillus ...
Resonance – Journal of Science Education | News
Indian Academy of Sciences (India)
pp 254-273 General Article. Symmetries and Conservation Laws in Classical and Quantum Mechanics - Quantum Mechanics · K S Mallesh S Chaturvedi V Balakrishnan R Simon N Mukunda ... T Padmanabhan · More Details Fulltext PDF. pp 279-292 Reflections. Darshana Jolts - Sound: The Vehicle for Speech and Music.
Czech Academy of Sciences Publication Activity Database
Sovilj, Milan
2017-01-01
Roč. 25, č. 1 (2017), s. 251-254 ISSN 0354-6497 Institutional support: RVO:68378114 Keywords : conference * Balkan studies * contemporary history Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)
Czech Academy of Sciences Publication Activity Database
Čeřovská, Noemi; Moravec, Tomáš; Plchová, Helena; Hoffmeisterová, Hana; Dědič, P.
2012-01-01
Roč. 160, č. 5 (2012), s. 251-254 ISSN 0931-1785 R&D Projects: GA MŠk 1M06030 Institutional research plan: CEZ:AV0Z50380511 Keywords : Potato virus M * recombinant protein * coat protein Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.000, year: 2012
Wives' Relative Wages, Husbands' Paid Work Hours, and Wives' Labor-Force Exit
Shafer, Emily Fitzgibbons
2011-01-01
Economic theories predict that women are more likely to exit the labor force if their partners' earnings are higher and if their own wage rate is lower. In this article, I use the National Longitudinal Survey of Youth (N = 2,254) and discrete-time event-history analysis to show that wives' relative wages are more predictive of their exit than are…
antidiabetic activity of anacardium occidentale in alloxan – diabetic
African Journals Online (AJOL)
User
ethanolic extract led to fractions that displayed diverse hypoglycemic effects at doses of 34.0,. 200.0 and 300.0 mg/kg body ... plates. TLC bands were visualized under UV lamps at 254 and 366 nm or with vanilin spray reagent. Plant Material.
acetyl-4-methyl- 6-(2-fluorophenylimino)-6H-thiopyran
African Journals Online (AJOL)
Administrator
2011-10-19
Oct 19, 2011 ... effect of ligand complexation on DNA structure led to the overall affinity constant of K3M-DNA = 2.4 x 104. M-1. ... (60 F254) sheets that were visualized under a UV lamp. .... inhibited ranging from 10 to 90% with a loss of viable.
Methods for Determination of Bioaccessibility and Bioavailability of Hydrophobic Organic Pollutants
Czech Academy of Sciences Publication Activity Database
Čvančarová, Monika; Cajthaml, Tomáš
2015-01-01
Roč. 109, č. 4 (2015), s. 254-268 ISSN 0009-2770 R&D Projects: GA TA ČR TE01020218; GA ČR GA13-28283S Institutional support: RVO:61388971 Keywords : bioremediation * bioaccumulation * environmental risk assessment Subject RIV: EE - Microbiology, Virology Impact factor: 0.279, year: 2015
DEFF Research Database (Denmark)
Hansen, M. Trier
1982-01-01
The processing of damaged DNA was altered in a mitomycin C-sensitive mutant (mtcA) of Micrococcus radiodurans. Even though the mutant retained resistance to 254-nm UV radiation, it did not, in contrast to the wild-type strain, show any excessive DNA degradation or cell death when incubated...
Personality as Correlate of Perceived Job Stress Among Electoral ...
African Journals Online (AJOL)
This study examined the relationship of personality (conscientiousness dimension) with electoral officers perceived job stress during election. The survey utilised the expost facto research design. A total of 346 participants responded to the questionnaires. In all, 254 (70.4%) were males and 101 (29.6%) were females.
Historiografie biologie a jejich grande dame Ilse Jahnová (1922-2010)
Czech Academy of Sciences Publication Activity Database
Hermann, Tomáš; Šimůnek, Michal V.
2010-01-01
Roč. 43, č. 4 (2010), s. 249-254 ISSN 0300-4414 R&D Projects: GA ČR GPP410/10/P550 Institutional research plan: CEZ:AV0Z80630520 Keywords : Ilse Jahn * historiography of biology * history of science Subject RIV: AB - History
A practitioner’s perspective on coaching effectiveness
Theeboom, T.; van Vianen, A.E.M.; Beersma, B.; Zwitser, R.; Kobayashi, V.; Nota, L.; Soresi, S.
2018-01-01
In past decades, coaching – which involves a “result-oriented, systematic process in which the coach facilitates the enhancement of life experience and goal-attainment in the personal and/or professional life of normal, non-clinical clients” (Grant, 2003, p. 254) – has grown into a $2 billion
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 3. General Relativity and the Accelerated Expansion of the Universe. Patrick Das Gupta. General Article Volume 17 Issue 3 March 2012 pp 254-273. Fulltext. Click here to view fulltext PDF. Permanent link:
The Eagle in the Desert: The Origins of the U.S.Saudi Arabian Security Partnership
2015-09-01
projects that 15 percent of Saudi Arabia’s power will 254 Angus Miller and Shamil Yenikeyeff...Studies 31, no. 1 (2004): 5–23. http://www.jstor.org/stable/4145533. Miller, Angus and Shamil Yenikeyeff. “Oil’s Well in Central Asia.” Foreign Affairs
Discrepancies between Parents' and Children's Attitudes toward TV Advertising
Baiocco, Roberto; D'Alessio, Maria; Laghi, Fiorenzo
2009-01-01
The authors conducted a study with 500 parent-child dyads. The sample comprised 254 boys and 246 girls. The children were grouped into 5 age groups (1 group for each age from 7 to 11 years), with each group comprising 100 children. The survey regards discrepancies between children and their parents on attitudes toward TV advertising to determine…
Choosing Adolescent Smokers as Friends: The Role of Parenting and Parental Smoking
Mercken, L.; Sleddens, E. F. C.; de Vries, H.; Steglich, C. E. G.
2013-01-01
The present study examined whether parenting and parental smoking can prevent children from selecting smoking friends during adolescence. 254 Adolescents of one Belgian secondary school participated. Self-administered questionnaires were distributed among 2nd-4th graders (mean ages = 14.2-16.2 years) during spring 2006. Follow-up was conducted 12…
2013-12-09
... dogs and the treatment and control of sarcoptic mange caused by Sarcoptes scabiei var. canis... sarcoptic mange caused by Sarcoptes scabiei var. canis. 141-254 Bayer HealthCare ADVANTAGE MULTI for... MULTI for Supplemental 524.1146 yes CE.1 3 LLC, Animal Health Dogs (imidacloprid approval for the...
Indian Academy of Sciences (India)
Admin
The purity determination of the starting materials and reaction monitoring was accomplished by thin-layer chromatography (TLC) on Merck silica gel G F254 plates. .... Brown liquid, 1H NMR (400 MHz, CDCl3):δ 8.78 (d, J = 8 Hz, 2H), 8.00 (d, ...
Choosing adolescent smokers as friends : The role of parenting and parental smoking
Mercken, L.; Sleddens, E. F. C.; de Vries, H.; Steglich, C. E. G.
The present study examined whether parenting and parental smoking can prevent children from selecting smoking friends during adolescence. 254 Adolescents of one Belgian secondary school participated. Self-administered questionnaires were distributed among 2nd-4th graders (mean ages = 14.2-16.2
Scanning Probe Investigation of Pitting Corrosion on Aluminum 5083 H131
2014-05-01
245–254. 10. Dolic, N.; Malina, J.; Begic Hadzipasic, A. Pit Nucleation on As-Cast Aluminum Alloy AW-5083 in 0.01M NaCl. Journal of Mining and...R. A.; Stratmann, M. Application of a Kelvin Microprobe to the Corrosion in Humid Atmospheres. J. Electrochem Soc. 1991, 138 (1), 55–61. 15
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics. K V Ramanathan. Articles written in Pramana – Journal of Physics. Volume 59 Issue 2 August 2002 pp 243-254. Developments in quantum information processing by nuclear magnetic resonance: Use of quadrupolar and dipolar couplings · Anil Kumar K V Ramanathan T S ...
78 FR 68987 - Guides for Private Vocational and Distance Education Schools
2013-11-18
... deceptive practices in connection with the advertising, promotion, marketing, or sale of their courses or... CFR Part 254 Advertising, Trade practices. Text of Amendments For the reasons set forth in the... the application of section 5 of the FTC Act [[Page 68990
Schaefer, K. U.; Kurtzhals, J. A.; Kager, P. A.; Gachihi, G. S.; Gramiccia, M.; Kagai, J. M.; Sherwood, J. A.; Muller, A. S.
1994-01-01
The leishmanin skin test (LST) was applied in 26 clusters of an average of 97 individuals in Baringo District, Kenya. These clusters were centered around recent cases of visceral leishmaniasis (VL). Of 2,411 individuals tested, 254 (10.5%, 155 males and 99 females) had a positive reaction. Among
Economic Efficiency of Maize Production in Yola North Local ...
African Journals Online (AJOL)
user
Table 2. mean effects of two location on the properties of the undisturbed soil samples. Location ... 12.0. 37.8. LSD. NS. NS. NS. NS. NS. CV. 32.8. 12.9. 26.8. 25.4. 31.6. BD: Bulk density. ... brain damage; produce tumour. 0.01. Nickel.
Method for removal of mercury from various gas streams
Granite, E.J.; Pennline, H.W.
2003-06-10
The invention provides for a method for removing elemental mercury from a fluid, the method comprising irradiating the mercury with light having a wavelength of approximately 254 nm. The method is implemented in situ at various fuel combustion locations such as power plants and municipal incinerators.
2010-07-08
... the occurrence and duration of any startup, shutdown, or malfunction in the operation of an affected... collection of information is estimated to average 100.5 hours per response. Burden means the total time... Total Annual Cost: $597,254, which includes $465,654 in labor costs, $0 in capital/startup costs, and...
Osburn, Christopher L.; Oviedo-Vargas, Diana; Barnett, Emily; Dierick, Diego; Oberbauer, Steven F.; Genereux, David P.
2018-03-01
A paired-watershed approach was used to compare the quality and fluxes of dissolved organic matter (DOM) during stormflow and baseflow in two lowland tropical rainforest streams located in northeastern Costa Rica. The Arboleda stream received regional groundwater (RGW) flow, whereas the Taconazo stream did not. DOM quality was assessed with absorbance and fluorescence and stable carbon isotope (δ13C-DOC) values. RGW DOM lacked detectable fluorescence and had specific ultraviolet absorption (SUVA254) and absorbance slope ratio (SR) values consistent with low aromaticity and low molecular weight material, respectively. We attributed these properties to microbial degradation and sorption of humic DOM to mineral surfaces during transport through bedrock. SUVA254 values were lower and SR values were higher in the Arboleda stream during baseflow compared to the Taconazo stream, presumably due to dilution by RGW. However, no significant difference in SUVA254 or SR occurred between the streams during stormflow. SUVA254 was negatively correlated to δ13C-DOC (r2 = 0.61, P runoff containing soil and throughfall C sources. Mean DOC export from the Taconazo stream during the study period was 2.62 ± 0.39 g C m-2 year-1, consistent with other tropical streams, yet mean DOC export from the Arboleda stream was 13.79 ± 2.07 g C m-2 year-1, one of the highest exports reported and demonstrating a substantial impact of old RGW from outside the watershed boundary can have on surface water carbon cycling.
Corporal Punishment in Tanzania's Schools
Feinstein, Sheryl; Mwahombela, Lucas
2010-01-01
The purpose of this survey was to acquire descriptive information regarding corporal punishment in Tanzania's O-level secondary schools. 448 individuals participated in the study: 254 teachers and 194 students, all from government or private secondary schools in the Iringa Region of Tanzania. In addition, 14 students and 14 teachers were…
File list: Unc.Neu.10.AllAg.Hypothalamus [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Unc.Neu.10.AllAg.Hypothalamus mm9 Unclassified Neural Hypothalamus SRX956253,SRX956...254 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.Neu.10.AllAg.Hypothalamus.bed ...
File list: ALL.Neu.10.AllAg.Hypothalamus [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available ALL.Neu.10.AllAg.Hypothalamus mm9 All antigens Neural Hypothalamus SRX956253,SRX956...254 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Neu.10.AllAg.Hypothalamus.bed ...
Brno (k.ú. Bystrc, okr. Brno-město). Rokle. Neolit. Ojedinělý nález. Povrchový průzkum
Czech Academy of Sciences Publication Activity Database
Kirchner, Karel; Kuča, M.
2009-01-01
Roč. 50, 1-2 (2009), s. 253-254 ISSN 1211-7250 R&D Projects: GA ČR GA205/06/1024 Institutional research plan: CEZ:AV0Z30860518 Keywords : Brno Reservoir * neolithic * surface survey Subject RIV: AC - Archeology, Anthropology, Ethnology
Data of evolutionary structure change: 1CG5A-2ZLWD [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1CG5A-2ZLWD 1CG5 2ZLW A D -VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQ...R VQLSGEEKAAVLALWDKV--NEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...ne> GLN CA 254 2ZLW D 2ZLWD...ain> 2ZLW D 2ZLWD AR...fEVID> 2 2ZLW D 2ZLWD
Czech Academy of Sciences Publication Activity Database
Lukavský, Jiří
2010-01-01
Roč. 52, č. 1 (2010), s. 15-22 ISSN 0039-3320 Institutional research plan: CEZ:AV0Z70250504 Keywords : Word Association Test * electrodermal activity * pupillary activity Subject RIV: AN - Psychology Impact factor: 0.254, year: 2010
Indian Academy of Sciences (India)
Saket
monitoring was accomplished by thin-layer chromatography (TLC) on Merck silica gel 60 F254 plates. Silica gel 60-120 mess was used for column chromatography. Melting points of all the compounds were recorded on Thermomik Campbell melting point apparatus having an oil bath system and are uncorrected. The FT-IR ...
75 FR 42121 - Marine Mammals; Incidental Take During Specified Activities
2010-07-20
... Slough Channel leads to the Parson's Slough study area, which consists of the 254-acre (1-square... Slough action area in general and the Parson's Slough study area in particular. Conversion of wetlands to....7 meters/second) (Ducks Unlimited et al. 2010)--are much slower than average wave velocities in the...
African Journals Online (AJOL)
Items 1 - 50 of 254 ... Sexual Behaviour and Reproductive Health Among Female Senior Secondary ... Vol 24, No 3-4 (2012), Assessment of Lipid Profile in HIV Seropositive Pregnant Women ... Vol 17, No 3 (2005), Bacteriology of asymptomatic bacteriuria in ... progression and treatment assessment in HIV/AIDS subjects?
Corrigendum to “Geometric Arveson–Douglas conjecture” [Adv. Math. 274 (2015) 606–630
Czech Academy of Sciences Publication Activity Database
Engliš, Miroslav; Eschmeier, J.
2015-01-01
Roč. 278, June (2015), s. 254 ISSN 0001-8708 Institutional support: RVO:67985840 Keywords : Arveson- Douglas conjecture * generalized Toeplitz operator Subject RIV: BA - General Mathematics Impact factor: 1.405, year: 2015 http://www.sciencedirect.com/science/article/pii/S000187081500119X
Czech Academy of Sciences Publication Activity Database
Arokiasamy, J.; Ball, M.; Barnett, D.; Bearman, M.; Bemmel van, J.; Douglas, J.; Fisher, P.; Garrie, R.; Gatewood, L.; Goossen, W.; Grant, A.; Hales, J.; Hasman, A.; Haux, R.; Hovenga, E.; Johns, M.; Knaup, P.; Leven, F. J.; Lorenzi, N.; Murray, P.; Neame, R.; Protti, D.; Power, M.; Richard, J.; Schuster, E.; Swinkels, W.; Yang, J.; Zelmer, L.; Zvárová, Jana
2001-01-01
Roč. 40, č. 5 (2001), s. 267-277 ISSN 0026-1270 Institutional research plan: AV0Z1030915 Keywords : health informatics * medical informatics * education * recommendations * International Medical Informatics Association * IMIA Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 1.254, year: 2001
Preliminary gut content and dentition analysis reveal subtle resource ...
African Journals Online (AJOL)
use
been hypothesized to have contributed to the evolution and adaptive .... nets with stretched mesh sizes (25.4 to 203.2 mm) during both day and night hours .... Embryos, Eggs. Unicuspid (Deeply embended). 3. Hypotrophic. Sucking. A. alluaudi. Molluscs. Subequally – Unequally bicuspid. 3. Hypertrophic. Crushing. A. nubila.
Nucci, Larry; Creane, Michael W.; Powers, Deborah W.
2015-01-01
Eleven teachers and 254 urban middle-school students comprised the sample of this study examining the social and moral development outcomes of the integration of social cognitive domain theory within regular classroom instruction. Participating teachers were trained to construct and implement history lessons that stimulated students' moral…
Linkage and association analysis of CACNG3 in childhood absence epilepsy
DEFF Research Database (Denmark)
Everett, Kate V; Chioza, Barry; Aicardi, Jean
2007-01-01
Childhood absence epilepsy (CAE) is an idiopathic generalised epilepsy characterised by absence seizures manifested by transitory loss of awareness with 2.5-4 Hz spike-wave complexes on ictal EEG. A genetic component to aetiology is established but the mechanism of inheritance and the genes...
Fate map of the dental mesenchyme: Dynamic development of the dental papilla and follicle
Czech Academy of Sciences Publication Activity Database
Rothová, Michaela; Peterková, Renata; Tucker, A. S.
2012-01-01
Roč. 366, č. 2 (2012), s. 244-254 ISSN 0012-1606 R&D Projects: GA ČR GA304/07/0223 Institutional research plan: CEZ:AV0Z50390703; CEZ:AV0Z50390512 Keywords : tooth * mouse * mesenchyme Subject RIV: EA - Cell Biology Impact factor: 3.868, year: 2012
Altered Signal Transduction in Renal Cell Injury Following Hemorrhagic Shock or Anoxia
1989-07-01
Camal ter, R. F. ; Saffiotti, U. Effects of serum and serum-derved factors on growth and differentiation of mouse keratinocytes. In Vitro 22: 423-428...growth and differentiation of mouse epidermal cells in culture. Cell 19: 245-254; 1980. 19. Kaighn, M. E.; Camaller , R. F.; Bertolero, F.; SaffLotti, U
76 FR 77696 - Establishment of the Naches Heights Viticultural Area
2011-12-14
... Decision. SUMMARY: This final rule establishes the 13,254-acre ``Naches Heights'' viticultural area in... origin of their wines and to allow consumers to better identify wines they may purchase. DATES: Effective... consumers to identify wines they may purchase. Establishment of a viticultural area is neither an approval...
Yi, Lin (Inventor); Tjoelker, Robert L. (Inventor); Burt, Eric A. (Inventor); Huang, Shouhua (Inventor)
2016-01-01
Hollow-core capillary discharge lamps on the millimeter or sub-millimeter scale are provided. The hollow-core capillary discharge lamps achieve an increased light intensity ratio between 194 millimeters (useful) and 254 millimeters (useless) light than conventional lamps. The capillary discharge lamps may include a cone to increase light output. Hollow-core photonic crystal fiber (HCPCF) may also be used.
Czech Academy of Sciences Publication Activity Database
Vlachová, Klára; Řeháková, Blanka
2009-01-01
Roč. 15, č. 2 (2009), s. 254-279 ISSN 1354-5078 R&D Projects: GA ČR GA403/02/1500 Institutional research plan: CEZ:AV0Z70280505 Keywords : European Union * ISSP * Czech Republic Subject RIV: AO - Sociology, Demography
Czech Academy of Sciences Publication Activity Database
Průková, Dana; Ileninová, Zuzana; Antošová, Barbora; Kašpárek, Petr; Gregor, Martin; Sedláček, Radislav
2015-01-01
Roč. 64, č. 2 (2015), s. 247-254 ISSN 0862-8408 R&D Projects: GA ČR GAP305/10/2143; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:68378050 Keywords : retinoid metabolism * retinyl esters * spermatogenesis * EGFP Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.643, year: 2015
Health problems of children with disabilities with special reference to ...
African Journals Online (AJOL)
admin
Conclusion: Majority of CWDs were not enjoying the health care provisions available in the study area because of the .... justice offices, the health office, the labor and social .... reasons (25.4 %), accidents (16.2%), hereditary (1.7%) and other ...
Thin layer chromatographic analyses of pesticides in a soil ecosystem
International Nuclear Information System (INIS)
Afful, S.; Dogbe, S.A.; Ahmad, K.; Ewusie, A.T.
2008-01-01
Silica gel 60, silica gel 60 F 254 , and aluminium oxide as adsorbents were used to investigate their suitability for the analysis and detection of the pesticides: nitrofen, atrazine, diuron, dioxacarb, propoxur, propanil, carbaryl and cypermethrin in soil ecosystem using ethyl acetate, chloroform, dichloromethane and ethyl acetate/chloroform (1:1) as developing solvents. O-tolidine and potassium iodide reagent were used for the detection of pesticides. R f values obtained for the pesticides using the silica gel 60-ethyl acetate. silica gel 60F 254 -ethyl acetate, silica gel 60 chloroform, silica gel 60 F 254 - chloroform, silica gel 60 - (1:1) ethyl acetate/chloroform and silica gel 60 F 254 - (1:1) ethyl acetate/chloroform systems generally were within the stipulated range of 0.4-0.8. R f values obtained for the pesticides using silica gel 60-dichloromethane systems were very low except for cypermethrin and nitrofen. Analysis with aluminium oxide coated plates gave a heavy yellow background with the detection reagent making visualization of spots difficult. Aluminium oxide coated plate is, therefore, not recommended when o-tolidine plus potassium iodide is used as detection reagent. (au)
Word order and information structure in Czech 3-and 4-year-olds' comprehension.
Czech Academy of Sciences Publication Activity Database
Smolík, Filip
2015-01-01
Roč. 35, č. 3 (2015), s. 237-253 ISSN 0142-7237 R&D Projects: GA ČR GA13-26779S Institutional support: RVO:68081740 Keywords : Case marking * grammar comprehension * information structure Subject RIV: AN - Psychology Impact factor: 1.254, year: 2015
Preschool Gifted Education: Perceived Challenges Associated with Program Development
Kettler, Todd; Oveross, Mattie E.; Salman, Rania C.
2017-01-01
This descriptive study investigated the challenges related to implementing gifted education services in preschool centers. Participants were 254 licensed preschool center directors in a southern state. Participants completed a researcher-created survey including both selected response items and constructed response items to examine the perceived…
Czech Academy of Sciences Publication Activity Database
Hoferek, L.; Mistřík, J.; Trivedi, R.; Chen, K. S.; Peřina, Vratislav; Čech, V.
2014-01-01
Roč. 254, SEP (2014), s. 49-53 ISSN 0257-8972 R&D Projects: GA MŠk(XE) LM2011019 Institutional support: RVO:61389005 Keywords : multilayer * Gradient film * Plasma polymerization * ellipsometry * nanoindentation Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.998, year: 2014
The degradation of cylindrospermopsin (CYN), a widely distributed and highly toxic cyanobacterial toxin (cyanotoxin), remains poorly elucidated. In this study, the mechanism of CYN destruction by UV-254 nm/H2O2 advanced oxidation process (AOP) was investigated by mass spectrometr...
DEFF Research Database (Denmark)
Jensen, A. G.; Cornett, Claus; Gudiksen, L.
2000-01-01
was illuminated with UV light at 254 nm for 1 min. The apparent content of hypericins was dependent on the mode of detection, and it is therefore of importance to state carefully the mode of detection in any analytical method in order to use the method for reproducible standardisation procedures. Copyright (C...
Czech Academy of Sciences Publication Activity Database
Goodson, W.H.; Vondráček, Jan
2015-01-01
Roč. 36, JUN 2015 (2015), s. 254-296 ISSN 0143-3334 R&D Projects: GA ČR(CZ) GA13-07711S Keywords : BREAST-CANCER CELLS * ESTROGEN-RECEPTOR-ALPHA * EPITHELIAL-MESENCHYMAL TRANSITION Subject RIV: BO - Biophysics Impact factor: 4.874, year: 2015
77 FR 75425 - Publication of State Plan Pursuant to the Help America Vote Act
2012-12-20
... ELECTION ASSISTANCE COMMISSION Publication of State Plan Pursuant to the Help America Vote Act... site at www.eac.gov . DATES: This notice is effective upon publication in the Federal Register. FOR... with HAVA Section 254(a)(12), all the State plans submitted for publication provide information on how...
75 FR 41454 - Publication of State Plan Pursuant to the Help America Vote Act
2010-07-16
... ELECTION ASSISTANCE COMMISSION Publication of State Plan Pursuant to the Help America Vote Act... plans previously submitted by Alaska. DATES: This notice is effective upon publication in the Federal... programs. In accordance with HAVA Section 254(a)(12), all the state plans submitted for publication provide...
75 FR 39671 - Publication of State Plan Pursuant to the Help America Vote Act
2010-07-12
... ELECTION ASSISTANCE COMMISSION Publication of State Plan Pursuant to the Help America Vote Act... plan previously submitted by South Dakota. DATES: This notice is effective upon publication in the... 254(a)(12), all the state plans submitted for publication provide information on how the respective...
Tuning the conductance of benzene-based single-molecule junctions
Czech Academy of Sciences Publication Activity Database
Kaminski, W.; Topolnicki, R.; Hapala, Prokop; Jelínek, Pavel; Kucharczyk, R.
2016-01-01
Roč. 34, Jul (2016), s. 254-261 ISSN 1566-1199 R&D Projects: GA ČR(CZ) GA14-02079S Institutional support: RVO:68378271 Keywords : molecular electronics * DFT * NEGF * transport Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.399, year: 2016
In vitro anti-hyperglycaemic effect of glucocapparin isolated from the ...
African Journals Online (AJOL)
enoh
2012-03-20
Mar 20, 2012 ... It showed a single spot on TLC precoated silica gel 60 F254 with the solvent system 15:85 ethyl acetate/hexane. ... oxidation by the measurement of the optical density at λ = 500 nm using a spectrophotometer DREL 2400 HACH. ... It showed on thin layer chroma- tography (TLC) a spot with Rf = 0.52.
Cooled optically stimulated luminescence in CaF2:Mn
International Nuclear Information System (INIS)
Miller, S.D.; Endres, G.W.R.; McDonald, J.C.; Swinth, K.L.
1988-01-01
A new optically stimulated luminescence technique has been developed for the readout of CaF 2 :Mn thermoluminescent material. Minimum detectable gamma exposures may potentially be measured at 10 nC.kg -1 using the 254 nm line of a mercury lamp. Additional studies were done on CaF 2 :Mn using 351 nm excimer laser stimulation. (author)
Book review Information and Communication Technologies for ...
African Journals Online (AJOL)
Book review. Information and Communication Technologies for Development in Africa: Volume 2. The Experience with Community Telecentres By Florence Etta and Sheila Parvyn-Wamahiu (2003). Kibet A Ngetich. Abstract. No Abstract Available Africa Development Vol. XXX (1&2) 2005: 254-256. Article Metrics. No metrics ...
Book review Information and Communication Technologies for ...
African Journals Online (AJOL)
Book review. Information and Communication Technologies for Development in Africa: Volume 2. The Experience with Community Telecentres By Florence Etta and Sheila Parvyn-Wamahiu (2003). Kibet A Ngetich. Abstract. No Abstract Available Africa Development Vol. XXX (1&2) 2005: 254-256.
Separation and identification of carp pituitary proteins and glycoproteins
Czech Academy of Sciences Publication Activity Database
Ryšlavá, H.; Janatová, M.; Čalounová, G.; Selicharová, Irena; Barthová, J.; Barth, Tomislav
2005-01-01
Roč. 50, č. 9 (2005), 430-437 ISSN 1212-1819 R&D Projects: GA MZe(CZ) QF3028 Institutional research plan: CEZ:AV0Z4055905 Keywords : carp hormones * glycoproteins * oligosaccharide chains Subject RIV: CE - Biochemistry Impact factor: 0.254, year: 2005
Czech Academy of Sciences Publication Activity Database
Novák, F.; Borovská, J.; Vecka, M.; Rychlíková, J.; Vávrová, L.; Petrásková, H.; Žák, A.; Nováková, Olga
2017-01-01
Roč. 52, č. 3 (2017), s. 245-254 ISSN 0024-4201 Institutional support: RVO:67985823 Keywords : sepsis * inflammation * oxidative stress * plasma lipids * fatty acid profile * PUFA * lipoproteins Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition OBOR OECD: Critical care medicine and Emergency medicine Impact factor: 1.934, year: 2016
Diverse Pathways of Psychology Majors: Vocational Interests, Self-Efficacy, and Intentions
Rottinghaus, Patrick J.; Gaffey, Abigail R.; Borgen, Fred H.; Ralston, Christopher A.
2006-01-01
The authors examine the differences in vocational interests and self-efficacy of 254 undergraduate psychology majors organized by 7 career intention groups (e.g., psychological research). The explanatory power of individual General Occupational Themes (GOTs), Basic Interest Scales (BISs), and Personal Style Scales (PPSs) of the Strong Interest…
Tan, Cheng Yong
2018-01-01
The present study examined indirect effects of principal leadership on the mathematics achievement of 254,475 15-year-old students from 10,313 schools in 32 OECD economies. Results showed that the students could be divided into three categories ("Disadvantaged," "Average," and "Privileged") differing in levels of…
Effects of Participation in a Martial Arts-Based Antibullying Program in Elementary Schools
Twemlow, Stuart W.; Biggs, Bridget K.; Nelson, Timothy D.; Vernberg, Eric M.; Fonagy, Peter; Twemlow, Stephen W.
2008-01-01
This study evaluated the Gentle Warrior Program, a traditional martial arts-based intervention to reduce aggression in children, as it was implemented in three elementary schools. The sample consisted of 254 children in grades 3, 4, and 5 who participated in the Gentle Warrior Program as part of a larger school violence intervention. Results…
Evaluation of the Contact Angle from Molecular Simulations.
Czech Academy of Sciences Publication Activity Database
Škvára, J.; Škvor, J.; Nezbeda, Ivo
2018-01-01
Roč. 44, č. 3 (2018), s. 190-199 ISSN 0892-7022 R&D Projects: GA ČR GA15-19542S Institutional support: RVO:67985858 Keywords : contact angle * argon droplet * surface molecules Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 1.254, year: 2016
Calibration and Validation of Inertial Measurement Unit for Wave Resolving Drifters
2013-12-01
B. NAVAL RELEVANCE Safety and cost effectiveness are concerns for the U.S. Navy, as well. Investing significant capital and man-hours into...insulation, and Velcro ) are non-magnetic, which will be noteworthy later as we discuss the sensors. The WRD-B is a hollow spherical buoy 0.254m (10”) in
Lee, Chwee Beng; Teo, Timothy; Chai, Ching Sing
2010-01-01
This study aims to examine pre-service teachers' knowledge and regulation of cognition. The authors administered Schraw and Dennison's Metacognitive Awareness Inventory to 254 pre-service teachers in Singapore. The results showed no significant difference by educational level on all subscales except for evaluation, which is a subscale of…
Shaffer, David R.; And Others
1996-01-01
Male and female research participants (n=254) self-disclosed to a male or female confederate with whom they anticipated or did not anticipate further interaction. Women disclosed more intimately, with increasing emotion, and displayed more topical responsiveness with female than with male targets. Only the highly masculine men reliably disclosed…
Treatability of South African surface waters by enhanced coagulation
African Journals Online (AJOL)
2013-06-05
Jun 5, 2013 ... From the study of 4 South African inland waters, this paper demonstrates that UV254 ... are effective at NOM removal, there is emerging consensus that ferric chloride is ...... contaminants in drinking water. EPA-600-R-01-110.
The Situation Awareness Weighted Network (SAWN) Model
2014-06-01
Administration Task Load Index (NASA- TLX ), a validated research instrument [Human Performance Research Group 1988]. The participants were asked to rate their...analysis”, Human Factors 40(2): 254–276. 17 Human Performance Research Group (1988) NASA- TLX , NASA Ames Research Center, Moffett Field, CA. Jin, Y. and
77 FR 58540 - Notice of Debarment
2012-09-21
... available for public inspection and copying during regular business hours at the FCC Reference Information... Commission's duplicating inspection and copying during regular business hours at the contractor, Best Copy......... Missouri 7,672.77 Red Cloud Community School Nebraska 2,254.52 District. SAU 41--Hollis Brookline Schools...
MICROWAVE-ASSISTED SYNTHESIS OF SOME 5(6)-NITRO-1H ...
African Journals Online (AJOL)
Preferred Customer
temperature sensor. All reactions were monitored by TLC using precoated aluminum sheets. (silica gel 60 F 2.54 0.2 mm thickness). Synthesis of compounds 2a-d. Conventional method. A mixture of 4-nitro-o-phenylenediamine (0.01 mol) and corresponding iminoester hydrochloride 1(a-d) (0.013 mol) in methanol (30 mL) ...
Association between Cigarette Smoking and Metabolic Syndrome in ...
African Journals Online (AJOL)
Purpose: To investigate the relationship between metabolic syndrome as defined by using the modified NCEP/ATP III criteria [modified the National Cholesterol Education Program (NCEP)/Adult Treatment Panel III (ATP III) criteria] and cigarette smoking in Thai subjects. Methods: This study was carried out among 254 ...
Lifescience Database Archive (English)
Full Text Available phosphopyruvate hydratase (EC 4.2.1.11) - liver f... 264 1e-69 AM279157_1( AM279157 |pid:none) Echinostoma capron...i mRNA for enola... 254 9e-67 DQ869009_1( DQ869009 |pid:none) Echinostoma caproni enolase mRNA, ... 25
Kirjad vallutatud Hiinast / Karl Rumor
Rumor, Karl, pseud., 1886-1971
2008-01-01
1937. a. alanud Hiina-Jaapani sõjast, poliitlistest oludest ja revolutsioonist Hiinas, hiinlastest ja Hiina suhetest teiste riikidega. Varem ilmunud: Uus Eesti 19.-20. aug, 1938, nr. 226-227; 12.-13., 16. sept. 1938, nr. 250-251, 254
The Five-Factor Nonverbal Personality Questionnaire in the Czech context
Czech Academy of Sciences Publication Activity Database
Hřebíčková, Martina
2010-01-01
Roč. 52, č. 3 (2010), s. 165-177 ISSN 0039-3320 Institutional research plan: CEZ:AV0Z70250504 Keywords : Nonverbal personality measurement * five -factor model * The Five -Factor Nonverbal Personality Questionnaire * FF-NPQ Subject RIV: AN - Psychology Impact factor: 0.254, year: 2010
Supporting Information final.pdf
Indian Academy of Sciences (India)
RC
Materials and apparatus. Spectroscopic grade organic solvents were obtained from Finar Chemicals. Starting and other chemicals and reagents were purchased from Sigma-Aldrich unless otherwise stated and were used without further purification. Thin layer chromatography (TLC) was performed on silica gel 60 F254 ...
In vitro antimicrobial properties of friedelan-3-one from Pterocarpus ...
African Journals Online (AJOL)
MRS I.C ODEH
2016-04-06
Apr 6, 2016 ... purchased from Sigma-Aldrich® with the exception of Silica gel 60. F254 Thin Layer ... The powder was obtained using mortar and pestle. ... The extracts were concentrated and allowed to dry in a fume hood to give the crude ...
2008-08-01
fragment with a mass m/z 254, [M-H]-120 corre- sponded to a fragmentation 0,2X, in agreement with the fragmentation of the C-glucosides of flavonoids ...Trends Plant Sci. 2, 144–151. Cuyckens, F. and Claeys, M. (2004) Mass spectrometry in the structural analysis of flavonoids . J. Mass Spectrom. 39, 1–15
CATALYTIC STEAM REFORMING OF CHLOROCARBONS: CATALYST COMPARISONS. (R822721C633)
Catalyst candidates for steam reforming chlorocarbons have been screened for activity using methyl chloride as a model reactant. At 500°C, a H2O/C ratio of about 10 and a GHSV of 254 000 h-1, catalysts comprising 0.5% loading of the metals o...
Czech Academy of Sciences Publication Activity Database
Płachno, B.J.; Stpiczyńska, M.; Krajewski, Ł.; Świątek, P.; Adamec, Lubomír; Miranda, V.F.O.
2017-01-01
Roč. 254, č. 5 (2017), s. 2007-2015 ISSN 0033-183X Institutional support: RVO:67985939 Keywords : aquatic bladderworts * pollination * ultrastructure Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 2.870, year: 2016
Brain Computed Tomography evaluation of patients with syncopal ...
African Journals Online (AJOL)
Objective: The aim of our study is to determine the value of using brain computerized tomography as a routine investigation in patients presenting with syncope to the emergency department at King Hussein Medical Center Amman Jordon. Methods: In the time period between March 2006 and April 2008, a total of 254 ...
Lifescience Database Archive (English)
Full Text Available 5060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, complete cds. 626 0.0 8 AC1170...bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-A... 254 4e-77 AC117076_18( AC1
Learning Random Numbers: A Matlab Anomaly
Czech Academy of Sciences Publication Activity Database
Savický, Petr; Robnik-Šikonja, M.
2008-01-01
Roč. 22, č. 3 (2008), s. 254-265 ISSN 0883-9514 R&D Projects: GA AV ČR 1ET100300517 Institutional research plan: CEZ:AV0Z10300504 Keywords : random number s * machine learning * classification * attribute evaluation * regression Subject RIV: BA - General Mathematics Impact factor: 0.795, year: 2008
Paths to subreplacement fertility : the empirical evidence / Tomas Frejka, John Ross
Frejka, Tomas
2001-01-01
Autorid väidavad, et paljudes riikides jääb sündimus ka edaspidi väga madalaks. Vaadeldakse 54 riigis abielude sõlmimist, rasestumisvastaste vahendite kasutamist ja abortide arvu. Diagrammid ja tabelid. Lisa lk. 213-254
Unit Ministry Team Religious Support to Casualties on the Airland Battlefield
1987-10-28
Dysentery, Mod 248 Gastrits, Acute 249 Peptic Ulcer, Severe 250 Peptic Ulcer, Mod 251 Regional Ileitis 252 Regional Ileitis, Mod 253 Helminthiasis ...Severe 254 Helminthiasis , Mod 255 Migraine, acute 256 Varicosities, Severe 257 Varicosities, Mod 258 Essential Hypertension 2,)9 Ischemic Heart
Design, synthesis and antibacterial activity of a novel hybrid ...
African Journals Online (AJOL)
ajl user 1
2012-01-26
Jan 26, 2012 ... 1College of Animal Science and Technology, Northeast Agricultural University, Harbin 150030, China. ... Antimicrobial peptides produced by many tissues and cell types of invertebrates, insects and humans as part of ..... In nature, almost all kinds of plants, animals and micro- .... Biopolymers, 65: 254-262.
2011-12-28
... carriers (ETCs), and the Commission codifies it in the rules. Section 254(e) thus contemplates that...-party service, operator services, and directory assistance. 30. Today, all ETCs, whether designated by a... service--throughout their designated service area. ETCs also must provide Lifeline service throughout...
Dijkstra, J.E.
2013-01-01
Bilingual acquisition largely depends on the input that children receive in each language. The more input in a language, the more proficient a child becomes in that language. The current project studied the role of language input among bilingual Frisian-Dutch preschool children (age 2.5-4 years) in
Attitudes toward the Homeless: A U.S.-Japan Comparison.
Guzewicz, Tony D.; Takooshian, Harold
1993-01-01
Compares attitudes toward the homeless in Japan and the United States through a survey of 268 Japanese and 254 U.S. adults and adolescents interviewed in public places. In Japan, homelessness is seldom discussed, and poverty, which may be as widespread as in the United States, is often not recognized. (SLD)
2010-10-01
... Section 725.403 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Trade Agreements 725.403 Exceptions. FAR 25.4 establishes procedures for purchases under the Trade Agreements Act of 1979 (including GATT's Agreement on Government Procurement) and...
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
2016-01-27
Jan 27, 2016 ... Home; Journals; Journal of Astrophysics and Astronomy; Volume 36; Issue 1. Issue front cover thumbnail. Volume 36, Issue 1. March 2015, pages a-254. Dynamical Plasma Processes in the Sun and Sun-like Stars. pp a-b. General Editorial on Publication Ethics · More Details Fulltext PDF. pp 1-3. Editorial.
An Approach to Reduce the Sample Consumption for LIBS based Identification of Explosive Materials
Czech Academy of Sciences Publication Activity Database
Anubham, S.K.; Junjuri, R.; Myakalwar, A.K.; Gundawar, M.K.
2017-01-01
Roč. 67, č. 3 (2017), s. 254-259 ISSN 0011-748X Institutional support: RVO:67985882 Keywords : Laser induced breakdown spectroscopy * K - Nearest neighbour * Synthetic spectra Subject RIV: JB - Sensors, Measurment, Regulation OBOR OECD: Electrical and electronic engineering Impact factor: 0.500, year: 2016
Corrosion properties of plasma deposited high-alloy steel
Czech Academy of Sciences Publication Activity Database
Voleník, Karel; Pražák, M.; Kalabisová, E.; Kreislová, K.; Neufuss, Karel
2002-01-01
Roč. 47, - (2002), s. 243-254 ISSN 0001-7043 R&D Projects: GA ČR GA106/99/0298 Institutional research plan: CEZ:AV0Z2043910 Keywords : plasma deposits, high-alloy steel, polarization curves, corrosion test Subject RIV: BL - Plasma and Gas Discharge Physics
Maintenance of DNA repair capacity in differentiating rat muscle cells in vitro
International Nuclear Information System (INIS)
Koval, T.M.; Kaufman, S.J.
1981-01-01
Unscheduled DNA synthesis was measured at several times during the differentiation of cultured rat skeletal muscle cells in response to exposures to 254 nm UV light. There was no change in the amount of repair DNA synthesis as the cells fuse and differentiate from postmitotic prefusion myoblasts to multinucleated contracting myotubes. (author)
The objective was to determine potential factors regulating gluconeogenesis (GNG) in extremely low birth weight infants receiving total parenteral nutrition. Seven infants (birth weight, 0.824 +/- 0.068 kg; gestational age, 25.4 +/- 0.5 weeks; postnatal age, 3.3 +/- 0.2 days) were studied for 11 hou...
Integrating AR services for the masses: geotagged POI transformation platform
Czech Academy of Sciences Publication Activity Database
Trojan, Jakub
2016-01-01
Roč. 7, č. 3 (2016), s. 254-265 ISSN 1757-9880 Institutional support: RVO:68145535 Keywords : augmented reality * location-based services * geotagging * points of interest Subject RIV: DE - Earth Magnetism, Geodesy, Geography http://dx.doi.org/10.1108/JHTT-07-2015-0028
Sn interaction with the CeO.sub.2./sub.(111) system: bimetallic bonding and ceria reduction
Czech Academy of Sciences Publication Activity Database
Škoda, M.; Cabala, M.; Cháb, Vladimír; Prince, K. C.; Sedláček, L.; Skála, T.; Šutara, F.; Matolín, V.
2008-01-01
Roč. 254, č. 14 (2008), 4375-4379 ISSN 0169-4332 R&D Projects: GA MŠk(CZ) LC06058 Institutional research plan: CEZ:AV0Z10100521 Keywords : resonant photoemission * RPES * XPS * LEED * ceria * tin * reduction * bimetallic interaction * bimetallic bonding Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.576, year: 2008
Thermodynamic and Spectrophotometric Studies of Electron Donor ...
African Journals Online (AJOL)
Some features of the formed complex, such as molar ratio of the reaction and effect of time ... Thermodynamic parameters were determined as well, the method was ... enthalpy change (ÄH) was steady at -0.254 kcal.mol-1 while the free energy ...
Impact of a Library Instruction Session on Bibliographies of Organic Chemistry Students
Kromer, John
2015-01-01
Students in Chemistry 254: Organic Chemistry for Majors were required to write a paper about an organic name reaction. Before turning in this assignment, students had the option of attending a one-hour library instruction session covering SciFinder, sources for spectra, ACS Style, and print resources about organic name reactions. Twenty-five…
Valuable Work, Minimal Rewards: A Report on the Wisconsin Child Care Work Force.
Burton, Alice; And Others
A 1994 state-wide survey examined the status of child care profession in Wisconsin. Surveyed were 326 family child care providers, 104 child care center directors, and 254 center teaching staff. Responses indicated that child care teaching staff have experienced a wage increase of just over 1 percent per year since 1988, and continue to earn low…
Texas, 2008 forest inventory and analysis factsheet
James Bentley
2011-01-01
This science update summarizes the findings of the first statewide annual inventory conducted by the Southern Forest Inventory and Analysis (FIA) Program in cooperation with the Texas Forest Service of the forest resource attributes in Texas. The 254 counties of Texas are consolidated into seven FIA survey unitsâsoutheast (unit 1), the northeast (unit 2), the north...
East Texas, 2012—Forest Inventory and Analysis Factsheet
Thomas J. Brandeis; Jason A. Cooper; James W. Bentley
2014-01-01
This science update summarizes the findings of the statewide annual inventory of the forest resource attributes in Texas conducted by the Southern Forest Inventory and Analysis (FIA) Program in cooperation with the Texas A&M Forest Service. The 254 counties of Texas are consolidated into seven FIA survey unitsâsoutheast (unit 1), northeast (unit 2), north central (...
Texas, 2010 forest inventory and analysis factsheet
James W. Bentley
2012-01-01
This science update summarizes the findings of the statewide annual inventory conducted by the Southern Forest Inventory and Analysis (FIA) Program in cooperation with the Texas Forest Service of the forest resource attributes in Texas. The 254 counties of Texas are consolidated into seven FIA survey units â southeast (unit 1), northeast (unit 2), north central (unit 3...
Kerry Dooley
2018-01-01
This resource update provides an overview of forest resources in east Texas based on an inventory conducted by the U.S. Forest Service, Forest Inventory and Analysis (FIA) program at the Southern Research Station (SRS) in cooperation with Texas A&M Forest Service. The 254 counties of Texas are consolidated into seven FIA survey unitsâSoutheast (unit 1),...
East Texas, 2011 forest inventory and analysis factsheet
Jason A. Cooper; James W. Bentley
2012-01-01
This science update summarizes the findings of the annual inventory conducted by the Southern Forest Inventory and Analysis (FIA) Program in cooperation with the Texas Forest Service of the forest resource attributes in east Texas. The 254 counties of Texas are consolidated into 7 FIA survey unitsâsoutheast (unit 1), northeast (unit 2), north central (unit 3), south (...
Musica, identita e mitografie nazionali dei cechi nel dicianovesimo secolo
Czech Academy of Sciences Publication Activity Database
Slavický, Tomáš
2016-01-01
Roč. 12, č. 1 (2016), s. 45-56. ISBN 978-961-254-915-2. ISSN 1854-3405 Institutional support: RVO:68378076 Keywords : Czech national music * Czech historical myths * Panslavism * Austroslavism Subject RIV: AL - Art, Architecture, Cultural Heritage; AL - Art, Architecture, Cultural Heritage (UEF-S)
Fan, Jun; Li, Haibo; Shuang, Chendong; Li, Wentao; Li, Aimin
2014-08-01
This study investigated the removal of dissolved organic matter (DOM) from real dyeing bio-treatment effluents (DBEs) with the use of a novel magnetic anion exchange resin (NDMP). DOMs in two typical DBEs were fractionized using DAX-8/XAD-4 resin and ultrafiltration membranes. The hydrophilic fractions and the low molecular weight (MW) (50%) of DOMs for the two effluents. The hydrophilic and low MW fractions of both effluents were the greatest contributors of specific UV254 absorbance (SUVA254), and the SUVA254 of DOM fractions decreased with hydrophobicity and MW. Two DBEs exhibited acute and chronic biotoxicities. Both acute and chronic toxicities of DOM fractions increased linearly with the increase of SUVA254 value. Kinetics of dissolved organic carbon (DOC) removal via NDMP treatment was performed by comparing it with that of particle active carbon (PAC). Results indicated that the removal of DOC from DBEs via NDMP was 60%, whereas DOC removals by PAC were lower than 15%. Acidic organics could be significantly removed with the use of NDMP. DOM with large MW in DBE could be removed significantly by using the same means. Removal efficiency of NDMP for DOM decreased with the decrease of MW. Compared with PAC, NDMP could significantly reduce the acute and chronic bio-toxicities of DBEs. NaCl/NaOH mixture regenerants, with selected concentrations of 10% NaCl (m/m)/1% NaOH (m/m), could improve desorption efficiency. Copyright © 2014. Published by Elsevier B.V.
M-Rated Video Games and Aggressive or Problem Behavior among Young Adolescents
Olson, Cheryl K.; Kutner, Lawrence A.; Baer, Lee; Beresin, Eugene V.; Warner, Dorothy E.; Nicholi, Armand M., II
2009-01-01
This research examined the potential relationship between adolescent problem behaviors and amount of time spent with violent electronic games. Survey data were collected from 1,254 7th and 8th grade students in two states. A "dose" of exposure to Mature-rated games was calculated using Entertainment Software Rating Board ratings of…
Fundamental Studies in the Molecular Basis of Laser Induced Retinal Damage.
1984-09-01
C. Hannemann , H. and Sochtig, E. (1979) Nature 277, 143-145. 25. Richards, J. M. and Swislocki, N. 1. (1979) J. Biol. Chem. 254, 6857-6860. 26...and Yamada, E. (1981) Biomedical Res. 2, 177-193. 51. Roof, D. J. and Heuser, J. E. (1982) J. Cell Biol. 95, 487-500. 52. Hagins, W. A. and Jennings , W
Causes of Mortality among American College Students: A Pilot Study
Turner, James C.; Leno, E. Victor; Keller, Adrienne
2013-01-01
This pilot study from self-selected institutions of higher education provides an estimate of the causes and rates of mortality among college students between the ages of 18 and 24 years old. One hundred fifty-seven 4-year colleges participated in an online survey of student deaths during one academic year. A total of 254 deaths were reported. The…
2011-07-20
... National Average Payments for free, reduced price and paid afterschool snacks as part of the National...; Hawaii--free lunch-- 294 cents, reduced price lunch--254 cents. Afterschool Snacks in Afterschool Care Programs--The payments are: Contiguous States--free snack--76 cents, reduced price snack--38 cents, paid...
S. Afr. Tydskr. Veek. I I , 2BS -286 ( I 98 I ) NAVORSINGSBERIG DIE ...
African Journals Online (AJOL)
Die produksie van lusernhooi het toegeneem vanaf. 448 000 ton in die l95ll52 seisoen tot | 254 000 ton in die 1979180 seisoen (Kortbegrip van l-andboustati- stiek, l98l). Verder is dit insiggewend om daarop te let dat lusemhooi nagenoeg3g/' bydra tot die hoeveelheid proteibne geproduseer uit die proteibnryke voersoorte ...
Carbon-supported iron and iron-molybdenum sulfide catalysts
International Nuclear Information System (INIS)
Ramselaar, W.L.T.M.
1988-01-01
The main objective was to describe the relations between the characteristics (composition and dispersion) of the actual sulfide phase and the catalytic activity. Attention was also paid to the influence of preparational aspects on these characteristics. The catalysts were characterized using in-situ Moessbauer spectroscopy down to 2.0 K. 254 refs.; 47 figs.; 22 tabs
Multilocus phylogeny of arvicoline voles (Arvicolini, Rodentia) shows small tree terrace size
Czech Academy of Sciences Publication Activity Database
Martínková, Natália; Moravec, J.
2012-01-01
Roč. 61, 3-4 (2012), s. 254-267 ISSN 0139-7893 R&D Projects: GA AV ČR IAA600930609 Institutional support: RVO:68081766 Keywords : divergence * evolutionary history * supertree * supermatrix * phylogenetic tree terrace * Microtus * Arvicolinae Subject RIV: EG - Zoology Impact factor: 0.494, year: 2012
DEFF Research Database (Denmark)
Holsgaard-Larsen, Anders; Jensen, Carsten; Aagaard, Per
2014-01-01
) subscales (Sport/Rec and QOL) in ACL-reconstructed patients. METHODS: 23 hamstring auto-graft ACL-reconstructed men (mean age: 27.2 standard deviation 7.5years, BMI: 25.4 standard deviation 3.2 time since surgery: 27 standard deviation 7months) completed KOOS-questionnaire and an objective test-battery: (i...
Conversational Behaviors in Youth with High-Functioning ASD and Asperger Syndrome
Paul, Rhea; Orlovski, Stephanie Miles; Marcinko, Hillary Chuba; Volkmar, Fred
2009-01-01
Twenty-nine youth with autism spectrum disorders and 26 with typical development between 12 and 18 years of age were engaged in structured interviews (ADOS). The interviews were videotaped and rated for atypical conversational behaviors by trained raters, using the Pragmatic Rating Scale (Landa et al. "Psychol Med" 22:245-254, 1992). The ASD group…
2010-12-14
... Pearson 1972, pp. 254-257). Litters are born from mid-February through March, containing one to five kits... several reasons. Wolverines tend to live in remote and inhospitable places away from human populations... human population density and the lack of suitable habitat suggests that wolverines did not exist in this...
2012-03-06
.... Services Group, Inc., Corporate/Finance/ Controllers. 81,213 American Express Travel Phoenix, AZ February.... Corporate Resources, Aerotek, Dysis and Tek. 81,254 BT North America, Network Atlanta, GA February 13, 2010... February 7, 2011. Services Group, Inc., Corporate/EIT/Consumer. The following certifications have been...
Yersinia pestis, the causative agent of plague, can occasionally be contracted as a naso-pharangeal or gastrointestinal illness through consumption of contaminated meat. In this study, the use of 254 nm ultraviolet light (UV-C) to inactivate a multi-isolate cocktail of avirulent Y. pestis on food an...
Burnout and health of primary school educators in the North West ...
African Journals Online (AJOL)
Burnout and health of primary school educators in the North West Province. Amanda Montgomery, Karina Mostert, Leon Jackson. Abstract. No Abstract. South African journal of Education Vol. 25(4) 2005: 266-272. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL ...
Avoiding acidic region streaking in two-dimensional gel ...
Indian Academy of Sciences (India)
Supplementary figure 6. 2DE gel images ... Number of acidic streaks. Fedyunin et al. 2012. 4.02. 6. Zuo et al. 2000. 2.54. 9. Valenete et ... CE, 3rd 2009 Proteasomal protein degradation in ... Nandakumar MP, Shen J, Raman B and Marten MR.
Revue de Médecine et de Pharmacie - Vol 3, No 1 (2013)
African Journals Online (AJOL)
La corticothérapie dans la prise en charge hospitalière de l'asthme à Yaoundé : Connaissances, Attitudes et Pratiques · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. EA Ze, AAM Kamgueng, G Nguefack-Tsague, J-B Bogne, 254-261 ...
2010-07-22
... Federal holidays. FOR FURTHER INFORMATION CONTACT: Mr. Anthony DeSimone, (317) 226-5307, Office of Program... 254, Indianapolis, Indiana, 46204, Monday through Friday, except Federal holidays. SUPPLEMENTARY... Virgin Islands and American Samoa. Frequency: Annually. Estimated Average Burden per Response: There is...
2010-10-01
... through the GPE awards exceeding $25,000 that are— (1) Covered by the World Trade Organization Government Procurement Agreement or a Free Trade Agreement (see Subpart 25.4); or (2) Likely to result in the award of... World Trade Organization Government Procurement Agreement or a Free Trade Agreement, contracting...
Rickettsia bellii in ticks Amblyomma varium Koch, 1844, from birds in Peru
Czech Academy of Sciences Publication Activity Database
Ogrzewalska, M.; Literák, I.; Cárdenas-Callirgos, J. M.; Čapek, Miroslav; Labruna, M. B.
2012-01-01
Roč. 3, č. 4 (2012), s. 254-256 ISSN 1877-959X R&D Projects: GA AV ČR IAA601690901; GA MŠk LC06073 Institutional support: RVO:68081766 Keywords : Rickettsia bellii * ticks * Amblyomma calcaratum * birds * Peru Subject RIV: EG - Zoology Impact factor: 2.353, year: 2012
School Principals' Leadership Behaviours and Its Relation with Teachers' Sense of Self-Efficacy
Mehdinezhad, Vali; Mansouri, Masoumeh
2016-01-01
The aim of this study was to investigate the relationship between school principals' leadership behaviours and teachers' sense of self-efficacy. The research method was descriptive and correlational. A sample size of 254 teachers was simply selected randomly by proportional sampling. For data collection, the Teachers' Sense of Efficacy Scale of…
Eu-doped barium aluminium oxynitride with the ß-alumina-type structure as new blue-emitting phosphor
Jansen, S.R.; Migchels, J.M.; Hintzen, H.T.J.M.; Metselaar, R.
1999-01-01
Attractive new blue-emitting phosphors for use in low-pressure mercury gas discharge lamps are synthesized by Eu-substitution in the barium aluminum oxynitride host lattice with the -alumina-type structure. The emission spectra of these phosphors for 254 nm excitation show a band at about 450 nm
Education for minority groups: a case study | Mochwanaesi | South ...
African Journals Online (AJOL)
No Abstract. South African journal of Education Vol. 25(4) 2005: 287-291. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...
'A' by Aspergillus terreus through mutation
African Journals Online (AJOL)
The highest drug yielding isolate FCBP-58 was subjected to both physical and chemical mutation to increase the biosynthetic capabilities of Cyclosporin 'A'. In this study, mutation was carried out by ultraviolet radiation (254 nm) and alkylating agent ethylmethane sulphonate (EMS). UV 5 min time treatment was proved to be ...
African Journals Online (AJOL)
those pregnant women who intended to deliver at home (OR= 8.5, 95%CI: 2.9, 25.4) and ... a risk of death in pregnancy and childbirth .... were unplanned. and analyzed using SPSS for windows. There was a significant association version 11.0. and Epi info 2000. Crude and. (P<0.05) between antenatal care service.
In vivo and in vitro Antimalarial Activity of Vernonia amygdalina ...
African Journals Online (AJOL)
omoregie
ABSTRACT. The in vitro antiplasmodial activity and cytotoxicity of extracts from Jatropha tanjorensis leaves ... an important role in the traditional methods of malaria treatment ... system consisted of TLC plates 10 × 10 cm silica gel. 60F254 .... Based on this classification, the three ... cost intervention during malaria infection.
Czech Academy of Sciences Publication Activity Database
Čechová, L.; Durnová, E.; Šikutová, Silvie; Halouzka, Jiří; Němec, M.
2004-01-01
Roč. 808, č. 2 (2004), s. 249-254 ISSN 1570-0232 R&D Projects: GA ČR GA206/03/0726 Institutional research plan: CEZ:AV0Z6093917 Keywords : spirochetes * arthropods * fatty acid methyl esters Subject RIV: EE - Microbiology, Virology Impact factor: 2.176, year: 2004
Fives, Helenrose; Hamman, Doug; Olivarez, Arturo
2007-01-01
The burnout process may begin as early as the student-teaching experience [Gold, Y., 1985. Does teacher burnout begin with student teaching? "Education", 105, 254-257]. Data from 49 student-teachers in the southwest United States were gathered twice during their student-teaching practicum. Data assessing teacher efficacy, teacher…
Karakus, Mehmet; Savas, Ahmet Cezmi
2012-01-01
In this study it was aimed to determine the effects of parental involvement, teachers' trust in parents and students, and teachers' pupil control ideology on the conflict management strategies used by teachers in classroom management. Data were collected from a sample of 254 teachers through paper and pencil questionnaires. Data were analyzed with…
Study of a railway embankment reinforced with jute tassels
Indian Academy of Sciences (India)
Embankment; models (physical); soil reinforcement; jute tassel; slope ... Because of high tensile strength of vetiver grass roots, they act like soil .... All the joints are glued as well as reinforced with steel angles and .... slipping, it is nailed to the top of the embankment by several 25.4 mm iron ... The cables can yield in ten-.
Potential Extraintestinal pathogenic Escherichia coli isolates DP254, WH333, WH398, F356, FEX675 and FEX725 were isolated from retail chicken meat products. Here, we report the draft genome sequences for these six E. coli isolates, which are currently being used in food safety research....
Sensitivity analysis of 1−d steady forced scalar conservation laws
Czech Academy of Sciences Publication Activity Database
Ersoy, M.; Feireisl, Eduard; Zuazua, E.
2013-01-01
Roč. 254, č. 9 (2013), s. 3817-3834 ISSN 0022-0396 R&D Projects: GA ČR GA201/09/0917 Institutional support: RVO:67985840 Keywords : sensitivity * scalar conservation law * control Subject RIV: BA - General Mathematics Impact factor: 1.570, year: 2013 http://www.sciencedirect.com/science/article/pii/S0022039613000892#
Invisible Religion in a "Non-believing" Country: The Case of the Czech Republic
Czech Academy of Sciences Publication Activity Database
Hamplová, Dana; Nešpor, Zdeněk
2009-01-01
Roč. 56, č. 4 (2009), s. 581-597 ISSN 0037-7686 R&D Projects: GA ČR GA403/08/0720 Institutional research plan: CEZ:AV0Z70280505 Keywords : economic behavior * money management marriage * cohabitation Subject RIV: AO - Sociology, Demography Impact factor: 0.254, year: 2009
Czech Academy of Sciences Publication Activity Database
Bujalský, L.; Jirka, V.; Zemek, František; Frouz, J.
2018-01-01
Roč. 32, č. 4 (2018), s. 254-263 ISSN 1748-0930 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : temperature * normalised difference * vegetation index (NDVI) * vegetation cover * remote sensing Subject RIV: DF - Soil Science Impact factor: 1.078, year: 2016
Poleward shifts in winter ranges of North American birds
Frank A. La Sorte; Frank R., III Thompson
2007-01-01
Climate change is thought to promote the poleward movement of geographic ranges; however, the spatial dynamics, mechanisms, and regional anthropogenic drivers associated with these trends have not been fully explored. We estimated changes in latitude of northern range boundaries, center of occurrence, and center of abundance for 254 species of winter avifauna in North...
A test of the permanent income hypothesis on Czech voucher privatization
Czech Academy of Sciences Publication Activity Database
Hanousek, Jan; Tůma, Z.
2002-01-01
Roč. 10, č. 2 (2002), s. 235-254 ISSN 0967-0750 Institutional research plan: CEZ:AV0Z7085904 Keywords : Barro-Riccardian * equivalence * permanent income hypothesis Subject RIV: AH - Economics Impact factor: 0.897, year: 2002 http://search. ebscohost .com/login.aspx?direct=true&db=bth&AN=6844845&site=ehost-live
2016-2017 Travel Expense Report for Stephen McGurk, Vice ...
International Development Research Centre (IDRC) Digital Library (Canada)
Beata Bialic
. Destination(s):. Saskatchewan. Airfare: $933.24. Other. Transportation: $89.13. Accommodation: $546.67. Meals and. Incidentals: $254.65. Other: $0.00. Total: $1,823.69. Comments: 2016-2017 Travel Expense Report for Stephen. McGurk ...
2017-2018 Travel Expense Reports for Stephen McGurk, Vice ...
International Development Research Centre (IDRC) Digital Library (Canada)
06-28 to 2017-06-29. Destination(s):. Vancouver. Airfare: $1,301.48. Other. Transportation: $78.00. Accommodation: $254.25. Meals and. Incidentals: $161.19. Other: $0.00. Total: $1,794.92. Comments: 2017-2018 Travel Expense Reports for ...
ISSN 2073-9990 East Cent Afr J Surg
African Journals Online (AJOL)
Results: A total of 46 cases were identified, representing 25.4% of all cases of SV noted during ... to have had a longer duration of symptoms and a higher incidence of peritonitis than those ... emergency surgery for SV have a high mortality rate, reported at 10% to 17%, ... The SV diagnoses were suspected on clinical and.
DEFF Research Database (Denmark)
A-Elbasit, Ishraga E; Elbashir, Mustafa I; Khalil, Insaf F
2006-01-01
OBJECTIVE: To compare the efficacy of sulfadoxine-pyremethamine (SP)+chloroquine (CQ) combination treatment against falciparum malaria with SP treatment alone. METHOD: In-vivo study of 254 patients with uncomplicated Plasmodium falciparum malaria in rural eastern Sudan, where the population is semi...
Czech Academy of Sciences Publication Activity Database
Agirre, J.; Ariza, A.; Offen, W. A.; Turkenburg, J. P.; Roberts, S. M.; McNicholas, S.; Harris, P. V.; McBrayer, B.; Dohnálek, Jan; Cowtan, K. D.; Davies, G. J.; Wilson, K. S.
2016-01-01
Roč. 72, č. 2 (2016), s. 254-265 ISSN 2059-7983 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:86652036 Keywords : cellulose degradation * N-glycan * biofuels * glycoblocks Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.114, year: 2016
CATALYTIC STEAM REFORMING OF CHLOROCARBONS: CATALYST COMPARISONS. (R826694C633)
Catalyst candidates for steam reforming chlorocarbons have been screened for activity using methyl chloride as a model reactant. At 500°C, a H2O/C ratio of about 10 and a GHSV of 254 000 h-1, catalysts comprising 0.5% loading of the metals ...
Scheduling Mission-Critical Flows in Congested and Contested Airborne Network Environments
2018-03-01
networks for atmospheric, wildlife, and ecological monitoring. They equip airborne nodes with off-the-shelf 802.15.4-compliant Zigbee radios. They...Theoretical Criminology, vol. 15, no. 3, pp. 239–254, 2011. [51] R. L. Finn and D. Wright, “Unmanned aircraft systems: Surveillance, ethics and privacy in
Leerssen, J.T.; Leerssen, J.T.; Beller, M.
2007-01-01
'Arabs', 94-5; 'Celts', 122-3; 'Czechs' (met Carlos Reijnen), 135-8; 'Indonesia', 187-9; 'Irish', 191-4; 'Jews' (met Evelien Gans), 202-8; 'Poles' (met André Gerrits), 216-9; 'Polynesia', 219-220; 'Russians' (met Bruno Naarden), 226-30; 'Tibet', 254; 'Centre/Periphery', 278-81; 'Character (moral)',
Czech Academy of Sciences Publication Activity Database
Deineka, Alexander; Glinchuk, M. D.; Jastrabík, Lubomír; Suchaneck, G.; Sandner, T.; Gerlach, G.
2001-01-01
Roč. 254, - (2001), s. 205-211 ISSN 0015-0193 R&D Projects: GA ČR GA202/00/1425 Institutional research plan: CEZ:AV0Z1010914 Keywords : ferroelecric film * depth profile * interface interaction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.471, year: 2001
International Nuclear Information System (INIS)
Fraikin, G.Y.; Strakhovskaya, M.G.; Rubin, L.B.
1981-01-01
Mechanisms of near-UV (334 nm) induced photoprotection as well as potentiation of far-UV (254 nm) lethality are considered in Candida guilliermondii. Using exogenous precursors of serotonin, it appears that the above two mechanisms involve photoactivated synthesis of serotonin. It has been postulated that the serotonin effect could take place by binding to DNA. (author)
Enhancement of the far-UV lethality in yeast Candida guilliermondii by near-UV post-irradiation
International Nuclear Information System (INIS)
Fraikin, G.Y.; Pospelov, M.E.; Rubin, L.B.
1980-01-01
In experiments with the non-photoreactivable yeast Candida guilliermondii, radiations at 313, 334 and 365 nm, having no effect on untreated cell populations, produced an 'enhancing' effect on the lethality of 254 nm-pretreated cells. Wavelengths in the visible region of the spectrum did not exhibit a similar effect. (author)
Data of evolutionary structure change: 1OZHA-1UPCB [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1OZHA-1UPCB 1OZH 1UPC A B VRQWAHGADLVVSQLEAQGVRQVFGIPGAKIDKVFDSLL...>B 1UPCB LLGSSEGIDTPNPP HH... ASP CA 254 1UPC B 1UPCB...MET CA 330 1UPC B 1UPCB.../pdbID> B 1UPCB WQKGIEKKTVR
2011-08-16
... Company, LLC (EGC), Docket No. 50-254, Quad Cities Nuclear Power Station (QCNPS), Unit 1, Rock Island... operation SLMCPR or either of the SLMCPR values for Unit 2. This change is needed to support the next cycle of operation (i.e., Cycle 22) for QCNPS Unit 1 for cycle exposure greater than 4000 MWd/MT, which is...
Energy Technology Data Exchange (ETDEWEB)
Tyrrell, R.M.; Werfelli, P.; Moraes, E.C. (Institut Suisse de Recherches Experimentales sur le Cancer, Lausanne)
1984-02-01
The repair proficient human lymphoblastoid line (TK6) has been employed to construct an action spectrum for the lethal action of ultraviolet (UV) radiation in the range 254 to 434 nm and to examine possible interactions between longer (334, 365 and 405 nm) and shorter wavelength (254 and 313 nm) radiations. The action spectrum follows a DNA absorption spectrum fairly closely out to 360 nm. As in previously determined lethal action spectra for procaryotic and eucaryotic cell populations, there is a broad shoulder in the 334 to 405 nm region which could reflect the existence of either (a) a non-DNA chromophore or (b) a unique photochemical reaction in the DNA over this region. Pre-treatment with radiation at 334 or 365 nm causes either a slight sensitivity to (low fluences) or protection from (higher fluences) subsequent exposure to radiation at a shorter wavelength (254 or 313 nm). Pre-irradiation at a visible wavelength (405 nm) at all fluence levels employed sensitizes the populations to treatment with 254 or 313 nm radiations. These interactions will influence the lethal outcome of cellular exposure to broad-band radiation sources.
BioRadBase: A database for bioremediation of radioactive waste
African Journals Online (AJOL)
Windows User
2012-05-01
May 1, 2012 ... 16(3): 254-260. Llyod JR, Chesnes J, Glasauer S, Bunker DJ, Livens FR, Lovely DR ... Macaskie LE, Lloyd JR, Thomas RAP, Tolley MR (1996). The use of ... Carroll S, He Z, Gu B, Luo J, Criddle CS, Watson DB, Jardine PM,.
Lewis, Michael A., Robert L. Quarles, Darrin D. Dantin and James C. Moore. 2004. Evaluation of a Coastal Golf Complex as a Local and Watershed Source of Bioavailable Contaminants. Mar. Pollut. Bull. 48(3-4):254-262. (ERL,GB 1183). Contaminant fate in coastal areas impacte...
ORF Alignment: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005027 gi|32475765 >1zrn0 11 219 5 254 2e-04 ... ref|NP_868759.1| N-acetylglucosamine-6-phosha... ... N-acetylglucosamine-6-phoshatase or p-nitrophenyl ... phosphatase [Pirellula sp.] ... Len
A combined experimental and theoretical study on the complexation of Li+ with valinomycin
Czech Academy of Sciences Publication Activity Database
Makrlík, E.; Dybal, Jiří; Vaňura, P.
2009-01-01
Roč. 140, č. 3 (2009), s. 251-254 ISSN 0026-9247 R&D Projects: GA AV ČR 1ET400500402 Institutional research plan: CEZ:AV0Z40500505 Keywords : antibiotics * macrocycles * stability constant Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.312, year: 2009
Photoluminescence properties of Er-doped Ge–In(Ga)–S glasses modified by caesium halides
Czech Academy of Sciences Publication Activity Database
Ivanova, Z.G.; Zavadil, Jiří; Kostka, P.; Djouama, T.; Reinfelde, M.
2017-01-01
Roč. 254, č. 6 (2017), č. článku 1600662. ISSN 0370-1972 Institutional support: RVO:67985882 Keywords : caesium halides * chalcohalide glasses * erbium doping * transmission spectroscopy * photoluminiscence Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass OBOR OECD: Ceramics Impact factor: 1.674, year: 2016
Photoluminescence properties of Er-doped Ge–In(Ga)–S glasses modified by caesium halides
Czech Academy of Sciences Publication Activity Database
Ivanova, Z.G.; Zavadil, Jiří; Kostka, Petr; Djouama, T.; Reinfelde, M.
2017-01-01
Roč. 254, č. 6 (2017), č. článku 1600662. ISSN 0370-1972 Institutional support: RVO:67985891 Keywords : caesium halides * chalcohalide glasses * erbium doping * transmission spectroscopy * photoluminiscence Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass OBOR OECD: Ceramics Impact factor: 1.674, year: 2016
Haley, William E.; Bergman, Elizabeth J.; Roth, David L.; McVie, Theresa; Gaugler, Joseph E.; Mittelman, Mary S.
2008-01-01
Purpose: The purpose of this study was to examine the joint effects of bereavement and caregiver intervention on caregiver depressive symptoms. Design and Methods: Alzheimer's caregivers from a randomized trial of an enhanced caregiver support intervention versus usual care who had experienced the death of their spouse (n = 254) were repeatedly…
Opuštěné vojenské prostory jako významná refugia motýlí fauny
Czech Academy of Sciences Publication Activity Database
Vrba, Pavel; Čížek, Oldřich; Marhoul, P.; Zámečník, J.; Beneš, Jiří; Konvička, Martin
2012-01-01
Roč. 2012, č. 5 (2012), s. 251-254 ISSN 0044-4812 R&D Projects: GA ČR GAP505/10/2167 Grant - others:Ministerstvo životního prostředí(CZ) VaV/SP/2d3/153/08 Institutional support: RVO:60077344 Keywords : butterfly fauna
Reconstruction of Effective Cloud Field Geometry from Series of Sunshine Number
Czech Academy of Sciences Publication Activity Database
Badescu, V.; Paulescu, M.; Brabec, Marek
176-177, 1 July - 1 August (2016), s. 254-266 ISSN 0169-8095 Institutional support: RVO:67985807 Keywords : cloud field geometry * sunshine number * point cloud iness Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 3.778, year: 2016
Differential operators admitting various rates of spectral projection growth
Czech Academy of Sciences Publication Activity Database
Mityagin, B.; Siegl, Petr; Viola, J.
2017-01-01
Roč. 272, č. 8 (2017), s. 3129-3175 ISSN 0022-1236 Institutional support: RVO:61389005 Keywords : harmonic and anharmonic oscillators * Hennite functions * spectral projections * Riesz basis Subject RIV: BE - Theoretical Physics OBOR OECD: Pure mathematics Impact factor: 1.254, year: 2016
African Journals Online (AJOL)
uovspc
2013-08-28
Aug 28, 2013 ... quality (Prusakova et al., 1999) and the induction of resis- tance towards .... 5434 Afr. J. Biotechnol. rate of monoculture yeast (Saccharomyces cerivisiae) and its effect .... detected under UV-light at 254 and 365 nm, stained with 10% (v/v) ethanolic ..... mutants showed that they play an essential role in main-.
Nigerian Journal of Physics - Vol 18, No 2 (2006)
African Journals Online (AJOL)
Bouguer correction density determination from fractal analysis using data from part of the Nigerian Basement Complex · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. K M Lawal, C Z Akaolisa, 251-254. http://dx.doi.org/10.4314/njphy.v18i2.38111 ...
24 CFR 570.208 - Criteria for national objectives.
2010-04-01
...- and moderate-income persons to be considered is the creation or retention of jobs, except as provided... or 92.254 are met. (4) Job creation or retention activities. An activity designed to create or retain... activity designed to provide job training and placement and/or other employment support services, including...
24 CFR 570.483 - Criteria for national objectives.
2010-04-01
... is the creation or retention of jobs, except as provided in paragraph (b)(2)(v) of this section. (ii... § 92.252 or § 92.254 of this title are met. (4) Job creation or retention activities. (i) An activity... facilities or improvements which will result in the creation or retention of jobs by more than one business...
77 FR 6809 - Center for Scientific Review; Notice of Closed Meetings
2012-02-09
... 7770, Bethesda, MD 20892, 301 806-0009, [email protected]csr.nih.gov . Name of Committee: Healthcare..., Room 3166, MSC 7770, Bethesda, MD 20892, 301-254-9975, [email protected]csr.nih.gov . Name of Committee... Committee: Healthcare Delivery and Methodologies Integrated Review Group Community-Level Health Promotion...
International Nuclear Information System (INIS)
Stonik, Valentin A
2001-01-01
Structures, taxonomic distribution and biological activities of polar steroids isolated from various marine organisms over the last 8-10 years are considered. The peculiarities of steroid biogenesis in the marine biota and their possible biological functions are discussed. Syntheses of some highly active marine polar steroids are described. The bibliography includes 254 references.