Chemistry of berkelium: a review
International Nuclear Information System (INIS)
Hobart, D.E.; Peterson, J.R.
1985-01-01
Element 97 was first produced in December 1949, by the bombardment of americium-241 with accelerated alpha particles. This new element was named berkelium (Bk) after Berkeley, California, the city of its discovery [Thompson, Ghiorso, and Seaborg, Phys. Rev. 77, 838 (1950); 80, 781 (1950)]. In the 36 years since the discovery of Bk, a substantial amount of knowledge concerning the physicochemical properties of this relatively scarce transplutonium element has been acquired. All of the Bk isotopes of mass numbers 240 and 242 through 251 are presently known, but only berkelium-249 (β - decay, 0.125 MeV, t/sub 1/2/ = 325 days) is available in sufficient quantities for bulk chemical studies. About 0.7 gram of this isotope has been isolated at the HFIR/TRU Complex in Oak Ridge, Tennessee in the last 18 years. Over the same time period, the scale of experimental work using berkelium-249 has increased from the tracer level to bulk studies at the microgram level to solution and solid state investigations with milligram quantities. Extended knowledge of the physicochemical behavior of berkelium is important in its own right, because Bk is the first member of the second half of the actinide series. In addition, such information should enable more accurate extrapolations to the predicted behavior of heavier elements for which experimental studies are severely limited by lack of material and/or by intense radioactivity
Citric complexes of trivalent cerium and berkelium
International Nuclear Information System (INIS)
Boulhassa, S.
1977-01-01
The extraction by thenoyltrifluoroacetone (TTA) in benzene of trivalent cerium, berkelium and californium, at the indicator scale, hydrolysis and complexation by citric acid of these cations are studied. The radionuclides used were 144 Ce, 249 Bk and 249 Cf respectively γ, β and α emitters. The solvent extraction technique of the elements by TTA in benzene from a perchloric medium at the ionic stength 0.1 was employed. The distribution coefficients D were measured by the γ, β or α radiometry. Cerium and berkelium, which have a comparable redox behavior, show in solution a relatively stable valency IV. Therefore the study by solvent extraction of their trivalent form required the standing up of complete reducing conditions of these elements and their stabilization in solution at the valency III. The thermodynamic data obtained for berkelium and californium contribute to understand the chemistry of these elements and permit to complete the third 'tetrad branch' of 5f elements from Cm 3+ to Es 3+ . This tetrad effect is a manifestation of thermodynamic consequence of the 'nephelauxetic effect'. As for Ce(III), the data confirm the pronounced acid property and may be show no neglected ligand effect for f 1 configuration [fr
Berkelium (4) and cerium (4) extraction with tertiary amines
International Nuclear Information System (INIS)
Milyukova, M.S.; Malikov, D.A.; Myasoedov, B.V.
1978-01-01
Oxidation of indicator quantities of berkelium and cerium by a mixture of silver nitrate and ammonium persulfate in the solutions of nitric and sulfuric acid has been examined. The stability of the elements in a tetravalent state and their extraction by the solutions of ternary amines have been investigated. It has been established that berkelium and cerium oxidation under these conditions occurs under the effect of ions of divalent silver which is formed owing to oxidation of monovalent silver by peroxide sulfate ions. The following supposition has been put forward: a difference in the behaviour of tetravalent berkelium and cerium during their extraction by ternary amines is explained by their different stability in this state, but not by the formation of complex compounds with nitrate ions
Chelation and stabilization of berkelium in oxidation state +IV
Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.
2017-09-01
Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.
vct 251,uop vct 251,vct 251 entire course new
admin
2018-01-01
UOP VCT 251 Week 1 Individual: Graphic Icon NEW Check this A+ tutorial guideline at http://www.assignmentcloud.com/vct-251-uop/vct-251-week-1-individual-graphic-icon-new For more classes visit http://www.assignmentcloud.com/ VCT 251 Week 1 Individual: Graphic Icon NEW Review Lessons 1, 2, and 3 of Adobe® Illustrator® CC™ Digital Classroom and the Lynda.com® video “Introduction to Graphic Design with Justin Seeley”. Create your first Illustrat...
International Nuclear Information System (INIS)
Payne, G.F.; Peterson, J.R.
1987-01-01
It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species
Trabesinger, Andreas
2017-09-01
The first new element produced after the Second World War has led a rather peaceful life since entering the period table -- until it became the target of those producing superheavy elements, as Andreas Trabesinger describes.
48 CFR 251.205 - Contract clause.
2010-10-01
... Fleet Management System (IFMS) Vehicles 251.205 Contract clause. Use the clause at 252.251-7001, Use of Interagency Fleet Management System (IFMS)Vehicles and Related Services, in solicitations and contracts which include the clause at FAR 52.251-2, Interagency Fleet Management System (IFMS) Vehicles and Related...
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Purpose. 25.1 Section 25.1 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY REGULATIONS TO SUPPORT ANTI-TERRORISM BY FOSTERING EFFECTIVE TECHNOLOGIES § 25.1 Purpose. This part implements the Support Anti-terrorism by Fostering...
49 CFR 234.251 - Standby power.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Standby power. 234.251 Section 234.251 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., Inspection, and Testing Inspections and Tests § 234.251 Standby power. Standby power shall be tested at least...
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Reciprocity. 251.63 Section 251.63 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LAND USES Special Uses § 251.63 Reciprocity. If it is determined that a right-of-way shall be needed by the United States...
40 CFR 421.251 - Specialized definitions.
2010-07-01
... AND STANDARDS NONFERROUS METALS MANUFACTURING POINT SOURCE CATEGORY Primary Precious Metals and Mercury Subcategory § 421.251 Specialized definitions. For the purpose of this subpart the general...
7 CFR 251.6 - Distribution plan.
2010-01-01
... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION THE EMERGENCY FOOD ASSISTANCE PROGRAM § 251.6..., 2009, § 251.6 was amended by revising paragraph (b), effective March 1, 2010. For the convenience of...
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Definitions. 206.251 Section 206.251 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT PRODUCT... impurities from coal. Coal washing may include, but is not limited to, operations such as flotation, air...
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Introduction. 25.1 Section 25.1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PUBLIC PARTICIPATION IN PROGRAMS UNDER THE... Introduction. This part sets forth minimum requirements and suggested program elements for public participation...
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 251.2 Section 251.2 Agriculture... Administration. (a) Food and Nutrition Service. Within the United States Department of Agriculture (the... this section, any information on changes in program administration, including any changes resulting...
37 CFR 1.251 - Unlocatable file.
2010-07-01
..., patent, or other patent-related proceeding after a reasonable search, the Office will notify the... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Unlocatable file. 1.251 Section 1.251 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF...
37 CFR 2.51 - Drawing required.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Drawing required. 2.51... COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Drawing § 2.51 Drawing required. (a) In an application under section 1(a) of the Act, the drawing of the mark must be a substantially exact representation of the mark...
37 CFR 251.21 - Public records.
2010-07-01
... available by law except to a party in litigation with a CARP, the Copyright Office, or the Library of... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Public records. 251.21 Section 251.21 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT...
48 CFR 251.202 - Authorization.
2010-10-01
... OF DEFENSE CONTRACT MANAGEMENT USE OF GOVERNMENT SOURCES BY CONTRACTORS Contractor Use of Interagency Fleet Management System (IFMS) Vehicles 251.202 Authorization. (a)(2)(A) See FAR 28.307-2(c) for policy...
50 CFR 216.251 - Effective dates.
2010-10-01
..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.251...
2010-01-01
... following categories: (i) Emergency feeding organizations (including food banks, food pantries and soup... eligible recipient agencies in the distribution of TEFAP commodities pursuant to § 251.4(h). (f) Food bank... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE...
29 CFR 1910.251 - Definitions.
2010-07-01
... OCCUPATIONAL SAFETY AND HEALTH STANDARDS Welding, Cutting and Brazing § 1910.251 Definitions. As used in this subpart: (a) Welder and welding operator mean any operator of electric or gas welding and cutting equipment. (b) Approved means listed or approved by a nationally recognized testing laboratory. Refer to...
27 CFR 25.251 - Authorized removals.
2010-04-01
..., DEPARTMENT OF THE TREASURY LIQUORS BEER Removal of Brewer's Yeast and Other Articles § 25.251 Authorized removals. (a) Brewer's yeast. A brewer may remove brewer's yeast, in liquid or solid form containing not... including the words “Brewer's Yeast.” (c) Pipeline. If brewer's yeast is removed by pipeline, the pipeline...
37 CFR 251.41 - Formal hearings.
2010-07-01
... ARBITRATION ROYALTY PANEL RULES AND PROCEDURES COPYRIGHT ARBITRATION ROYALTY PANEL RULES OF PROCEDURE Procedures of Copyright Arbitration Royalty Panels § 251.41 Formal hearings. (a) The formal hearings that will be conducted under the rules of this subpart are rate adjustment hearings and royalty fee...
37 CFR 251.43 - Written cases.
2010-07-01
... and redirect) must be referenced. (d) In the case of a royalty fee distribution proceeding, each party... ROYALTY PANEL RULES AND PROCEDURES COPYRIGHT ARBITRATION ROYALTY PANEL RULES OF PROCEDURE Procedures of Copyright Arbitration Royalty Panels § 251.43 Written cases. (a) All parties who have filed a notice of...
37 CFR 251.58 - Judicial review.
2010-07-01
... determination on appeal, from depositing statements of account and royalty fees by those sections. [59 FR 23981... ARBITRATION ROYALTY PANEL RULES AND PROCEDURES COPYRIGHT ARBITRATION ROYALTY PANEL RULES OF PROCEDURE Procedures of Copyright Arbitration Royalty Panels § 251.58 Judicial review. (a) Any order of determination...
Organic Matter in Space (IAU S251)
Kwok, Sun; Sanford, Scott
2009-01-01
Preface; From the local organising committee; Organising committee; Conference participants; Opening address of Symposium 251 C. Cesarsky; Session I. Observations of organic compounds beyond the Solar System William Irvine, Ewine van Dishoeck, Yvonne Pendleton and Hans Olofsson; Session II. Organic compounds within the Solar System Scott Sandford, Ernst Zinner and Dale Cruikshank; Session III. Laboratory analogues of organic compounds in space Max Bernstein and Thomas Henning; Banquet speech; Author index; Object index.
27 CFR 25.1 - Production and removal of beer.
2010-04-01
... beer. 25.1 Section 25.1 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Scope of Regulations § 25.1 Production and removal of beer. The regulations in this part relate to beer and cereal beverages and cover the location, construction, equipment...
7 CFR 251.1 - General purpose and scope.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 251.1 Section 251.1... AGRICULTURE GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION THE EMERGENCY FOOD ASSISTANCE PROGRAM § 251.1 General purpose and scope. This part announces the policies and prescribes the regulations necessary to...
34 CFR 75.251 - The budget period.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false The budget period. 75.251 Section 75.251 Education... Multi-Year Projects § 75.251 The budget period. (a) The Secretary usually approves a budget period of... budget period; and (2) Indicates his or her intention to make contination awards to fund the remainder of...
47 CFR 25.251 - Special requirements for coordination.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Special requirements for coordination. 25.251 Section 25.251 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25.251 Special requirements for coordination. (a) The...
37 CFR 251.23 - FOIA and Privacy Act.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false FOIA and Privacy Act. 251.23 Section 251.23 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT... Access to and Inspection of Records § 251.23 FOIA and Privacy Act. Freedom of Information Act and Privacy...
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHI251 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) SHI251F 125 - - - - - - Show SHI251 Library SH (Link to library) Clone ID SHI251 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...XX sequence update 2002.10.25 Translated Amino Acid sequence ilfqilkistnk**IKNYYVNRVYEIIIIINICT...YKKK--- Translated Amino Acid sequence (All Frames) Frame A: ilfqilkistnk**IKNYYVNRVYEIIIIINICT
5 CFR 251.302 - All other organizations.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false All other organizations. 251.302 Section... RELATIONSHIPS WITH ORGANIZATIONS REPRESENTING FEDERAL EMPLOYEES AND OTHER ORGANIZATIONS Dues Withholding § 251.302 All other organizations. Under 5 CFR 550.311(b), an agency may permit an employee to make an...
36 CFR 251.52 - Delegation of authority.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Delegation of authority. 251... USES Special Uses § 251.52 Delegation of authority. Special use authorizations shall be issued, granted, amended, renewed, suspended, terminated, or revoked by the Chief, or through delegation, by the Regional...
40 CFR 265.251 - Protection from wind.
2010-07-01
... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Protection from wind. 265.251 Section... FACILITIES Waste Piles § 265.251 Protection from wind. The owner or operator of a pile containing hazardous waste which could be subject to dispersal by wind must cover or otherwise manage the pile so that wind...
43 CFR 17.251 - Drug and alcohol addicts.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Drug and alcohol addicts. 17.251 Section... Drug and alcohol addicts. A recipient that operates a general hospital or outpatient facility may not discriminate in admission or treatment against a drug or alcohol abuser or addict who is suffering from a...
7 CFR 251.4 - Availability of commodities.
2010-01-01
... existing food bank networks and other organizations whose ongoing primary function is to facilitate the... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION THE EMERGENCY FOOD ASSISTANCE PROGRAM § 251.4...
28 CFR 25.1 - Purpose and authority.
2010-07-01
... Instant Criminal Background Check System § 25.1 Purpose and authority. The purpose of this subpart is to establish policies and procedures implementing the Brady Handgun Violence Prevention Act (Brady Act), Public... Instant Criminal Background Check System (NICS) to be contacted by any licensed importer, licensed...
Phenotype abnormality: 251 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available lant flowering stage in environment of long day length regimen in environment of long day length regimen htt... 251 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u757i delayed whole p
37 CFR 251.71 - Commencement of proceedings.
2010-07-01
... PROCEDURE Royalty Fee Distribution Proceedings § 251.71 Commencement of proceedings. (a) Cable. In the case of royalty fees collected under the cable compulsory license (17 U.S.C. 111), any person claiming to... royalty fees collected under the satellite carrier compulsory license (17 U.S.C. 119), any person claiming...
8 CFR 251.1 - Arrival manifests and lists.
2010-01-01
... List, in accordance with the instructions contained thereon. (2) Longshore work notations. The master... master, captain, or agent shall prepare as a part of the manifest, when one is required for presentation... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Arrival manifests and lists. 251.1 Section...
27 CFR 41.251 - Change in name.
2010-04-01
... corporate name. When there is a change in the corporate name of an importer of processed tobacco, the... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Change in name. 41.251... name. (a) Change in individual name. When there is a change in the name of an individual operating...
48 CFR 2452.251-70 - Contractor employee travel.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contractor employee travel... 2452.251-70 Contractor employee travel. As prescribed in 2451.7001, insert the following clause in all cost-reimbursement solicitations and contracts involving travel: Contractor Employee Travel (OCT 1999...
36 CFR 251.56 - Terms and conditions.
2010-07-01
... subject to State regulatory or conservation laws governing its purchase by pipeline companies is offered... standards established by or pursuant to applicable Federal or State law; and (D) Require compliance with... making explicit its preexisting understanding of § 251.56(a)(1)(ii)(G) of this subpart in the context of...
36 CFR 251.93 - Resolution of issues.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Resolution of issues. 251.93... issues. (a) Authorized Forest Service officers shall, to the extent practicable and consistent with the... meetings is to discuss any issues or concerns related to the authorized use and to reach a common...
37 CFR 251.33 - Ex parte communications.
2010-07-01
....33 Section 251.33 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT... person outside the Library of Congress shall engage in ex parte communication with the Librarian of... concerning public policies related to royalty fee distribution and rate adjustment so long as they are...
38 CFR 3.251 - Income of parents; dependency and indemnity compensation.
2010-07-01
...; dependency and indemnity compensation. 3.251 Section 3.251 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS ADJUDICATION Pension, Compensation, and Dependency and Indemnity Compensation Dependency, Income and Estate § 3.251 Income of parents; dependency and indemnity compensation. (a) Annual...
24 CFR 251.6 - Method of payment of mortgage insurance premiums.
2010-04-01
... insurance premiums. 251.6 Section 251.6 Housing and Urban Development Regulations Relating to Housing and... HOUSING PROJECTS § 251.6 Method of payment of mortgage insurance premiums. In the cases that the... affected lenders, that mortgage insurance premiums be remitted electronically. [63 FR 1303, Jan. 8, 1998] ...
37 CFR 251.2 - Purpose of Copyright Arbitration Royalty Panels.
2010-07-01
... carrier royalty fees and digital audio recording devices and media payments deposited with the Register of... Arbitration Royalty Panels. 251.2 Section 251.2 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES COPYRIGHT ARBITRATION ROYALTY...
12 CFR 335.251 - Forms for notification of action taken by national securities exchanges.
2010-01-01
... national securities exchanges. 335.251 Section 335.251 Banks and Banking FEDERAL DEPOSIT INSURANCE... for notification of action taken by national securities exchanges. The applicable forms for notification of action taken by national securities exchanges are codified in subpart A of 17 CFR part 249. All...
26 CFR 1.381(c)(25)-1 - Deficiency dividend of a qualified investment entity.
2010-04-01
... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Deficiency dividend of a qualified investment entity. 1.381(c)(25)-1 Section 1.381(c)(25)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(25...
TWOS - TIME WARP OPERATING SYSTEM, VERSION 2.5.1
Bellenot, S. F.
1994-01-01
The Time Warp Operating System (TWOS) is a special-purpose operating system designed to support parallel discrete-event simulation. TWOS is a complete implementation of the Time Warp mechanism, a distributed protocol for virtual time synchronization based on process rollback and message annihilation. Version 2.5.1 supports simulations and other computations using both virtual time and dynamic load balancing; it does not support general time-sharing or multi-process jobs using conventional message synchronization and communication. The program utilizes the underlying operating system's resources. TWOS runs a single simulation at a time, executing it concurrently on as many processors of a distributed system as are allocated. The simulation needs only to be decomposed into objects (logical processes) that interact through time-stamped messages. TWOS provides transparent synchronization. The user does not have to add any more special logic to aid in synchronization, nor give any synchronization advice, nor even understand much about how the Time Warp mechanism works. The Time Warp Simulator (TWSIM) subdirectory contains a sequential simulation engine that is interface compatible with TWOS. This means that an application designer and programmer who wish to use TWOS can prototype code on TWSIM on a single processor and/or workstation before having to deal with the complexity of working on a distributed system. TWSIM also provides statistics about the application which may be helpful for determining the correctness of an application and for achieving good performance on TWOS. Version 2.5.1 has an updated interface that is not compatible with 2.0. The program's user manual assists the simulation programmer in the design, coding, and implementation of discrete-event simulations running on TWOS. The manual also includes a practical user's guide to the TWOS application benchmark, Colliding Pucks. TWOS supports simulations written in the C programming language. It is designed
2010-07-01
... and information and certain processing costs. 251.13 Section 251.13 Mineral Resources MINERALS... third party for the reasonable costs of processing geophysical information (which does not include cost... OUTER CONTINENTAL SHELF § 251.13 Reimbursement for the costs of reproducing data and information and...
Mortari, Márcia Renata; Schwartz, Elisabeth N Ferroni; Schwartz, Carlos Alberto; Pires, Osmindo Rodrigues; Santos, Marcello Moreira; Bloch, Carlos; Sebben, Antonio
2004-03-01
Epipedobates flavopictus, Dendrobatidae, is a small aposematic frog found in Brazilian Cerrado bioma. In the present work, we isolated and characterized chemically the most abundant alkaloids present in the cutaneous extract of E. flavopictus. The specimens were collected in Pirenópolis (Goiás, Brazil), their skins were removed and extracted with methanol, and submitted to purification by HPLC and identification by gas chromatography and mass spectrometry. Pumiliotoxin 251D, histrionicotoxin 285Da and two decahydroquinolines, 219A and 243A, were identified. The pumiliotoxin 251D was tested on isolated frog sciatic nerve and on isolated guinea pig ileum muscle. The pumiliotoxin 251D slightly reduced the action potentials amplitude of frog sciatic nerve. The crude skin extract of E. flavopictus and the pumiliotoxin 251D produced rhythmic contractions and increased the muscular tension on isolated guinea pig ileum.
29 CFR 779.251 - Goods that have lost their out-of-State identity.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Goods that have lost their out-of-State identity. 779.251... Coverage Interstate Inflow Test Under Prior Act § 779.251 Goods that have lost their out-of-State identity... been processed or manufactured so as to have lost their identity as out-of-State goods before they are...
THE CANNABINOID RECEPTOR ANTAGONIST AM251 INCREASES PARAOXON AND CHLORPYRIFOS OXON TOXICITY IN RATS
Liu, Jing; Pope, Carey
2014-01-01
Organophosphorus anticholinesterases (OPs) elicit acute toxicity by inhibiting acetylcholinesterase (AChE), leading to acetylcholine accumulation and overstimulation of cholinergic receptors. Endocannabinoids (eCBs, e.g., arachidonoyl ethanolamide [AEA] and 2-arachidonoyl glycerol [2-AG]) are neuromodulators that regulate neurotransmission by reducing neurotransmitter release. The eCBs are degraded by the enzymes fatty acid amide hydrolase (FAAH, primarily involved in hydrolysis of AEA) and monoacylglycerol lipase (MAGL, primarily responsible for metabolism of 2-AG). We previously reported that the cannabinoid receptor agonist WIN 55,212-2 reduced cholinergic toxicity after paraoxon exposure. This study compared the effects of the cannabinoid receptor antagonist AM251 on acute toxicity following either paraoxon (PO) or chlorpyrifos oxon (CPO). CPO was more potent in vitro than PO at inhibiting AChE (≈ 2 fold), FAAH (≈ 8 fold), and MAGL (≈ 19 fold). Rats were treated with vehicle, PO (0.3 and 0.6 mg/kg, sc.) or CPO (6 and 12 mg/kg, sc.) and subsets treated with AM251 (3 mg/kg, ip; 30 min after OP). Signs of toxicity were recorded for four hours and rats were then sacrificed. OP-treated rats showed dose-related involuntary movements, with AM251 increasing signs of toxicity with the lower dosages. PO and CPO elicited excessive secretions, but AM251 had no apparent effect with either OP. Lethality was increased by AM251 with the higher dosage of PO, but no lethality was noted with either dosage of CPO, with or without AM251. Both OPs caused extensive inhibition of hippocampal AChE and FAAH (>80–90%), but only CPO inhibited MAGL (37–50%). These results provide further evidence that eCB signaling can influence acute OP toxicity. The selective in vivo inhibition of MAGL by CPO may be important in the differential lethality noted between PO and CPO with AM251 co-administration. PMID:25447325
Downregulation of HIF-1a sensitizes U251 glioma cells to the temozolomide (TMZ) treatment
Energy Technology Data Exchange (ETDEWEB)
Tang, Jun-Hai [Department of Neurosurgery, Xinqiao Hospital, Third Military Medical University, Chongqing 400037 (China); Ma, Zhi-Xiong [National Institute of Biological Sciences, Beijing 102206 (China); Huang, Guo-Hao; Xu, Qing-Fu; Xiang, Yan [Department of Neurosurgery, Xinqiao Hospital, Third Military Medical University, Chongqing 400037 (China); Li, Ningning; Sidlauskas, Kastytis [Division of Neuropathology and Department of Neurodegenerative Disease, Institute of Neurology, University College London, London WC1N 3BG (United Kingdom); Zhang, Eric Erquan [National Institute of Biological Sciences, Beijing 102206 (China); Lv, Sheng-Qing, E-mail: lvsq0518@hotmail.com [Department of Neurosurgery, Xinqiao Hospital, Third Military Medical University, Chongqing 400037 (China)
2016-05-01
Purpose: The aim of this study was to investigate the effect of downregulation of HIF-1α gene on human U251 glioma cells and examine the consequent changes of TMZ induced effects and explore the molecular mechanisms. Methods: U251 cell line stably expressing HIF-1α shRNA was acquired via lentiviral vector transfection. The mRNA and protein expression alterations of genes involved in our study were determined respectively by qRT-PCR and Western blot. Cell proliferation was measured by MTT assay and colony formation assay, cell invasion/migration capacity was determined by transwell invasion assay/wound healing assay, and cell apoptosis was detected by flow cytometry. Results: We successfully established a U251 cell line with highly efficient HIF-1α knockdown. HIF-1a downregulation sensitized U251 cells to TMZ treatment and enhanced the proliferation-inhibiting, invasion/migration-suppressing, apoptosis-inducing and differentiation-promoting effects exerted by TMZ. The related molecular mechanisms demonstrated that expression of O{sup 6}-methylguanine DNA methyltransferase gene (MGMT) and genes of Notch1 pathway were significantly upregulated by TMZ treatment. However, this upregulation was abrogated by HIF-1α knockdown. We further confirmed important regulatory roles of HIF-1α in the expression of MGMT and activation of Notch1 pathways. Conclusion: HIF-1α downregulation sensitizes U251 glioma cells to the temozolomide treatment via inhibiting MGMT expression and Notch1 pathway activation. - Highlights: • TMZ caused more significant proliferation inhibition and apoptosis in U251 cells after downregulating HIF-1α. • Under TMZ treatment, HIF-1 downregulated U251 cells exhibited weaker mobility and more differentiated state. • TMZ caused MGMT over-expression and Notch1 pathway activation, which could be abrogated by HIF-1α downregulation.
Directory of Open Access Journals (Sweden)
Soekadar Wiryadiputra
2002-07-01
Full Text Available Experiment on the effect of P. lilacinus on the infestation of P. coffeae on robusta coffee was conducted in Sumber Asin Experimental Garden, Malang. The treatments were dosages of bionematicide i.e. : 0 (control, 0.25, 0.50, 1.00, 2.00, and 4.00 g; carbofuran (3 % active ingredient 50 g/plant and organic soil treatment (OST at 100 g/plant. Each treatment was replicated four times, and each replication consists of five coffee trees. The results in second year observation revealed that the population of P. coffeae in the roots on PL 251 treatments was not significantly different compared to the control, whereas in soil samples the population of both P. coffeae and Rotylenchulus reniformis inclined to be lower than the control, although they were not statistically significant. The lowest infestation was observed on PL 251 treatment at a dosage level of 4.00 g/tree. On nematode infestation, no significant difference on treatments of carbofuran and OST compared to the control. The yield of green coffee (market coffee was the highest on the treatment of PL 251 at a dosage of 4.00 g/tree and significantly higher than the control and carbofuran treatments, with increasing levels of 225.3 and 198.9%, respectively. Keywords: bionematicide Paecilomyces lilacinus strain 251 (PL 251, Pratylenchus coffeae, Rotylenchulus reniformis
Mustapha, Mohd Aminudin; Shahpudin, Siti Nurfatimah Mohd; Aziz, Ahmad Aizat Abdul; Ankathil, Ravindran
2012-06-07
To investigate the allele and genotype frequencies and associated risk of interleukin (IL)-8 -251T>A polymorphism on colorectal cancer (CRC) susceptibility risk. Peripheral blood samples of 255 normal controls and 255 clinically and histopathologically confirmed CRC patients were genotyped for IL-8 -251T>A polymorphism employing allele-specific polymerase chain reaction. The relative association of variant allele and genotypes with CRC susceptibility risk was determined by calculating the odds ratios (ORs). Corresponding χ² tests on the CRC patients and controls were carried out and 95% confidence intervals (CIs) were determined using Fisher's exact test. The allele frequencies and its risk association were calculated using FAMHAP, haplotype association analysis software. On comparing the frequencies of genotypes of patients and controls, the homozygous variant AA was significantly higher in CRC patients (P = 0.002) compared to controls. Investigation on the association of the polymorphic genotypes with CRC susceptibility risk, showed that the homozygous variant IL-8 -251AA had a significantly increased risk with OR 3.600 (95% CI: 1.550-8.481, P = 0.001). In the case of allele frequencies, variant allele A of IL-8 -251 showed a significantly increased risk of CRC predisposition with OR 1.32 (95% CI: 1.03-1.69, P = 0.003). Variant allele and genotype of IL-8 (-251T>A) was significantly associated with CRC susceptibility risk and could be considered as a high-risk variant for CRC predisposition.
The prosurvival role of autophagy in Resveratrol-induced cytotoxicity in human U251 glioma cells
International Nuclear Information System (INIS)
Li, Jun; Qin, Zhenghong; Liang, Zhongqin
2009-01-01
Previous study reported that resveratrol has anti-tumor activity. In this study, we investigated the involvement of autophagy in the resveratrol-induced apoptotic death of human U251 glioma cells. The growth inhibition of U251 cells induced by resveratrol was assessed with methyl thiazolyl tetrazolium (MTT). The activation of autophagy and proapoptotic effect were characterized by monodansylcadaverine labeling and Hoechst stain, respectively. Mitochondrialtransmembrane potential (ΔΨm) was measured as a function of drug treatment using 5,5',6,6'-tetrachloro-1,1',3,3'-tetraethylbenzimidazolylcarbocyanine iodide (JC-1). The role of autophagy and apoptosis in the resveratrol-induced death of U251 cells was assessed using autophagic and caspase inhibitors. Immunofluorescence, flow cytometry, and Western blot analysis were used to study the apoptotic and autophagic mechanisms. Methyl thiazolyl tetrazolium (MTT) assays indicated that resveratrol decreased the viability of U251 cells in a dose- and time-dependent manner. Flow cytometry analysis indicated that resveratrol increased cell population at sub-G1 phase, an index of apoptosis. Furthermore, resveratrol-induced cell death was associated with a collapse of the mitochondrial membrane potential. The pan-caspase inhibitor Z-VAD-fmk suppressed resveratrol-induced U251 cell death. Resveratrol stimulated autophagy was evidenced by punctuate monodansylcadaverine(MDC) staining and microtubule-associated protein light chain 3 (LC3) immunoreactivty. Resveratrol also increased protein levels of beclin 1 and membrane form LC3 (LC3-II). Autophagy inhibitors 3-methylademine (3-MA) and bafilomycin A1 sensitized the cytotoxicity of resveratrol. Together, these findings indicate that resveratrol induces autophagy in human U251 glioma cells and autophagy suppressed resveratrol-induced apoptosis. This study thus suggests that autophagy inhibitors can increase the cytotoxicity of resveratrol to glioma cells
International Nuclear Information System (INIS)
Torsvik, Anja; Stieber, Daniel; Enger, Per Øyvind; Golebiewska, Anna; Molven, Anders; Svendsen, Agnete; Westermark, Bengt; Niclou, Simone P; Olsen, Thale Kristin; Chekenya Enger, Martha; Bjerkvig, Rolf
2014-01-01
It is well known that in vitro subculture represents a selection pressure on cell lines, and over time this may result in a genetic drift in the cancer cells. In addition, long-term cultures harbor the risk of cross-contamination with other cell lines. The consequences may have major impact on experimental results obtained in various laboratories, where the cell lines no longer reflect the original tumors that they are supposed to represent. Much neglected in the scientific community is a close monitoring of cell cultures by regular phenotypic and genetic characterization. In this report, we present a thorough characterization of the commonly used glioblastoma (GBM) model U-251, which in numerous publications has been wrongly identified as U-373, due to an earlier cross-contamination. In this work, the original U-251 and three subclones of U-251, commonly referred to as U-251 or U-373, were analyzed with regard to their DNA profile, morphology, phenotypic expression, and growth pattern. By array comparative genomic hybridization (aCGH), we show that only the original low-passaged U-251 cells, established in the 1960s, maintain a DNA copy number resembling a typical GBM profile, whereas all long-term subclones lost the typical GBM profile. Also the long-term passaged subclones displayed variations in phenotypic marker expression and showed an increased growth rate in vitro and a more aggressive growth in vivo. Taken together, the variations in genotype and phenotype as well as differences in growth characteristics may explain different results reported in various laboratories related to the U-251 cell line
20 CFR 702.251 - Employer's controversion of the right to compensation.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Employer's controversion of the right to... PROCEDURE Claims Procedures Controverted Claims § 702.251 Employer's controversion of the right to compensation. Where the employer controverts the right to compensation after notice or knowledge of the injury...
36 CFR 251.103 - Mediation of term grazing permit disputes.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Mediation of term grazing... Lands § 251.103 Mediation of term grazing permit disputes. (a) Decisions subject to mediation. In those States with Department of Agriculture certified mediation programs, any holder of a term grazing permit...
48 CFR 52.251-2 - Interagency Fleet Management System Vehicles and Related Services.
2010-10-01
... CLAUSES Text of Provisions and Clauses 52.251-2 Interagency Fleet Management System Vehicles and Related Services. As prescribed in 51.205, insert the following clause: Interagency Fleet Management System... to obtain interagency fleet management system vehicles and related services for use in the...
37 CFR 251.72 - Declaration of controversy: Initiation of arbitration proceeding.
2010-07-01
... OFFICE, LIBRARY OF CONGRESS COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES COPYRIGHT ARBITRATION ROYALTY PANEL RULES OF PROCEDURE Royalty Fee Distribution Proceedings § 251.72 Declaration of... royalties, the Librarian shall publish in the Federal Register a declaration of controversy along with a...
37 CFR 251.44 - Filing and service of written cases and pleadings.
2010-07-01
... OF CONGRESS COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES COPYRIGHT ARBITRATION ROYALTY PANEL RULES OF PROCEDURE Procedures of Copyright Arbitration Royalty Panels § 251.44 Filing and service of written cases and pleadings. (a) Filing of pleadings. In a royalty fee distribution proceeding or...
37 CFR 251.73 - Deduction of costs of distribution proceedings.
2010-07-01
... OF CONGRESS COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES COPYRIGHT ARBITRATION ROYALTY PANEL RULES OF PROCEDURE Royalty Fee Distribution Proceedings § 251.73 Deduction of costs of... distributions of royalty fees are made, deduct the reasonable costs incurred by the Library of Congress and the...
37 CFR 251.56 - Order of the Librarian of Congress.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Order of the Librarian of... PROCEDURE Procedures of Copyright Arbitration Royalty Panels § 251.56 Order of the Librarian of Congress. (a... the determination of a panel, the Librarian of Congress shall issue an order accepting the panel's...
37 CFR 251.53 - Report to the Librarian of Congress.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Report to the Librarian of... PROCEDURE Procedures of Copyright Arbitration Royalty Panels § 251.53 Report to the Librarian of Congress... Librarian of Congress a report incorporating its written determination. Such determination shall be...
5 CFR 251.201 - Associations of management officials and/or supervisors.
2010-01-01
... managers should be included in the decision-making process and notified of executive-level decisions on a... SERVICE REGULATIONS AGENCY RELATIONSHIPS WITH ORGANIZATIONS REPRESENTING FEDERAL EMPLOYEES AND OTHER ORGANIZATIONS Relationships With Organizations Representing Federal Employees and Other Organizations § 251.201...
40 CFR 81.251 - Northeast Kansas Intrastate Air Quality Control Region.
2010-07-01
... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Northeast Kansas Intrastate Air... Air Quality Control Regions § 81.251 Northeast Kansas Intrastate Air Quality Control Region. The Northeast Kansas Intrastate Air Quality Control Region consists of the territorial area encompassed by the...
Impact of pEGFP mediated ING4 gene on growth of glioma U251 ...
African Journals Online (AJOL)
Jane
2011-06-22
Jun 22, 2011 ... Full Length Research Paper. Impact of pEGFP mediated ING4 gene on growth of glioma U251 cells and its potential molecular mechanism. Yuefei Deng*, Bingxi Lei and Yiying Zhao. Department of Neurosurgery, Sun Yat-Sen Memorial Hospital, Sun Yat-Sen University, Guangzhou 510120, China.
36 CFR 251.54 - Proposal and application requirements and procedures.
2010-07-01
..., DEPARTMENT OF AGRICULTURE LAND USES Special Uses § 251.54 Proposal and application requirements and... activity does not materially impact the characteristics or functions of the environmentally sensitive...-disposal facilities; (3) The availability of sufficient potable drinking water; (4) The risk of disease...
Radiosensitization and relative mechanisms of vanillin derivative BVAN08 on human glioma U-251 cells
International Nuclear Information System (INIS)
Wang Shubin; Zhang Bo; Sun Weijian; Wang Yu; Liu Xiaodan; Xu Qinzhi; Zhou Pingkun
2010-01-01
Objective: To provide more convincing evidences and experimental data for exploring vanillin derivative BVAN08, 6-bromine-5-hydroxy-4-methoxy-benzaldehyde, as a new anticancer drug, and to investigate the effect on the growth, radiosensitization of human glioma cell line U-251 and the relative mechanism. Methods: The effect of BVAN08 on cell proliferation of U-251 and radiosensitivity to 60 Co γ-rays (irradiation dose rate 2.3 Gy/min) were analyzed with MTT and colony-forming ability assay. Change in cellular morphology was observed by using light microscope. Change in cell cycle and apoptosis was detected with flow cytometry. The autophagy was observed by using TEM (irradiation dose rate is transmission electron microscope). DNA-PKcs protein level was detected through Western blot analysis. Results: BVAN08 exhibited a dose- and time-dependent inhibition on the proliferation of U-251 cells during the concentration range of 10-100 mol/L (t=1.83-3.07, P 50 at 48 h and 72 h after administration with BVAN08 were 55.3 and 52.7 mol/L, respectively. Obvious G 2 /M arrest was induced in U-251 cells after 4 h administration with BVAN08, and reached peck at 12 h. The G 2 /M population reached 63.3% in U-251 cells after 12 h administration of 60 μmol/L BVAN08 and kept increasing with the time, while both apoptosis and autophagic cell death were induced. The most effective radiosensitization time for BVAN08 treatment was 12 h before irradiation. The enhancement ratio of radiosensitivity was 3.14 for 20 μmol/L of BVAN08 12 h before 2 Gy irradiation. Conclusions: BVAN08 can induce apoptosis as radiosensitizing effect might be associated with the induction of G 2 /M arrest and inhibition of DNA-PKcs expression. BVAN08 seemed to be a promising radiosensitizing anticancer drug. (authors)
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Prohibition of location of mining claims within certain areas in the Norbeck Wildlife Preserve, South Dakota. 251.10 Section 251.10... areas in the Norbeck Wildlife Preserve, South Dakota. The location of mining claims in such areas within...
2011-03-22
... of social marketing. Social marketing principles and practices apply marketing principles to social... Prepaid Card Marketing Customer Survey, CS-10-251. AGENCY: Internal Revenue Service (IRS), Treasury..., the IRS is soliciting comments concerning Prepaid Card Marketing Customer Survey, CS-10-251 DATES...
43 CFR 30.251 - What happens if an heir or devisee participates in the killing of the decedent?
2010-10-01
... participates in the killing of the decedent? 30.251 Section 30.251 Public Lands: Interior Office of the... if an heir or devisee participates in the killing of the decedent? Any person who knowingly participates, either as a principal or as an accessory before the fact, in the willful and unlawful killing of...
Toda, Yuki; Takata, Kazuyuki; Nakagawa, Yuko; Kawakami, Hikaru; Fujioka, Shusuke; Kobayashi, Kazuya; Hattori, Yasunao; Kitamura, Yoshihisa; Akaji, Kenichi; Ashihara, Eishi
2015-01-16
Exosomes, the natural vehicles of various biological molecules, have been examined in several research fields including drug delivery. Although understanding of the biological functions of exosomes has increased, how exosomes are transported between cells remains unclear. We hypothesized that cell tropism is important for effective exosomal intercellular communication and that parental cells regulate exosome movement by modulating constituent exosomal molecules. Herein, we demonstrated the strong translocation of glioblastoma-derived exosomes (U251exo) into their parental (U251) cells, breast cancer (MDA-MB-231) cells, and fibrosarcoma (HT-1080). Furthermore, disruption of proteins of U251exo by enzymatic treatment did not affect their uptake. Therefore, we focused on lipid molecules of U251exo with the expectation that they are crucial for effective incorporation of U251exo by cancer cells. Phosphatidylethanolamine was identified as a unique lipid component of U251-MG cell-derived extracellular vesicles. From these results, valuable insight is provided into the targeting of U251exo to cancer cells, which will help to develop a cancer-targeted drug delivery system. Copyright © 2014 Elsevier Inc. All rights reserved.
Pan, Hao; Wang, Handong; Jia, Yue; Wang, Qiang; Li, Liwen; Wu, Qi; Chen, Longbang
2017-07-01
Chemoresistance is the primary obstacle to effective treatment of glioblastoma, the most lethal brain tumor. Our previous study demonstrated that Nf-E2 related factor 2 (Nrf2), a traditional cytoprotective transcription factor, was overexpressed in gliomas and promoted malignancy. The present study aimed to investigate the expression levels of Nrf2‑antioxidant response element (ARE) signaling pathway genes in temozolomide (TMZ)‑resistant U251 human glioblastoma cells (U251‑TMZ). Additionally, the effect of valproic acid (VPA) and melatonin (MEL) on Nrf2 expression in U251‑TMZ cells and their association with chemoresistance was investigated. The results of the present study indicated that the expression levels of components of the Nrf2‑ARE signaling pathway were increased in U251‑TMZ cells compared with U251 parent cells. Silencing of Nrf2 by transfection with small interfering RNA restored the chemosensitivity of U251‑TMZ cells. The Nrf2 inhibitors VPA and MEL successfully reduced Nrf2 expression and survival in U251‑TMZ cells treated with TMZ, accompanied by increased reactive oxygen species levels and apoptosis. Therefore, VPA and MEL may be potential chemotherapeutic sensitizers for the treatment of chemoresistant glioblastoma.
Study of the 249-251Cf + 48Ca reactions: recent results and outlook
Voinov, A. A.; Oganessian, Yu Ts; Abdullin, F. Sh; Brewer, N. T.; Dmitriev, S. N.; Grzywacz, R. K.; Hamilton, J. H.; Itkis, M. G.; Miernik, K.; Polyakov, A. N.; Roberto, J. B.; Rykaczewski, K. P.; Sabelnikov, A. V.; Sagaidak, R. N.; Shirokovsky, I. V.; Shumeiko, M. V.; Stoyer, M. A.; Subbotin, V. G.; Sukhov, A. M.; Tsyganov, Yu S.; Utyonkov, V. K.; Vostokin, G. K.
2018-02-01
Experiment aiming at the synthesis of heavy isotopes of Z=118 (Og) using beam of 48Ca and a target of 249-251Cf was undertaken in October 2015 - April 2016 employing the Dubna Gas-Filled Recoil Separator (FLNR JINR). The target of mixed isotopes of 249-251Cf (50.7% of 249Cf, 12.9% of 250Cf, and 36.4% of 251Cf) was irradiated by 48Ca ions at two beam energies of 252 and 258 MeV with the corresponding accumulated beam doses of 1.6×1019 and 1.1×1019. A single event observed at lower beam energy was assigned to the isotope 294Og, the product of the reaction 249Cf(48Ca, 3n); its decay pattern and the observed radioactive properties of the nuclides in the decay chain reproduce in full those observed for 294Og in our earlier experiments of 2002-2005 and 2012. At higher beam energy we observed no decay chains that could be attributed to the isotopes of Og. The possibility of renewal of this experiment in the future is discussed.
Identification of two novel mammographic density loci at 6Q25.1.
Brand, Judith S; Li, Jingmei; Humphreys, Keith; Karlsson, Robert; Eriksson, Mikael; Ivansson, Emma; Hall, Per; Czene, Kamila
2015-06-03
Mammographic density (MD) is a strong heritable and intermediate phenotype for breast cancer, but much of its genetic variation remains unexplained. We performed a large-scale genetic association study including 8,419 women of European ancestry to identify MD loci. Participants of three Swedish studies were genotyped on a custom Illumina iSelect genotyping array and percent and absolute mammographic density were ascertained using semiautomated and fully automated methods from film and digital mammograms. Linear regression analysis was used to test for SNP-MD associations, adjusting for age, body mass index, menopausal status and six principal components. Meta-analyses were performed by combining P values taking sample size, study-specific inflation factor and direction of effect into account. Genome-wide significant associations were observed for two previously identified loci: ZNF365 (rs10995194, P = 2.3 × 10(-8) for percent MD and P = 8.7 × 10(-9) for absolute MD) and AREG (rs10034692, P = 6.7 × 10(-9) for absolute MD). In addition, we found evidence of association for two variants at 6q25.1, both of which are known breast cancer susceptibility loci: rs9485370 in the TAB2 gene (P = 4.8 × 10(-9) for percent MD and P = 2.5 × 10(-8) for absolute MD) and rs60705924 in the CCDC170/ESR1 region (P = 2.2 × 10(-8) for absolute MD). Both regions have been implicated in estrogen receptor signaling with TAB2 being a potential regulator of tamoxifen response. We identified two novel MD loci at 6q25.1. These findings underscore the importance of 6q25.1 as a susceptibility region and provide more insight into the mechanisms through which MD influences breast cancer risk.
Joint Institute for Nuclear Research Data Analysis Guide - Berkelium Edition
International Nuclear Information System (INIS)
Henderson, R.A.
2009-01-01
This is a data analysis guide to the JINR system developed by Roger Henderson. It is intended as a complete guide to the data format and the calibration parameters utilized for the analysis of the data. This guide will provide the basic structure of the data files, the description of the individual data items, and the basic equations developed for the calculation of the results. Currently (7/17/2009), calculation of the calibration parameters is not a covered topic. It is intended that this will be covered in a future update
Chelation and stabilization of berkelium in oxidation state +IV
Czech Academy of Sciences Publication Activity Database
Deblonde, G. J.-P.; Sturzbecher-Hoehne, M.; Rupert, P. B.; An, D. D.; Illy, M.-C.; Ralston, C. Y.; Brabec, Jiří; de Jong, W. A.; Strong, R. K.; Abergel, R. J.
2017-01-01
Roč. 9, č. 9 (2017), s. 843-849 ISSN 1755-4330 Institutional support: RVO:61388955 Keywords : bioorganic chemistry * chemical bonding * mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 25.870, year: 2016
Yu, Min; Tan, De-Yong; Qian, Wei; Lai, Jian-Hua; Sun, Gui-Lin
2004-05-01
U251 cell is a sensitive cell line to serum, which stops at G0 phase of cell cycle in no-serum medium, and recovers growth when the serum is added into no-serum medium. The cell can express corresponding proteins in different phase of cell cycle. Therefore it is very signification for the study of cell cycle regulation mechanism that explores these proteins. In this paper, the mouse antibody phage display library was added into the bottle in which the serum starvation U251 cells had been cultured, and the special antibody phages were absorbed. Then the absorbed antibody phages were amplified by adding E. coli TG1 and helper phage M13K07. Amplified antibody phages were added into bottle in which the serum cultured cell after serum starvation (follow named as serum recovered cells) were incubated, so that the cell absorbed the no-special antibody phages for the serum starvation cell and the special antibody phages were in supernatant. The remaining no-special antibody phages in the supernatant were discarded by repeating above program 3-4 times. The pure special antibody phages were gotten, and amplified by adding the host cell E. coli TG1 and helper phage M13K07. Then the host bacterium infected special antibody phage was spread on the plate medium with ampicillin, and the monoclonal antibody phages were gotten. Using same as above program, the monoclonal antibody phages absorbed specially for serum recovered U251 cells were obtained when the serum recovered cells instead of serum starvation cells and serum starvation cells instead of serum recovered cells. In this study, ninety-six positive monoclonal antibody phages that absorbed specially the serum starvation cells and eighty-two positive monoclonal antibody phages that absorbed specially the serum recovered cells were obtained. By using cell immunochemistry assay, two special signification antibodies were obtained. one (No.11) was the strong response in serum starvation cells, the other (No.2) was the strong
Ratano, Patrizia; Everitt, Barry J; Milton, Amy L
2014-10-01
We have investigated the requirement for signaling at CB1 receptors in the reconsolidation of a previously consolidated auditory fear memory, by infusing the CB1 receptor antagonist AM251, or the FAAH inhibitor URB597, directly into the basolateral amygdala (BLA) in conjunction with memory reactivation. AM251 disrupted memory restabilization, but only when administered after reactivation. URB597 produced a small, transient enhancement of memory restabilization when administered after reactivation. The amnestic effect of AM251 was rescued by coadministration of the GABAA receptor antagonist bicuculline at reactivation, indicating that the disruption of reconsolidation was mediated by altered GABAergic transmission in the BLA. These data show that the endocannabinoid system in the BLA is an important modulator of fear memory reconsolidation and that its effects on memory are mediated by an interaction with the GABAergic system. Thus, targeting the endocannabinoid system may have therapeutic potential to reduce the impact of maladaptive memories in neuropsychiatric disorders such as posttraumatic stress disorder.
Evaluation of potential regulatory function of breast cancer risk locus at 6q25.1.
Sun, Yaqiong; Ye, Chuanzhong; Guo, Xingyi; Wen, Wanqing; Long, Jirong; Gao, Yu-Tang; Shu, Xiao Ou; Zheng, Wei; Cai, Qiuyin
2016-02-01
In a genome-wide association study conducted among Chinese women, we identified the single nucleotide polymorphism (SNP) rs2046210 at 6q25.1 for breast cancer risk. To explore a potential regulatory role for this risk locus, we measured expression levels of nine genes at the locus in breast cancer tissue and adjacent normal tissue samples obtained from 67 patients recruited in the Shanghai Breast Cancer Study. We found that rs2046210 had a statistically significant association with the expression levels of the AKAP12 and ESR1 genes in adjacent normal breast tissues. Women who carry the AA/AG risk genotypes had higher expressions of these two genes compared to those who carry G/G genotypes (P = 0.02 and 0.04 for the AKAP12 and ESR1, respectively). However, no significant differences of SNP rs2046210 with gene expression levels were found in tumor tissues. In The Cancer Genome Atlas samples, the AA/AG risk genotypes of SNP rs2046210 were associated with a significantly higher expression level of the AKAP12 gene and a lower level of the ESR1 gene in tumor tissue. Functional analysis using ENCODE data revealed that SNP rs7763637, which is in strong linkage disequilibrium with SNP rs2046210, is likely a potential functional variant, regulating the AKAP12 gene. Taken together, these results from our study suggest that the association between the 6q25.1 locus and breast cancer risk may be mediated through SNPs that regulate expressions of the AKAP12 gene. © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
2010-10-01
... Fleet Management System (IFMS) vehicles and related services. As prescribed in 251.205, use the following clause: Use of Interagency Fleet Management System (IFMS) Vehicles and Related Services (DEC 1991... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Use of Interagency Fleet...
2010-07-01
... Region, what planning information must accompany the DPP? 250.251 Section 250.251 Mineral Resources... Region, what planning information must accompany the DPP? If you propose development and production activities in the Alaska OCS Region, the following planning information must accompany your DPP: (a...
Newcastle disease virus triggers autophagy in U251 glioma cells to enhance virus replication.
Meng, Chunchun; Zhou, Zhizhi; Jiang, Ke; Yu, Shengqing; Jia, Lijun; Wu, Yantao; Liu, Yanqing; Meng, Songshu; Ding, Chan
2012-06-01
Newcastle disease virus (NDV) can replicate in tumor cells and induce apoptosis in late stages of infection. However, the interaction between NDV and cells in early stages of infection is not well understood. Here, we report that, shortly after infection, NDV triggers the formation of autophagosomes in U251 glioma cells, as demonstrated by an increased number of double-membrane vesicles, GFP-microtubule-associated protein 1 light chain 3 (GFP-LC3) a dot formations, and elevated production of LC3II. Moreover, modulation of NDV-induced autophagy by rapamycin, chloroquine or small interfering RNAs targeting the genes critical for autophagosome formation (Atg5 and Beclin-1) affects virus production, indicating that autophagy may be utilized by NDV to facilitate its own production. Furthermore, the class III phosphatidylinositol 3-kinase (PI3K)/Beclin-1 pathway plays a role in NDV-induced autophagy and virus production. Collectively, our data provide a unique example of a paramyxovirus that uses autophagy to enhance its production.
Adjuvant-dependent innate and adaptive immune signatures of risk of SIVmac251 acquisition.
Vaccari, Monica; Gordon, Shari N; Fourati, Slim; Schifanella, Luca; Liyanage, Namal P M; Cameron, Mark; Keele, Brandon F; Shen, Xiaoying; Tomaras, Georgia D; Billings, Erik; Rao, Mangala; Chung, Amy W; Dowell, Karen G; Bailey-Kellogg, Chris; Brown, Eric P; Ackerman, Margaret E; Vargas-Inchaustegui, Diego A; Whitney, Stephen; Doster, Melvin N; Binello, Nicolo; Pegu, Poonam; Montefiori, David C; Foulds, Kathryn; Quinn, David S; Donaldson, Mitzi; Liang, Frank; Loré, Karin; Roederer, Mario; Koup, Richard A; McDermott, Adrian; Ma, Zhong-Min; Miller, Christopher J; Phan, Tran B; Forthal, Donald N; Blackburn, Matthew; Caccuri, Francesca; Bissa, Massimiliano; Ferrari, Guido; Kalyanaraman, Vaniambadi; Ferrari, Maria G; Thompson, DeVon; Robert-Guroff, Marjorie; Ratto-Kim, Silvia; Kim, Jerome H; Michael, Nelson L; Phogat, Sanjay; Barnett, Susan W; Tartaglia, Jim; Venzon, David; Stablein, Donald M; Alter, Galit; Sekaly, Rafick-Pierre; Franchini, Genoveffa
2016-07-01
A recombinant vaccine containing Aventis Pasteur's canarypox vector (ALVAC)-HIV and gp120 alum decreased the risk of HIV acquisition in the RV144 vaccine trial. The substitution of alum with the more immunogenic MF59 adjuvant is under consideration for the next efficacy human trial. We found here that an ALVAC-simian immunodeficiency virus (SIV) and gp120 alum (ALVAC-SIV + gp120) equivalent vaccine, but not an ALVAC-SIV + gp120 MF59 vaccine, was efficacious in delaying the onset of SIVmac251 in rhesus macaques, despite the higher immunogenicity of the latter adjuvant. Vaccine efficacy was associated with alum-induced, but not with MF59-induced, envelope (Env)-dependent mucosal innate lymphoid cells (ILCs) that produce interleukin (IL)-17, as well as with mucosal IgG to the gp120 variable region 2 (V2) and the expression of 12 genes, ten of which are part of the RAS pathway. The association between RAS activation and vaccine efficacy was also observed in an independent efficacious SIV-vaccine approach. Whether RAS activation, mucosal ILCs and antibodies to V2 are also important hallmarks of HIV-vaccine efficacy in humans will require further studies.
Spectroscopy of odd Z trans-fermium nuclei: the nuclear structure of Md251
International Nuclear Information System (INIS)
Chatillon, A.
2005-10-01
The objective of this thesis was to determine the structure of trans-fermium nuclei (Z 100) with odd proton number, which remained largely unexplored. These nuclei were produced in fusion-evaporation reactions with small cross sections below 1 μb. The experimental methods of Recoil-Tagging and Recoil-Decay-Tagging were used for their identification. In order to identify the active orbitals in this mass region, 255 Lr, 251 M1d and 247 Es nuclei have been studied by decay spectroscopy at the University of Jyvaskyla and at GANIL with the LISE spectrometer and the α-electron detector BEST coupled to four CLover detectors from the EXOGAM array. New states have been observed in each of the isotopes, and their configuration has been proposed. The collective properties were also studied in two experiments using prompt γ and electron spectroscopy, combining the JUROGAM and SACRED arrays, respectively, with the recoil separator RITU and the GREAT spectrometer at its focal plane. A rotational band has been observed for the first time in a proton-odd trans-fermium nucleus. The interpretation of this collective structure is based on the theoretical HFB calculations. (author)
Kiewnick, S; Sikora, R A
2004-01-01
The egg pathogenic fungus Paecilomyces lilacinus (strain 251) is a biocontrol fungus with a potential range of activity to control the worldwide most important plant parasitic nematodes. This biological nematicide may be an useful tool in an integrated approach to control mainly sedentary nematodes. Greenhouse experiments were conducted with the root-knot nematodes Meloidogyne incognita and M. hapla on tomato. P. lilacinus, formulated as WG (BIOACT WG), was incorporated into soil inoculated with root-knot nematode eggs prior to transplanting the susceptible tomato cultivar "Hellfrucht". Furthermore, soil treatments were combined with seedling treatments 24 hours before transplanting and a soil drench 2 weeks after planting, respectively. Seedling and post planting treatment was also combined with a soil treatment at planting. All single or combination treatments tested decreased the gall index and the number of egg masses compared to the untreated control 12 weeks after planting. However, the combination of the seedling treatment with a pre- or at-planting application of P. lilacinus was necessary to achieve higher levels of control. Additional post plant drenching resulted in only a slight increase In efficacy. To the feasibility of this modified application system for the control of root-knot nematodes, a yield experiment was conducted with M. hapla and the susceptible cultivar "Gnom F1 Hybrid". It could be demonstrated that the above mentioned combination of pre-planting application plus the seedling and one post plant drench gave the best control and resulted in a significant fruit yield increase in concurrence with a decrease in number of galls per root.
The spiral-compact galaxy pair AM 2208-251: Computer simulations versus observations
International Nuclear Information System (INIS)
Klaric, M.; Byrd, G.G.
1990-01-01
The system AM2208-251 is a roughly edge-on spiral extending east-west with a smaller round compact E system about 60 arcsec east of the spiral nucleus along the major axis of the spiral. Spectroscopic observations may indicate a tidal interaction in the system. In order to learn more about such pairs, the authors simulated the interaction using the computer model developed by Miller (1976 a,b, 1978) and modified by the authors (Byrd 1986, 1987, 1988). To do the simulation they need an idea of the mutual orbits of the two galaxies. Their computer model is a two-dimensional polar N-body program. It consists of a self-gravitating disk of particles, within an inert axially symmetric stabilizing halo potential. The particles are distributed in a 24(radial) by 36(azimuthal) polar grid. Self consistent calculations can be done only within the grid area. The disk is modeled with a finite Mestel disk, where all the particles initially move in circular orbits with constant tangential velocities (Mestel 1963), resulting in a flat rotation curve. The gas particles in the spiral's disk, which make up 30 percent of its mass, collide in the following manner. The number of particles in each bin of the polar grid is counted every time step. If it is greater than a given critical density, all the particles in the bin collide, obtaining in the result the same velocities, equal to the average for the bin. This process produces clumps of gas particles-the star formation sites. The authors suppress the collision in the inner part of the disk (within the circle r = 6) to represent the hole seen in the gas in the nuclear bulge of spirals. They thus avoid spurious effects due to collisions in that region
Cabotegravir long acting injection protects macaques against intravenous challenge with SIVmac251.
Andrews, Chasity D; Bernard, Leslie St; Poon, Amanda Yee; Mohri, Hiroshi; Gettie, Natanya; Spreen, William R; Gettie, Agegnehu; Russell-Lodrigue, Kasi; Blanchard, James; Hong, Zhi; Ho, David D; Markowitz, Martin
2017-02-20
We evaluated the effectiveness of cabotegravir (CAB; GSK1265744 or GSK744) long acting as preexposure prophylaxis (PrEP) against intravenous simian immunodeficiency virus (SIV) challenge in a model that mimics blood transfusions based on the per-act probability of infection. CAB long acting is an integrase strand transfer inhibitor formulated as a 200 mg/ml injectable nanoparticle suspension that is an effective PrEP agent against rectal and vaginal simian/human immunodeficiency virus transmission in macaques. Three groups of rhesus macaques (n = 8 per group) were injected intramuscularly with CAB long acting and challenged intravenously with 17 animal infectious dose 50% SIVmac251 on week 2. Group 1 was injected with 50 mg/kg on week 0 and 4 to evaluate the protective efficacy of the CAB long-acting dose used in macaque studies mimicking sexual transmission. Group 2 was injected with 50 mg/kg on week 0 to evaluate the necessity of the second injection of CAB long acting for protection against intravenous challenge. Group 3 was injected with 25 mg/kg on week 0 and 50 mg/kg on week 4 to correlate CAB plasma concentrations at the time of challenge with protection. Five additional macaques remained untreated as controls. CAB long acting was highly protective with 21 of the 24 CAB long-acting-treated macaques remaining aviremic, resulting in 88% protection. The plasma CAB concentration at the time of virus challenge appeared to be more important for protection than sustaining therapeutic plasma concentrations with the second CAB long acting injection. These results support the clinical investigation of CAB long acting as PrEP in people who inject drugs.
Stegger, M; Andersen, P S; Kearns, A; Pichon, B; Holmes, M A; Edwards, G; Laurent, F; Teale, C; Skov, R; Larsen, A R
2012-04-01
The recent finding of a new mecA homologue, mecA(LGA251) , with only 70% nucleotide homology to the conventional mecA gene has brought the routine testing for mecA as a confirmatory test for methicillin-resistant Staphylococcus aureus (MRSA) into question. A multiplex PCR was designed to differentiate mecA(LGA251) from the known mecA together with detection of lukF-PV and the spa gene fragments, enabling direct spa typing by sequencing of the PCR amplicons. The PCR analysis and subsequent spa typing were validated on a large collection (n=185) of contemporary MRSA and methicillin-sensitive S. aureus isolates, including 127 isolates carrying mecA(LGA251) . The mecA(LGA251) gene was situated in staphylococcal cassette chromosome mec type XI elements, and sequence variation within a 631-bp fragment of mecA(LGA251) in 79 isolates indicated a very conserved gene sequence. Following a successful validation, the multiplex PCR strategy was implemented in the routine testing of MRSA for national surveillance. Over a 2-month period, among 203 samples tested, 12 new MRSA cases caused by isolates carrying mecA(LGA251) were identified, emphasizing the clinical importance of testing for these new MRSA isolates. © 2011 STATENS SERUM INSTITUT. Clinical Microbiology and Infection © 2011 European Society of Clinical Microbiology and Infectious Diseases.
International Nuclear Information System (INIS)
Lan, Ruoxi; Makriyannis, Alexandros; Gatley, S.J.
1996-01-01
We report the synthesis and labeling with iodine-123 of N-(piperidin-1-yl)-5-(4-iodophenyl)-1-(2, 4-dichlorophenyl)-4-methyl-1H-pyrazole-3-carboxamide (AM251). This compound is an analog of the recently described cannabinoid receptor antagonist, SR141716A, in which a 4-chlorophenyl group is replaced by 4-iodophenyl. Labeling in good yield (62%) and radiochemical purity (> 95%), and high specific activity (> 2500 Ci/mmol) was achieved by an iododestannylation reaction using the tributyltin precursor, no carrier added I-123 iodide, and chloramine-T. (author)
Energy Technology Data Exchange (ETDEWEB)
Lan, Ruoxi; Makriyannis, Alexandros [Connecticut Univ., Molecular and Cell Biology Dept., Storrs, CT (United States); Gatley, S.J. [Brookhaven National Lab., Medical Dept., Upton, NY (United States)
1996-10-01
We report the synthesis and labeling with iodine-123 of N-(piperidin-1-yl)-5-(4-iodophenyl)-1-(2, 4-dichlorophenyl)-4-methyl-1H-pyrazole-3-carboxamide (AM251). This compound is an analog of the recently described cannabinoid receptor antagonist, SR141716A, in which a 4-chlorophenyl group is replaced by 4-iodophenyl. Labeling in good yield (62%) and radiochemical purity (> 95%), and high specific activity (> 2500 Ci/mmol) was achieved by an iododestannylation reaction using the tributyltin precursor, no carrier added I-123 iodide, and chloramine-T. (author).
Giné, Ariadna; Sorribas, Francisco J
2017-05-01
The effectiveness of combining resistant tomato with BioAct WG (Purpureocillium lilacinum strain 251, Pl251) against Meloidogyne incognita was assessed in a tomato-cucumber rotation in a greenhouse over 2 years. Additionally, the enzymatic activity of the fungus, the percentage of fungal egg and juvenile parasitism, cardinal temperatures and the effect of water potential on mycelial growth and the soil receptivity to Pl251 were determined in vitro. Plant resistance was the only factor that suppressed nematode and crop yield losses. Percentage of egg parasitism in plots treated with BioAct WG was less than 2.6%. However, under in vitro conditions, Pl251 showed protease, lipase and chitinase activities and parasitised 94.5% of eggs, but no juveniles. Cardinal temperatures were 14.2, 24-26 and 35.4 °C. The maximum Pl251 mycelial growth was at -0.25 MPa and 25 °C. Soil temperatures and water potential in the greenhouse were in the range of the fungus. However, soil receptivity was lower in greenhouse soil, irrespective of sterilisation, than in sterilised sand. Plant resistance was the only factor able to suppress nematode densities, disease severity and yield losses, and to protect the following cucumber crop. Environmental factors involved in soil receptivity could have negatively affected fungus effectiveness. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.
International Nuclear Information System (INIS)
Pichlmayer, F.
1986-06-01
For carbon isotope investigations with a moderate precision demand of about 0.2 per mil in the isotope ratio fast and reliable results are attained by on line combination of the ANA 1500 Elemental Analyzer and the MAT 251 Isotope Mass Spectrometer. The crucial point hereof is the gas splitting device. By proper design and adjustment of the analytical parameters, good sample efficiency and a sharp CO 2 bulk within the He stream is reached. The main characteristics of this combined equipment are described and some isotopic results of organic and anorganic carbon in lake sediment-samples are given as well as deltasup1 3 C-analyses of spiritous liquors. (Author)
International Nuclear Information System (INIS)
Lee, Hyung Chahn; Park, In Chul; Park, Myung Jin; Woo, Sang Hyeok; Rhee, Chang Hum; Hong, Seok-II
2004-01-01
To investigate the radioresistant mechanism in glioblastoma multiforme(GBM), we isolated the radioresistant clone (RRC) from U251 human glioblastoma cell line by exposing to repeated fractions of 3 Gy γ-radiation for six months. RRC had higher radioresistance than the parent cell line as measured by clonogenic survival assay. FACS analysis showed that RRC had a delayed G2 arrest after radiation. Antioxidant enzymes, such as SOD, catalase, glutathione peroxidase (GPX), glutathione reductase (GR), were activated up to 5 folds in RRC after radiation. Erk 1/2 activation was higher in RRC than in the parent cell. Therefore, radioresistancy in RRC might be due to the delayed cell cycle, the coordinated high activation of antioxidant enzyme rather than a single enzyme alone,and higher activation of Erk 1/2
Low dose radiation enhance the anti-tumor effect of high dose radiation on human glioma cell U251
International Nuclear Information System (INIS)
Wang Chang; Wang Guanjun; Tan Yehui; Jiang Hongyu; Li Wei
2008-01-01
Objective: To detect the effect on the growth of human glioma cell U251 induced by low dose irradiation and low dose irradiation combined with large dose irradiation. Methods: Human glioma cell line U251 and nude mice carried with human glioma were used. The tumor cells and the mice were treated with low dose, high dose, and low dose combined high dose radiation. Cells growth curve, MTT and flow cytometry were used to detect the proliferation, cell cycle and apoptosis of the cells; and the tumor inhibition rate was used to assess the growth of tumor in vivo. Results: After low dose irradiation, there was no difference between experimental group and control group in cell count, MTT and flow cytometry. Single high dose group and low dose combined high dose group both show significantly the suppressing effect on tumor cells, the apoptosis increased and there was cell cycle blocked in G 2 period, but there was no difference between two groups. In vivo apparent anti-tumor effect in high dose radiation group and the combining group was observed, and that was more significant in the combining group; the prior low dose radiation alleviated the injury of hematological system. There was no difference between single low dose radiation group and control. Conclusions: There is no significant effect on human glioma cell induced by low dose radiation, and low dose radiation could not induce adaptive response. But in vivo experience, low dose radiation could enhance the anti-tumor effect of high dose radiation and alleviated the injury of hematological system. (authors)
International Nuclear Information System (INIS)
Levitt, Randy J.; Georgescu, Maria-Magdalena; Pollak, Michael
2005-01-01
PTEN is a tumor suppressor gene whose loss of function is observed in ∼40-50% of human cancers. Although insulin-like growth factor binding protein-2 (IGFBP-2) was classically described as a growth inhibitor, multiple recent reports have shown an association of overexpression and/or high serum levels of IGFBP-2 with poor prognosis of several malignancies, including gliomas. Using an inducible PTEN expression system in the PTEN-null glioma cell line U251, we demonstrate that PTEN-induction is associated with reduced proliferation, increased apoptosis, and a substantial reduction of the high levels of IGFBP-2 expression. The PTEN-induced decrease in IGFBP-2 expression could be mimicked with the PI3-kinase inhibitor LY294002, indicating that the lipid phosphatase activity of PTEN is responsible for the observed effect. However, the rapamycin analog CCI-779 did not affect IGFBP-2 expression, suggesting that the PTEN-induced decrease in IGFBP-2 expression is not attributable to decreased mTOR signalling. Recombinant human IGFBP-2 was unable to rescue U251-PTEN cells from the antiproliferative effects of PTEN, and IGFBP-2 siRNA did not affect the IGF-dependent or -independent growth of this cell line. These results suggest that the clinical data linking IGFBP-2 expression to poor prognosis may arise, at least in part, because high levels of IGFBP-2 expression correlate with loss of function of PTEN, which is well known to lead to aggressive behavior of gliomas. Our results motivate translational research regarding the relationship between IGFBP-2 expression and loss of function of PTEN
Gunasekeran, Dinesh V; Agrawal, Rupesh; Agarwal, Aniruddha; Carreño, Ester; Raje, Dhananjay; Aggarwal, Kanika; Kon, Onn M; Nguyen, Quan Dong; Pavesio, Carlos; Gupta, Vishali
2018-04-24
Tubercular retinal vasculitis (TRV) is a heterogeneous disease that can be difficult to manage because of nonspecific presentation and limitations of confirmatory tests for tuberculosis. This is a big data analysis on phenotypes and treatment outcomes for TRV. Multicentre retrospective study of patients with TRV between January 2004 and December 2014 and a minimum follow-up of 1 year. Two hundred and fifty-one patients with TRV with a mean age of 38.9 ± 14.4 years (range, 9-86 years) were included. The patients were predominantly males (n = 167/251; 66.5%) of Asian ethnicity (n = 174/246; 70.7%), and geographical origin (n = 137/251; 54.6%). Most patients had features of occlusive type of RV (n = 113/185; 61.1%) except Caucasians (n = 11; 28.2%). There was no significant difference in treatment failure whether patients received antitubercular therapy (ATT) (P = 0.29), although treatment failure was less frequent in patients who received ATT (13.6%; n = 31/228) compared with those who did not (21.7%, n = 5/23). Less treatment failures were observed in patients with occlusive type RV who received ATT; however, this was not significant on survival analysis (P = 0.09). Treatment with ATT was associated with higher failure rates in patients of Hispanic and African American race and those with TRV associated with panuveitis (compared with posterior uveitis). In this multinational study of TRV, there was no significant therapeutic effect of ATT. However, a definitive conclusion about the role of ATT could not be made because of a few patients who did not receive ATT. Because this is a retrospective study with a limited 1-year follow-up, the effect of ATT may have been overestimated (or underestimated) in the duration of follow-up.
DEFF Research Database (Denmark)
Antoniou, Antonis C; Kartsonaki, Christiana; Sinilnikova, Olga M
2011-01-01
Two single nucleotide polymorphisms (SNPs) at 6q25.1, near the ESR1 gene, have been implicated in the susceptibility to breast cancer for Asian (rs2046210) and European women (rs9397435). A genome-wide association study in Europeans identified two further breast cancer susceptibility variants: rs...
DEFF Research Database (Denmark)
Antoniou, Antonis C; Kartsonaki, Christiana; Sinilnikova, Olga M
2011-01-01
Two single nucleotide polymorphisms (SNPs) at 6q25.1, near the ESR1 gene, have been implicated in the susceptibility to breast cancer for Asian (rs2046210) and European women (rs9397435). A genome-wide association study in Europeans identified two further breast cancer susceptibility variants: rs...... to a better understanding of the biology of tumour development in these women....
A.C. Antoniou (Antonis); C. Kartsonaki (Christiana); O. Sinilnikova (Olga); P. Soucy (Penny); L. McGuffog (Lesley); S. Healey (Sue); A. Lee (Andrew); P. Peterlongo (Paolo); S. Manoukian (Siranoush); B. Peissel (Bernard); D. Zaffaroni (D.); E. Cattaneo (Elisa); M. Barile (Monica); V. Pensotti (Valeria); B. Pasini (Barbara); R. Dolcetti (Riccardo); G. Giannini (Giuseppe); A.L. Putignano; L. Varesco (Liliana); P. Radice (Paolo); P.L. Mai (Phuong); M.H. Greene (Mark); I.L. Andrulis (Irene); G. Glendon (Gord); H. Ozcelik (Hilmi); M. Thomassen (Mads); A-M. Gerdes (Anne-Marie); T.A. Kruse (Torben); U.B. Jensen; D. Cruger (Dorthe); M.A. Caligo (Maria); Y. Laitman (Yael); R. Milgrom (Roni); B. Kaufman (Bella); S. Paluch-Shimon (Shani); E. Friedman (Eitan); N. Loman (Niklas); K. Harbst (Katja); A. Lindblom (Annika); B. Melin (Beatrice); K.L. Nathanson (Katherine); S.M. Domchek (Susan); R. Rebbeck (Timothy); A. Jakubowska (Anna); J. Lubinski (Jan); J. Gronwald (Jacek); T. Huzarski (Tomasz); T. Byrski (Tomasz); C. Cybulski (Cezary); B. Górski (Bohdan); A. Osorio (Ana); T.R. Cajal; F. Fostira (Florentia); R. Andres (Raquel); J. Benitez (Javier); U. Hamann (Ute); F.B.L. Hogervorst (Frans); M.A. Rookus (Matti); M.J. Hooning (Maartje); M.R. Nelen (Marcel); R.B. van der Luijt (Rob); T.A.M. van Os (Theo); C.J. van Asperen (Christi); P. Devilee (Peter); H. Meijers-Heijboer (Hanne); E.B.G. Garcia; S. Peock (Susan); M. Cook (Margaret); D. Frost; R. Platte (Radka); J. Leyland (Jean); D.G. Evans (Gareth); F. Lalloo (Fiona); R. Eeles (Rosalind); L. Izatt (Louise); R. Davidson (Rosemarie); D. Eccles (Diana); K.-R. Ong; F. Douglas (Fiona); J. Paterson (Joan); M.J. Kennedy (John); Z. Miedzybrodzka (Zosia); A.K. Godwin (Andrew); D. Stoppa-Lyonnet (Dominique); B. Buecher (Bruno); M. Belotti (Muriel); C. Tirapo (Carole); S. Mazoyer (Sylvie); L. Barjhoux (Laure); C. Lasset (Christine); D. Leroux (Dominique); L. Faivre (Laurence); M. Bronner (Myriam); F. Prieur (Fabienne); C. Nogues (Catherine); E. Rouleau (Etienne); P. Pujol (Pascal); I. Coupier (Isabelle); M. Frenay (Marc); J. Hopper (John); M.J. Daly (Mark); M-B. Terry (Mary-beth); E.M. John (Esther); S.S. Buys (Saundra); Y. Yassin (Yosuf); A. Miron (Alexander); D. Goldgar (David); C.F. Singer (Christian); M.-K. Tea; G. Pfeiler (Georg); C. Dressler (Catherina); T.V.O. Hansen (Thomas); L. Jønson (Lars); B. Ejlertsen (Bent); R.B. Barkardottir (Rosa); T. Kircchoff (Tomas); K. Offit (Kenneth); M. Piedmonte (Marion); G.C. Rodriguez (Gustavo); L. Small (Laurie); J.F. Boggess (John); S.V. Blank (Stephanie); J. Basil (Jack); M. Azodi (Masoud); A.E. Toland (Amanda); M. Montagna (Marco); S. Tognazzo (Silvia); S. Agata (Simona); E.N. Imyanitov (Evgeny); R. Janavicius (Ramunas); C. Lazaro (Conxi); I. Blanco (Ignacio); P.D.P. Pharoah (Paul); L. Sucheston (Lara); B.Y. Karlan (Beth); C.S. Walsh (Christine); E. Olah (Edith); A. Bozsik (Aniko); S.-H. Teo (Soo-Hwang); J.L. Seldon (Joyce); M.S. Beattie (Mary); E.J. van Rensburg (Elizabeth); M.D. Sluiter (Michelle); O. Diez (Orland); R.K. Schmutzler (Rita); B. Wapenschmidt (Barbara); C. Engel (Christoph); A. Meindl (Alfons); I. Ruehl (Ina); R. Varon-Mateeva (Raymonda); K. Kast (Karin); H. Deissler (Helmut); D. Niederacher (Dieter); N. Arnold (Norbert); D. Gadzicki (Dorothea); I. Schönbuchner (Ines); T. Caldes (Trinidad); M. de La Hoya (Miguel); H. Nevanlinna (Heli); K. Aittomäki (Kristiina); M. Dumont (Martine); J. Chiquette (Jocelyne); M. Tischkowitz (Marc); G. Chenevix-Trench (Georgia); J. Beesley (Jonathan); A.B. Spurdle (Amanda); S.L. Neuhausen (Susan); Y.C. Ding (Yuan); Z. Fredericksen (Zachary); X. Wang (Xing); V.S. Pankratz (Shane); F.J. Couch (Fergus); J. Simard (Jacques); D.F. Easton (Douglas); G. Chenevix-Trench (Georgia); P. Karlsson (Per); M. Nordling (Margareta); A. Bergman (Annika); Z. Einbeigi (Zakaria); M. Stenmark-Askmalm (M.); S. Liedgren (Sigrun); Å. Borg (Åke); H. Olsson (Hans); U. Kristoffersson (Ulf); H. Jernström (H.); K. Henriksson (Karin); A. von Wachenfeldt (Anna); A. Liljegren (Annelie); G. Barbany-Bustinza (Gisela); J. Rantala (Johanna); H. Grönberg (Henrik); E.-L. Stattin; M. Emanuelsson (Monica); R.R. Brandell; N. Dahl (Niklas); S. Verhoef; M. Verheus (Martijn); L.J. van 't Veer (Laura); F.E. van Leeuwen; J.M. Collée (Margriet); A.M.W. van den Ouweland (Ans); A. Jager (Agnes); M.M.A. Tilanus-Linthorst (Madeleine); C.M. Seynaeve (Caroline); J.T. Wijnen (Juul); M.P. Vreeswijk (Maaike); R.A.E.M. Tollenaar (Rob); M.J. Ligtenberg (Marjolijn); N. Hoogerbrugge (Nicoline); M.G.E.M. Ausems (Margreet); C.M. Aalfs (Cora); J.J.P. Gille (Jan); Q. Waisfisz (Quinten); E.B. Gómez García (Encarna); C.E. van Roozendaal (Cees); M.J. Blok (Marinus); B. Caanen; J.C. Oosterwijk; A.H. van der Hout (Annemarie); M.J. Mourits; H.F. Vasen (Hans); H. Gregory (Helen); P.J. Morrison (Patrick); L. Jeffers (Lisa); T.J. Cole (Trevor); C. McKeown (Carole); J. Hoffman (Jonathan); A. Donaldson (Alan); S. Downing (Sarah); A. Taylor (Amy); A. Murray (Alexandra); M.T. Rogers (Mark); E. McCann (Emma); M.E. Porteous (Mary); S. Drummond (Sarah); C. Brewer (Carole); E. Kivuva (Emma); A. Searle (Anne); S. Goodman (Selina); K. Hill (Kathryn); V. Murday (Victoria); N. Bradshaw (Nicola); L. Snadden (Lesley); M. Longmuir (Mark); C. Watt (Catherine); S. Gibson (Sarah); E. Haque (Eshika); E. Tobias (Ed); A. Duncan (Alexis); C. Jacobs (Chris); C. Langman (Caroline); A. Whaite (Anna); H. Dorkins (Huw); J. Barwell (Julian); C. Chu (Chengbin); J. Miller (Julie); I.O. Ellis (Ian); C. Houghton (Catherine); L. Side (Lucy); A. Male (Alison); C. Berlin (Cheryl); J. Eason (Jacqueline); R. Collier (Rebecca); O. Claber (Oonagh); I. Jobson (Irene); L.J. Walker (Lisa); D. McLeod (Diane); D. Halliday (Dorothy); S. Durell (Sarah); B. Stayner (Barbara); S. Shanley (Susan); N. Rahman (Nazneen); R. Houlston (Richard); E.K. Bancroft (Elizabeth); L. D'Mello (Lucia); E. Page (Elizabeth); A. Ardern-Jones (Audrey); K. Kohut (Kelly); J. Wiggins (Jennifer); E. Castro (Elena); A. Mitra (Anita); L. Robertson (Lisa); O. Quarrell (Oliver); C. Bardsley (Cathryn); H. Ehrencrona (Hans); S.V. Hodgson (Shirley); D.E. Barton (David); S. Goff (Sheila); G. Brice (Glen); L. Winchester (Lizzie); C. Eddy (Charlotte); V. Tripathi (Vishakha); V. Attard (Virginia); A. Lucassen (Anneke); G. Crawford (Gillian); D. McBride (Donna); S. Smalley (Sarah); J.W. Adlard (Julian); B. Arver (Brita Wasteson)
2011-01-01
textabstractTwo single nucleotide polymorphisms (SNPs) at 6q25.1, near the ESR1 gene, have been implicated in the susceptibility to breast cancer for Asian (rs2046210) and European women (rs9397435). A genome-wide association study in Europeans identified two further breast cancer susceptibility
Antoniou, Antonis C.; Kartsonaki, Christiana; Sinilnikova, Olga M.; Soucy, Penny; McGuffog, Lesley; Healey, Sue; Lee, Andrew; Peterlongo, Paolo; Manoukian, Siranoush; Peissel, Bernard; Zaffaroni, Daniela; Cattaneo, Elisa; Barile, Monica; Pensotti, Valeria; Pasini, Barbara; Dolcetti, Riccardo; Giannini, Giuseppe; Putignano, Anna Laura; Varesco, Liliana; Radice, Paolo; Mai, Phuong L.; Greene, Mark H.; Andrulis, Irene L.; Glendon, Gord; Ozcelik, Hilmi; Thomassen, Mads; Gerdes, Anne-Marie; Kruse, Torben A.; Birk Jensen, Uffe; Crüger, Dorthe G.; Caligo, Maria A.; Laitman, Yael; Milgrom, Roni; Kaufman, Bella; Paluch-Shimon, Shani; Friedman, Eitan; Loman, Niklas; Harbst, Katja; Lindblom, Annika; Arver, Brita; Ehrencrona, Hans; Melin, Beatrice; Nathanson, Katherine L.; Domchek, Susan M.; Rebbeck, Timothy; Jakubowska, Ania; Lubinski, Jan; van Os, Theo A. M.; Meijers-Heijboer, Hanne E. J.; Aalfs, C. M.
2011-01-01
Two single nucleotide polymorphisms (SNPs) at 6q25.1, near the ESR1 gene, have been implicated in the susceptibility to breast cancer for Asian (rs2046210) and European women (rs9397435). A genome-wide association study in Europeans identified two further breast cancer susceptibility variants:
Vandendriessche, Thomas; Abdel-Mottaleb, Yousra; Maertens, Chantal; Cuypers, Eva; Sudau, Alexander; Nubbemeyer, Udo; Mebs, Dietrich; Tytgat, Jan
2008-03-01
Certain amphibians provide themselves with a chemical defense by accumulating lipophilic alkaloids into skin glands from dietary arthropods. Examples of such alkaloids are pumiliotoxins (PTXs). In general, PTXs are known as positive modulators of voltage-gated sodium channels (VGSCs). Unlike other PTXs, PTX 251D does not share this characteristic. However, mice and insect studies showed that PTX 251D is highly toxic and to date the basis of its toxicity remains unknown. In this work, we searched for the possible target of PTX 251D. The toxin was therefore made synthetically and tested on four VGSCs (mammalian rNa(v)1.2/beta(1), rNa(v)1.4/beta(1), hNa(v)1.5/beta(1) and insect Para/tipE) and five voltage-gated potassium channels (VGPCs) (mammalian rK(v)1.1-1.2, hK(v)1.3, hK(v)11.1 (hERG) and insect Shaker IR) expressed heterologously in Xenopus laevis oocytes, using the two-electrode voltage clamp technique. PTX 251D not only inhibited the Na(+) influx through the mammalian VGSCs but also affected the steady-state activation and inactivation. Interestingly, in the insect ortholog, the inactivation process was dramatically affected. Additionally, PTX 251D inhibited the K(+) efflux through all five tested VGPCs and slowed down the deactivation kinetics of the mammalian VGPCs. hK(v)1.3 was the most sensitive channel, with an IC(50) value 10.8+/-0.5 microM. To the best of our knowledge this is the first report of a PTX affecting VGPCs.
Strale, Pierre-Olivier; Clarhaut, Jonathan; Lamiche, Coralie; Cronier, Laurent; Mesnil, Marc; Defamie, Norah
2012-11-01
Glioblastoma cells are characterized by high proliferation and invasive capacities. Tumor development has been associated with a decrease of gap-junctional intercellular communication, but the concrete involvement of gap junction proteins, connexins, remains elusive since they are also suspected to promote cell invasion. In order to better understand how connexins control the glioma cell phenotype, we studied the consequences of inhibiting the intrinsic expression of the major astrocytic connexin, Connexin43, in human U251 glioblastoma cells by the shRNA strategy. The induced down-regulation of Cx43 expression has various effects on the U251 cells such as increased clonogenicity, angiogenesis and decreased adhesion on specific extracellular matrix proteins. We demonstrate that the invasion capacity measured in vitro and ex vivo correlates with Cx43 expression level. For the first time in a cancer cell context, our work demonstrates that Cx43 cofractionates, colocalizes and coimmunoprecipitates with a lipid raft marker, caveolin-1 and that this interaction is inversely correlated to the level of Cx43. This localization of Cx43 in these lipid raft microdomains regulates both homo- and heterocellular gap junctional communications (respectively between U251 cells, or between U251 cells and astrocytes). Moreover, the adhesive and invasive capacities are not dependent, in our model, on Cav-1 expression level. Our results tend to show that heterocellular gap junctional communication between cancer and stroma cells may affect the behavior of the tumor cells. Altogether, our data demonstrate that Cx43 controls the tumor phenotype of glioblastoma U251 cells and in particular, invasion capacity, through its localization in lipid rafts containing Cav-1. Copyright © 2011 Wiley Periodicals, Inc.
Energy Technology Data Exchange (ETDEWEB)
Chatillon, A
2005-10-01
The objective of this thesis was to determine the structure of trans-fermium nuclei (Z 100) with odd proton number, which remained largely unexplored. These nuclei were produced in fusion-evaporation reactions with small cross sections below 1 {mu}b. The experimental methods of Recoil-Tagging and Recoil-Decay-Tagging were used for their identification. In order to identify the active orbitals in this mass region, {sup 255}Lr, {sup 251}M1d and {sup 247}Es nuclei have been studied by decay spectroscopy at the University of Jyvaskyla and at GANIL with the LISE spectrometer and the {alpha}-electron detector BEST coupled to four CLover detectors from the EXOGAM array. New states have been observed in each of the isotopes, and their configuration has been proposed. The collective properties were also studied in two experiments using prompt {gamma} and electron spectroscopy, combining the JUROGAM and SACRED arrays, respectively, with the recoil separator RITU and the GREAT spectrometer at its focal plane. A rotational band has been observed for the first time in a proton-odd trans-fermium nucleus. The interpretation of this collective structure is based on the theoretical HFB calculations. (author)
Crowe, C A M; Ravenhill, P J; Hepburn, R J; Shepherd, C H
2008-09-01
Historically, artificial insemination (AI) using frozen semen has been perceived to have poorer success rates and be more labour intensive than using chilled semen. A retrospective study was therefore conducted to compare the conception rate achieved by AI between chilled and frozen semen, using fixed time insemination protocols over 2 breeding seasons. Artificial insemination using chilled semen produces a higher conception rate than that achieved with frozen semen. Mares (n = 251) were inseminated with either chilled (n = 112) or frozen (n = 139) semen in the 2006 and 2007 northern hemisphere breeding season. Per rectum ultrasonography of the mare's reproductive tract determined the timing of insemination, and deslorelin acetate was used to induce ovulation. Chilled semen insemination was performed using a single preovulatory dose delivered into the uterine body. Frozen semen was administered as 2 doses (pre- and post ovulation) using a deep uterine insemination technique. Pregnancy was detected ultrasonographically at 15 days post insemination. Conception rates were compared using a Chi-squared test. Insemination with frozen semen produced a significantly (P = 0.022) higher seasonal conception rate (82.0%) than that achieved with chilled semen (69.6%). Insemination with frozen semen can achieve conception rates equal to those with chilled semen, enabling the mare owner a greater selection of stallions.
Jamhiri, Iman; Saadat, Iraj; Omidvari, Shahpour
2017-06-01
Oxidative stress is significant in numerous types of disease including cancer. To protect cells and organs against reactive oxygen species (ROS), the body has evolved an antioxidant protection system that involved in the detoxification of ROS. Single nucleotide polymorphisms (SNP) of anti-oxidative enzymes may dramatically change the activity of the encoded proteins; therefore, certain alleles can be established as risk factors for some kind of multi-factorial diseases including cancer. In present study we investigate the possible association between polymorphisms of superoxide dismutase 1 ( SOD1 , OMIM: 147450) and catalase ( CAT , OMIM: 115500) genes and the risk of colorectal cancer (CRC). The study included 204 colorectal cancer patients and 239 healthy control group matched for gender and age. Genotyping of SOD1 A251G and CAT C-262T were done by polymerase chain reaction and restriction fragment length polymorphism (PCR-RFLP) method. There was no significant association between CAT C-262T polymorphism and susceptibility to CRC (P>0.05). The carries of the G allele of SOD1 significantly showed higher prevalence in CRC patients compared with the control group (OR=1.84, 95% CI=1.13-2.98, P=0.013). We assessed the effect of combination of genotypes of the study polymorphisms on the risk of CRC. We found that the combination of AG+GG ( SOD1 ) and CC ( CAT ) increases the risk of developing CRC (OR=2.38, 95% CI=1.25-4.52, P=0.008).
Low dose rectal inoculation of rhesus macaques by SIV smE660 or SIVmac251 recapitulates
Energy Technology Data Exchange (ETDEWEB)
Hraber, Peter [Los Alamos National Laboratory; Giorgi, Elena E [Los Alamos National Laboratory; Keele, Brandon [UNIV OF ALABAMA; Li, Hui [UNIV OF ALABAMA; Learn, Gerald [UNIV OF ALABAMA
2008-01-01
We recently developed a novel strategy to identify transmitted HIV-1 genomes in acutely infected humans using single-genome amplification and a model of random virus evolution. Here, we used this approach to determine the molecular features of simian immunodeficiency virus (SIV) transmission in 18 experimentally infected Indian rhesus macaques. Animals were inoculated intrarectally (i.r.) or intravenously (i.v.) with stocks of SIVmac251 or SIVsmE660 that exhibited sequence diversity typical of early-chronic HIV-1 infection. 987 full-length SIV env sequences (median of 48 per animal) were determined from plasma virion RNA 1--5 wk after infection. i.r. inoculation was followed by productive infection by one or a few viruses (median 1; range 1--5) that diversified randomly with near starlike phylogeny and a Poisson distribution of mutations. Consensus viral sequences from ramp-up and peak viremia were identical to viruses found in the inocula or differed from them by only one or a few nucleotides, providing direct evidence that early plasma viral sequences coalesce to transmitted/founder viruses. i.v. infection was >2,000-fold more efficient than i.r. infection, and viruses transmitted by either route represented the full genetic spectra of the inocula. These findings identify key similarities in mucosal transmission and early diversification between SIV and HIV-1, and thus validate the SIV-macaque mucosal infection model for HIV-1 vaccine and microbicide research.
Directory of Open Access Journals (Sweden)
Lineu Cesar Werneck
2007-06-01
Full Text Available OBJECTIVE: To study the clinical forms of amyotrophic lateral sclerosis (ALS and the possible presence of risk factors in order to verify if there is any difference between cases in Paraná, Brazil. METHOD: We studied 251 cases, all of which fulfilled the diagnosis criteria proposed in El Escorial (WFN. Between 1977 and 2004, 157 male and 94 female patients were examined. RESULTS: 220 cases were classified as ALS-Spinal Onset (ALS-SO, 24 as ALS-Bulbar Onset (ALS-BO and 7 as Familial ALS. The mean age at time of evaluation was 54.4±12.3 years, and symptoms had started 17.9±15.7months previously. In the group studied, statistical relationships were found between heavy occupations and males; previous surgeries and females; ALS-BO and dysphagia and dysarthria in females; and ALS-SO and males, cramps, weakness, muscle atrophy, hypertonia, increased deep tendon reflex and abnormal gait. CONCLUSION: The average age at time of evaluation was lower than that registered in the literature but similar to the Brazilian series. Domestic work and heavy occupations appear to be related to precocious perception of the symptoms by interference with daily functions. The socioeconomically higher classes seek medical care early. There was no relationship with exposure to toxic agents or trauma.OBJETIVO: Estudar as formas clínicas de esclerose lateral amiotrófica (ELA e possíveis fatores de risco, a fim de verificar se existem diferenças entre os casos do Paraná, Brasil. MÉTODO: Estudamos 251 casos entre 1977 e 2004, que preencheram os critérios propostos em El Escorial (WFN, sendo 157 do sexo masculino e 94 do feminino. RESULTADOS: Foram classificados como ELA de início espinhal (ELA-IE 220 casos, ELA de início bulbar (ELA-IB 24 casos e 7 casos como ELA familiar. A idade média na avaliação foi 54,4±12,3 anos cujos sintomas iniciaram 17,9 ±15,7 meses antes. Foram encontradas relações estatísticas entre ocupação que demandam esforços físicos com
Directory of Open Access Journals (Sweden)
Noor Dawany
Full Text Available BACKGROUND: Co-infection with tuberculosis (TB is the leading cause of death in HIV-infected individuals. However, diagnosis of TB, especially in the presence of an HIV co-infection, can be limiting due to the high inaccuracy associated with the use of conventional diagnostic methods. Here we report a gene signature that can identify a tuberculosis infection in patients co-infected with HIV as well as in the absence of HIV. METHODS: We analyzed global gene expression data from peripheral blood mononuclear cell (PBMC samples of patients that were either mono-infected with HIV or co-infected with HIV/TB and used support vector machines to identify a gene signature that can distinguish between the two classes. We then validated our results using publically available gene expression data from patients mono-infected with TB. RESULTS: Our analysis successfully identified a 251-gene signature that accurately distinguishes patients co-infected with HIV/TB from those infected with HIV only, with an overall accuracy of 81.4% (sensitivity = 76.2%, specificity = 86.4%. Furthermore, we show that our 251-gene signature can also accurately distinguish patients with active TB in the absence of an HIV infection from both patients with a latent TB infection and healthy controls (88.9-94.7% accuracy; 69.2-90% sensitivity and 90.3-100% specificity. We also demonstrate that the expression levels of the 251-gene signature diminish as a correlate of the length of TB treatment. CONCLUSIONS: A 251-gene signature is described to (a detect TB in the presence or absence of an HIV co-infection, and (b assess response to treatment following anti-TB therapy.
Neonatal Caffeine Treatment and Respiratory Function at 11 Years in Children under 1,251 g at Birth.
Doyle, Lex W; Ranganathan, Sarath; Cheong, Jeanie L Y
2017-11-15
Caffeine in the newborn period shortens the duration of assisted ventilation and reduces the incidence of bronchopulmonary dysplasia, but its effects on respiratory function in later childhood are unknown. To determine if children born with birth weight less than 1,251 g who were treated with neonatal caffeine had improved respiratory function at 11 years of age compared with children treated with placebo. Children enrolled in the CAP (Caffeine for Apnea of Prematurity) randomized controlled trial and assessed at the Royal Women's Hospital in Melbourne at 11 years of age had expiratory flow rates measured according to the standards of the American Thoracic Society. Values were converted to z-scores predicted for age, height, ethnicity, and sex. Parents completed questionnaires related to their child's respiratory health. A total of 142 children had expiratory flows measured. Expiratory flows were better in the caffeine group, by approximately 0.5 SD for most variables (e.g., FEV 1 ; mean z-score, -1.00 vs. -1.53; mean difference, 0.54; 95% confidence interval, 0.14-0.94; P = 0.008). Fewer children in the caffeine group had values for FVC below the fifth centile (11% vs. 28%; odds ratio, 0.31; 95% confidence interval, 0.12-0.77; P = 0.012). When adjusted for bronchopulmonary dysplasia, the difference in flow rates between groups diminished. Caffeine treatment in the newborn period improves expiratory flow rates in midchildhood, which seems to be achieved by improving respiratory health in the newborn period. Follow-up lung function testing in adulthood is vital for these individuals. Future placebo-controlled randomized trials of neonatal caffeine are unlikely. Clinical trial registered with www.clinicaltrials.gov (NCT00182312).
Single-centre experience with the frozen elephant trunk technique in 251 patients over 15 years.
Shrestha, Malakh; Martens, Andreas; Kaufeld, Tim; Beckmann, Erik; Bertele, Sebastian; Krueger, Heike; Neuser, Julia; Fleissner, Felix; Ius, Fabio; Abd Alhadi, Firas; Hanke, Jasmin; Schmitto, Jan D; Cebotari, Serghei; Karck, Matthias; Haverich, Axel; Chavan, Ajay
2017-11-01
Our goal was to present our 15-year experience (2001-2015) with the frozen elephant trunk (FET) technique. A total of 251 patients (82 with aortic aneurysms, 96 with acute aortic dissection type A, 4 with acute type B dissections, 52 with chronic aortic dissection type A, 17 with chronic type B dissection and 67 redo cases) underwent FET implantation with either the custom-made Chavan-Haverich (n = 66), the Jotec E-vita (n = 31) or the Vascutek Thoraflex hybrid (n = 154) prosthesis. The cases were assigned to an early period (2001-2011) and a contemporary period (2012-present). Mean cardiopulmonary bypass time, aortic cross-clamp time, circulatory arrest time and selective antegrade cerebral perfusion time were 241 ± 72, 125 ± 59, 56 ± 30 and 81 ± 34 min, respectively. Incidence of rethoracotomy for bleeding, stroke, spinal cord injury, prolonged ventilatory support (>96 h) and long-term dialysis were 18, 14, 2, 24 and 2%, respectively. The in-hospital mortality rate was 11% (in acute aortic dissection type A, 12%). Of the 2 patients with graft infections, 1 died and the other had a protracted hospital stay. There were 49 second-stage procedures in the downstream aorta: either open surgical [n = 25 (thoraco-abdominal, n = 15; descending, n = 6; infrarenal, n = 4)] or transfemoral endovascular (n = 23). Elective thoracic endovascular aneurysm repair R implantation was successful in all 23 cases. FET results are comparable with those of the published results of the conventional elephant trunk technique. FET is an ideal landing zone for subsequent transfemoral endovascular completion. Patients with graft infections may have dismal results. © The Author 2017. Published by Oxford University Press on behalf of the European Association for Cardio-Thoracic Surgery. All rights reserved.
A Chimeric Protein PTEN-L-p53 Enters U251 Cells to Repress Proliferation and Invasion.
Xiao, Man; An, Yang; Wang, Fengling; Yao, Chao; Zhang, Chu; Xin, Junfang; Duan, Yongjian; Zhao, Xiaofang; Fang, Na; Ji, Shaoping
2018-05-23
PTEN, a well-known tumor suppressor, dephosphorylates PIP3 and inhibits AKT activity. A translational variant of PTEN has been identified and termed PTEN-Long (PTEN-L). The additional 173 amino acids (PTEN-L leader) at the N-terminal constitute a potential signal peptide. Differing from canonical PTEN, PTEN-L is secreted into the extracellular fluid and re-enters recipient cells, playing the similar roles as PTEN in vivo and in vitro. This character confers the PTEN-L a therapeutic ability via directly protein delivering instead of traditional DNA and RNA vector options. In the present study, we employed PTEN-L leader to assemble a fusion protein, PTEN-L-p53, inosculated with the transcriptional regulator TP53, which is another powerful tumor suppressor. We overexpressed PTEN-L-p53 in HEK293T cells and detected it in both the cytoplasm and nucleus. Subsequently, we found that PTEN-L-p53 was secreted outside of the cells and detected in the culture media by immunoblotting. Furthermore, we demonstrated that PTEN-L-p53 freely entered the cells and suppressed the viability of U251cells (p53 R273H , a cell line with p53 R273H-mutation). PTEN-L-p53 is composed of endogenous protein/peptide bearing low immunogenicity, and only the junction region between PTEN-L leader and p53 can act as a new immune epitope. Accordingly, this fusion protein can potentially be used as a therapeutic option for TP53-abnormality cancers. Copyright © 2018. Published by Elsevier Inc.
African Journals Online (AJOL)
AISA
Cette étude montre la situation des pertes post-récolte de ces légumes telle que ... techniques, the development of transport and storage infrastructures, as well as an efficient marketing system. ..... des secteurs publics (l'Etat, les services de.
International Nuclear Information System (INIS)
Stevceva, Liljana; Moniuszko, Marcin; Alvarez, Xavier; Lackner, Andrew A.; Franchini, Genoveffa
2004-01-01
The vaginal and rectal mucosae are the first line of cellular immune defense to sexually transmitted human immunodeficiency virus type 1 (HIV-1) entry. Thus, intraepithelial lymphocytes (IELs) may be important in the immune response to HIV infection. Here we investigated whether functional IELs in mucosal compartments could be visualized by direct staining with a tetrameric complex specific for the simian immunodeficiency virus (SIV) immunodominant Gag epitope in either separated IEL cells or tissues of macaques infected with SIVmac251. Of the 15 Mamu-A*01-positive macaques studied here, eight were chronically infected with either SIVmac251 or simian-human immunodeficiency virus (SHIV) KU2 and the remaining seven were exposed mucosally to SIVmac251 and sacrificed within 48 h to assess the local immune response. Gag-specific CD8+ T-cells were found in separated IELs from the rectum, colon, jejunum, and vagina of most infected animals. Direct staining of tetramers also revealed their presence in intact tissue. These Gag-specific IELs expressed the activation marker CD69 and produced IFN-γ, suggesting an active immune response in this locale
International Nuclear Information System (INIS)
Li, Yi; Li, Qiang; Asai, Akio; Kawamoto, Keiji; Zhao Shiguang; Zhen Yunbo; Teng Lei
2011-01-01
MicroRNAs (miRNAs) are small noncoding RNAs that take part in diverse biological processes by suppressing target gene expression. Elevated expression of miR-21 has been reported in many types of human cancers. Radiotherapy is a standard adjuvant treatment for patients with glioblastoma. However, the resistance of glioblastoma cells to radiation limits the success of this treatment. In this study, we found that miR-21 expression was upregulated in response to ionizing radiation (IR) in U251 cells, which suggested that miR-21 could be involved in the response of U251 cells to radiation. We showed that a miR-21 inhibitor enhanced IR-induced glioblastoma cell growth arrest and increased the level of apoptosis, which was probably caused by abrogation of the G 2 -M arrest induced by IR. Further research demonstrated that the miR-21 inhibitor induced the upregulation of Cdc25A. Taken together, these findings suggest that miR-21 inhibitor can increase IR-induced growth arrest and apoptosis in U251 glioblastoma cells, at least in part by abrogating G 2 -M arrest, and that Cdc25A is a potential target of miR-21. (author)
Wang, Chunhua; Lin, Dongmei; Chen, Quan; Lin, Shuqian; Shi, Songsheng; Chen, Chunmei
2018-04-01
The Ganoderma lucidum ( G. lucidum ) mushroom is one of the most extensively studied functional foods, known for its numerous health benefits, including the inhibition of tumor cell growth. The present study assessed the anti-proliferative and pro-apoptotic activity of a novel G. lucidum polysaccharide peptide (GL-PP) in human glioma U251 cells, which was purified from grass-cultured G. lucidum . GL-PP is a glycopeptide with an average molecular weight of 42,635 Da and a polysaccharide-to-peptide ratio of 88.70:11.30. The polysaccharides were composed of l-arabinose, d-mannose and d-glucose at a molar ratio of 1.329:0.372:2.953 and a total of 17 amino acids were detected. The results of the current study demonstrated that GL-PP significantly inhibited U251 cellular proliferation. The proportion of G 0 /G 1 phase cells and sub-G 1 phase cells significantly increased as the concentration of GL-PP increased, as did the activity of caspase-3. These results indicate that GL-PP directly inhibited human glioma U251 proliferation by inducing cell cycle arrest and promoting apoptosis.
Directory of Open Access Journals (Sweden)
Chia-Chang Wu
2018-01-01
Full Text Available Cigarette smoking and exposure to environmental tobacco smoke are well-known risk factors for urothelial carcinoma (UC. We conducted a hospital-based case-control study involving 287 UC cases and 574 cancer-free controls to investigate the joint effects of cigarette smoking and polymorphisms of inflammatory genes on UC risk. Tumor necrosis factor alpha (TNF-α -308 G/A and interleukin-8 (IL-8 -251 T/A polymorphisms were determined using a polymerase chain reaction-restriction fragment length polymorphism method. People who had ever smoked and those who were exposed to environmental tobacco smoke had significantly increased UC odds ratios (ORs of 1.65 and 1.68, respectively. Participants who had smoked more than 18 pack-years had a significantly increased UC OR of 2.64. People who had ever smoked and who carried the A/A genotype of the TNF-α -308 G/A polymorphism had a significantly higher UC OR (10.25 compared to people who had never smoked and who carried the G/G or G/A genotype. In addition, people who had ever smoked and who carried the IL-8 -251 T/T genotype had a significantly increased UC OR (3.08 compared to people who had never smoked and who carried the T/A or A/A genotype. In a combined analysis of three major risk factors (cumulative cigarette smoking, the TNF-α -308 A/A genotype, and the IL-8 -251 T/T genotype, subjects with any one, any two, and all three risk factors experienced significantly increased UC ORs of 1.55, 2.89, and 3.77, respectively, compared to individuals with none of the risk factors. Conclusions. Our results indicate that the combined effects of cumulative cigarette exposure and the TNF-α -308 A/A genotype and/or the IL-8 -251 T/T genotype on UC OR showed a significant dose-response relationship.
Rapisarda, Annamaria; Zalek, Jessica; Hollingshead, Melinda; Braunschweig, Till; Uranchimeg, Badarch; Bonomi, Carrie A; Borgel, Suzanne D; Carter, John P; Hewitt, Stephen M; Shoemaker, Robert H; Melillo, Giovanni
2004-10-01
We have previously shown that topotecan, a topoisomerase I poison, inhibits hypoxia-inducible factor (HIF)-1alpha protein accumulation by a DNA damage-independent mechanism. Here, we report that daily administration of topotecan inhibits HIF-1alpha protein expression in U251-HRE glioblastoma xenografts. Concomitant with HIF-1alpha inhibition, topotecan caused a significant tumor growth inhibition associated with a marked decrease of angiogenesis and expression of HIF-1 target genes in tumor tissue. These results provide a compelling rationale for testing topotecan in clinical trials to target HIF-1 in cancer patients.
International Nuclear Information System (INIS)
Carr, W.J.; Grow, J.A.; Keller, S.M.
1995-01-01
Two wildcat oil and gas exploration holes drilled in 1991 on the northern edge of the Amargosa Desert penetrated Tertiary and Quaternary sedimentary rocks, alluvium, and basalt, possible Tertiary volcanic or volcaniclastic rocks, and Tertiary (?) and Paleozoic carbonate rocks. The easternmost of the two holes, Felderhoff-Federal 5-1, encountered about 200 feet of alluvium, underlain by 305 feet of basalt breccia and basalt, about 345 feet of probable Tertiary tuffaceous sedimentary rocks, and 616 feet of dense limestone and dolomite of uncertain age. Drill hole 25-1 penetrated 240 feet of alluvium and marl (?), and 250 feet of basalt breccia (?) and basalt, 270 feet of tuff (?) and/or tuffaceous sedimentary rocks, 360 feet of slide blocks (?) and large boulders of Paleozoic carbonate rocks, and 2,800 feet of Paleozoic limestone and dolomite. The two drill holes are located within a northerly trending fault zone defined largely by geophysical data; this fault zone lies along the east side of a major rift containing many small basalt eruptive centers and, farther north, several caldera complexes. Drill hole 25-1 penetrated an inverted paleozoic rock sequence; drill hole 5-1 encountered two large cavities 24-inches wide or more in dense carbonate rock of uncertain, but probable Paleozoic age. These openings may be tectonic and controlled by a regional system of northeast-striking faults
Directory of Open Access Journals (Sweden)
Jiateng Zhong
Full Text Available CLIC4/mtCLIC, a chloride intracellular channel protein, localizes to mitochondria, endoplasmic reticulum (ER, nucleus and cytoplasm, and participates in the apoptotic response to stress. Apoptosis and autophagy, the main types of the programmed cell death, seem interconnected under certain stress conditions. However, the role of CLIC4 in autophagy regulation has yet to be determined. In this study, we demonstrate upregulation and nuclear translocation of the CLIC4 protein following starvation in U251 cells. CLIC4 siRNA transfection enhanced autophagy with increased LC3-II protein and puncta accumulation in U251 cells under starvation conditions. In that condition, the interaction of the 14-3-3 epsilon isoform with CLIC4 was abolished and resulted in Beclin 1 overactivation, which further activated autophagy. Moreover, inhibiting the expression of CLIC4 triggered both mitochondrial apoptosis involved in Bax/Bcl-2 and cytochrome c release under starvation and endoplasmic reticulum stress-induced apoptosis with CHOP and caspase-4 upregulation. These results demonstrate that CLIC4 nuclear translocation is an integral part of the cellular response to starvation. Inhibiting the expression of CLIC4 enhances autophagy and contributes to mitochondrial and ER stress-induced apoptosis under starvation.
Dau, Phuong D; Vasiliu, Monica; Peterson, Kirk A; Dixon, David A; Gibson, John K
2017-12-06
Actinyl chemistry is extended beyond Cm to BkO 2 + and CfO 2 + through transfer of an O atom from NO 2 to BkO + or CfO + , establishing a surprisingly high lower limit of 73 kcal mol -1 for the dissociation energies, D[O-(BkO + )] and D[O-(CfO + )]. CCSD(T) computations are in accord with the observed reactions, and characterize the newly observed dioxide ions as linear pentavalent actinyls; these being the first Bk and Cf species with oxidation states above IV. Computations of actinide dioxide cations AnO 2 + for An=Pa to Lr reveal an unexpected minimum for D[O-(CmO + )]. For CmO 2 + , and AnO 2 + beyond EsO 2 + , the most stable structure has side-on bonded η 2 -(O 2 ), as An III peroxides for An=Cm and Lr, and as An II superoxides for An=Fm, Md, and No. It is predicted that the most stable structure of EsO 2 + is linear [O=Es V =O] + , einsteinyl, and that FmO 2 + and MdO 2 + , like CmO 2 + , also have actinyl(V) structures as local energy minima. The results expand actinide oxidation state chemistry, the realm of the distinctive actinyl moiety, and the non-periodic character towards the end of the periodic table. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Total neutron cross sections of berkelium-249 and californium-249 below 100 eV
International Nuclear Information System (INIS)
Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.
1979-01-01
The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data
Malkevitch, Nina V; Patterson, L Jean; Aldrich, M Kristine; Wu, Yichen; Venzon, David; Florese, Ruth H; Kalyanaraman, V S; Pal, Ranajit; Lee, Eun Mi; Zhao, Jun; Cristillo, Anthony; Robert-Guroff, Marjorie
2006-09-15
Previously, priming with replication-competent adenovirus-SIV multigenic vaccines and boosting with envelope subunits strongly protected 39% of rhesus macaques against rectal SIV(mac251) challenge. To evaluate protection durability, eleven of the protected and two SIV-infected unimmunized macaques that controlled viremia were re-challenged rectally with SIV(mac251). Strong protection was observed in 8/11 vaccinees, including two exhibiting protected macaques. Durable protection was associated with significantly increased SIV-specific ELISPOT responses and lymphoproliferative responses to p27 at re-challenge. After CD8 depletion, 2 of 8 re-challenged, protected vaccinees maintained protection against re-challenge.
Nawata, Yoko; Kitaichi, Kiyoyuki; Yamamoto, Tsuneyuki
2016-03-01
3,4-Methylenedioxymethamphetamine (MDMA), a methamphetamine (METH) derivative, exhibits METH-like actions at monoamine transporters and positive reinforcing effects in rodents and primates. The purposes of the present study were to determine whether cross-reinstatement would be observed between MDMA and METH and if the cannabinoid receptor, a receptor known to play critical roles in the brain reward system, could modulate MDMA craving. Rats were trained to press a lever for intravenous MDMA (0.3mg/infusion) or METH (0.02mg/infusion) infusions under a fixed ratio 1 schedule paired with drug-associated cues (light and tone). Following drug self-administration acquisition training, rats underwent extinction training (an infusion of saline). Reinstatement tests were performed once the extinction criteria were achieved. In MDMA-trained rats, the MDMA-priming injection (3.2mg/kg, i.p.) or re-exposure to MDMA-associated cues reinstated MDMA-seeking behavior. Additionally, a priming injection of METH (1.0mg/kg, i.p.) also reinstated MDMA-seeking behavior. In contrast, none of the MDMA doses reinstated METH-seeking behavior in the METH-trained rats. The CB1 cannabinoid receptor antagonist AM251 markedly attenuated the MDMA-seeking behaviors induced by MDMA-priming injection or re-exposure to MDMA-associated cues in a dose-dependent manner. These findings show that MDMA has obvious addictive potential for reinstating drug-seeking behavior and that METH can be an effective stimulus for reinstating MDMA-seeking behaviors. Furthermore, based on the attenuating effect of AM251 in the reinstatement of MDMA-seeking behaviors, drugs that suppress CB1 receptors may be used in treatment of MDMA dependence. Copyright © 2016. Published by Elsevier Ireland Ltd.
Cagni, Priscila; Barros, Marilia
2013-03-01
Cannabinoid type 1 receptors (CB1r) are an important modulatory site for emotional behavior. However, little is known on the effects of CB1r ligands on emotionality aspects of primates, even with their highly similar behavioral response and receptor density/distribution as humans. Thus, we analyzed the effects of the CB1r agonist WIN 55,212-2 (WIN; 1mg/kg) and the antagonist AM 251 (AM; 2mg/kg), systemically administered prior to a single brief (15 min) exposure to a novel open-field (OF) environment, on the behavior of individually tested adult black tufted-ear marmosets. Both WIN- and AM-treated subjects, compared to vehicle controls, had significantly lower rates of long (contact) calls and exploration, while higher levels of vigilance-related behaviors (scan/glance); these are indicators of anxiolysis in this setup. Changes in locomotion were not detected. However, in the vehicle and AM-groups, sojourn in the peripheral zone of the OF was significantly higher than in its central region. WIN-treated marmosets spent an equivalent amount of time in both zones. Therefore, activation or blockade CB1r function prior to a short and individual exposure to an unfamiliar environment exerted a significant and complex influence on different behavioral indicators of anxiety in these monkeys (i.e., a partially overlapping anxiolytic-like profile). AM 251, however, has no anxiolytic effect when the time spent in the center of the OF is considered. This is a major difference when compared to the WIN-treated group. Data were compared to the response profile reported in other pre-clinical (rodent) and clinical studies. Copyright © 2012 Elsevier B.V. All rights reserved.
Pegu, Poonam; Vaccari, Monica; Gordon, Shari; Keele, Brandon F.; Doster, Melvin; Guan, Yongjun; Ferrari, Guido; Pal, Ranajit; Ferrari, Maria Grazia; Whitney, Stephen; Hudacik, Lauren; Billings, Erik; Rao, Mangala; Montefiori, David; Tomaras, Georgia; Alam, S. Munir; Fenizia, Claudio; Lifson, Jeffrey D.; Stablein, Donald; Tartaglia, Jim; Michael, Nelson; Kim, Jerome; Venzon, David
2013-01-01
The recombinant canarypox vector, ALVAC-HIV, together with human immunodeficiency virus (HIV) gp120 envelope glycoprotein, has protected 31.2% of Thai individuals from HIV acquisition in the RV144 HIV vaccine trial. This outcome was unexpected, given the limited ability of the vaccine components to induce CD8+ T-cell responses or broadly neutralizing antibodies. We vaccinated macaques with an immunization regimen intended to mimic the RV144 trial and exposed them intrarectally to a dose of the simian immunodeficiency virus SIVmac251 that transmits few virus variants, similar to HIV transmission to humans. Vaccination induced anti-envelope antibodies in all vaccinees and CD4+ and CD8+ T-cell responses. Three of the 11 macaques vaccinated with ALVAC-SIV/gp120 were protected from SIVmac251 acquisition, but the result was not significant. The remaining vaccinees were infected and progressed to disease. The magnitudes of vaccine-induced SIVmac251-specific T-cell responses and binding antibodies were not significantly different between protected and infected animals. However, sera from protected animals had higher avidity antibodies to gp120, recognized the variable envelope regions V1/V2, and reduced SIVmac251 infectivity in cells that express high levels of α4β7 integrins, suggesting a functional role of antibodies to V2. The current results emphasize the utility of determining the titer of repeated mucosal challenge in the preclinical evaluation of HIV vaccines. PMID:23175374
Pegu, Poonam; Vaccari, Monica; Gordon, Shari; Keele, Brandon F; Doster, Melvin; Guan, Yongjun; Ferrari, Guido; Pal, Ranajit; Ferrari, Maria Grazia; Whitney, Stephen; Hudacik, Lauren; Billings, Erik; Rao, Mangala; Montefiori, David; Tomaras, Georgia; Alam, S Munir; Fenizia, Claudio; Lifson, Jeffrey D; Stablein, Donald; Tartaglia, Jim; Michael, Nelson; Kim, Jerome; Venzon, David; Franchini, Genoveffa
2013-02-01
The recombinant canarypox vector, ALVAC-HIV, together with human immunodeficiency virus (HIV) gp120 envelope glycoprotein, has protected 31.2% of Thai individuals from HIV acquisition in the RV144 HIV vaccine trial. This outcome was unexpected, given the limited ability of the vaccine components to induce CD8(+) T-cell responses or broadly neutralizing antibodies. We vaccinated macaques with an immunization regimen intended to mimic the RV144 trial and exposed them intrarectally to a dose of the simian immunodeficiency virus SIV(mac251) that transmits few virus variants, similar to HIV transmission to humans. Vaccination induced anti-envelope antibodies in all vaccinees and CD4(+) and CD8(+) T-cell responses. Three of the 11 macaques vaccinated with ALVAC-SIV/gp120 were protected from SIV(mac251) acquisition, but the result was not significant. The remaining vaccinees were infected and progressed to disease. The magnitudes of vaccine-induced SIV(mac251)-specific T-cell responses and binding antibodies were not significantly different between protected and infected animals. However, sera from protected animals had higher avidity antibodies to gp120, recognized the variable envelope regions V1/V2, and reduced SIV(mac251) infectivity in cells that express high levels of α(4)β(7) integrins, suggesting a functional role of antibodies to V2. The current results emphasize the utility of determining the titer of repeated mucosal challenge in the preclinical evaluation of HIV vaccines.
Cai, Qiuyin; Wen, Wanqing; Qu, Shimian; Li, Guoliang; Egan, Kathleen M; Chen, Kexin; Deming, Sandra L; Shen, Hongbing; Shen, Chen-Yang; Gammon, Marilie D; Blot, William J; Matsuo, Keitaro; Haiman, Christopher A; Khoo, Ui Soon; Iwasaki, Motoki; Santella, Regina M; Zhang, Lina; Fair, Alecia Malin; Hu, Zhibin; Wu, Pei-Ei; Signorello, Lisa B; Titus-Ernstoff, Linda; Tajima, Kazuo; Henderson, Brian E; Chan, Kelvin Y K; Kasuga, Yoshio; Newcomb, Polly A; Zheng, Hong; Cui, Yong; Wang, Furu; Shieh, Ya-Lan; Iwata, Hiroji; Le Marchand, Loic; Chan, Sum Yin; Shrubsole, Martha J; Trentham-Dietz, Amy; Tsugane, Shoichiro; Garcia-Closas, Montserrat; Long, Jirong; Li, Chun; Shi, Jiajun; Huang, Bo; Xiang, Yong-Bing; Gao, Yu-Tang; Lu, Wei; Shu, Xiao-Ou; Zheng, Wei
2011-02-15
We evaluated the generalizability of a single nucleotide polymorphism (SNP), rs2046210 (A/G allele), associated with breast cancer risk that was initially identified at 6q25.1 in a genome-wide association study conducted among Chinese women. In a pooled analysis of more than 31,000 women of East-Asian, European, and African ancestry, we found a positive association for rs2046210 and breast cancer risk in Chinese women [ORs (95% CI) = 1.30 (1.22-1.38) and 1.64 (1.50-1.80) for the AG and AA genotypes, respectively, P for trend = 1.54 × 10⁻³⁰], Japanese women [ORs (95% CI) = 1.31 (1.13-1.52) and 1.37 (1.06-1.76), P for trend = 2.51 × 10⁻⁴], and European-ancestry American women [ORs (95% CI) = 1.07 (0.99-1.16) and 1.18 (1.04-1.34), P for trend = 0.0069]. No association with this SNP, however, was observed in African American women [ORs (95% CI) = 0.81 (0.63-1.06) and 0.85 (0.65-1.11) for the AG and AA genotypes, respectively, P for trend = 0.4027]. In vitro functional genomic studies identified a putative functional variant, rs6913578. This SNP is 1,440 bp downstream of rs2046210 and is in high linkage disequilibrium with rs2046210 in Chinese (r(2) = 0.91) and European-ancestry (r² = 0.83) populations, but not in Africans (r² = 0.57). SNP rs6913578 was found to be associated with breast cancer risk in Chinese and European-ancestry American women. After adjusting for rs2046210, the association of rs6913578 with breast cancer risk in African Americans approached borderline significance. Results from this large consortium study confirmed the association of rs2046210 with breast cancer risk among women of Chinese, Japanese, and European ancestry. This association may be explained in part by a putatively functional variant (rs6913578) identified in the region. ©2011 AACR.
International Nuclear Information System (INIS)
Dechery, Fabien
2012-01-01
In analogy with the atomic closed shells giving rise to the stability and high ionisation energies of noble gases, nuclear physics also has its magic numbers of protons and neutrons which enhance nuclear structure stability. Knowledge of the structure of doubly-magic nuclei, both proton and neutron numbers, is crucial to parameterize theoretical models. The discovery of the next and ultimate magic numbers will provide a strong constraint on the many predictions. These two numbers are like the centre coordinates of an area of enhanced stability of the nuclear chart, well known as 'island of stability'. These superheavy nuclei only exist due to pure quantum shell effects. My thesis work deals with two distinct, but complementary, aspects of fundamental physics with the common goal of studying these extreme mass nuclei structure. The first part corresponds to the development of a next generation instrument for nuclear physics to allow synthesis and spectroscopy studies of superheavy nuclei: the Super Separator Spectrometer S 3 . This project will be installed at SPIRAL2 (GANIL) and has been approved by the French Research National Agency (ANR) within the EQUIPEX framework. It has been designed to take advantage of the high intensity heavy ion beam from the LINAC, giving access to a wide range of physical programs. The second part corresponds to the preparation, realisation and analysis of an experiment on 251-Mendelevium in which the very first prompt gamma-electron coincidence spectroscopy was performed for a transfermium nuclei. (author) [fr
Energy Technology Data Exchange (ETDEWEB)
Koraber, Bette [Los Alamos National Laboratory; Perelson, Alan [Los Alamos National Laboratory; Hraber, Peter [Los Alamos National Laboratory; Giorgi, E [Los Alamos National Laboratory; Bhattacharya, T [Los Alamos National Laboratory
2009-01-01
Recently, we developed a novel approach to the identification of transmitted or early founder HIV -1 genomes in acutely infected humans based on single genome amplification and sequencing. Here we tested this approach in 18 acutely infected Indian rhesus macaques to determine the molecular features of SIV transmission. Animals were inoculated intrarectally (IR) or intravenously (IV) with stocks of SIVmac251 or SIVsmE660 that exhibited sequence diversity typical of early-chronic HIV -1 infection. 987 full-length SIV env sequences (median of 48 per animal) were determined from plasma virion RNA one to five weeks after infection. IR inoculation was followed by productive infection by one or few viruses (median 1; range 1-5) that diversified randomly with near star-like phylogeny and a Poisson distribution of mutations. Consensus viral sequences from ramp-up and peak viremia were identical to viruses found in the inocula or differed from them by only one or few nuc1eotides, providing direct evidence that early plasma viral sequences coalesce to transmitted/founder virus( es). IV infection was approximately 10,000-fold more efficient than IR infection, and viruses transmitted by either route represented the full genetic spectra of the inocula. These findings identify key similarities in mucosal transmission and early diversification between SIV and HIV -1.
Directory of Open Access Journals (Sweden)
S. Borin
2009-06-01
Full Text Available Realizou-se um estudo retrospectivo dos aspectos epidemiológicos, sinais clínicos, dados de exame físico e alterações hematológicas da erliquiose em 251 cães naturalmente infectados por Ehrlichia spp. Dos 4407 casos atendidos em hospital veterinário no período de janeiro de 2002 a dezembro de 2003, verificou-se que 251 cães eram portadores de mórula de Ehrlichia spp. em leucócitos de sangue periférico. Destes, 48 foram eliminados das avaliações por apresentarem patologias concomitantes. Nos 203 cães restantes, verificou-se que houve maior ocorrência em fêmeas (61,1% e que a doença manteve-se constante durante todo o período avaliado. Observou-se que 38% encontravam-se na faixa etária entre um e 23 meses e 58,6% eram de raça definida. As principais alterações clínicas observadas foram apatia, anorexia/hiporexia, vômito, secreção oculonasal e esplenomegalia. Cento e cinco cães apresentaram temperatura retal entre 38 e 39,5°C. As alterações observadas com maior frequência no hemograma foram anemia, predominando o tipo normocítica normocrômica (58,2%; desvio nuclear de neutrófilos para a esquerda (67% e eosinopenia (58,1%.A study of epidemiological and clinical aspects, alterations of physical exams, and hematological changes of canine ehrlichiosis was performed. A retrospective study was performed in 4,407 dogs referred to a Veterinary Hospital from January 2002 to December 2003. Of all cases, 251 dogs showed Ehrlichia spp. morulae. Among these, 48 were excluded from the study due to other co-infection by other pathologies. In the other 203 evaluated dogs, females (61.1% were more infected than males. The dogs aged from one to 23 months (68.6% and 58.6% were definite breed. Emesis, apathy, anorexia/hypoxeria, spleenomegaly, and nasal discharge were the most common signs presented. Rectal temperature was 38 - 39.5ÚC in 105 dogs. The most usual changes seen during the hematological tests were normochromic and
Ji, Xiang-Jun; Chen, Sui-Hua; Zhu, Lin; Pan, Hao; Zhou, Yuan; Li, Wei; You, Wan-Chun; Gao, Chao-Chao; Zhu, Jian-Hong; Jiang, Kuan; Wang, Han-Dong
2013-07-01
NF-E2-related factor 2 (Nrf2) is a pivotal transcription factor of cellular responses to oxidative stress and recent evidence suggests that Nrf2 plays an important role in cancer pathobiology. However, the underlying mechanism has yet to be elucidated, particularly in glioma. In the present study, we investigated the role of Nrf2 in the clinical prognosis, cell proliferation and tumor growth of human glioblastoma multiforme (GBM). We detected overexpression of Nrf2 protein levels in GBM compared to normal brain tissues. Notably, higher protein levels of Nrf2 were significantly associated with poorer overall survival and 1-year survival for GBM patients. Furthermore, we constructed the plasmid Si-Nrf2 and transduced it into U251MG cells to downregulate the expression of Nrf2 and established stable Nrf2 knockdown cells. The downregulation of Nrf2 suppressed cell proliferation in vitro and tumor growth in mouse xenograft models. We performed immunohistochemistry staining to detect the protein levels of Nrf2, Ki-67, caspase-3 and CD31 in the xenograft tumors and found that the expression levels of Nrf2 and Ki-67 were much lower in the Si-Nrf2 group compared to the Si-control group. In addition, the number of caspase-3-positive cells was significantly increased in the Si-Nrf2 group. By analysis of microvessel density (MVD) assessed by CD31, the MVD value in the Si-Nrf2 group decreased significantly compared to the Si-control group. These findings indicate that the knockdown of Nrf2 may suppress tumor growth by inhibiting cell proliferation, increasing cell apoptosis and inhibiting angiogenesis. These results highlight the potential of Nrf2 as a candidate molecular target to control GBM cell proliferation and tumor growth.
Directory of Open Access Journals (Sweden)
Maldonado-Garza Hector J
2007-04-01
Full Text Available Abstract Background The intensity of the inflammation induced by Helicobacter pylori colonization is associated with the development of distal gastric cancer (GC. The host response to H. pylori has been related to genetic polymorphisms that influence both innate and adaptive immune responses. Our aim was to investigate whether the presence of the TLR4 Asp299Gly, TLR4 Thr399Ile and IL-8-251 A/T polymorphisms had any influence in the development of distal GC in a Mexican population. Methods We studied 337 patients that were divided in two groups: 78 patients with histologically confirmed distal GC and 259 non-cancer controls. The presence of H. pylori in the control population was defined by positive results of at least two of four diagnostic tests: serology, histology, rapid urease test and culture. Human DNA was purified and genotyped for TLR4 Asp299Gly polymorphism by pyrosequencing, for TLR4 Thr399Ile by PCR-RFLP and for IL8-251 by the amplification refractory mutation system (ARMS-PCR. Results The non-cancer control group was found to be in Hardy-Weinberg equilibrium at the polymorphic loci studied (chi-square H-W = 0.58 for IL8-251, 0.42 for TLR4 Asp299Gly and 0.17 for TLR4 Thr399Ile. The frequencies of mutated alleles (homozygous plus heterozygous were compared between cases and controls. We found no significant difference for TLR4- Asp299Gly [the 7.7% of distal GC patients and 7.7 % non-cancer controls (p = 0.82] and for TLR4 Thr399Ile [the 1.3% of GC patients and the 5% of the control population (p = 0.2]. In contrast, for IL-8-251 A/T, 80.77% of the GC patients and 66.4% in the control group age and gender matched had at least one copy of mutated allele (OR = 2.12, 95% CI = 1.1–4.2 (p = 0.023. Conclusion This study showed that the IL8-251*A allele could be related to the development of distal gastric cancer in this Mexican population.
Directory of Open Access Journals (Sweden)
Iskra Tuero
2015-08-01
Full Text Available Many viral infections, including HIV, exhibit sex-based pathogenic differences. However, few studies have examined vaccine-related sex differences. We compared immunogenicity and protective efficacy of monomeric SIV gp120 with oligomeric SIV gp140 in a pre-clinical rhesus macaque study and explored a subsequent sex bias in vaccine outcome. Each immunization group (16 females, 8 males was primed twice mucosally with replication-competent Ad-recombinants encoding SIVsmH4env/rev, SIV239gag and SIV239nefΔ1-13 and boosted twice intramuscularly with SIVmac239 monomeric gp120 or oligomeric gp140 in MF59 adjuvant. Controls (7 females, 5 males received empty Ad and MF59. Up to 9 weekly intrarectal challenges with low-dose SIVmac251 were administered until macaques became infected. We assessed vaccine-induced binding, neutralizing, and non-neutralizing antibodies, Env-specific memory B cells and plasmablasts/plasma cells (PB/PC in bone marrow and rectal tissue, mucosal Env-specific antibodies, and Env-specific T-cells. Post-challenge, only one macaque (gp140-immunized remained uninfected. However, SIV acquisition was significantly delayed in vaccinated females but not males, correlated with Env-specific IgA in rectal secretions, rectal Env-specific memory B cells, and PC in rectal tissue. These results extend previous correlations of mucosal antibodies and memory B cells with protective efficacy. The gp140 regimen was more immunogenic, stimulating elevated gp140 and cyclic V2 binding antibodies, ADCC and ADCP activities, bone marrow Env-specific PB/PC, and rectal gp140-specific IgG. However, immunization with gp120, the form of envelope immunogen used in RV144, the only vaccine trial to show some efficacy, provided more significant acquisition delay. Further over 40 weeks of follow-up, no gp120 immunized macaques met euthanasia criteria in contrast to 7 gp140-immunized and 2 control animals. Although males had higher binding antibodies than females, ADCC
Directory of Open Access Journals (Sweden)
Nancy L Saccone
2010-08-01
Full Text Available Recently, genetic association findings for nicotine dependence, smoking behavior, and smoking-related diseases converged to implicate the chromosome 15q25.1 region, which includes the CHRNA5-CHRNA3-CHRNB4 cholinergic nicotinic receptor subunit genes. In particular, association with the nonsynonymous CHRNA5 SNP rs16969968 and correlates has been replicated in several independent studies. Extensive genotyping of this region has suggested additional statistically distinct signals for nicotine dependence, tagged by rs578776 and rs588765. One goal of the Consortium for the Genetic Analysis of Smoking Phenotypes (CGASP is to elucidate the associations among these markers and dichotomous smoking quantity (heavy versus light smoking, lung cancer, and chronic obstructive pulmonary disease (COPD. We performed a meta-analysis across 34 datasets of European-ancestry subjects, including 38,617 smokers who were assessed for cigarettes-per-day, 7,700 lung cancer cases and 5,914 lung-cancer-free controls (all smokers, and 2,614 COPD cases and 3,568 COPD-free controls (all smokers. We demonstrate statistically independent associations of rs16969968 and rs588765 with smoking (mutually adjusted p-values<10(-35 and <10(-8 respectively. Because the risk alleles at these loci are negatively correlated, their association with smoking is stronger in the joint model than when each SNP is analyzed alone. Rs578776 also demonstrates association with smoking after adjustment for rs16969968 (p<10(-6. In models adjusting for cigarettes-per-day, we confirm the association between rs16969968 and lung cancer (p<10(-20 and observe a nominally significant association with COPD (p = 0.01; the other loci are not significantly associated with either lung cancer or COPD after adjusting for rs16969968. This study provides strong evidence that multiple statistically distinct loci in this region affect smoking behavior. This study is also the first report of association between rs588765
Dunbier, Anita K.; Anderson, Helen; Ghazoui, Zara; Lopez-Knowles, Elena; Pancholi, Sunil; Ribas, Ricardo; Drury, Suzanne; Sidhu, Kally; Leary, Alexandra; Martin, Lesley-Ann; Dowsett, Mitch
2011-01-01
Approximately 80% of human breast carcinomas present as oestrogen receptor α-positive (ER+ve) disease, and ER status is a critical factor in treatment decision-making. Recently, single nucleotide polymorphisms (SNPs) in the region immediately upstream of the ER gene (ESR1) on 6q25.1 have been associated with breast cancer risk. Our investigation of factors associated with the level of expression of ESR1 in ER+ve tumours has revealed unexpected associations between genes in this region and ESR1 expression that are important to consider in studies of the genetic causes of breast cancer risk. RNA from tumour biopsies taken from 104 postmenopausal women before and after 2 weeks treatment with an aromatase (oestrogen synthase) inhibitor was analyzed on Illumina 48K microarrays. Multiple-testing corrected Spearman correlation revealed that three previously uncharacterized open reading frames (ORFs) located immediately upstream of ESR1, C6ORF96, C6ORF97, and C6ORF211 were highly correlated with ESR1 (Rs = 0.67, 0.64, and 0.55 respectively, FDRaccount for the correlations. The correlations were maintained in cultured cells. An ERα antagonist did not affect the ORFs' expression or their correlation with ESR1, suggesting their transcriptional co-activation is not directly mediated by ERα. siRNA inhibition of C6ORF211 suppressed proliferation in MCF7 cells, and C6ORF211 positively correlated with a proliferation metagene in tumours. In contrast, C6ORF97 expression correlated negatively with the metagene and predicted for improved disease-free survival in a tamoxifen-treated published dataset, independently of ESR1. Our observations suggest that some of the biological effects previously attributed to ER could be mediated and/or modified by these co-expressed genes. The co-expression and function of these genes may be important influences on the recently identified relationship between SNPs in this region and breast cancer risk. PMID:21552322
Directory of Open Access Journals (Sweden)
Anita K Dunbier
2011-04-01
Full Text Available Approximately 80% of human breast carcinomas present as oestrogen receptor α-positive (ER+ve disease, and ER status is a critical factor in treatment decision-making. Recently, single nucleotide polymorphisms (SNPs in the region immediately upstream of the ER gene (ESR1 on 6q25.1 have been associated with breast cancer risk. Our investigation of factors associated with the level of expression of ESR1 in ER+ve tumours has revealed unexpected associations between genes in this region and ESR1 expression that are important to consider in studies of the genetic causes of breast cancer risk. RNA from tumour biopsies taken from 104 postmenopausal women before and after 2 weeks treatment with an aromatase (oestrogen synthase inhibitor was analyzed on Illumina 48K microarrays. Multiple-testing corrected Spearman correlation revealed that three previously uncharacterized open reading frames (ORFs located immediately upstream of ESR1, C6ORF96, C6ORF97, and C6ORF211 were highly correlated with ESR1 (Rs = 0.67, 0.64, and 0.55 respectively, FDR<1 × 10(-7. Publicly available datasets confirmed this relationship in other groups of ER+ve tumours. DNA copy number changes did not account for the correlations. The correlations were maintained in cultured cells. An ERα antagonist did not affect the ORFs' expression or their correlation with ESR1, suggesting their transcriptional co-activation is not directly mediated by ERα. siRNA inhibition of C6ORF211 suppressed proliferation in MCF7 cells, and C6ORF211 positively correlated with a proliferation metagene in tumours. In contrast, C6ORF97 expression correlated negatively with the metagene and predicted for improved disease-free survival in a tamoxifen-treated published dataset, independently of ESR1. Our observations suggest that some of the biological effects previously attributed to ER could be mediated and/or modified by these co-expressed genes. The co-expression and function of these genes may be
Tuero, Iskra; Mohanram, Venkatramanan; Musich, Thomas; Miller, Leia; Vargas-Inchaustegui, Diego A; Demberg, Thorsten; Venzon, David; Kalisz, Irene; Kalyanaraman, V S; Pal, Ranajit; Ferrari, Maria Grazia; LaBranche, Celia; Montefiori, David C; Rao, Mangala; Vaccari, Monica; Franchini, Genoveffa; Barnett, Susan W; Robert-Guroff, Marjorie
2015-08-01
Many viral infections, including HIV, exhibit sex-based pathogenic differences. However, few studies have examined vaccine-related sex differences. We compared immunogenicity and protective efficacy of monomeric SIV gp120 with oligomeric SIV gp140 in a pre-clinical rhesus macaque study and explored a subsequent sex bias in vaccine outcome. Each immunization group (16 females, 8 males) was primed twice mucosally with replication-competent Ad-recombinants encoding SIVsmH4env/rev, SIV239gag and SIV239nefΔ1-13 and boosted twice intramuscularly with SIVmac239 monomeric gp120 or oligomeric gp140 in MF59 adjuvant. Controls (7 females, 5 males) received empty Ad and MF59. Up to 9 weekly intrarectal challenges with low-dose SIVmac251 were administered until macaques became infected. We assessed vaccine-induced binding, neutralizing, and non-neutralizing antibodies, Env-specific memory B cells and plasmablasts/plasma cells (PB/PC) in bone marrow and rectal tissue, mucosal Env-specific antibodies, and Env-specific T-cells. Post-challenge, only one macaque (gp140-immunized) remained uninfected. However, SIV acquisition was significantly delayed in vaccinated females but not males, correlated with Env-specific IgA in rectal secretions, rectal Env-specific memory B cells, and PC in rectal tissue. These results extend previous correlations of mucosal antibodies and memory B cells with protective efficacy. The gp140 regimen was more immunogenic, stimulating elevated gp140 and cyclic V2 binding antibodies, ADCC and ADCP activities, bone marrow Env-specific PB/PC, and rectal gp140-specific IgG. However, immunization with gp120, the form of envelope immunogen used in RV144, the only vaccine trial to show some efficacy, provided more significant acquisition delay. Further over 40 weeks of follow-up, no gp120 immunized macaques met euthanasia criteria in contrast to 7 gp140-immunized and 2 control animals. Although males had higher binding antibodies than females, ADCC and ADCP
Wierucka-Rybak, M; Wolak, M; Bojanowska, E
2014-08-01
High intake of fats and sugars has prompted a rapid growth in the number of obese individuals worldwide. To further investigate whether simultaneous pharmacological intervention in the leptin and cannabinoid system might change food and water intake, preferences for palatable foods, and body weight, we have examined the effects of concomitant intraperitoneal administration of leptin and AM 251, a cannabinoid 1 (CB1) receptor antagonist, or cannabidiol (CBD), a plant cannabinoid, in rats maintained on either a high-fat (HF) diet (45% energy from fat) or free-choice (FC) diet consisting of high-sucrose and normal rat chow (83% and 61% energy from carbohydrates, respectively). Leptin at a dose of 100 μg/kg injected individually for 3 subsequent days to rats fed a HF diet reduced significantly the daily caloric intake and inhibited body weight gain. The hormone had no significant effects, however, on either caloric intake, body weight or food preferences in rats fed an FC diet. Co-injection of leptin and 1 mg/kg AM 251 resulted in a further significant decrease in HF diet intake and a profound reduction in body weight gain both in HF diet- and FC diet-fed rats. This drug combination, however, had no effect on the consumption of high-sucrose chow. In contrast, 3mg/kg of CBD co-injected with leptin did not modify leptin effects on food intake in rats maintained on an FC or HF diet. None of the drug combinations affected water consumption. It is concluded that the concomitant treatment with leptin and AM 251 attenuated markedly body weight gain in rats maintained on high-calorie diets rich in fat and carbohydrates but did not affect preferences for sweet food.
DEFF Research Database (Denmark)
Bertelsen, Birgitte; Melchior, Linea; Jensen, Lars Riff
2015-01-01
Gilles de la Tourette syndrome (GTS) is a neuropsychiatric disorder with a strong genetic etiology; however, finding of candidate genes is hampered by its genetic heterogeneity and the influence of non-genetic factors on disease pathogenesis. We report a case of a male patient with GTS, obsessive...... compulsive disorder, attention-deficit/hyperactivity-disorder, as well as other comorbidities, and a translocation t(3;9)(q25.1;q34.3) inherited from a mother with tics. Mate-pair sequencing revealed that the translocation breakpoints truncated the olfactomedin 1 (OLFM1) gene and two uncharacterized...
International Nuclear Information System (INIS)
Belanova, T.S.
1994-12-01
Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs
International Nuclear Information System (INIS)
Samhoun, K.
1976-01-01
The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr
International Nuclear Information System (INIS)
Milanović, Dušan; Firat, Elke; Grosu, Anca Ligia; Niedermann, Gabriele
2013-01-01
Heat shock Protein 90 (Hsp90) is a molecular chaperone that folds, stabilizes, and functionally regulates many cellular proteins involved in oncogenic signaling and in the regulation of radiosensitivity. It is upregulated in response to stress such a heat. Hyperthermia is a potent radiosensitizer, but induction of Hsp90 may potentially limit its efficacy. Our aim was to investigate whether the new Hsp90 inhibitor NVP-HSP990 increases radiosensitivity, thermosensitivity and radiothermosensitivity of human tumor cell lines. U251 glioblastoma and MIA PaCa-2 pancreatic carcinoma cells were used. To determine clonogenic survival, colony forming assays were performed. Cell viability and proliferation were assesed by Trypan blue staining. Cell cycle and apoptosis analyses were performed by flow cytometry. DAPI staining was used to detect mitotic catastrophe. NVP-HSP990 increased the thermosensitivity, radiosensitivity and radio-thermosensitivity of both cell lines in clonogenic assays. 72 hours after irradiation with 4 Gy, a significant reduction in cell number associated with considerable G2/M acumulation and mitotic catastrophe as well as cell death by apoptosis/necrosis was observed. Treatment with NVP-HSP990 strongly sensitized U251 and MIA PaCa-2 cells to hyperthermia and ionizing radiation or combination thereof through augmentation of G2/M arrest, mitotic catastrophe and associated apoptosis
Murray, R S; Keeling, J W; Ellis, P M; FitzPatrick, D R
2002-04-01
We report a female fetus of 20 weeks gestation with severe symmetrical deformity affecting all four limbs. These deformities were unusual in that there was upper limb peromelia and lower limb phocomelia. No additional major malformations were identified on postmortem examination. In particular there was no evidence of splenogonadal fusion or micrognathia and hypoglossia. The limb malformations in this case are associated with a de novo apparently balanced reciprocal translocation 46,XX,t(2;12)(p25.1;q24.1). The cytogenetic features of Roberts-SC phocomelia syndrome were not detected. Unfortunately, the fibroblast line died and no FISH or DNA analysis could be carried out. In spite of this, the case is presented as it may be useful to other researchers in the selection of candidate genes for mendelian forms of peromelia and phocomelia.
Energy Technology Data Exchange (ETDEWEB)
Wallace, P.M.; Bilpuch, E.G.; Bybee, C.R.; Mitchell, G.E.; Moore, E.F.; Shriner, J.D.; Shriner, J.F. Jr.; Vavrina, G.A.; Westerfeldt, C.R. [Duke University, Durham, North Carolina 27708 (United States)]|[Triangle Universities Nuclear Laboratory, Durham, North Carolina 27708 North Carolina State University, Raleigh, North Carolina 27695 (United States)]|[Triangle Universities Nuclear Laboratory, Durham, North Carolina 27708 Tennessee Technological University, Cookeville, Tennessee 38505 (United States)
1996-12-01
The {sup 29}Si({ital p},{gamma}) reaction has been studied for 30 resonances in the range {ital E}{sub {ital p}}=1.75{endash}2.51 MeV. Branching ratios have been measured for 28 of these resonances. The separation energy {ital S}{sub {ital p}} for {sup 30}P has been determined to be 5594.5{plus_minus}0.5 keV. Improved spin, parity, and isospin assignments have been made to a number of the resonant states. A new level has been identified in {sup 30}P at {ital E}{sub {ital x}}=6006 keV, and its {gamma}-ray branching ratios have been measured. {copyright} {ital 1996 The American Physical Society.}
Directory of Open Access Journals (Sweden)
Washington Parks Robyn
2001-07-01
Full Text Available Abstract Background HIV-I can be transmitted by intravenous inoculation of contaminated blood or blood product or sexually through mucosal surfaces. Here we performed a pilot study in the SIVmac251 macaque model to address whether the route of viral entry influences the kinetics of the appearance and the size of virus-specific immune in different tissue compartments. Methods For this purpose, of 2 genetically defined Mamu-A*01-positive macaques, 1 was exposed intravenously and the other intrarectally to the same SIVmac251 viral stock and virus-specific CD8+ T-cells were measured within the first 12 days of infection in the blood and at day 12 in several tissues following euthanasia. Results Virus-specific CD8+ T-cell responses to Gag, Env, and particularly Tat appeared earlier in the blood of the animal exposed by the mucosal route than in the animal exposed intravenously. The magnitude of these virus-specific responses was consistently higher in the systemic tissues and GALT of the macaque exposed by the intravenous route, suggesting a higher viral burden in the tissues as reflected by the faster appearance of virus in plasma. Differences in the ability of the virus-specific CD8+ T-cells to respond in vitro to specific peptide stimulation were also observed and the greatest proliferative ability was found in the GALT of the animal infected by the intrarectal route. Conclusions These data may suggest that the natural mucosal barrier may delay viral spreading. The consequences of this observation, if confirmed in studies with a larger number of animals, may have implications in vaccine development.
International Nuclear Information System (INIS)
Radaelli, Antonia; Nacsa, Janos; Tsai, W.-P.; Edghill-Smith, Yvette; Zanotto, Carlo; Elli, Veronica; Venzon, David; Tryniszewska, Elzbieta; Markham, Phil; Mazzara, Gail P.; Panicali, Dennis; Morghen, Carlo De Giuli; Franchini, Genoveffa
2003-01-01
A therapeutic vaccine for individuals infected with HIV-1 and treated with antiretroviral therapy (ART) should be able to replenish virus-specific CD4+ T-cells and broaden the virus-specific CD8+ T-cell response in order to maintain CD8+ T-cell function and minimize viral immune escape after ART cessation. Because a combination of DNA and recombinant poxvirus vaccine modalities induces high levels of virus-specific CD4+ T-cell response and broadens the cytolytic activity in naive macaques, we investigated whether the same results could be obtained in SIVmac251-infected macaques. The macaques studied here were long-term nonprogressors that naturally contained viremia but were nevertheless treated with a combination of antiviral drugs to assess more carefully the effect of vaccination in the context of ART. The combination of a DNA expressing the gag and pol genes (DNA-SIV-gp) of SIVmac239 followed by a recombinant fowlpox expressing the same SIVmac genes (FP-SIV-gp) was significantly more immunogenic than two immunizations of FP-SIV-gp in SIVmac251-infected macaques treated with ART. The DNA/FP combination significantly expanded and broadened Gag-specific T-cell responses measured by tetramer staining, ELISPOT, and intracellular cytokine staining and measurement of ex vivo cytolytic function. Importantly, the combination of these vaccine modalities also induced a sizeable expansion in most macaques of Gag-specific CD8-(CD4+) T-cells able to produce TNF-α. Hopefully, this modality of vaccine combination may be useful in the clinical management of HIV-1-infected individuals
Zhou, Qifeng; Hidajat, Rachmat; Peng, Bo; Venzon, David; Aldrich, M Kristine; Richardson, Ersell; Lee, Eun Mi; Kalyanaraman, V S; Grimes, George; Gómez-Román, V Raúl; Summers, L Ebonita; Malkevich, Nina; Robert-Guroff, Marjorie
2007-11-19
Oral, replication-competent Ad-HIV vaccines are advancing to human trials. Previous evaluation of protective efficacy in non-human primates has primarily followed upper respiratory tract administrations. Here we compared sequential oral (O/O) versus intranasal/oral (I/O) priming of rhesus macaques with Ad5 host range mutant-SIV recombinants expressing SIV env/rev, gag, and nef genes followed by boosting with SIV gp120 protein. Cellular immune responses in PBMC were stronger and more frequent after I/O administration. Both groups developed mucosal immunity, including memory cells in bronchial alveolar lavage, and gut-homing receptors on PBMC. Following intrarectal SIV(mac251) challenge, both groups exhibited equivalent, significant protection and robust post-challenge cellular immunity. Our results illustrate the promise of oral replication-competent Ad-recombinant vaccines. Pre-challenge PBMC ELISPOT and proliferative responses did not predict protection in the O/O group, highlighting the need for simple, non-invasive methods to reliably assess mucosal immunity.
Demberg, Thorsten; Boyer, Jean D; Malkevich, Nina; Patterson, L Jean; Venzon, David; Summers, Ebonita L; Kalisz, Irene; Kalyanaraman, V S; Lee, Eun Mi; Weiner, David B; Robert-Guroff, Marjorie
2008-11-01
Previously, combination DNA/nonreplicating adenovirus (Ad)- or poxvirus-vectored vaccines have strongly protected against SHIV(89.6P), DNAs expressing cytokines have modulated immunity elicited by DNA vaccines, and replication-competent Ad-recombinant priming and protein boosting has strongly protected against simian immunodeficiency virus (SIV) challenge. Here we evaluated a vaccine strategy composed of these promising components. Seven rhesus macaques per group were primed twice with multigenic SIV plasmid DNA with or without interleukin-12 (IL-12) DNA or IL-15 DNA. After a multigenic replicating Ad-SIV immunization, all groups received two booster immunizations with SIV gp140 and SIV Nef protein. Four control macaques received control DNA plasmids, empty Ad vector, and adjuvant. All vaccine components were immunogenic, but the cytokine DNAs had little effect. Macaques that received IL-15-DNA exhibited higher peak anti-Nef titers, a more rapid anti-Nef anamnestic response postchallenge, and expanded CD8(CM) T cells 2 weeks postchallenge compared to the DNA-only group. Other immune responses were indistinguishable between groups. Overall, no protection against intrarectal challenge with SIV(mac251) was observed, although immunized non-Mamu-A*01 macaques as a group exhibited a statistically significant 1-log decline in acute viremia compared to non-Mamu-A*01 controls. Possible factors contributing to the poor outcome include administration of cytokine DNAs to sites different from the Ad recombinants (intramuscular and intratracheal, respectively), too few DNA priming immunizations, a suboptimal DNA delivery method, failure to ensure delivery of SIV and cytokine plasmids to the same cell, and instability and short half-life of the IL-15 component. Future experiments should address these issues to determine if this combination approach is able to control a virulent SIV challenge.
Dioszeghy, Vincent; Benlhassan-Chahour, Kadija; Delache, Benoit; Dereuddre-Bosquet, Nathalie; Aubenque, Celine; Gras, Gabriel; Le Grand, Roger; Vaslin, Bruno
2006-01-01
Cross-sectional studies have shown that the capacity of CD8+ cells from human immunodeficiency virus (HIV)-infected patients and simian immunodeficiency virus (SIV) SIVmac-infected macaques to suppress the replication of human and simian immunodeficiency viruses in vitro depends on the clinical stage of disease, but little is known about changes in this antiviral activity over time in individual HIV-infected patients or SIV-infected macaques. We assessed changes in the soluble factor-mediated noncytolytic antiviral activity of CD8+ cells over time in eight cynomolgus macaques infected with SIVmac251 to determine the pathophysiological role of this activity. CD8+ cell-associated antiviral activity increased rapidly in the first week after viral inoculation and remained detectable during the early phase of infection. The net increase in antiviral activity of CD8+ cells was correlated with plasma viral load throughout the 15 months of follow-up. CD8+ cells gradually lost their antiviral activity over time and acquired virus replication-enhancing capacity. Levels of antiviral activity correlated with CD4+ T-cell counts after viral set point. Concentrations of beta-chemokines and interleukin-16 in CD8+ cell supernatants were not correlated with this antiviral activity, and alpha-defensins were not detected. The soluble factor-mediated antiviral activity of CD8+ cells was neither cytolytic nor restricted to major histocompatibility complex. This longitudinal study strongly suggests that the increase in noncytolytic antiviral activity from baseline and the maintenance of this increase over time in cynomolgus macaques depend on both viral replication and CD4+ T cells.
Dioszeghy, Vincent; Benlhassan-Chahour, Kadija; Delache, Benoit; Dereuddre-Bosquet, Nathalie; Aubenque, Celine; Gras, Gabriel; Le Grand, Roger; Vaslin, Bruno
2006-01-01
Cross-sectional studies have shown that the capacity of CD8+ cells from human immunodeficiency virus (HIV)-infected patients and simian immunodeficiency virus (SIV) SIVmac-infected macaques to suppress the replication of human and simian immunodeficiency viruses in vitro depends on the clinical stage of disease, but little is known about changes in this antiviral activity over time in individual HIV-infected patients or SIV-infected macaques. We assessed changes in the soluble factor-mediated noncytolytic antiviral activity of CD8+ cells over time in eight cynomolgus macaques infected with SIVmac251 to determine the pathophysiological role of this activity. CD8+ cell-associated antiviral activity increased rapidly in the first week after viral inoculation and remained detectable during the early phase of infection. The net increase in antiviral activity of CD8+ cells was correlated with plasma viral load throughout the 15 months of follow-up. CD8+ cells gradually lost their antiviral activity over time and acquired virus replication-enhancing capacity. Levels of antiviral activity correlated with CD4+ T-cell counts after viral set point. Concentrations of β-chemokines and interleukin-16 in CD8+ cell supernatants were not correlated with this antiviral activity, and α-defensins were not detected. The soluble factor-mediated antiviral activity of CD8+ cells was neither cytolytic nor restricted to major histocompatibility complex. This longitudinal study strongly suggests that the increase in noncytolytic antiviral activity from baseline and the maintenance of this increase over time in cynomolgus macaques depend on both viral replication and CD4+ T cells. PMID:16352548
Directory of Open Access Journals (Sweden)
Nick Orr
2011-09-01
Full Text Available Male breast cancer accounts for approximately 1% of all breast cancer. To date, risk factors for male breast cancer are poorly defined, but certain risk factors and genetic features appear common to both male and female breast cancer. Genome-wide association studies (GWAS have recently identified common single nucleotide polymorphisms (SNPs that influence female breast cancer risk; 12 of these have been independently replicated. To examine if these variants contribute to male breast cancer risk, we genotyped 433 male breast cancer cases and 1,569 controls. Five SNPs showed a statistically significant association with male breast cancer: rs13387042 (2q35 (odds ratio (OR = 1.30, p = 7.98×10⁻⁴, rs10941679 (5p12 (OR = 1.26, p = 0.007, rs9383938 (6q25.1 (OR = 1.39, p = 0.004, rs2981579 (FGFR2 (OR = 1.18, p = 0.03, and rs3803662 (TOX3 (OR = 1.48, p = 4.04×10⁻⁶. Comparing the ORs for male breast cancer with the published ORs for female breast cancer, three SNPs--rs13387042 (2q35, rs3803662 (TOX3, and rs6504950 (COX11--showed significant differences in ORs (p<0.05 between sexes. Breast cancer is a heterogeneous disease; the relative risks associated with loci identified to date show subtype and, based on these data, gender specificity. Additional studies of well-defined patient subgroups could provide further insight into the biological basis of breast cancer development.
Directory of Open Access Journals (Sweden)
Brian Fraser Cumming
2015-08-01
Full Text Available Recently there has been an active discussion about the potential and challenges of tracking past lake-water trophic state using paleolimnological methods. Herein, we present analyses of the relationship between modern-day diatom assemblages from the surface sediments of 251 fresh-water lakes from British Columbia and contemporary limnological variables. Total phosphorus (TP was significantly related to the modern distribution of diatom assemblages. The large size of this new calibration dataset resulted in higher abundances and occurrences of many diatom taxa thereby allowing a more accurate quantification of the optima of diatom taxa to TP in comparison to previous smaller calibration datasets. Robust diatom-based TP inference models with a moderate predictive power were developed using weighted-averaging regression and calibration. Information from the calibration dataset was used to interpret changes in the diatom assemblages from the north and south basins of Osoyoos Lake, in conjunction with fossil pigment analyses. Osoyoos Lake is a large salmon-bearing lake that straddles the British Columbia-Washington border and has undergone cultural eutrophication followed by recovery due to substantial mitigation efforts in managing sources of nutrients. Both diatom assemblages and sedimentary pigments indicate that eutrophication began c. 1950 in the north basin and c. 1960 in the southern basin, reaching peak levels of production between 1960 and 1990, after which decreases in sedimentary pigments occurred, as well as decreases in the relative abundance and concentrations of diatom taxa inferred to have high TP optima. Post-1990 changes in the diatom assemblage suggests conditions have become less productive with a shift to taxa more indicative of lower TP optima in concert with measurements of declining TP, two of these diatom taxa, Cyclotella comensis and Cyclotella gordonensis, that were previously rare are now abundant.
37 CFR 251.31 - Financial interests.
2010-07-01
... any stocks, bonds, or other securities, or deriving any income from the prohibited entity. (c) “Direct or indirect financial interest” shall not include— (1) Owning shares in any stock or bond mutual fund or blind trust which might have an interest in a prohibited entity but whose decisions to invest or...
24 CFR 92.251 - Property standards.
2010-04-01
..., as applicable, one of three model codes: Uniform Building Code (ICBO), National Building Code (BOCA), Standard (Southern) Building Code (SBCCI); or the Council of American Building Officials (CABO) one or two...) Housing that is constructed or rehabilitated with HOME funds must meet all applicable local codes...
2010-01-01
... taken to establish matters of aggravation or mitigation. (b) Objections and offers of proof. (1) A party...) Whenever evidence is excluded from the record, the party offering such evidence may make an offer of proof... the agency as an expert body. Where a decision or part thereof rests on official notice of a material...
2010-04-01
... international organizations when to do so without charge is an appropriate courtesy, or when the recipient is... established business custom (e.g., furnishing personal reference data to prospective employers of former...
2010-07-01
... of royalty fees. This subpart does not apply to other arbitration proceedings specified by 17 U.S.C... Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES COPYRIGHT ARBITRATION ROYALTY PANEL RULES OF PROCEDURE Procedures of...
2010-07-01
... Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES COPYRIGHT ARBITRATION ROYALTY PANEL RULES OF PROCEDURE Royalty Fee... provisions of subpart E generally regulating the conduct of proceedings shall apply to royalty fee...
2010-07-01
... of motion picture, videotaping, sound recording, or any other moving image or audio recording... CFR parts 1500-1508, 7 CFR part 1b, Forest Service Manual Chapter 1950, and Forest Service Handbook... to the operation and support of skiing activities. Sound business management principles—a phrase that...
Publications | Page 251 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
The study assesses water quality change of the Akaki river system since the introduction of ... Local Governance and ICTs in Africa: Case Studies and Guidelines for ... focalization, subsidies on demand, decentralization and privatization.
47 CFR 0.251 - Authority delegated.
2010-10-01
...' comparative qualifications. (d) When an adjudicatory proceeding is before the Commission for the issuance of a... Collection Improvement Act of 1996, Public Law 104-134, 110 Stat. 1321, 1358 (1996) (DCIA), including, but...
2010-07-01
... consideration the reconditioning and maintenance of the government-owned or controlled structures, improvements... (that is, acting in an individual capacity), as opposed to those who are commercial, other corporate, or business or government entities, may, at their option, elect to make either annual payments or payments...
2010-07-01
..., gas, and sulphur mean oil, gas, sulphur, geopressured-geothermal, and associated resources. Outer..., laboratory analyses of physical and chemical properties, well logs or charts, results from formation fluid... authorized to act on the Director's behalf. Exploration means the commercial search for oil, gas, and sulphur...
36 CFR 251.58 - Cost recovery.
2010-07-01
... resulting from an act of God, an act of war, or negligence of the United States; (iv) The application is for... by using the annual rate of change, second quarter to second quarter, in the Implicit Price Deflator...
251 - 258_Hajara_Mobile exhaust
African Journals Online (AJOL)
pc
Furthermore, there was no significant difference based on the type ... environmental stress which could be recommended in high traffic den ... may exert control over their gas exchange rate .... into the plants' system through the openings.
47 CFR 1.251 - Summary decision.
2010-10-01
... an attachment to pleadings filed by him pursuant to paragraph (b) of this section. (b) Within 14 days... or memoranda of law. The presiding officer, giving appropriate weight to the nature of the proceeding... decision to the extent that the pleadings, affidavits, materials obtained by discovery or otherwise...
2010-01-01
... introduction of a new product or service offered for sale at a specified price unless the offeror expects, in... and Labeling Regulation Regarding ‘Cents-Off’ and Guides Against Deceptive Pricing.”) (b) Meaning of... the sale of a product or service (See paragraph (f) of this section), an offer of “Free” merchandise...
2010-07-01
... of coal through indirect heating of the coal through contact with a heat transfer medium. If the... heat transfer medium. (s) Transfer and loading system means any facility used to transfer and load coal... PERFORMANCE FOR NEW STATIONARY SOURCES Standards of Performance for Coal Preparation and Processing Plants...
2010-01-01
... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS AGENCY RELATIONSHIPS WITH... to agency operations and personnel management. (c) The purposes of consultation and communication are... communication with organizations representing Federal employees and with other organizations under this part may...
37 CFR 251.1 - Official addresses.
2010-07-01
..., James Madison Memorial Building, Room LM-401, 101 Independence Avenue, SE., Washington, DC 20559-6000...: Copyright Office General Counsel/CARP, Room 403, James Madison Memorial Building, 101 Independence Avenue...
2010-04-01
... laws of the State, district or territory in which the real estate is located, together with the credit.... (d) The term insured mortgage means a mortgage which has been insured by the endorsement of the credit instrument by the Commissioner, or his duly authorized representative. (e) The term contract of...
2010-04-01
... that stands for “Technology Open to Approved Lenders.” TOTAL is a mortgage scorecard based on a... substitute for the mortgagee's reasonable consideration of risk and credit worthiness. Direct Endorsement...
2010-07-01
... structures and facilities for recreation, public convenience, or safety; (ii) industrial or commercial... stores; (e) Permits or easements for a right-of-way for a pipeline for the transportation of oil, gas, or...
2010-10-01
... HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Public Assistance Insurance Requirements... result of a major disaster. (b) Building means a walled and roofed structure, other than a gas, or liquid storage tank, that is principally above ground and affixed to a permanent site, as well as a manufactured...
2010-07-01
... partnership, limited partnership, joint venture, or individual entrepreneurship, a beneficial ownership of or..., have the intention of returning to it. (2) For corporations, partnerships, limited partnerships, joint ventures, individual entrepreneurships, and other circumstances—where the controlling interest is held by...
Publications | Page 251 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Rules of origin and development of regional production network in Asia : case studies of selected industries (restricted access). Simpler Rules of Origin (RoO) with product specific rules can act as a catalyst in trade even if tariff rates are not low. Sector specific restrictiveness across trade agreements are assessed, in view of ...
H:\\PMKER 25(1)\\PDF 25(1)\\KIKOUN.xps
African Journals Online (AJOL)
AISA
évolution de la richesse, de la pureté ..... Richesse au labo agro = 100 x Somme Tonnes ..... Sugar industry technologists ; NEW YORK, éd. S.I.T. 298 p. Hildebrand C., 2002. An independent assessment of the sugar industry. Report to the Hon Truss ...
H:\\PMKER 25(1)\\PDF 25(1)\\KOTAIX.xps
African Journals Online (AJOL)
AISA
The results showed that the treatment T10 (300 Kg ha-1 mineral fertilizer + 3.75 L ha-1 Dragon 1), better improved growth ... Keywords : Tomato, mineral fertilization, liquid organic fertilization. ...... Nitrogen management : foliar nitrogen application timing influence on grain yield and protein ... Plan directeur du développement.
H:\\PMKER 25(1)\\PDF 25(1)\\EMANFO.xps
African Journals Online (AJOL)
AISA
milieu Potato Dextrose Agar (PDA) en vue de déceler d'éventuels microorganismes. Cette étude a permis de relever la présence de quatre genres de moisissure : Aspergillus, Alternaria, Penicillium et. Fusarium. Certaines espèces appartenant à ces genres sont généralement impliquées dans des mycoses chez les ...
H:\\PMKER 25(1)\\PDF 25(1)\\AMOUKOU.xps
African Journals Online (AJOL)
AISA
leur sécurité alimentaire dans un contexte de variabilité climatique. ... outre, cette étude a comparé le procédé d'extraction de l'huile par le solvant à ... 25 % de la production mondiale, d'où ..... adaptées en zone sahélienne seraient les plus.
H:\\PMKER 25(1)\\PDF 25(1)\\AKOUANGO.xps
African Journals Online (AJOL)
AISA
Pour atteindre ces objectifs, nous avons procédé à la recherche documentaire singulièrement sur l'éthologie des gorilles et à la récolte de données qualitative et quantitative de terrain, suivant la méthode de Masi et al. (2008). Les résultats de cette étude montrent que l'alimentation constitue l'essentiel des activités du ...
H:\\PMKER 25(1)\\PDF 25(1)\\ZOBI.xps
African Journals Online (AJOL)
AISA
moyenne par classe de surface terrière, on obtient la meilleure qualité prédictive du taux ... The evolution of the diameter growth rates shows that liberation thinning has a positive effect on the basal ..... successful management and restoration.
Persu, Alexandre; Lambert, Michel; Deinum, Jaap; Cossu, Marta; de Visscher, Nathalie; Irenge, Leonid; Ambroise, Jerôme; Minon, Jean-Marc; Nesterovitch, Andrew B.; Churbanov, Alexander; Popova, Isolda A.; Danilov, Sergei M.; Danser, A. H. Jan; Gala, Jean-Luc
2013-01-01
Background Angiotensin-converting enzyme (ACE) (EC 4.15.1) metabolizes many biologically active peptides and plays a key role in blood pressure regulation and vascular remodeling. Elevated ACE levels are associated with different cardiovascular and respiratory diseases. Methods and Results Two Belgian families with a 8-16-fold increase in blood ACE level were incidentally identified. A novel heterozygous splice site mutation of intron 25 - IVS25+1G>A (c.3691+1G>A) - cosegregating with elevated plasma ACE was identified in both pedigrees. Messenger RNA analysis revealed that the mutation led to the retention of intron 25 and Premature Termination Codon generation. Subjects harboring the mutation were mostly normotensive, had no left ventricular hypertrophy or cardiovascular disease. The levels of renin-angiotensin-aldosterone system components in the mutated cases and wild-type controls were similar, both at baseline and after 50 mg captopril. Compared with non-affected members, quantification of ACE surface expression and shedding using flow cytometry assay of dendritic cells derived from peripheral blood monocytes of affected members, demonstrated a 50% decrease and 3-fold increase, respectively. Together with a dramatic increase in circulating ACE levels, these findings argue in favor of deletion of transmembrane anchor, leading to direct secretion of ACE out of cells. Conclusions We describe a novel mutation of the ACE gene associated with a major familial elevation of circulating ACE, without evidence of activation of the renin-angiotensin system, target organ damage or cardiovascular complications. These data are consistent with the hypothesis that membrane-bound ACE, rather than circulating ACE, is responsible for Angiotensin II generation and its cardiovascular consequences. PMID:23560051
Time Warp Operating System, Version 2.5.1
Bellenot, Steven F.; Gieselman, John S.; Hawley, Lawrence R.; Peterson, Judy; Presley, Matthew T.; Reiher, Peter L.; Springer, Paul L.; Tupman, John R.; Wedel, John J., Jr.; Wieland, Frederick P.;
1993-01-01
Time Warp Operating System, TWOS, is special purpose computer program designed to support parallel simulation of discrete events. Complete implementation of Time Warp software mechanism, which implements distributed protocol for virtual synchronization based on rollback of processes and annihilation of messages. Supports simulations and other computations in which both virtual time and dynamic load balancing used. Program utilizes underlying resources of operating system. Written in C programming language.
43 CFR 2.51 - Assuring integrity of records.
2010-10-01
... on those recommended in the National Bureau of Standard's booklet “Computer Security Guidelines for..., technical and physical safeguards to insure the security and confidentiality of records and to protect against any anticipated threats or hazards to their security or integrity which could result in...
7 CFR 764.251 - Operating loan uses.
2010-01-01
...) Farm operating expenses, including, but not limited to, feed, seed, fertilizer, pesticides, farm supplies, repairs and improvements which are to be expensed, cash rent and family living expenses; (4... non-compliance with the standards will cause substantial economic injury; (9) Borrower training costs...
37 CFR 251.45 - Discovery and prehearing motions.
2010-07-01
...) Request for comment, notice of intention to participate. In the case of a royalty fee distribution..., filing of written cases, scheduling. (1)(i) In the case of a royalty fee distribution proceeding, the... COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES COPYRIGHT ARBITRATION ROYALTY PANEL RULES OF...
7 CFR 251.9 - Matching of funds.
2010-01-01
... otherwise be allowable as State or local-level administrative costs. (1) Cash. An allowable cash... State- or local-level administrative costs for which there has been a cash outlay by the State agency...-cash goods or services specifically identifiable with allowable State-level administrative costs or...
17 CFR 230.251 - Scope of exemption.
2010-04-01
... received in a foreign currency shall be translated into United States currency at a currency exchange rate... Company Act of 1940 (15 U.S.C. 80a-1 et seq.); (5) Is not issuing fractional undivided interests in oil or gas rights as defined in § 230.300, or a similar interest in other mineral rights; and (6) Is not...
Lifescience Database Archive (English)
Full Text Available srasevg mixed_tissue Sebastes... 32 0.80 2 dna update 2008.11. 7 Homology vs Protein Score E Sequences prod...( AM954142 ) Sparus aurata EST, clone cDN02P0004P17, 5'-end se... 32 0.80 2 ( EW981227 ) EST_sras_evg_782073
37 CFR 251.37 - Use of nonpublic information.
2010-07-01
... arbitrator shall disclose in any manner any information contained in filings, pleadings, or evidence that the arbitration panel has ruled to be confidential in nature. (b) Unless required by law, no arbitrator shall...
7 CFR 3550.251 - Property management and disposition.
2010-01-01
... property through direct sales, sealed bid, or auction. RHS will follow affirmative fair housing marketing.... RHS will also notify any potential purchaser of any known lead-based paint hazards. (3) Property on... housing during the first 60 days after the date of the first notice of sale, and during the first 30 days...
48 CFR 952.251-70 - Contractor employee travel discounts.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contractor employee travel... Contractor employee travel discounts. As prescribed in 951.7002, insert the following clause: Contractor Employee Travel Discounts (AUG 2009) (a) The Contractor shall take advantage of travel discounts offered to...
Correction [Physics Today, v. 25(1) p. 53
International Nuclear Information System (INIS)
1972-01-01
November 1971, page 37—The figure illustrating estimated radiation doses in Joseph Lieberman's article was credited to the Division of Criteria and Standards, Office of Radiation Programs of the Environmental Protection Agency. Lieberman tells us that the data presented there should be attributed to an interagency special‐studies group working with the Criteria and Standards division; the participating agencies were the Department of Defense, the Department of Health, Education and Welfare, the Atomic Energy Commission and the Environmental Protection Agency. Their final report is due to be issued in June.
37 CFR 251.35 - Outside employment and other activities.
2010-07-01
... the arbitrator's knowledge and acquiescence to the arbitrator's parent, sibling, spouse, child, or dependent relative because of that person's relationship to the arbitrator, or (2) Given to any other person...
36 CFR 251.55 - Nature of interest.
2010-07-01
... determined by the authorized officer for any mineral and vegetative materials (including timber) to be cut, removed, used, or destroyed by the holder from the authorized use area or other National Forest System... States, including but not limited to (1) continuing rights of access to all National Forest System land...
29 CFR 1926.251 - Rigging equipment for material handling.
2010-07-01
..., shall consist of one continuous piece without knot or splice. (iii) Eyes in wire rope bridles, slings... splices shall contain at least three full tucks, and short splices shall contain at least six full tucks... tails shall project at least six rope diameters beyond the last full tuck. For fiber ropes 1-inch...
All projects related to | Page 251 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Program: Food, Environment, and Health. Total Funding: CA$ 509,050.00. Rethinking Political Legitimacy: Citizen Inclusion and Social Digital Media. Project. In Chile, a mobilized, invigorated civil society is using new digital technologies to ...
37 CFR 251.48 - Rules of evidence.
2010-07-01
... Executive Department, a legislative agency or committee, or a Federal administrative agency (Government... summary of their assumptions, their study plans, and their procedures. Supplementary details shall be... furnished: (1) Sample surveys. (i) A clear description of the survey design, the definition of the universe...
76 FR 251 - Country of Origin Labeling of Packed Honey
2011-01-04
... percent), Argentina (11 percent), Malaysia (9 percent), and Canada (9 percent). Imports accounted for 62... processed product shall bear a brand name, trademark, product name, company name, or any other descriptive... pre-existing Federal laws and regulations, country of origin labeling is required by the Tariff Act of...
AF-Geospace User’s Manual Version 2.5.1 and Version 2.51P
2012-08-01
SECURITY CLASSIFICATION OF: 17. LIMITATION OF ABSTRACT 18. NUMBER OF PAGES 19a. NAME OF RESPONSIBLE PERSON Adrian Wheelock a. REPORT...Australids (202-214) 27 Jul 2.89 21Jul-02Aug 42.0 delta-Aquarids(S) (185-232) 28 Jul 11.37 04Jul-20Aug 43.0 iota -Aquarids(S) (198-233
Actinide production in the reaction of heavy ions with curium-248
International Nuclear Information System (INIS)
Moody, K.J.
1983-07-01
Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined
100 mg 251Cf activation analysis facility at the Savannah River Laboratory
International Nuclear Information System (INIS)
MacMurdo, K.W.; Bowman, W.W.
1975-01-01
The 252 Cf Activation Analysis Facility at the Savannah River Laboratory (SRL) is used routinely for multielement analyses of a wide variety of solid and liquid samples (e.g., metal alloys, fly ash and other airborne particles, rocks, and aqueous and nonaqueous solutions). An automated absolute activation analysis technique, developed to use neutron transport codes to calculate multienergy group neutron spectra and fluxes, converts counting data directly into elemental concentrations expressed in parts per million. The facility contains four sources of 252 Cf totaling slightly over 100 mg. A pneumatic ''rabbit'' system permits automatic irradiation/decay/counting regimes to be performed unattended on up to 100 samples. Detection sensitivities of less than or equal to 400 ppb natural uranium and less than or equal to 0.5 nCi/g for 239 Pu are observed. Detection limits for over 65 elements have been determined. Over 40 elements are detectable at the one part per million level or less. Overall accuracies of +- 10 percent are observed for most elements. (auth)
30 CFR 251.7 - Test drilling activities under a permit.
2010-07-01
... with special attention to safety, pollution prevention, oil-spill containment and cleanup plans, and... advertising period if you begin operations before the advertising period is over. The names of any subsequent...
37 CFR 251.46 - Conduct of hearings: Role of arbitrators.
2010-07-01
... shall have responsibility for: (1) Setting the order of presentation of evidence and appearance of... decorum of the parties and their counsel, and insuring that the proceedings are fair and impartial; and (5...
Wang et al., Afr J Tradit Complement Altern Med. (2013) 10(2):251 ...
African Journals Online (AJOL)
AJTCAM
perilla suppressed HCC tumor growth via blocking PI3K/Akt signaling pathway. ... Two hepatoma cell carcinoma-derived cell line-Huh-7 and Hep3B were used as ... system and quantified by Genetools software. β-tubulin was considered as a ...
36 CFR 251.124 - Preferred operator competitive special use authorization procedures.
2010-07-01
... entrepreneurship, nonprofit entity, or other form of organization shall be considered valid only when the... entrepreneurship, nonprofit entity, or other form of organization. (f) A qualified preferred operator shall be... shall be given the opportunity, by amending its application, to meet the terms and conditions of the...
37 CFR 251.54 - Assessment of costs of arbitration panels.
2010-07-01
... Accounting Operations Section, Financial Services Directorate, Library of Congress, 101 Independence Avenue... Service and similar corporate courier services), use the following address: Copyright Office General... corporate courier services may not be used for correspondence and filings for the Copyright Arbitration...
People and things. CERN Courier, Jan-Feb 1985, v. 25(1)
Energy Technology Data Exchange (ETDEWEB)
Anon.
1985-01-15
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The General Assembly of the International Union of Pure and Applied Physics (IUPAP) met in Trieste in October. At this meeting the People 's Republic of China became a full member of IUPAP. Last year, voting took place for the new Executive Committee of the Division of Particles and Fields of the American Physical Society. A NATO Advanced Study Institute 'New Vistas in Electro-Nuclear Physics' will be held in Banff, Alberta, Canada, from 22 August to 4 September. The 1985 International Symposium on Lepton and Photon Interactions at High Energies is being held in Kyoto from 19-24 August. A conference on Computing in High Energy Physics will be held at Amsterdam, the Netherlands University of Amsterdam and will be devoted mainly to three subjects: networking, embedded systems and vector and parallel processing. The 1985 CERN/Joint Institute for Nuclear Research (JINR, Dubna, USSR) School of Physics, the ninth in the series, will be held from 1-14 September at Urbino, Italy. The basic aim of these schools is to teach various aspects of high energy physics, especially theoretical, to young experimentalists drawn mainly from CERN and JINR Member States.
People and things. CERN Courier, Jan-Feb 1985, v. 25(1)
International Nuclear Information System (INIS)
Anon.
1985-01-01
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The General Assembly of the International Union of Pure and Applied Physics (IUPAP) met in Trieste in October. At this meeting the People 's Republic of China became a full member of IUPAP. Last year, voting took place for the new Executive Committee of the Division of Particles and Fields of the American Physical Society. A NATO Advanced Study Institute 'New Vistas in Electro-Nuclear Physics' will be held in Banff, Alberta, Canada, from 22 August to 4 September. The 1985 International Symposium on Lepton and Photon Interactions at High Energies is being held in Kyoto from 19-24 August. A conference on Computing in High Energy Physics will be held at Amsterdam, the Netherlands University of Amsterdam and will be devoted mainly to three subjects: networking, embedded systems and vector and parallel processing. The 1985 CERN/Joint Institute for Nuclear Research (JINR, Dubna, USSR) School of Physics, the ninth in the series, will be held from 1-14 September at Urbino, Italy. The basic aim of these schools is to teach various aspects of high energy physics, especially theoretical, to young experimentalists drawn mainly from CERN and JINR Member States
36 CFR 251.123 - Most directly affected Native Corporation determination.
2010-07-01
... affected by the establishment or expansion of the CSU under section 1307(b) of ANILCA (16 U.S.C. 1397(b... landownership patterns) on the Native Corporation resulting from establishment or expansion of the applicable... Native Corporation's population centers and/or business address to the applicable CSU; (2) Socioeconomic...
Physics in a spin. CERN Courier, Jan-Feb 1985, v. 25(1)
International Nuclear Information System (INIS)
Anon.
1985-01-01
About two hundred physicists travelled to Marseille in September to attend the 6th International Symposium on High Energy Spin Physics, it gathered specialists in polarization physics from all over the world. The meeting reflected optimism about the future of spin physics, an optimism clearly driven by the successful start-up of many new polarized beam projects and by the discovery of several new spin effects. The topics covered included spin effects at large transverse momentum, hyperon polarization, analysing power in elastic processes, and experiments at intermediate energies including dibaryon resonances. There were reports on new polarized beam developments at many Laboratories and on perspectives, plans, and theoretical predictions for the spin physics in future machines
: tous les projets | Page 251 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
La maladie de Chagas, une maladie grave à transmission vectorielle, impose une lourde charge de morbidité aux populations pauvres de l'Amérique latine et des Caraïbes (région ALC). Date de début : 31 mars 2011. End Date: 31 mars 2014. Sujet: TRYPANOSOMIASIS, ENVIRONMENTAL ENGINEERING, ...
37 CFR 251.34 - Gifts and other things of monetary value.
2010-07-01
... under circumstances in which it is clear that the gift is motivated by a family relationship or personal... acquiescence to the arbitrator's parent, sibling, spouse, child, or dependent relative because of that person's relationship to the arbitrator, or (2) Given to any other person, including any charitable organization, on the...
Dynamics of viral replication in blood and lymphoid tissues during SIVmac251 infection of macaques
Directory of Open Access Journals (Sweden)
Mannioui Abdelkrim
2009-01-01
Full Text Available Abstract Background Extensive studies of primary infection are crucial to our understanding of the course of HIV disease. In SIV-infected macaques, a model closely mimicking HIV pathogenesis, we used a combination of three markers -- viral RNA, 2LTR circles and viral DNA -- to evaluate viral replication and dissemination simultaneously in blood, secondary lymphoid tissues, and the gut during primary and chronic infections. Subsequent viral compartmentalization in the main target cells of the virus in peripheral blood during the chronic phase of infection was evaluated by cell sorting and viral quantification with the three markers studied. Results The evolutions of viral RNA, 2LTR circles and DNA levels were correlated in a given tissue during primary and early chronic infection. The decrease in plasma viral load principally reflects a large decrease in viral replication in gut-associated lymphoid tissue (GALT, with viral RNA and DNA levels remaining stable in the spleen and peripheral lymph nodes. Later, during chronic infection, a progressive depletion of central memory CD4+ T cells from the peripheral blood was observed, accompanied by high levels of viral replication in the cells of this subtype. The virus was also found to replicate at this point in the infection in naive CD4+ T cells. Viral RNA was frequently detected in monocytes, but no SIV replication appeared to occur in these cells, as no viral DNA or 2LTR circles were detected. Conclusion We demonstrated the persistence of viral replication and dissemination, mostly in secondary lymphoid tissues, during primary and early chronic infection. During chronic infection, the central memory CD4+ T cells were the major site of viral replication in peripheral blood, but viral replication also occurred in naive CD4+ T cells. The role of monocytes seemed to be limited to carrying the virus as a cargo because there was an observed lack of replication in these cells. These data may have important implications for the targeting of HIV treatment to these diverse compartments.
49 CFR 40.251 - What are the first steps in an alcohol confirmation test?
2010-10-01
... or STT conducted the screening test. (c) Complete Step 1 of the ATF. (d) Direct the employee to... ensure that the waiting period lasts at least 15 minutes, starting with the completion of the screening..., but not more than 30 minutes after the completion of the screening test. (i) If the confirmation test...
Chromosome 15q25.1 genetic markers associated with level of response to alcohol in humans.
Joslyn, Geoff; Brush, Gerry; Robertson, Margaret; Smith, Tom L; Kalmijn, Jelger; Schuckit, Marc; White, Raymond L
2008-12-23
As with other genetically complex common psychiatric and medical conditions, multiple genetic and environmental components contribute to alcohol use disorders (AUDs), which can confound attempts to identify genetic components. Intermediate phenotypes are often more closely correlated with underlying biology and have often proven invaluable in genetic studies. Level of response (LR) to alcohol is an intermediate phenotype for AUDs, and individuals with a low LR are at increased risk. A high rate of concurrent alcohol and nicotine use and dependence suggests that these conditions may share biochemical and genetic mechanisms. Genetic association studies indicate that a genetic locus, which includes the CHRNA5-CHRNA3-CHRNB4 gene cluster, plays a role in nicotine consumption and dependence. Genetic association with alcohol dependence was also recently shown. We show here that two of the markers from the nicotine studies also show an association (multiple testing corrected P a sample of 367 siblings. Additional markers in the region were analyzed and shown to be located in a 250-kb expanse of high linkage disequilibrium containing three additional genes. These findings indicate that LR intermediate phenotypes have utility in genetic approaches to AUDs and will prove valuable in the identification of other genetic loci conferring susceptibility to AUDs.
2010-07-01
... prospect for, mine and remove minerals, oil, gas, or other inorganic substances, said reservations shall be... repair, replacement or restoration. (iv) Failure to comply with the terms and conditions of the aforesaid...
2010-07-01
... information, and interpreted geophysical information including, but not limited to, shallow and deep subbottom...) You must notify the Regional Director, in writing, when you complete the initial processing and interpretation of any geophysical data and information. Initial processing is the stage of processing where the...
2010-10-01
... standardized ship construction, when the applicant feels that a new design is necessary in exceptional cases... days preceding bid opening. Any changes desired by the owner which do not adversely affect the safe...
Intake assessment of the food additives nitrite (E 249 and E 250) and nitrate (E 251 and E 252)
Sprong RC; Niekerk EM; Beukers MH; VVH; V&Z
2017-01-01
Nitrate and nitrite are authorised as preservatives in certain food products, such as salami, ham (nitrite) and cheese (nitrate). They prevent food spoilage and protect the consumer against food-borne pathogens. Next to that, nitrate and nitrite play a role in food colour retention and contribute to
Veen, Bart A. van der; Alebeek, Gert-Jan W.M. van; Uitdehaag, Joost C.M.; Dijkstra, Bauke W.; Dijkhuizen, Lubbert
Cyclodextrin glycosyltransferase (CGTase) catalyzes three transglycosylation reactions via a double displacement mechanism involving a covalent enzyme-intermediate complex (substituted-enzyme intermediate). Characterization of the three transglycosylation reactions, however, revealed that they
Entrevista com Luise Von Flotow.DOI: 10.5007/2175-7968.2011v2n28p251
Directory of Open Access Journals (Sweden)
Luciana Wrege Rassier
2011-12-01
Full Text Available Luise von Flotow, de dupla cidadania – canadense e alemã, é professora e atual diretora da School of Translation and Interpretation da Universidade de Ottawa, Canadá. Suas principais áreas de interesse são as influências políticas e ideológicas na tradução, especialmente questões de gênero; tradução audio-visual, dublagem e legendagem; tradução literária como diplomacia pública. A pesquisadora atua também como tradutora literária do alemão e do francês para o inglês, havendo traduzido diversas obras de escritoras alemãs (Christa Wolf, Herta Müller, Ulrike Meinhof, e algumas de escritores (Thomas Brasch, Martin Walser, das escritoras do Québec France Theoret, Anne Dandurand, Claire Dé, Hélène Rioux, Madeleine Ouellette-Michalska, de várias autoras do Leste Europeu, além de textos teóricos sobre tradução. Possui uma vasta lista de publicações de livros, artigos e capítulos de livros na área dos Estudos da Tradução. Um livro de grande destaque foi Translation and Gender, publicado em 1997, traduzido na China e na República Tcheca. Agora ela acaba de lançar o livro Translating Women, que reúne artigos de diversos teóricos e teóricas dos Estudos da Tradução em torno das mais recentes pesquisas realizadas na interface Estudos de Gênero/Feministas e Estudos da Tradução. Foi professora visitante em universidades de diversos países ao redor do mundo: Espanha, Noruega, Chile, Argentina, México, Áustria, Portugal, Irã, Equador, Estados Unidos, Brasil. Sua viagem para a América Latina neste ano tem como objetivo divulgar e encontrar parcerias para um amplo projeto de pesquisa que está sendo realizado pelas universidades de Ottawa e de Concórdia.
Jamhiri, Iman; Saadat, Iraj; Omidvari, Shahpour
2017-01-01
Oxidative stress is significant in numerous types of disease including cancer. To protect cells and organs against reactive oxygen species (ROS), the body has evolved an antioxidant protection system that involved in the detoxification of ROS. Single nucleotide polymorphisms (SNP) of anti-oxidative enzymes may dramatically change the activity of the encoded proteins; therefore, certain alleles can be established as risk factors for some kind of multi-factorial diseases including cancer. In pr...
Decree no. 2004-251 from March 19, 2004 relative to public utility obligations in the gas sector
International Nuclear Information System (INIS)
2004-03-01
This decree defines the public utility obligations that gas suppliers and gas facility operators (transportation and distribution networks, underground storage facilities, LNG facilities) have to fulfill in order to ensure without interruption the continuity of gas supplies to their clients. (J.S.)
SU-E-J-251: Fast MR-Based DRR Generation Using Highly Undersampled 3D Radial Trajectories
International Nuclear Information System (INIS)
Pereira, G; Traughber, B; Traughber, M; Hu, L; Su, K; Muzic, R
2014-01-01
Purpose: The construction of a digitally reconstructed radiograph (DRR) from a magnetic resonance image (MRI) is possible if the cortical bone signal can be acquired and separated from air and soft tissue. This may be accomplished by subtracting a long echo-time, in-phase, gradient echo (GRE) image volume from an ultra-short echo time free induction decay (FID) image to produce a bone-enhanced (BE) image that reveals cortical bone. One limitation of this approach is the length of time required for data acquisition, which can limit the quality of the DRRs due to patient and organ motion. This study aimed to significantly reduce the acquisition time without compromising DRR quality. Methods: Brain data were acquired from two volunteers using a 3T MR scanner (Ingenia, Philips Healthcare). The FID and GRE images were acquired in a single acquisition using a 3D radial readout sequence with the following parameters: TE1=0.142ms (ultra-short), TE2=2.197ms (nearly in-phase), 2*2*2mm3 isotropic voxels, 250*250*250mm3 FOV. To reduce the acquisition time, k-space was sampled at 75, 50 and 25% of a full 3D sphere . The TE2 image was subtracted from the TE1 image to generate the BE images. The BE images were used to generate DRRs using the Pinnacle treatment planning system (Philips-version 9.2). The quality of the DRRs was evaluated qualitatively by 5 board certified medical physicists for clinical usefulness. Results: The acquisition time for 75, 50 and 25% sampling schemes were 219s, 146s, and 73s, respectively, the latter of which was a four-fold reduction in scan time compared to a 300s fully-sampled acquisition. All DRRs obtained were of acceptable quality and were shown to have sufficient information for clinical 2D image matching. Conclusion: Undersampling k-space while maintaining the same range of frequency information results in significantly reduced scan time and clinically acceptable DRR image quality. Drs. B Traughber and R Muzic have research support from Philips Healthcare. Drs. M Traughber and L Hu are employees of Philips Healthcare
2010-07-01
... agreement, or other means. (2) The Regional Director may ask if you have further analyzed, processed, or... permittee, or from another third party, by sale, trade, license agreement, or other means. If this happens... accepting these obligations is a condition precedent of the sale, trade, license, or other agreement; and (3...
2010-07-01
... timber products and in locating, constructing and using mills, logging roads, railroads, chutes, landings..., and to young growth or to trees left standing. All survey monuments and witness trees shall be preserved. (3) All trees, timber or timber products of species or sizes not specifically reserved which are...
Takahashi, T; Hiraga, A; Ohmura, H; Kai, M; Jones, J H
2001-05-01
To determine the frequency of epistaxis during or after racing among racehorses and identify factors associated with development of epistaxis. Retrospective study. 247,564 Thoroughbred and 4,045 Anglo-Arab race starts. Race start information (breed, age, sex, racing distance, and race type) was obtained for Thoroughbred and Anglo-Arab horses racing in Japan Racing Association-sanctioned races between 1992 and 1997. All horses that raced were examined by a veterinarian within 30 minutes of the conclusion of the race; any horse that had blood at the nostrils was examined with an endoscope. If blood was observed in the trachea, epistaxis related to exercise-induced pulmonary hemorrhage (EIPH) was diagnosed. Epistaxis related to EIPH was identified following 369 race starts (0.15%). Frequency of EIPH-related epistaxis was significantly associated with race type, age, distance, and sex. Epistaxis was more common following steeplechase races than following flat races, in older horses than in horses that were 2 years old, following races horses that had an episode of epistaxis, the recurrence rate was 4.64%. Results suggested that frequency of EIPH-related epistaxis in racehorses is associated with the horse's age and sex, the type of race, and the distance raced. The higher frequency in shorter races suggests that higher intensity exercise of shorter duration may increase the probability of EIPH.
http://periodicos.ufsc.br/index.php/gual/article/view/1983-4535.2012v5n2p251/22582
Directory of Open Access Journals (Sweden)
Alexandre Costa Quintana
2012-08-01
Full Text Available The process of virtual learning passes for the necessity of the existence of an evaluation process. Normally, this evaluation is integrated by a virtual part and another class attendance. The posting of the task becomes an important communication tool between students, teachers and tutors, as it enables the exchange of information between those involved, besides serving as a component of assessment and therefore reflecting the development of teaching-learning process.In this direction the objective of this work is in the distance to analyze the form of execution of the virtual tasks of the pupil of the course of graduation in Administration at distance. This work was elaborated, by means of a descriptive research, with analysis of content and a qualitative boarding. Concluding that the results of this study show that teachers, tutors and coordination of distance courses have attention on the needs of students in relation to time for implementation, appropriate date for posting and service to academics, that in understanding these will be key to the tasks are actually an important tool in the teaching-learning.
International Nuclear Information System (INIS)
Anthony, G; Cunliffe, A; Armato, S; Al-Hallaq, H; Castillo, R; Pham, N; Guerrero, T
2015-01-01
Purpose: To determine whether the addition of standardized uptake value (SUV) statistical variables to CT lung texture features can improve a predictive model of radiation pneumonitis (RP) development in patients undergoing radiation therapy. Methods: Anonymized data from 96 esophageal cancer patients (18 RP-positive cases of Grade ≥ 2) were retrospectively collected including pre-therapy PET/CT scans, pre-/posttherapy diagnostic CT scans and RP status. Twenty texture features (firstorder, fractal, Laws’ filter and gray-level co-occurrence matrix) were calculated from diagnostic CT scans and compared in anatomically matched regions of the lung. The mean, maximum, standard deviation, and 50th–95th percentiles of the SUV values for all lung voxels in the corresponding PET scans were acquired. For each texture feature, a logistic regression-based classifier consisting of (1) the average change in that texture feature value between the pre- and post-therapy CT scans and (2) the pre-therapy SUV standard deviation (SUV SD ) was created. The RP-classification performance of each logistic regression model was compared to the performance of its texture feature alone by computing areas under the receiver operating characteristic curves (AUCs). T-tests were performed to determine whether the mean AUC across texture features changed significantly when SUV SD was added to the classifier. Results: The AUC for single-texturefeature classifiers ranged from 0.58–0.81 in high-dose (≥ 30 Gy) regions of the lungs and from 0.53–0.71 in low-dose (< 10 Gy) regions. Adding SUVSD in a logistic regression model using a 50/50 data partition for training and testing significantly increased the mean AUC by 0.08, 0.06 and 0.04 in the low-, medium- and high-dose regions, respectively. Conclusion: Addition of SUVSD from a pre-therapy PET scan to a single CT-based texture feature improves RP-classification performance on average. These findings demonstrate the potential for more accurate prediction of RP using information from multiple imaging modalities. Supported, in part, by the National Institute of Biomedical Imaging and Bioengineering of the National Institutes of Health under grant number T32 EB002103; SGA receives royalties and licensing fees through the University of Chicago for computer-aided diagnosis technology. HA receives royalties through the University of Chicago for computer-aided diagnosis technology
1981-12-01
CC + I& CY STCNE FILL PROTECTION SCHEME 3 ALLEGHENY RIVER FLOW NOT TO SCALE -. -2’ kofnimuim Width At Top of dank LEevatlon (Variable) - StonO F111...exposed to various types of pollution which tend to affect aquatic life and generally detract from the aesthetic value of the river. Organic matter
Czech Academy of Sciences Publication Activity Database
Childs, E.J.; Mocci, E.; Campa, D.; Bracci, P. M.; Gallinger, S.; Goggins, M.; Li, D.; Neale, R.E.; Olson, S. H.; Scelo, G.; Amundadottir, L. T.; Bamlet, W.R.; Bijlsma, M.F.; Blackford, A.; Borges, M.; Brennan, P.; Brenner, H.; Bueno-de-Mesquita, H. B.; Canzian, F.; Capurso, G.; Cavestro, G.M.; Chaffee, K.G.; Chanock, S. J.; Cleary, S.P.; Cotterchio, M.; Foretová, L.; Fuchs, Ch.; Funel, N.; Gazouli, M.; Hassan, M.; Herman, J.M.; Holcatová, I.; Holly, E. A.; Hoover, R.N.; Hung, R.J.; Janout, V.; Key, T.J.; Kupcinskas, J.; Kurtz, R. C.; Landi, S.; Lu, S.; Malecka-Panas, E.; Mambrini, A.; Mohelníková-Duchoňová, B.; Neoptolemos, J.P.; Oberg, A. L.; Orlow, I.; Pasquali, C.; Pezzilli, R.; Rizzato, C.; Saldia, A.; Scarpa, A.; Stolzenberg-Solomon, R. S.; Strobel, O.; Tavano, F.; Vashist, Y.K.; Vodička, Pavel; Wolpin, B. M.; Yu, H.; Petersen, G.; Risch, H. A.; Klein, A. P.
2015-01-01
Roč. 47, č. 8 (2015), s. 911-918 ISSN 1061-4036 R&D Projects: GA MZd NR9422; GA ČR GAP301/12/1734 Institutional support: RVO:68378041 Keywords : genome-wide association * genotype imputation * lung adenocarcinoma * cigarette-smoking * genetic-variation * alpha-gene * risk * loci * population * mutations Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 31.616, year: 2015
Energy Technology Data Exchange (ETDEWEB)
Anthony, G; Cunliffe, A; Armato, S; Al-Hallaq, H [The University of Chicago, Chicago, IL (United States); Castillo, R [Univ Texas Medical Branch of Galveston, Pearland, TX (United States); Pham, N [Baylor College of Medicine, Houston, TX (United States); Guerrero, T [Beaumont Health System, Royal Oak, MI (United States)
2015-06-15
Purpose: To determine whether the addition of standardized uptake value (SUV) statistical variables to CT lung texture features can improve a predictive model of radiation pneumonitis (RP) development in patients undergoing radiation therapy. Methods: Anonymized data from 96 esophageal cancer patients (18 RP-positive cases of Grade ≥ 2) were retrospectively collected including pre-therapy PET/CT scans, pre-/posttherapy diagnostic CT scans and RP status. Twenty texture features (firstorder, fractal, Laws’ filter and gray-level co-occurrence matrix) were calculated from diagnostic CT scans and compared in anatomically matched regions of the lung. The mean, maximum, standard deviation, and 50th–95th percentiles of the SUV values for all lung voxels in the corresponding PET scans were acquired. For each texture feature, a logistic regression-based classifier consisting of (1) the average change in that texture feature value between the pre- and post-therapy CT scans and (2) the pre-therapy SUV standard deviation (SUV{sub SD}) was created. The RP-classification performance of each logistic regression model was compared to the performance of its texture feature alone by computing areas under the receiver operating characteristic curves (AUCs). T-tests were performed to determine whether the mean AUC across texture features changed significantly when SUV{sub SD} was added to the classifier. Results: The AUC for single-texturefeature classifiers ranged from 0.58–0.81 in high-dose (≥ 30 Gy) regions of the lungs and from 0.53–0.71 in low-dose (< 10 Gy) regions. Adding SUVSD in a logistic regression model using a 50/50 data partition for training and testing significantly increased the mean AUC by 0.08, 0.06 and 0.04 in the low-, medium- and high-dose regions, respectively. Conclusion: Addition of SUVSD from a pre-therapy PET scan to a single CT-based texture feature improves RP-classification performance on average. These findings demonstrate the potential for more accurate prediction of RP using information from multiple imaging modalities. Supported, in part, by the National Institute of Biomedical Imaging and Bioengineering of the National Institutes of Health under grant number T32 EB002103; SGA receives royalties and licensing fees through the University of Chicago for computer-aided diagnosis technology. HA receives royalties through the University of Chicago for computer-aided diagnosis technology.
Safety analysis report for packaging: neutron shipping cask, model 0.5T
International Nuclear Information System (INIS)
Peterson, R.T.
1976-01-01
The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual
Directed evolution of the periodic table: probing the electronic structure of late actinides.
Marsh, M L; Albrecht-Schmitt, T E
2017-07-25
Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.
Ponte, Rosalie
2014-01-01
As a model to study type 1 human immunodeficiency virus (HIV-1) pathogenesis, rhesus macaques infected with the simian immunodeficiency virus (SIV) are under extensive investigation. Two subspecies of rhesus macaques have been defined, based on a different geographic origin. Indian rhesus macaques exhibit a rapid disease progression and acute infection is characterized by a massive CD4 T-cell loss in the intestinal mucosa. This was associated to the translocation of bacterial products through...
International Nuclear Information System (INIS)
Xie, J; Wang, J; Peng, J; Chen, J; Hu, W
2016-01-01
Purpose: To implement an entire workflow quality assurance (QA) process in the radiotherapy department and to reduce the error rates of radiotherapy based on the entire workflow management in the developing country. Methods: The entire workflow QA process management starts from patient registration to the end of last treatment including all steps through the entire radiotherapy process. Error rate of chartcheck is used to evaluate the the entire workflow QA process. Two to three qualified senior medical physicists checked the documents before the first treatment fraction of every patient. Random check of the treatment history during treatment was also performed. A total of around 6000 patients treatment data before and after implementing the entire workflow QA process were compared from May, 2014 to December, 2015. Results: A systemic checklist was established. It mainly includes patient’s registration, treatment plan QA, information exporting to OIS(Oncology Information System), documents of treatment QAand QA of the treatment history. The error rate derived from the chart check decreases from 1.7% to 0.9% after our the entire workflow QA process. All checked errors before the first treatment fraction were corrected as soon as oncologist re-confirmed them and reinforce staff training was accordingly followed to prevent those errors. Conclusion: The entire workflow QA process improved the safety, quality of radiotherapy in our department and we consider that our QA experience can be applicable for the heavily-loaded radiotherapy departments in developing country.
International Nuclear Information System (INIS)
Gleitz, C.D.; Freihorst, J.
1985-01-01
The physical and biological fundamentals of radiology and radiation protection are presented. Methods of diagnostic radiology and nuclear medicine are outlined, and the fundamentals of radiotherapy are discussed. Original examination questions in radiology are presented together with the correct answers. (HP) [de
International Nuclear Information System (INIS)
Brown, B.W.; Feige, E.J.; Galbraith, S.G.; Porter, A.M.
1995-02-01
This report presents the results of the evaluation of the Turkey Point Nuclear Power Plant, Units 3 and 4, Third 10-Year Interval Inservice Inspection Program Plan, Revision 0, submitted September 9, 1993, including the requests for relief from the American Society of Mechanical Engineers (ASME) Boiler and Pressure Vessel Code, Section XI, requirements that the licensee has determined to be impractical. The Turkey Point Nuclear Power Plant, Units 3 and 4, Third 10-Year Interval Inservice Inspection Program Plan is evaluated in Section 2 of this report. The inservice inspection (ISI) program plan is evaluated for (a) compliance with the appropriate edition/addenda of Section XI, (b) acceptability of the examination sample, (c) correctness of the application of system or component examination exclusion criteria, and (d) compliance with ISI-related commitments identified during previous Nuclear Regulatory Commission (NRC) reviews. The requests for relief are evaluated in Section 3 of this report
Energy Technology Data Exchange (ETDEWEB)
Xie, J; Wang, J; Peng, J; Chen, J; Hu, W [Fudan University Shanghai Cancer Center, Shanghai, Shanghai (China)
2016-06-15
Purpose: To implement an entire workflow quality assurance (QA) process in the radiotherapy department and to reduce the error rates of radiotherapy based on the entire workflow management in the developing country. Methods: The entire workflow QA process management starts from patient registration to the end of last treatment including all steps through the entire radiotherapy process. Error rate of chartcheck is used to evaluate the the entire workflow QA process. Two to three qualified senior medical physicists checked the documents before the first treatment fraction of every patient. Random check of the treatment history during treatment was also performed. A total of around 6000 patients treatment data before and after implementing the entire workflow QA process were compared from May, 2014 to December, 2015. Results: A systemic checklist was established. It mainly includes patient’s registration, treatment plan QA, information exporting to OIS(Oncology Information System), documents of treatment QAand QA of the treatment history. The error rate derived from the chart check decreases from 1.7% to 0.9% after our the entire workflow QA process. All checked errors before the first treatment fraction were corrected as soon as oncologist re-confirmed them and reinforce staff training was accordingly followed to prevent those errors. Conclusion: The entire workflow QA process improved the safety, quality of radiotherapy in our department and we consider that our QA experience can be applicable for the heavily-loaded radiotherapy departments in developing country.
2010-10-01
... exceed 3000 microvolts/meter/MHz at 3 meters in any direction. Further, an AVIS, when in its operating position, shall not produce a field strength greater than 400 microvolts/meter/MHz at 3 meters in any... maximum of 100 microvolts/meter/MHz at 3 meters, measured from 30 MHz to 20 GHz for the complete system...
Stoppa, Francesco; Principe, Claudia
1998-01-01
The Monticchio Lakes Formation (MLF) is a newly identified carbonatite-melilitite tuff sequence which is exposed in the southwestern sector of the Vulture volcano. It is the youngest example (ca. 0.13 m.y.) of this type of volcanism in Italy, although other carbonatites of smaller volume, but with similar characteristics, have been discovered recently. This volcanic event occurred in isolation after a 0.35 m.y. period of inactivity at Vulture. The eruption produced two maar-type vents and formed tuff aprons mainly composed of dune beds of lapilli. Depositional features suggest that a dry surge mechanism, possibly triggered by CO 2 expansion, was dominant during tuff emplacement. The MLF event involved a mixture of carbonatite and melilitite liquids which were physically separated before the eruption. Abundant mantle xenoliths are direct evidence of the deep-seated origin of the parental magma and its high velocity of propagation towards the surface. Often, these nodules form the core of lapilli composed of concentric shells of melilitite and/or porphyritic carbonatite. Coarse-ash beds alternate with lapilli beds and consist of abundant lumps and spherulae of very fine-grained calcite immersed in a welded, highly compacted carbonatite matrix. Porphyritic carbonatite shells of the lapilli and fine-grained spherulae of calcite in the tuff matrix suggest incipient crystallisation of a carbonatite liquid in subvolcanic conditions and eruption of carbonatite-spray droplets. Dark coloured juvenile fragments mainly consist of melilite, phlogopite, calcite, apatite, perovskite, and häuyne crystals in a carbonatite or melilitite matrix. The rocks have an extremely primitive, ultramafic composition with very high Mg# (> 85) and Cr and Ni content (1500 ppm). The calcite contains high SrO, BaO and REE of up to 1.5 wt.%. Similar compositions are typical of primary, magmatic carbonates which are found in both intrusive and extrusive carbonatites. The high modal Sr-Ba-REE-rich calcite, the typical mineralogy, and the high amount of Sr-group elements identify the carbonate component as a carbonatite. The very high Mg#, mantle debris and C, O, He isotope ratios in the range of mantle values indicate a near-primary character for the carbonatite which is distinctive of a restricted group of extrusive carbonatites only found in continental rift areas.
Directory of Open Access Journals (Sweden)
Térssio Roger Ramalho
2007-11-01
Full Text Available O objetivo do trabalho foi avaliar a substituição do milho moído fino (MM por farelo de trigo (FT ou farelo de glúten de milho (FGM na ração de 36 bovinos não castrados, em terminação (14 meses; peso inicial de 382 kg durante 87 dias. A ração continha 24% de silagem de capim e 76% de concentrado, constituído por polpa cítrica, farelo de soja, uréia, minerais, bicarbonato de sódio e monensina sódica, além de uma das fontes energéticas testadas. A substituição de MM por FT aumentou a ingestão de FDN (pThe objective of this work was to evaluate the substitution of finely ground (GC corn by wheat middlings (WM or dried corn gluten feed (CGF in finishing feedlot diets. Thirty-six yearling bulls (382 kg average initial live weight; 14 months old were fed during 87 days. The diets contained 24% grass silage and 76% concentrate, formulated with dried citrus pulp, soybean meal, urea, mineral-vitamin mix, sodium bicarbonate, sodium monensin, and one of the energy sources tested. The substitution of wheat middlings for corn increased NDF intake (p<0.05. However, no effect was observed on other measured parameters. Substitution of corn gluten feed for ground corn reduced dry matter intake (p<0.05 and average daily gain (p<0.10, increased NDF intake (p<0.05, but had no effect on feed efficiency. These diets showed no differences in the observed values of net energy of maintenance or gain. The ratio observed/expected net energy for the diet differs from the other treatments. For this type of diet, GC may be completely replaced by WM or CGF with no depression on feed efficiency or on diet net energy. NRC (2001 underestimates TDN values and net energy estimates for WM and CGF.
Energy Technology Data Exchange (ETDEWEB)
Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert
1976-07-01
This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.
International Nuclear Information System (INIS)
Haynes, C.E.
1976-01-01
The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research
Composition containing transuranic elements for use in the homeopathic treatment of aids
International Nuclear Information System (INIS)
Lustig, D.
1996-01-01
A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
Safety analysis report for packaging: neutron shipping cask, model 4T
International Nuclear Information System (INIS)
Peterson, R.T.
1977-01-01
This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials
Energy Technology Data Exchange (ETDEWEB)
Albrecht-Schmitt, Thomas
2012-03-01
This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.
International Nuclear Information System (INIS)
Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.
1980-01-01
Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures
Reactor production of 252Cf and transcurium isotopes
International Nuclear Information System (INIS)
Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.
1990-01-01
Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs
Nuclear fission and the transuranium elements
International Nuclear Information System (INIS)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs
Nuclear fission and the transuranium elements
Energy Technology Data Exchange (ETDEWEB)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.
ORF Alignment: NT_033778 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available VSVDQTPVNAAGYLKELTHLTTLNVSHTLIWNWEIVASIAQQLPSLTNLNLS 60 ... Query: 251 LAEVDRTKIFKQLHELDLHRTNIMDFDQVTKLGNLTTLRLLNIMENGIE...EIKLPDCDSQE 310 ... LAEVDRTKIFKQLHELDLHRTNIMDFDQVTKLGNLTTLRLLNIMENGIEEIKLPDCDSQE Sbjct: 121 ...LAEVDRTKIFKQLHELDLHRTNIMDFDQVTKLGNLTTLRLLNIMENGIEEIKLPDCDSQE 180 ... Query: 371 HLKS
ORF Alignment: NT_033778 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available VSVDQTPVNAAGYLKELTHLTTLNVSHTLIWNWEIVASIAQQLPSLTNLNLS 60 ... Query: 251 LAEVDRTKIFKQLHELDLHRTNIMDFDQVTKLGNLTTLRLLNIMENGIE...EIKLPDCDSQE 310 ... LAEVDRTKIFKQLHELDLHRTNIMDFDQVTKLGNLTTLRLLNIMENGIEEIKLPDCDSQE Sbjct: 121 ...LAEVDRTKIFKQLHELDLHRTNIMDFDQVTKLGNLTTLRLLNIMENGIEEIKLPDCDSQE 180 ... Query: 352 HLKS
ORF Alignment: NC_005139 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available bjct: 1 ... HLEGQDDVELHYIVTMFVDIKGSTRLNLLLDLHDAFYVKNRILQAAIDVVRSLDGHPHRL 60 ... Query: 201 GDDGEVLWGRYGHGNVCEVTAQGLHVDC...ASKLQGKASSNHIMMGGNVTQYI 251 ... GDDGEVLWGRYGHGNVCEVTAQGLHVDCASKLQGKASSNHIMMGGNVTQYI Sbjct: 121 GDDGEVLWGRYGHGNVCEVTAQGLHVDCASKLQGKASSNHIMMGGNVTQYI 171
77 FR 22795 - Agency Information Collection Activities: Passenger List/Crew List
2012-04-17
... Sections 231 and 251 of the Immigration and Nationality Act (INA). This form is filled out upon arrival of... 251.1, 251.3, and 251.4. A copy of CBP Form I- 418 can be found at http://forms.cbp.gov/pdf/CBP_Form_I418.pdf . Current Actions: This submission is being made to extend the expiration date with no change...
Mancini, F R; Paul, D; Gauvreau, J; Volatier, J L; Vin, K; Hulin, M
2015-01-01
This study aimed to estimate the exposure to seven additives (benzoates, parabens, nitrites, nitrates, BHA, BHT and aspartame) in children aged less than 3 years old in France. A conservative approach, combining individual consumption data with maximum permitted levels, was carried out for all the additives. More refined estimates using occurrence data obtained from products' labels (collected by the French Observatory of Food Quality) were conducted for those additives that exceeded the acceptable daily intake (ADI). Information on additives' occurrence was obtained from the food labels. When the ADI was still exceeded, the exposure estimate was further refined using measured concentration data, if available. When using the maximum permitted level (MPL), the ADI was exceeded for benzoates (1.94 mg kg(-1) bw day(-1)), nitrites (0.09 mg kg(-1) bw day(-1)) and BHA (0.39 mg kg(-1) bw day(-1)) in 25%, 54% and 20% of the entire study population respectively. The main food contributors identified with this approach were current foods as these additives are not authorised in specific infant food: vegetable soups and broths for both benzoates and BHA, delicatessen and meat for nitrites. The exposure estimate was significantly reduced when using occurrence data, but in the upper-bound scenario the ADI was still exceeded significantly by the age group 13-36 months for benzoates (2%) and BHA (1%), and by the age group 7-12 months (16%) and 13-36 months (58%) for nitrites. Measured concentration data were available exclusively for nitrites and the results obtained using these data showed that the nitrites' intake was below the ADI for all the population considered in this study. These results suggest that refinement of exposure, based on the assessment of food levels, is needed to estimate the exposure of children to BHA and benzoates for which the risk of exceeding the ADI cannot be excluded when using occurrence data.
National Oceanic and Atmospheric Administration, Department of Commerce — Slocum glider dataset gathered as part of the CMOP observatory SATURN, funded by NOAA and NSF. Glider operations have historically been seasonal (April-September),...
A. Persu (Alexandre); M. Lambert (Michael); J. Deinum (Jacob); M. Cossu (Marta); N. de Visscher (Nathalie); L. Irenge (Leonid); J. Ambroise (Jerôme); J.M. Minon (Jean-Marc); A.B. Nesterovitch (Andrew); A. Churbanov (Alexander); I.A. Popova (Isolda); S.M. Danilov (Sergei); A.H.J. Danser (Jan); J.L. Gala (Jean-Luc)
2013-01-01
textabstractBackground: Angiotensin-converting enzyme (ACE) (EC 4.15.1) metabolizes many biologically active peptides and plays a key role in blood pressure regulation and vascular remodeling. Elevated ACE levels are associated with different cardiovascular and respiratory diseases. Methods and
Persu, A.; Lambert, M.; Deinum, J.; Cossu, M.; Visscher, N. de; Irenge, L.; Ambroise, J.; Minon, J.M.; Nesterovitch, A.B.; Churbanov, A.; Popova, I.A.; Danilov, S.M.; Danser, A.H.; Gala, J.L.
2013-01-01
BACKGROUND: Angiotensin-converting enzyme (ACE) (EC 4.15.1) metabolizes many biologically active peptides and plays a key role in blood pressure regulation and vascular remodeling. Elevated ACE levels are associated with different cardiovascular and respiratory diseases. METHODS AND RESULTS: Two
Directory of Open Access Journals (Sweden)
Cari Merkley
2013-06-01
Full Text Available Objective – To outline the collaborative development of an online course addressing academic integrity by a university’s library system and writing centre.Design – Case study.Setting – A public research university in the Midwestern United States.Subjects – 1650 students who completed the online module.Methods – Oakland University (OU Libraries and the Writing Centre began to collaborate on the development of a new online course on academic integrity in 2011. It was felt that an existing online library tutorial on plagiarism no longer met the needs of students and faculty. The development of the course was informed by the Association of College and Research Libraries’ Information Literacy Competency Standards for Higher Education (2000 as well as a research study investigating students’ use of sources in their scholarly writing across several institutions. Moodle, the institution’s learning management system (LMS, was used to develop the learning object.Main Results – OU Libraries and the Writing Centre launched the six-part online course entitled “Using and Citing Sources” in January 2012. They developed modules around learning outcomes in five broad categories: defining academic integrity and plagiarism; the use of sources in academic writing; paraphrasing; quoting; and citation. The final module provided students with an opportunity to practise lessons learned in the first five modules. The use of the LMS to design and host the course limited the tutorial to registered students, but provided developers with access to additional course functionality without labour-intensive coding. It also allowed Writing Centre staff to access students’ performance data on the modules prior to their appointments. Improvements over the previous online tutorial included expanded content on academic ethics and referencing, more active learning elements, video content, and the opportunity for students to choose discipline-specific examples. In the first four months of its availability, 1650 students completed the course, with 3330 attempts overall.Conclusion – The diverse perspectives and expertise that individuals from OU Libraries and the Writing Center brought to their collaboration greatly informed the development of the course. The time and effort saved by using the university’s existing LMS to develop interactive content and the focus on providing students with opportunities for active learning within the course contributed to the project’s success.
International Nuclear Information System (INIS)
Eckert, Christian; Mariton, Herve
2012-01-01
After having indicated some key figures (public finances and budgets awarded to different involved institutions and agencies), this report comments and discusses the various challenges and financial aspects regarding risk prevention: evolution of endowments in 2013, action in the field of prevention of technological risks and pollutions, issue of nuclear safety after the Fukushima accident (actions undertaken by the ASN, IRSN and ANDRA), assessment of the implementation of the PPRN (plan of prevention of natural risks) and management of flood risks, management of the after-mine period. The second part discusses the management and steering of policies of ecology, energy, sustainable development and sea in a context of decreased endowments
Dicty_cDB: Contig-U08029-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 81 |pid:none) Tanichthys albonubes beta-actin mR... 251 6e-65 ( P45886 ) RecName: Full=Actin-3, muscle-speci...fic; &L12255_1(L122... 251 6e-65 EU128482_1( EU128482 |pid:none) Tanichthys albonubes beta-actin ge... 251 6
Suzukawa, Keisuke; Yamagami, Takeshi; Ohnuma, Takayuki; Hirakawa, Hideki; Kuhara, Satoru; Aso, Yoichi; Ishiguro, Masatsune
2003-02-01
We expressed chitinase-1 (TBC-1) from tulip bulbs (Tulipa bakeri) in E. coli cells and used site-directed mutagenesis to identify amino acid residues essential for catalytic activity. Mutations at Glu-125 and Trp-251 completely abolished enzyme activity, and activity decreased with mutations at Asp-123 and Trp-172 when glycolchitin was the substrate. Activity changed with the mutations of Trp-251 to one of several amino acids with side-chains of little hydrophobicity, suggesting that hydrophobic interaction of Trp-251 is important for the activity. Molecular dynamics (MD) simulation analysis with hevamine as the model compound showed that the distance between Asp-123 and Glu-125 was extended by mutation of Trp-251. Kinetic studies of Trp-251-mutated chitinases confirmed these various phenomena. The results suggested that Glu-125 and Trp-251 are essential for enzyme activity and that Trp-251 had a direct role in ligand binding.
ORF Alignment: NC_002945 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Mycobacterium tuberculosis CDC1551] ... Length = 251 ... Query: 1 ... MANAVVAIAGSSGLIGSALTAALRAADHT...VLRIVRRAPANSEELHWNPESGEFDPHALTD 60 ... MANAVVAIAGSSGLIGSALTAALRAADHTVLRI...VRRAPANSEELHWNPESGEFDPHALTD Sbjct: 2 ... MANAVVAIAGSSGLIGSALTAALRAADHTVLRIVRRAPANSEELHWNPESGEFDPHALTD 61 ... Quer
Gene : CBRC-MDOM-02-0490 [SEVENS
Lifescience Database Archive (English)
Full Text Available 35195 /gi=3928780 /ug=Mdm.251 /len=1699 0.001 30% MHVKHLRHTYMIYVHANTCTHIPLYTLAYIIHTYTYIHICPSIHPSIHPSTHPHIHTST...HLHIHPSIHPLIHSSTHPHIYTSTHLSIHPSTHPPIHPSIHPSIHPSIHPSIHLPIHTSTYPHIHPSTHPSIHTSIHPSIHTSTHPSIHLPIHTSTYPHIHPSTHPSIHTSIHPSIHTSTHPSIHLPIHTST...YPHIHPSTHPSIHTSTHPSIHTSTHPSIHLPIHTSTYPHIHPSTHPSIHTSTHPSIHTST...HPSIHPSIHPSIHPSIHPSTLPHIYLSTHPSTHPSIHPHIHSSIHPHIHTSTQPASQPATHTYIHPSIDPHIHPTIHPHIHPSTHPFIHPSIDPHIHPTIHPHIHPSTHPSIHPSIDPLIHPSTHPHIHPSTHTCTWNGGRSTC ...
ORF Alignment: NC_003902 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available PEQAIRDAGYGVIWQGQRSW 60 ... Query: 128 KWFQRLLRHAATLVALPHPVALIGDFNVVPTDAHIYDPKGWRKDALLQPESRAAYAQLLA 187 ... ... ... KWFQRLLRHAATLVALPHPVALIGDFNVVPTDAHIYDPKGWRKDALLQPESRAAYAQLLA Sbjct: 121 KWFQR...LLRHAATLVALPHPVALIGDFNVVPTDAHIYDPKGWRKDALLQPESRAAYAQLLA 180 ... Query: 248 EKASDHAPTWI 258 ... EKASDHAPTWI Sbjct: 241 EKASDHAPTWI 251
Characterization of a Viking Blade Fabricated by Traditional Forging Techniques
Vo, H.; Frazer, D.; Bailey, N.; Traylor, R.; Austin, J.; Pringle, J.; Bickel, J.; Connick, R.; Connick, W.; Hosemann, P.
2016-12-01
A team of students from the University of California, Berkeley, participated in a blade-smithing competition hosted by the Minerals, Metals, and Materials Society at the TMS 2015 144th annual meeting and exhibition. Motivated by ancient forging methods, the UC Berkeley team chose to fabricate our blade from historical smithing techniques utilizing naturally-occurring deposits of iron ore. This approach resulted in receiving the "Best Example of a Traditional Blade Process/Ore Smelting Technique" award for our blade named "Berkelium." First, iron-enriched sand was collected from local beaches. Magnetite (Fe3O4) was then extracted from the sand and smelted into individual high- and low-carbon steel ingots. Layers of high- and low-carbon steels were forge-welded together, predominantly by hand, to form a composite material. Optical microscopy, energy dispersive spectroscopy, and Vickers hardness mechanical testing were conducted at different stages throughout the blade-making process to evaluate the microstructure and hardness evolution during formation. It was found that the pre-heat-treated blade microstructure was composed of ferrite and pearlite, and contained many nonmetallic inclusions. A final heat treatment was performed, which caused the average hardness of the blade edge to increase by more than a factor of two, indicating a martensitic transformation.
Nuclear Chemistry Institute, Mainz University. Annual Report 1995
International Nuclear Information System (INIS)
Denschlag, H.O.
1996-03-01
The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR) [de
The Transplutonium. The superheavy nuclei found in the micas of Madagascar and their interests
International Nuclear Information System (INIS)
Raoelina Andriambololona
1976-01-01
Since June 1976, evidence for the existence of superheavy elements is discussed about. After having recalled artificial elements with atomic numbers Z of wich go from Z=95 (Americium) to Z=107 (built in 1976), superheavy elements having Z greater than 110 are considered. They have been discovered by american searchers in giant halos seen in Madagascar micas. The samples have been recoked in the Fort-Dauphin region (Haut Mandrare). The corresponding numbers Z are 114, 115, 116, 124, 125, 125, 126, 127. It seems that the existence of Z=126 element should be accepted with a greater degree of confidence. But different experiences done by other groups seem to show the evidence of superheavy elements in micas looks weaker. Nevertheless, it is interesting to investigate the evidence or the non-evidence of those elements. We estimate the mass numbers A of those superheavy elements in the liquid drop model if we assume that they are stable versus β. The results thus obtained agree with the shell-model ones within 4 % approximation. We propose if the evidence of superheavies is confirmed to give the name of madagascarium to one of them (Z=126) by similitude with francium, lutetium, polonium, berkelium, americium, europium, ...Their evidence was first conjectured in Madagascar micas in 1976. Superheavy nuclei are to be distinguished from hypernuclei. [fr
Identification of the new isotope sup 2 sup 4 sup 1 Bk
Asai, M; Ichikawa, S; Nagame, Y; Nishinaka, I; Akiyama, K; Toyoshima, A; Kaneko, T; Sakama, M; Haba, H; Oura, Y; Kojima, Y; Shibata, M
2003-01-01
A new neutron-deficient berkelium isotope sup 2 sup 4 sup 1 Bk produced in the sup 2 sup 3 sup 9 Pu( sup 6 Li, 4n) reaction has been identified using a gas-jet coupled on-line isotope separator. Cm K and L X-rays associated with the EC decay of sup 2 sup 4 sup 1 Bk were observed in the mass-241 fraction, and three gamma transitions were attributed to the EC decay of sup 2 sup 4 sup 1 Bk through X-gamma coincidences. The half-life of sup 2 sup 4 sup 1 Bk was determined to be 4.6+-0.4 min which is 1/2-1/4 of that of theoretical predictions. The half-life value and the observed gamma transitions can be consistently explained as a consequence of the allowed EC transition of pi 7/2 sup + [633] -> nu 7/2 sup + [624]. (orig.)
International Nuclear Information System (INIS)
Armbruster, P.; Hessberger, F.P.
1998-01-01
In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)
Energy Technology Data Exchange (ETDEWEB)
Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling
2016-07-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
International Nuclear Information System (INIS)
Behrens, R.G.; Roth, S.B.; Jones, S.R.
1991-01-01
Los Alamos National Laboratory is a multidisciplinary R ampersand D organization and, as such, its nuclear materials inventory is diverse. Accordingly, major inventories of isotopes such as Pu-238, Pu-239, Pu-242, U-235, Th, tritium, and deuterium, and lesser amounts of isotopes of Am, Cm, Np and exotic isotopes such as berkelium must be managed in accordance with Department of Energy Orders and Laboratory policies. Los Alamos also acts as a national resource for many one-of-a-kind materials which are supplied to universities, industry, and other government agencies within the US and throughout the world. Management of these materials requires effective interaction and communication with many nuclear materials custodians residing in over forty technical groups as well as effective interaction with numerous outside organizations. This paper discusses the role, philosophy, and organizational structure of Nuclear Materials Management at Los Alamos and also briefly presents results of two special nuclear materials management projects: 1- Revision of Item Description Codes for use in the Los Alamos nuclear material data base and 2- The recommendation of new economic discard limits for Pu-239. 2 refs., 1 fig
Extraction of transplutonium elements from carbonate solutions by alkylpyrocatechol
International Nuclear Information System (INIS)
Karalova, Z.K.; Myasoedov, B.F.; Rodionova, L.M.; Kuznetsova, V.S.
1983-01-01
Extraction of americium, berkelium as well as Ce, Eu, Th, U, Zr, Cs, Fe with solution of 4(α, α-dioctylethyl)pyrocatechol (DOP) in toluene from carbonate solutions to determine conditions of their separation has been studied. It is established that americium extraction is quite sensitive to the changes of potassium carbonate concentration. The maximum extraction of americium (R >90%) is observed in the case of 0.1-0.5 mol/l of K 2 CO 3 solutions and the minimum one (R=2.5%) - in the case of 8 mol/l K 2 CO 3 . Americium extraction increases sharply when sodium hydroxide is introduced in carbonate solutions. It is shown that varying sodium hydroxide concentration it is possible to achieve qualitative extraction of americium even from saturated solution of potassium carbonate. Reextraction of TPE is easily realized with 3 mol/l HCl solution. The system K 2 CO 3 (KOH)-DOP proved to be perspective for Am separation from Bk, Ce, Cs, actinoid elements as well as from Fe
International Nuclear Information System (INIS)
Brown, Paul L.; Ekberg, Christian
2016-01-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter
International Nuclear Information System (INIS)
Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A.
2000-01-01
Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided
Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter
Energy Technology Data Exchange (ETDEWEB)
Gobrecht, J; Gaeggeler, H; Herlach, D; Junker, K; Kettle, P -R; Kubik, P; Zehnder, A [eds.
2000-07-01
lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.
International Nuclear Information System (INIS)
Moeser, Christina
2010-01-01
The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.
Fluorescence and excitation spectra of Bk3+, Cf3+, and Es3+ ions in single crystals of LaCl3
International Nuclear Information System (INIS)
Hessler, J.P.; Caird, J.A.; Carnall, W.T.; Crosswhite, H.M.; Sjoblom, R.K.; Wagner, F. Jr.
1978-01-01
Dye laser techniques have been used to study the energy level structure of the heavier actinides in single crystals of lanthanum chloride. In the case of einsteinium, fluorescence was detected and measured from the following manifolds: J = 5 at 0.984 μm -1 , J = 4 at 1.572 μm -1 , J = 6 at 2.930 μm -1 . This fluorescence was observed to the five lowest manifolds: J = 8, 5, 7, 2, 6. For californium, fluorescence has been detected from the manifolds: J = 11/2 at 1.190 μm -1 , J = 7/2 at 1.389 μm -1 , J = 5/2 at 1.977 μm -1 . This fluorescence was observed to the three lowest manifolds: J = 15/2, 9/2, 11/2. The fluorescence manifolds of berkelium are J = 6 at 1.540 μm -1 , and J = 4 at 1.953 μm -1 . The three lowest manifolds, J = 6, 5, and 4, have been observed in fluorescence. Absorption spectra data have yielded crystal-field splitting measurements in the higher manifolds of Es + . The location of the manifolds in general confirmed earlier approximate free-ion level structure calculations based on assumed regularities in the energy level parameters derived from spectra of the actinide ions through Cf + . 2 figures
Digital Repository Service at National Institute of Oceanography (India)
Haake, B.; Rixen, T.; Reemtsma, T.; Ramaswamy, V.; Ittekkot, V.
stream_size 20 stream_content_type text/plain stream_name Particle_Flux_Ocean_Chapter_14_1996_251.pdf.txt stream_source_info Particle_Flux_Ocean_Chapter_14_1996_251.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...
2010-05-28
... Materials (``ASTM'') ASTM-B42, ASTM- B68, ASTM-B75, ASTM-B88, ASTM-B88M, ASTM-B188, ASTM-B251, ASTM-B251M, ASTM-B280, ASTM-B302, ASTM-B306, ASTM-359, ASTM-B743, ASTM-B819, and ASTM-B903 specifications and...
Lucifensins, the Insect Defensins of Biomedical Importance: The Story behind Maggot Therapy
Czech Academy of Sciences Publication Activity Database
Čeřovský, Václav; Bém, R.
2014-01-01
Roč. 7, č. 3 (2014), s. 251-264 ISSN 1424-8247 R&D Projects: GA ČR GA203/08/0536 Institutional support: RVO:61388963 Keywords : antimicrobial peptide * insect defensin * lucifensin * maggot therapy * Lucilia sericata * Lucilia cuprina * peptide isolation * peptide identification Subject RIV: CC - Organic Chemistry http://www.mdpi.com/1424-8247/7/3/251
Dynamics of the proteome in human and farm animal milk
Zhang, L.
2015-01-01
25.1pt;">Abstract
25.1pt;">The milk proteome changes due to many factors, such as lactation, individual, health status, processing, and species differences. The objective of the work described in this thesis was to increase our
DEFF Research Database (Denmark)
Bonde, Lars Ole
2014-01-01
Indeholder underkapitlerne: 2.5.1 Musik som analogi 2.5.2 Musik som metafor 2.5.3 Musikkens psykologiske funktioner - en taxonomi og metaforisk lytning til fire baroksatser......Indeholder underkapitlerne: 2.5.1 Musik som analogi 2.5.2 Musik som metafor 2.5.3 Musikkens psykologiske funktioner - en taxonomi og metaforisk lytning til fire baroksatser...
2011-10-11
... section replaces Sec. 251.83. Contrary to the 251 Appeal Rule, which enumerates 15 types of decisions that... Rule, the proposed rule requires an appeal to include a reference to the title or type of written... subject to appeal or discretionary review. This provision is unnecessary given the omission of this type...
Directory of Open Access Journals (Sweden)
Danielle Faye Tran
2013-01-01
Full Text Available Review of the monograph:Derek Hook, A Critical Psychology of the Postcolonial: The Mind of Apartheid, London: Routledge, 2012, ISBN 978-0-415-58757-0, 251 pagesBesprechung der Monographie:Derek Hook, A Critical Psychology of the Postcolonial: The Mind of Apartheid, London: Routledge, 2012, ISBN 978-0-415-58757-0, 251 Seiten
Yamamoto, Yutaro; Tomiyama, Arata; Sasaki, Nobuyoshi; Yamaguchi, Hideki; Shirakihara, Takuya; Nakashima, Katsuhiko; Kumagai, Kosuke; Takeuchi, Satoru; Toyooka, Terushige; Otani, Naoki; Wada, Kojiro; Narita, Yoshitaka; Ichimura, Koichi; Sakai, Ryuichi; Namba, Hiroki; Mori, Kentaro
2018-01-01
Development of resistance against temozolomide (TMZ) in glioblastoma (GBM) after continuous treatment with TMZ is one of the critical problems in clinical GBM therapy. Intracellular cholesterol regulates cancer cell biology, but whether intracellular cholesterol is involved in TMZ resistance of GBM cells remains unclear. The involvement of intracellular cholesterol in acquired resistance against TMZ in GBM cells was investigated. Intracellular cholesterol levels were measured in human U251 MG cells with acquired TMZ resistance (U251-R cells) and TMZ-sensitive control U251 MG cells (U251-Con cells), and found that the intracellular cholesterol level was significantly lower in U251-R cells than in U251-Con cells. In addition, treatment by intracellular cholesterol remover, methyl-beta cyclodextrin (MβCD), or intracellular cholesterol inducer, soluble cholesterol (Chol), regulated TMZ-induced U251-Con cell death in line with changes in intracellular cholesterol level. Involvement of death receptor 5 (DR5), a death receptor localized in the plasma membrane, was evaluated. TMZ without or with MβCD and/or Chol caused accumulation of DR5 into the plasma membrane lipid raft and formed a complex with caspase-8, an extrinsic caspase cascade inducer, reflected in the induction of cell death. In addition, treatment with caspase-8 inhibitor or knockdown of DR5 dramatically suppressed U251-Con cell death induced by combination treatment with TMZ, MβCD, and Chol. Combined treatment of Chol with TMZ reversed the TMZ resistance of U251-R cells and another GBM cell model with acquired TMZ resistance, whereas clinical antihypercholesterolemia agents at physiological concentrations suppressed TMZ-induced cell death of U251-Con cells. These findings suggest that intracellular cholesterol level affects TMZ treatment of GBM mediated via a DR5-caspase-8 mechanism. Copyright © 2017 Elsevier Inc. All rights reserved.
Transfer of the sodium/iodide symporter gene into gliomas for radioiodine therapy in vitro
International Nuclear Information System (INIS)
Tan Jian; Li Wei; Liu Xiaohua; Xiao Qian; Jia Qiang; Li Ning
2008-01-01
Objective: The most frequent brain tumors are the gliomas. Glioblastomas are largely incurable secondary, to their rapid, aggressive and diffusely infiltrative growth pattern and hypervascularity. This study aimed at investigating the possibility of transecting human sodium/iodide symporter (hNIS) gene into human glioma cell lines to facilitate radioactive iodide treatment in vitro. Methods: Transecting hNIS gene into human glioma cell lines U251 was performed by recombinant expression plasmids with lipofectamine 2000-plasmid complexes. The hNIS gene cell lines with stable expression (hNIS-U251) were selected through G418 antibiotic constraint. The hNIS-U251 gene cell lines were then evaluated for their biologic functions, including 125 I uptake assay, 125 I influx-course, 125 I-efflux-course, 131 I inhibitory effect on cellular proliferation by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyhe-trazolium bromide (MTT) assay and flow cytometer. Results: We were successful in transecting hNIS gene into human glioma cell lines by recombinant expression plasmids, and were able to obtain hNIS gene cell lines (hNIS-U251) with stable expression. The hNIS-U251 cell lines could intake and bind radioactive iodide by hNIS gene. The uptakes of 125 I were 117 fold higher in hNIS-U251 cell lines than U251 cell lines [(50 469.88 ± 997.29), (432.92 ± 89.28) counts·min -1 , respectively]. And the proliferation index of hNIS-U251 cell lines was lower than U251 cell lines after incubating with 131 I. Conclusion: The hNIS gene with stable gene expression (hNIS- U251) cell lines could be labeled by 131 I with a high efficiency, thereby may function effectively in the treatment of glioma-related brain tumors. (authors)
Czech Academy of Sciences Publication Activity Database
Londesborough, Michael Geoffrey Stephen; Janoušek, Zbyněk; Štíbr, Bohumil; Císařová, I.
2004-01-01
Roč. 689, č. 16 (2004), s. 2702-2706 ISSN 0022-328X R&D Projects: GA MŠk LN00A028 Institutional research plan: CEZ:AV0Z4032918 Keywords : boranes * metallacarboranes * rhodium complex Subject RIV: CA - Inorganic Chemistry Impact factor: 1.905, year: 2004
Pearson, A D; Greenwood, M H; Feltham, R K; Healing, T D; Donaldson, J; Jones, D M; Colwell, R R
1996-01-01
A study of Campylobacter jejuni on a broiler chicken farm between 1989 and 1994 gave an estimated isolation rate of 27% (3,304 of 12,233) from a 0.9% sample of 1.44 million broiler chickens from six to eight sheds over 32 consecutive rearing flocks comprising 251 broiler shed flocks. During the study, C. jejuni was found in 35.5% of the 251 shed flocks but only 9.2% (23 of 251) had Campylobacter isolates in successive flocks, with 9 of those 23 sheds having the same serotype between consecuti...
Radiochemical studies of neutron deficient actinide isotopes
International Nuclear Information System (INIS)
Williams, K.E.
1978-04-01
The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, 242 Bk, was produced with a cross-section of approximately 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, αxn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,αxn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z 1 + Z 2 = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,αxn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of 228 Pu, 230 Pu, 232 Cm, or 238 Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes
Radiochemical studies of neutron deficient actinide isotopes
Energy Technology Data Exchange (ETDEWEB)
Williams, K.E.
1978-04-01
The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, /sup 242/Bk, was produced with a cross-section of approximately 10 ..mu..b in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, ..cap alpha..xn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,..cap alpha..xn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z/sub 1/ + Z/sub 2/ = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,..cap alpha..xn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of /sup 228/Pu, /sup 230/Pu, /sup 232/Cm, or /sup 238/Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes.
Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter
Energy Technology Data Exchange (ETDEWEB)
Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.
2000-07-01
lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.
Minor Actinides Recycling in PWRs
International Nuclear Information System (INIS)
Delpech, M.; Golfier, H.; Vasile, A.; Varaine, F.; Boucher, L.; Greneche, D.
2006-01-01
Recycling of minor actinides in current and near future PWR is considered as one of the options of the general waste management strategy. This paper presents the analysis of this option both from the core physics and fuel cycle point of view. A first indicator of the efficiency of different neutron spectra for transmutation purposes is the capture to fission cross sections ratio which is less favourable by a factor between 5 to 10 in PWRs compared to fast reactors. Another indicator presented is the production of high ranking isotopes like Curium, Berkelium or Californium in the thermal or epithermal spectrum conditions of PWR cores by successive neutron captures. The impact of the accumulation of this elements on the fabrication process of such PWR fuels strongly penalizes this option. The main constraint on minor actinides loadings in PWR (or fast reactors) fuels are related to their direct impact (or the impact of their transmutation products) on the reactivity coefficients, the reactivity control means and the core kinetics parameters. The main fuel cycle physical parameters like the neutron source, the alpha decay power, the gamma and neutrons dose rate and the criticality aspects are also affected. Recent neutronic calculations based on a reference core of the Evolutionary Pressurized Reactor (EPR), indicates typical maximum values of 1 % loadings. Different fuel design options for minor actinides transmutation purposes in PWRs are presented: UOX and MOX, homogeneous and heterogeneous assemblies. In this later case, Americium loading is concentrated in specific pins of a standard UOX assembly. Recycling of Neptunium in UOX and MOX fuels was also studied to improve the proliferation resistance of the fuel. The impact on the core physics and penalties on Uranium enrichment were underlined in this case. (authors)
International Nuclear Information System (INIS)
King, L.J.; Bigelow, J.E.; Collins, E.D.
1976-10-01
Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity 248 Cm, were separated from 252 Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown 248 Cm and the residual 252 Cf. Eight pellets, each containing 100 μg of high-purity 248 Cm were prepared for irradiation in HFIR to study the production of 250 Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 251 - 260 of 8494 ... ... demand for health service delivery in the Middle East and North Africa. ... Strengthening response capacity to African infectious disease outbreaks. The 2014 Ebola outbreak in West Africa claimed the lives of tens of ...
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Genetics; Volume 97; Issue 1. Interleukin gene polymorphisms and susceptibility to HIV-1 infection: a meta-analysis. CHRISSA G TSIARA ... RESEARCH ARTICLE Volume 97 Issue 1 March 2018 pp 235-251 ...
Cytochemical and ultrastructural aspects of aquatic carnivorous plant turions
Czech Academy of Sciences Publication Activity Database
Plachno, B.J.; Adamec, Lubomír; Kozieradzka-Kiszkurno, M.; Świątek, P.; Kamińska, I.
2014-01-01
Roč. 251, č. 6 (2014), s. 1449-1454 ISSN 0033-183X Institutional support: RVO:67985939 Keywords : aquatic carnivorous plants * winter buds * storage functions Subject RIV: EF - Botanics Impact factor: 2.651, year: 2014
African Journals Online (AJOL)
Items 251 - 300 of 674 ... Gender and Behaviour. ... Vol 6, No 1 (2008), Gender Differences In Mathematics Performance: Some Fresh Insights, Abstract ... Vol 14, No 1 (2016), Gender discrimination and the Nigerian scenario: a review, Abstract.
African Zoology - Vol 11, No 2 (1976)
African Journals Online (AJOL)
Patterns in the Distribution of Southern African Terrestrial Tortoises (Cryptodira: Testudinidae) · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. John Comrie Greig, Peter D. Burdett, 251-273 ...
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 251 - 260 of 439 ... Institutional Support to Policy Research Organizations in India ... In South Asia, people's social, political and cultural aspirations often get ... large numbers of Chinese migrants to Southeast Asia and the United States.
African Journals Online (AJOL)
Items 251 - 300 of 644 ... Vol 17, No 4 (2005), Evaluation of antiretroviral therapy results in .... and physiotherapy practice at the Kachere Rehabilitation Centre in ... High incidence of tuberculosis in prison officers in Zomba, Malawi, Abstract PDF.
2010-04-01
... in 24 CFR 203.251(e). Premium pricing means the price for the sale of a mortgage loan with an above... for real estate taxes, premiums for required hazard and mortgage insurance, homeowners' association...
African Journals Online (AJOL)
Items 251 - 300 of 444 ... Vol 60 (2007), Phase Transformation of Hydrothermally Synthesized Nanoparticle ... Vol 67 (2014), Reaction of Hydrazine Hydrate with Oxalic Acid: Synthesis and Crystal Structure of Dihydrazinium Oxalate, Abstract PDF.
African Journals Online (AJOL)
Items 251 - 300 of 1125 ... Vol 12, No 3 (2006):, Constructing safety through “contrast” during training in ... Frederick W. Stander, Leon T. de Beer, Annatjie S. Stander ... Debriefing - The Cinderella of track and field event management, Abstract.
African Journals Online (AJOL)
Items 251 - 289 of 289 ... Vol 7, No 3 (2008), The geological control and triggering mechanisms of landslides ... Vol 5, No 2 (2005), Tomato production in Foumbot (Cameroon) in ... the 1999 Eruption of Mount Cameroon Volcano: Characterization ...
S¯adhan¯a Vol. 26, 2001 Subject Index
Indian Academy of Sciences (India)
R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22
. Acoustic emission ... approach. 251. Blumlein-spark gap. Design and construction of double-Blumlein. HV pulse power ... A note on critical flow section in collector channels. 439 ... system for Langmuir-blodgett film deposition set-up. 213.
Effects of Aedes aegypti salivary components on dendritic cell and lymphocyte biology
Czech Academy of Sciences Publication Activity Database
Bizzarro, B.; Barros, M.S.; Maciel, C.; Gueroni, D.I.; Lino, C.N.; Campopiano, J.; Kotsyfakis, Michalis; Amarante-Mendes, G.P.; Calvo, E.; Capurro, M.L.; Sa-Nunes, A.
2013-01-01
Roč. 6, NOV 2013 (2013), s. 329 ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : dendritic cells * T-cells * Aedes aegypti * saliva * apoptosis Subject RIV: EC - Immunology Impact factor: 3.251, year: 2013
Sensitization of Secondary School Students towards Sustainable ...
African Journals Online (AJOL)
gold
2012-07-26
Jul 26, 2012 ... Independent Electoral Commission as a Focus. (Pp. 239-251) .... eligible voters and addresses specific electoral events as well as the general electoral .... A government chosen by a small, exclusive group is not a democracy ...
Německý Mácha, Óda na radost a krize evropské vize
Czech Academy of Sciences Publication Activity Database
Pokorný, Martin Z.
2013-01-01
Roč. 31, 97-98 (2013), s. 244-251 ISSN 0862-7045 Institutional support: RVO:67985955 Keywords : K. H. Mácha * F. Schiller * A. Mozart * Enlightenment * romanticism Subject RIV: AA - Philosophy ; Religion
The Chlamydomonas genome reveals the evolution of key animal and plant functions
Czech Academy of Sciences Publication Activity Database
Merchant, S.S.; Prochnik, S. E.; Bišová, Kateřina
2007-01-01
Roč. 318, - (2007), s. 245-251 ISSN 0036-8075 Institutional research plan: CEZ:AV0Z50200510 Keywords : chlamydomonas reinhardtii * alga * eukaryotic cell Subject RIV: EE - Microbiology, Virology Impact factor: 26.372, year: 2007
African Journals Online (AJOL)
Items 101 - 150 of 251 ... Vol 65 (2017), Financialisation and the financial and economic ... P Burger ... Vol 66 (2017), King IV is here: Corporate Governance in South ... development in Africa: A summary of an IFAA Research Report, Abstract.
African Journals Online (AJOL)
Items 251 - 300 of 1250 ... Ricardo Gomez-Flores, David Espinosa-Ramos, Ramiro ... Porfiria Barrón- Gonzalez, Patricia Tamez-Guerra, Reyes Tamez-Guerra, ... TC Fleischer, MLK Mensah, AY Mensah, G Komlaga, SY Gbedema, H Skaltsa.
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 251 - 260 of 292 ... Filter by type .... As the region most affected by conflict, Africa needs to acquire knowledge and expertise in the field of peace and security. Project ... Armed Conflict in Colombia : Different Resources Different Conflicts?
African Journal of Biotechnology - Vol 15, No 8 (2016)
African Journals Online (AJOL)
Codon usage bias analysis for the coding sequences of Camellia sinensis and Brassica campestris · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Prosenjit Paul, Supriyo Chakraborty, 236-251 ...
... Parents Have Safe, Stable, Nurturing Relationships [PDF 255KB] Essentials for Childhood Connecting the Dots: An Overview of the Links Among Multiple Forms of Violence [PDF 2.51MB] Economic Cost of Child Abuse Adverse Childhood Experiences (ACE) ...
African Journals Online (AJOL)
Items 251 - 300 of 533 ... Vol 30, No 4 (2012), Implementing a speaking test at Grade 6 (primary ... Vol 30, No 1 (2012), Inclusive education for Deaf students: .... Vol 24, No 2 (2006), Linguistic creativity from a cognitive perspective, Abstract.
African Journals Online (AJOL)
Items 251 - 300 of 900 ... Vol 14, No 6 (2014), Effect of Cassava Flour Processing Methods and ... properties of maize/cowpea/sweet potato as complementary food, Abstract PDF ... tilapia (Oreochromis shiranus) stored at ambient temperature ...
75 FR 52779 - Notice of Information Collection
2010-08-27
... and aerospace-related science, technology, engineering, and mathematics (STEM) workforce. NASA intends... Public: Business Individuals or households. Estimated Number of Respondents: 15,571 (15,251 survey; 320...
African Journals Online (AJOL)
Items 251 - 300 of 437 ... Vol 10, No 2 (2013), Motivating Factors for Knowledge Sharing of ... Vol 14, No 1 (2017), Motivation and librarians' productivity in academic libraries in ... students' perception of open and distance learning, Abstract.
2011-09-13
... St. (at Grove), San Francisco, CA 94102. 5. Hawaii Documents Center, Hawaii State Library, 478 South.... 7. Hilo Public Library, 300 Waianuenue Ave., Hilo, HI 96720. 8. Wailuku Public Library, 251 High St...
Animal Production Research Advances - Vol 5, No 4 (2009)
African Journals Online (AJOL)
Carcass Characteristics and Economics of Broiler Chickens Fed Different Levels of Grasshopper Meal in Place of Fish Meal · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. MA Muftau, BR Olorede, 248-251 ...
African Journals Online (AJOL)
Items 251 - 300 of 808 ... ... feed access time and re - alimentation on performance of growing ... Fermentation Characteristics of Guinea Grass - Cassava Leaves Silage, Abstract ... Vol 59, No 1 (2011), Effects on performance of growing pigs fed ...
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2009-01-01
Results 251 - 260 of 1368 ... Job quality in Jordan : an analysis based on a job quality index (JQI). Published date. January 1, 2009. Papers. WAGES EGYPT LABOUR MARKET MANUFACTURING EXPORT ORIENTED INDUSTRIES TRADE LIBERALIZATION ...
African Journals Online (AJOL)
Items 251 - 300 of 524 ... ... activities of some Naturally occurring facial cosmetics in Nigeria, Abstract PDF ... Vol 13, No 2 (2011), Heavy Metals Determination in Some .... to sub-lethal and lethal concentrations of lead acetate, Abstract PDF.
African Journals Online (AJOL)
Items 251 - 300 of 769 ... Vol 16, No 2 (2008), Employee Retention Strategies And Organizational Performance ... Uundergraduates' Attitude to Self-Employment: A Case Study of a ... Vol 10, No 2 (2002), Factors Affecting Tourist Satisfaction in ...
African Journals Online (AJOL)
Items 251 - 300 of 2037 ... ... sacra Oleogum Resin: The Sacred Frankincense, Abstract PDF .... Vol 13, No 8 (2014), Antimicrobial and Antioxidant Activities of the Essential Oils of ... effects of Indian medicinal plants against acne-inducing bacteria ...
African Journals Online (AJOL)
Items 251 - 300 of 1260 ... Journal Home > Advanced Search > Browse Title Index ... Consumption of ammonia-nitrogen by aob in immobilized batch culture, Abstract PDF .... Vol 9, No 3S (2017): Special Issue, Design an automatic temperature ...
African Journals Online (AJOL)
Items 251 - 300 of 508 ... South African Journal for Research in Sport, Physical Education and Recreation. ... Lean body mass as a predictor of performance of young Iranian elite .... leisure participants: the case of the comrades marathon, Abstract.
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 251 - 260 of 369 ... Corporate Social Responsibility in the Latin American Extractive Industry ... Its impact on national businesses, particularly micro, small and medium ... Experiment in Collaborative Learning Network for Enhanced ...
Czech Academy of Sciences Publication Activity Database
Holec, J.; Kolařík, Miroslav; Borgarino, D.; Bidaud, A.; Moreau, P.A.
2016-01-01
Roč. 103, 1-2 (2016), s. 251-263 ISSN 0029-5035 Institutional support: RVO:61388971 Keywords : Basidiomycota * Strophariaceae * phylogeny Subject RIV: EE - Microbiology, Virology Impact factor: 0.941, year: 2016
African Journals Online (AJOL)
Items 251 - 300 of 319 ... ... and Application of Nuclear Morphometry and DNA Image Cytometry, Abstract ... of the N-acetyltransferase 2 gene (NAT2) among Jordanian volunteers ... Vol 7, No 1 (2012), Sleep complaints and daytime sleepiness ...
The Struggle for Air Force Independence, 1943-1947
1997-01-01
222 7. EPILOGUE .............................................. 227 A PPENDICES .............................................. 251 1. Operational...Arnold, acutely sensitive to the connection between operations--especially the impact of major air cam- paigns-and postwar plans, felt this was the time
African Journals Online (AJOL)
Items 251 - 300 of 1050 ... ... in the Wouri River estuary mangrove, Douala, Cameroon, Abstract ... morphological, phylogenetic and ecotoxicological aspects, Abstract PDF ... eddies in the Mozambique Basin and Mozambique Channel, Abstract.
Characterizing the transcriptome and molecular markers information ...
Indian Academy of Sciences (India)
2008). Analyses of the genetic structure .... The annotations and classifications for the transcriptome ... Based on the Pfam classification, the predic- ..... J. Lipid. Res. 33, 251–262. Eckert C. G., Samis K. E. and Lougheed S. C. 2008 Genetic vari-.
African Journals Online (AJOL)
Items 251 - 298 of 298 ... ... of Horse Heart Ferricytochrome C: An FTIR Study, Abstract PDF ... Soil Resources Degradation and Conservation Techniques Adopted ... Composition of Meat from Goat Breeds of North-Western Nigeria, Abstract PDF.
African Journals Online (AJOL)
Items 251 - 300 of 879 ... South African Journal of Higher Education. ... tutor training as a prerequisite for successful in-service teacher training, Abstract ... Vol 16, No 2 (2002), Employers' perceptions of the profile of MBA graduates, Abstract.
African Journals Online (AJOL)
Items 251 - 300 of 323 ... Vol 16, No 1 (2012), Reporting of Climate Change News in Three Nigerian Newspapers, Abstract PDF ... Vol 17, No 1 (2013), Risk management strategies utilized by small scale poultry ... TB Fregene, P.I Bolorunduro.
... chap 251. Murray PR. The clinician and the microbiology laboratory. In: Bennett JE, Dolin R, Blaser MJ, ... Vyas, MD, PhD, Assistant Professor in Medicine, Harvard Medical School; Assistant in Medicine, Division of Infectious Disease, ...
African Journals Online (AJOL)
Items 251 - 300 of 437 ... Health SA Gesondheid. ... Vol 19, No 1 (2014), Patient-perceived factors contributing to low tuberculosis cure rate at Greater Giyani healthcare facilities ... dispensation at a selected nursing college in Limpopo Province ...
Maheshwari, Prof. Satish Chandra
Indian Academy of Sciences (India)
Delhi), FNA, FNASc. Date of birth: 4 October 1933. Specialization: Physiology & Biochemistry of Plant Growth & Development and Plant Molecular Biology Address: 251/56, Prathap Enclave, Haldighati Road, Jaipur 302 033, Rajasthan Contact ...
Magnetické pole Země a jeho možný vliv na živé organizmy
Czech Academy of Sciences Publication Activity Database
Střeštík, Jaroslav
2004-01-01
Roč. 54, č. 4 (2004), s. 249-251 ISSN 0009-0700 Institutional research plan: CEZ:AV0Z3012916 Keywords : geomagnetic activity * geomagnetic storms * human beings Subject RIV: DE - Earth Magnetism, Geodesy, Geography
Sex differences in cardiovascular function
Czech Academy of Sciences Publication Activity Database
Kolář, František; Ošťádal, Bohuslav
2013-01-01
Roč. 207, č. 4 (2013), s. 584-587 ISSN 1748-1708 Institutional support: RVO:67985823 Keywords : heart * vascular * risk factors * sex Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 4.251, year: 2013
African Journals Online (AJOL)
Items 251 - 300 of 705 ... Vol 11 (2001), From Business Corpus to Business Lexicon, Abstract PDF ... and Jens Erik Mogensen (Editors): Dictionary Visions, Research and Practice. ... Quantitative analyses of revisions in the English and German ...
Thermal Manifestations and Nanoindentation of Bone Cements for Orthopaedic Surgery
Czech Academy of Sciences Publication Activity Database
Hloch, Sergej; Monka, P.; Hvizdoš, P.; Jakubéczyová, D.; Kozak, D.; Čolič, K.; Kloc, J.; Magurová, D.
2013-01-01
Roč. 17, č. 1 (2013), s. 251-258 ISSN 0354-9836 Institutional support: RVO:68145535 Keywords : bone cement * exothermic behaviour * nanoindentation * porosity * osteonecrosis Subject RIV: FJ - Surgery incl. Transplants Impact factor: 0.962, year: 2013
Chromatin modification of Notch targets in olfactory receptor neuron diversification
Czech Academy of Sciences Publication Activity Database
Endo, K.; Karim, M. R.; Taniguchi, H.; Krejčí, Alena; Kinameri, E.; Siebert, M.; Ito, K.; Bray, S. J.; Moore, A. W.
2012-01-01
Roč. 15, č. 2 (2012), s. 224-233 ISSN 1097-6256 Institutional research plan: CEZ:AV0Z50070508 Keywords : neuron diversification Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 15.251, year: 2012
Czech Academy of Sciences Publication Activity Database
Dostál, Petr
2007-01-01
Roč. 18, - (2007), s. 91-102 ISSN 1100-9233 Institutional research plan: CEZ:AV0Z60050516 Keywords : Lasius flavus * disturbance * megamatrix Subject RIV: EF - Botanics Impact factor: 2.251, year: 2007
2010-10-01
... shall include labeling and make clear in all sales, marketing, and packaging materials, including online... low power auxiliary stations that operate in the core TV bands (channels 2-51, excluding channel 37...
Indian Academy of Sciences (India)
Varadhan, Prof. Srinivasa S R . Date of birth: 2 January 1940. Address: Department of Mathematics, Courant Institute, New York University, 251, Mercer Street, New York, NY 10012, U.S.A.. Contact: Office: (+1-212) 982 9883
African Journals Online (AJOL)
Items 251 - 300 of 479 ... Nigerian Food Journal. ... Vol 28, No 2 (2010), Improving consumer safety and satisfaction at fast food outlets in Owerri metropolis, Nigeria, Abstract ... associated with the natural fermentation of prawn (Litopenaus sp.) ...
African Journals Online (AJOL)
Items 51 - 100 of 251 ... ... and autoclaving in the decontamination of dental instruments, Abstract ... Vol 7, No 2 (2005), Effect if bonny light crude oil on the neuroglial ... of tropical ascorbic acid on corneal ulceration induced by alkali burn, Abstract.
African Journals Online (AJOL)
Items 251 - 300 of 412 ... Vol 26, No 2 (2007), Practical nationalism and global duties of justice, Abstract ... Vol 30, No 2 (2011), Qualified-agent virtue ethics, Abstract ... Vol 32, No 3 (2013), Redrawing Kant's philosophy of mathematics, Abstract.
African Journals Online (AJOL)
Items 251 - 300 of 446 ... Vol 5, No 2 (2000), Perception of self and safe sexual behavior among ... Vol 8, No 2 (2005), Personal factors and personality characteristics as predictors of ... influencing self-disclosure in marital relationships, Abstract.
African Journals Online (AJOL)
Items 251 - 300 of 506 ... Vol 71, No 2 (2009), Individual tree growth differences in a clonal eucalypt blanking ... tenure and policy, domestication, intellectual property rights and ... in Eucalyptus grandis stands not subjected to soil water deficits: ...
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
RESEARCH ARTICLE Volume 96 Issue 2 June 2017 pp 251-259 ... is a chronic immuno-inflammatory disease characterized by inflammatory mediators and ... no notable differences between the multiple comparisons of rs28362491– rs696 ...
Změny Římského statutu Mezinárodního trestního soudu
Czech Academy of Sciences Publication Activity Database
Šturma, Pavel
2010-01-01
Roč. 9, č. 8 (2010), s. 245-251 ISSN 1213-5313 Institutional research plan: CEZ:AV0Z70680506 Keywords : public international law * International Criminal Court * crime of agression Subject RIV: AG - Legal Sciences
International Development Research Centre (IDRC) Digital Library (Canada)
men and women farmers. All numbers as of August 2014. 251 postgraduate students. 37 consortia ... of whom are women, gained new skills in good agronomic and post-harvest practices ... and participatory methods. Research demonstrated ...
Czech Academy of Sciences Publication Activity Database
Štrbáňová, Soňa
2015-01-01
Roč. 22, č. 2 (2015), s. 251-253 ISSN 1230-1159 Institutional support: RVO:68378114 Keywords : history of science and technology * hungarian history of science and technology * women in science Subject RIV: AB - History
African Journals Online (AJOL)
Items 251 - 300 of 1346 ... African Journal of Range and Forage Science. ... in quantity and quality of vegetation for estimating the predictable sustainable ... for determination of rangeland biomass using canopy reflectance properties, Abstract.
Digital Repository Service at National Institute of Oceanography (India)
Murty, V.S.N.; Sarma, M.S.S.; Lambata, B.P.; Gopalakrishna, V.V.; Pednekar, S.M.; Rao, A.S.; Luis, A.J.; Kaka, A.R.; Rao, L.V.G.
(2000) 1569}1582 1581 Subrahmanyam, B., 1998. A study of the Indian Ocean Circulation using satellite observations and model simulations. Ph.D. Thesis. University of Southampton, Department of Oceanography, UK., p. 251, unpublished. Suryanarayana, A...
Digital Repository Service at National Institute of Oceanography (India)
Menezes, M.R.; Ikeda, M.; Taniguchi, N.
Journal of Marine and Freshwater Research 34, 231–251. Sharp, G. D. & Pirages, S. W. (1978). The distribution of enzymes of red, white and heart muscle: distributional characteristics in selected scombrid fishes. In The Physiological Ecology of Tunas...
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 251 - 260 of 875 ... ... "Planning and Managing Sustainable Cities: From Research to Practice," focused ... has contributed to the development of regional knowledge and ... of and recommendations for the functioning of the DIRSI Network.
African Journals Online (AJOL)
Items 251 - 300 of 1255 ... Vol 13, No 1 (2007), Central defference approximation of heat function in forced ... Vol 16, No 3 (2010), Chemical and mineralogical characteristics of ... Chemical profile of the endocarp and exocarp of yellow monkey ...
Czech Academy of Sciences Publication Activity Database
Casillas-Trujillo, L.; Andersson, D.A.; Dorado, B.; Nikl, Martin; Sickafus, K.E.; McClellan, K.J.; Stanek, C.R.
2014-01-01
Roč. 251, č. 11 (2014), s. 2279-2286 ISSN 0370-1972 Institutional support: RVO:68378271 Keywords : atomistic simulation * defects * nonstoichiometry * perovskites * scintillators Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.489, year: 2014
14 CFR 25.1585 - Operating procedures.
2010-01-01
...) Non-normal procedures for malfunction cases and failure conditions involving the use of special... envelopes, determined under § 25.251 must be furnished. The buffet onset envelopes presented may reflect the...
78 FR 46998 - Agency Information Collection Activities: Passenger List/Crew List
2013-08-02
... vessels in complying with Sections 231 and 251 of the Immigration and Nationality Act (INA). This form is...://forms.cbp.gov/pdf/CBP_Form_I418.pdf . Current Actions: This submission is being made to extend the...
78 FR 26648 - Agency Information Collection Activities: Passenger List/Crew List (CBP Form I-418)
2013-05-07
..., owners, or agents of vessels in complying with Sections 231 and 251 of the Immigration and Nationality... at http://forms.cbp.gov/pdf/CBP_Form_I418.pdf . Current Actions: This submission is being made to...
77 FR 2561 - Agency Information Collection Activities: Passenger List/Crew List (CBP Form I-418)
2012-01-18
... use by masters, owners, or agents of vessels in complying with Sections 231 and 251 of the Immigration... I-418 can be found at http://forms.cbp.gov/pdf/CBP_Form_I418.pdf . Current Actions: This submission...
76 FR 9806 - Agency Information Collection Activities: Passenger List/Crew List (CBP Form I-418)
2011-02-22
..., owners, or agents of vessels in complying with Sections 231 and 251 of the Immigration and Nationality... can be found at http://forms.cbp.gov/pdf/CBP_Form_I418.pdf . Current Actions: This submission is being...
How Alzheimer's Changes the Brain
Full Text Available ... the Rest of Your Life - Duration: 57:30. University of California Television (UCTV) 251,564 views 57:30 ... About Press Copyright Creators Advertise Developers +YouTube Terms Privacy Policy & ...
African Journals Online (AJOL)
Items 251 - 300 of 1011 ... Vol 36, No 4 (2017), Design and implementation of a density-based traffic light control with ... Design of Improved Stormwater Management System for the ... Vol 35, No 2 (2016), DETERMINANTS OF RESIDENTIAL PER ...
African Journals Online (AJOL)
Items 251 - 300 of 1215 ... Vol 5, No 2 (2011), Corporate Relationship Marketing in Developing Economies: ... Vol 6, No 3 (2012), Culture, Product Advertising, and Advertising ... in Nigerian Secondary Schools: The Role of School Administrators ...
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 251 - 260 of 8491 ... ... to foster effective women's leadership for inclusive policymaking. “Women supporting Women” is an applied research project led by Fundación Democracia y ... Addressing the Barriers to Young Women's Economic ...
Cumulative lactate and hospital mortality in ICU patients
van Beest, Paul A.; Brander, Lukas; Jansen, Sebastiaan P. A.; Rommes, Johannes H.; Kuiper, Michael A.; Spronk, Peter E.
2013-01-01
Background: Both hyperlactatemia and persistence of hyperlactatemia have been associated with bad outcome. We compared lactate and lactate-derived variables in outcome prediction. Methods: Retrospective observational study. Case records from 2,251 consecutive intensive care unit (ICU) patients
African Journals Online (AJOL)
Items 251 - 300 of 641 ... Vol 4, No 1 (2014), Fine Needle Aspiration Cytology in Pediatric Age Group with .... Dental Examination of Adult Turkish Dental Patients, Abstract PDF ... Pattern and Management of Ovarian Cancer at a Tertiary Medical ...
Testing of models of stomatal ozone fluxes with field measurements in a mixed Mediterranean forest
Czech Academy of Sciences Publication Activity Database
Fares, S.; Matteucci, G.; Mugnozza, S.; Morani, A.; Calfapietra, Carlo; Salvatori, E.; Fusaro, L.; Manes, F.; Loreto, F.
2013-01-01
Roč. 67, MAR (2013), s. 242-251 ISSN 1352-2310 Institutional support: RVO:67179843 Keywords : Ozone fluxes * Stomatal conductance models * GPP * Mediterranean forest Subject RIV: EH - Ecology, Behaviour Impact factor: 3.062, year: 2013
African Journals Online (AJOL)
Items 251 - 300 of 592 ... ... s.s. to chemical insecticides after exposure to agrochemical mixture, Abstract PDF .... attitudes and practices on tsetse and sleeping sickness among ... Vol 20, No 2 (2018), Life threatening arrhythmias: Knowledge and ...
Czech Academy of Sciences Publication Activity Database
Lukerchenko, Nikolay
2012-01-01
Roč. 50, č. 2 (2012), s. 251-252 ISSN 0022-1686 Institutional research plan: CEZ:AV0Z20600510 Keywords : saltation * spherical particle * particle-particle collision * numerical model Subject RIV: BK - Fluid Dynamics
Page 1 242 Ethiopian Journal of Environmental Studies ...
African Journals Online (AJOL)
USER
2015-03-17
Mar 17, 2015 ... Ethiopian Journal of Environmental Studies & Management 8(3): 242 – 251, 2015. .... Central Kenya hardly used innovations on botanical pesticides. ..... science of the pests. Similarly ... Management Project in Western. Kenya ...
African Journals Online (AJOL)
Items 251 - 300 of 649 ... Vol 10, No 1 (2000), Health Concern and Challenges Among Junior and High School ... Related Knowledge and Determinants of Voluntary Counseling ... Oral Health on The Quality of Life of Elementary School Teachers ...
African Journals Online (AJOL)
Items 251 - 300 of 429 ... ... in the Management of Pentazocine Dependence- Two Case Reports. ... Vol 16, No 1 (2017), One stage treatment of chronic osteomyelitis .... as a result of juvenile periodontitis in Benin City: A Case Report, Abstract.
Jak se laser uplatnil v holografii?
Czech Academy of Sciences Publication Activity Database
Miler, Miroslav
2010-01-01
Roč. 60, 4-5 (2010), s. 251-256 ISSN 0009-0700 Institutional research plan: CEZ:AV0Z20670512 Keywords : holography * lasers * coherence Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering
Book Review: Training the Party: Party Adaptation and Elite Training in Reform-era China
DEFF Research Database (Denmark)
Brødsgaard, Kjeld Erik
2016-01-01
Review of: Training the Party: Party Adaptation and Elite Training in Reform-era China. Charlotte P. Lee . Cambridge: Cambridge University Press, 2015. xii + 251 pp. $99.99. ISBN 978-1-107-09063-7......Review of: Training the Party: Party Adaptation and Elite Training in Reform-era China. Charlotte P. Lee . Cambridge: Cambridge University Press, 2015. xii + 251 pp. $99.99. ISBN 978-1-107-09063-7...
2012-09-26
... (``ASTM'') ASTM-B42, ASTM-B68, ASTM- B75, ASTM-B88, ASTM-B88M, ASTM-B188, ASTM-B251, ASTM-B251M, ASTM-B280, ASTM-B302, ASTM-B306, ASTM-359, ASTM-B743, ASTM-B819, and ASTM-B903 specifications and meeting the...
1987-06-01
inadequacies of the BUI technique, also used another technique. They sham-exposed previously venous - catheterized but conscious rats for 5, 30, or 60 min...Histochemistry of the Central Nervous System ...................................... 251 3.4.2.1 Studies of Excised Neural Tissues .......... 251 3.4.2.2 In-Vitro...confinement at the Clinic of Occupational Diseases in Prague, the medical history of the subjects were recorded, with some attention also to their social
Ionospheric trough Model used for Telecommunication Purposes
International Nuclear Information System (INIS)
Rothkaehl, H.; Stanislawska, I.
1999-01-01
The mid-latitude trough is dynamical phenomena influenced the COST 251 area. Modelled parameters in COST 251 project are critically dependent on its location and magnitude. The particular importance to HF propagation assessments involving off-great-circle modes of incorporating a representation of the position of the trough is noted. ITU-R prediction maps (ITU-R, 1997) which are currently used in most international propagation assessments do not include this fact. (author)
The effect of transport density and gender on stress indicators and carcass and meat quality in pigs
Energy Technology Data Exchange (ETDEWEB)
Pereira, T.L.; Corassa, A.; Komiyama, C. M.; Araújo, C.V.; Kataoka, A.
2015-07-01
A total of 168 finishing pigs were used to investigate the effects of gender (barrows and gilts) and transport densities for slaughter (236, 251, and 275 kg/m²) on stress indicators and carcass and pork quality. The animals transported at 251 kg/m² (T251) presented cortisol values below those at 236 kg/m2 (T236), but no different from those at 275 kg/m2 (T275). The lactate dehydrogenase (LDH) values in pigs transported at T236 were the lowest. The blood components did not differ between T236 and T275. The pH values at 45 min (pH45) and at 24 h (pH24) postmortem were higher for pigs subjected to T236. However, the pH45 was higher at T251 than at T275, but pH24 was lower at T251 than at T275. The lightness values in the muscles of the pigs transported at T236 and T251 were higher than those at T275. Lower drip loss values were observed in the muscle of animals at T251. Carcasses of pigs at T236 contained more 1–5 cm lesions while those at T275 contained more 5–10 cmlesions in sections of loin. No significant effects of gender were found on the stress indicators, blood components, pH45, pH24, color, drip loss or carcass lesions in general. These results indicate that the pre-slaughter transport of pigs at densities of 251 kg/m² generates less physiological damage and smaller losses on carcass and pork quality irrespective of gender. (Author)
Directory of Open Access Journals (Sweden)
Pedro Reis Rodrigues
2016-06-01
Full Text Available Under adverse environmental conditions the nematode Caenorhabditis elegans can enter an alternate developmental stage called the dauer larva. To identify lipophilic signaling molecules that influence this process, we screened a library of bioactive lipids and found that AM251, an antagonist of the human cannabinoid (CB receptor, suppresses dauer entry in daf-2 insulin receptor mutants. AM251 acted synergistically with glucose supplementation indicating that the metabolic status of the animal influenced the activity of this compound. Similarly, loss of function mutations in the energy-sensing AMP-activated kinase subunit, aak-2, enhanced the dauer-suppressing effects of AM251, while constitutive activation of aak-2 in neurons was sufficient to inhibit AM251 activity. Chemical epistasis experiments indicated that AM251 acts via G-protein signaling and requires the TGF-β ligand DAF-7, the insulin peptides DAF-28 and INS-6, and a functional ASI neuron to promote reproductive growth. AM251 also required the presence of the SER-5 serotonin receptor, but in vitro experiments suggest that this may not be via a direct interaction. Interestingly, we found that other antagonists of mammalian CB receptors also suppress dauer entry, while the nonselective CB receptor agonist, O-2545, not only inhibited the activity of AM251, but also was able to promote dauer entry when administered alone. Since worms do not have obvious orthologs of CB receptors, the effects of synthetic CBs on neuroendocrine signaling in C. elegans are likely to be mediated via another, as yet unknown, receptor mechanism. However, we cannot exclude the existence of a noncanonical CB receptor in C. elegans.
Hu, Yuanjie; Ke, Chao; Ru, Ning; Chen, Yumay; Yu, Liping; Siegel, Eric R; Linskey, Mark E; Wang, Ping; Zhou, Yi-Hong
2015-10-13
Conflicting functions of EFEMP1 in cancer have been reported. Using two syngeneic glioma cell lines (U251 and U251-NS) carrying two different principal cell subpopulations that express high or low EGFR, and that are able to interconvert via mis-segregation of chromosome 7 (Chr7), we studied EFEMP1's cell-context-dependent functions in regulating subpopulation equilibrium, here defined by the percentage of cells carrying different copies of Chr7. We found that EFEMP1 attenuated levels of EGFR and cellular respiration in high-EGFR-expressing cells, but increased levels of NOTCH1, MMP2, cell invasiveness, and both oxidative phosphorylation and glycolytic respiration in low-EGFR-expressing cells. Consistently, EFEMP1 suppressed intracranial xenograft formation in U251 and promoted its formation in U251-NS. Interestingly, subpopulation equilibria in xenografts of U251-NS without EFEMP1 overexpression were responsive to inoculum size (1, 10 and 100 thousand cells), which may change the tumor-onset environment. It was not observed in xenografts of U251-NS with EFEMP1 overexpression. The anti-EGFR function of EFEMP1 suppressed acceleration of growth of U251-NS, but not the subpopulation equilibrium, when serially passed under a different (serum-containing adherent) culture condition. Overall, the data suggest that the orthotopic environment of the brain tumor supports EFEMP1 in carrying out both its anti-EGFR and pro-invasive/cancer stem cell-transforming functions in the two glioma cell subpopulations during formation of a single tumor, where EFEMP1 stabilizes the subpopulation equilibrium in response to alterations of the growth environment. This finding implies that EFEMP1 may restrain cancer plasticity in coping with ever-changing tumor microenvironments and/or therapeutic-intervention stresses.
Chowdhury, Sayan Mullick; Surhland, Cassandra; Sanchez, Zina; Chaudhary, Pankaj; Suresh Kumar, M A; Lee, Stephen; Peña, Louis A; Waring, Michael; Sitharaman, Balaji; Naidu, Mamta
2015-01-01
We report use of PEG-DSPE coated oxidized graphene nanoribbons (O-GNR-PEG-DSPE) as agent for delivery of anti-tumor drug Lucanthone (Luc) into Glioblastoma Multiformae (GBM) cells targeting base excision repair enzyme APE-1 (Apurinic endonuclease-1). Lucanthone, an endonuclease inhibitor of APE-1, was loaded onto O-GNR-PEG-DSPEs using a simple non-covalent method. We found its uptake by GBM cell line U251 exceeding 67% and 60% in APE-1-overexpressing U251, post 24h. However, their uptake was ~38% and 29% by MCF-7 and rat glial progenitor cells (CG-4), respectively. TEM analysis of U251 showed large aggregates of O-GNR-PEG-DSPE in vesicles. Luc-O-GNR-PEG-DSPE was significantly toxic to U251 but showed little/no toxicity when exposed to MCF-7/CG-4 cells. This differential uptake effect can be exploited to use O-GNR-PEG-DSPEs as a vehicle for Luc delivery to GBM, while reducing nonspecific cytotoxicity to the surrounding healthy tissue. Cell death in U251 was necrotic, probably due to oxidative degradation of APE-1. Copyright © 2015 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Chao Yang
2014-01-01
Full Text Available Human mesenchymal stem cells (MSCs have an intrinsic property for homing towards tumor sites and can be used as tumor-tropic vectors for tumor therapy. But very limited studies investigated the antitumor properties of MSCs themselves. In this study we investigated the antiglioma properties of two easily accessible MSCs, namely, human adipose tissue-derived mesenchymal stem cells (ASCs and umbilical cord-derived mesenchymal stem cells (UC-MSCs. We found (1 MSC conditioned media can significantly inhibit the growth of human U251 glioma cell line; (2 MSC conditioned media can significantly induce apoptosis in human U251 cell line; (3 real-time PCR experiments showed significant upregulation of apoptotic genes of both caspase-3 and caspase-9 and significant downregulation of antiapoptotic genes such as survivin and XIAP after MSC conditioned media induction in U 251 cells; (4 furthermore, MSCs conditioned media culture induced rapid and complete differentiation in U251 cells. These results indicate MSCs can efficiently induce both apoptosis and differentiation in U251 human glioma cell line. Whereas UC-MSCs are more efficient for apoptosis induction than ASCs, their capability of differentiation induction is not distinguishable from each other. Our findings suggest MSCs themselves have favorable antitumor characteristics and should be further explored in future glioma therapy.
Hoa, Neil T; Ge, Lisheng; Erickson, Kate L; Kruse, Carol A; Cornforth, Andrew N; Kuznetsov, Yurii; McPherson, Alex; Martini, Filippo; Jadus, Martin R
2015-01-01
Cancer cells derived from Glioblastoma multiforme possess membranous protrusions allowing these cells to infiltrate surrounding tissue, while resisting lymphocyte cytotoxicity. Microvilli and filopodia are supported by actin filaments cross-linked by fascin. Fascin-1 was genetically silenced within human U251 glioma cells; these knock-down glioma cells lost their microvilli/filopodia. The doubling time of these fascin-1 knock-down cells was doubled that of shRNA control U251 cells. Fascin-1 knock-down cells lost their transmigratory ability responding to interleukin-6 or insulin-like growth factor-1. Fascin-1 silenced U251 cells were more easily killed by cytolytic lymphocytes. Fascin-1 knock-down provides unique opportunities to augment glioma immunotherapy by simultaneously targeting several key glioma functions: like cell transmigration, cell division and resisting immune responses. PMID:25901196
Bitoun, Jacob P; Liao, Sumei; McKey, Briggs A; Yao, Xin; Fan, Yuwei; Abranches, Jacqueline; Beatty, Wandy L; Wen, Zezhang T
2013-03-01
Streptococcus mutans, the primary causative agent of dental caries, contains two paralogues of the LytR-CpsA-Psr family proteins encoded by brpA and psr, respectively. Previous studies have shown that BrpA plays an important role in cell envelope biogenesis/homeostasis and affects stress responses and biofilm formation by Strep. mutans, traits critical to cariogenicity of this bacterium. In this study, a Psr-deficient mutant, TW251, was constructed. Characterization of TW251 showed that deficiency of Psr did not have any major impact on growth rate. However, when subjected to acid killing at pH 2.8, the survival rate of TW251 was decreased dramatically compared with the parent strain UA159. In addition, TW251 also displayed major defects in biofilm formation, especially during growth with sucrose. When compared to UA159, the biofilms of TW251 were mainly planar and devoid of extracellular glucans. Real-time-PCR and Western blot analyses revealed that deficiency of Psr significantly decreased the expression of glucosyltransferase C, a protein known to play a major role in biofilm formation by Strep. mutans. Transmission electron microscopy analysis showed that deficiency of BrpA caused alterations in cell envelope and cell division, and the most significant defects were observed in TW314, a Psr-deficient and BrpA-down mutant. No such effects were observed with Psr mutant TW251 under similar conditions. These results suggest that while there are similarities in functions between BrpA and Psr, distinctive differences also exist between these two paralogues. Like Bacillus subtilis but different from Staphylococcus aureus, a functional BrpA or Psr is required for viability in Strep. mutans.
Antiviral and cytotoxic activities of some Indonesian plants.
Lohézic-Le Dévéhat, F; Bakhtiar, A; Bézivin, C; Amoros, M; Boustie, J
2002-08-01
Ten methanolic extracts from eight Indonesian medicinal plants were phytochemically screened and evaluated for antiviral (HSV-1 and Poliovirus) and cytotoxic activities on murine and human cancer lines (3LL, L1210, K562, U251, DU145, MCF-7). Besides Melastoma malabathricum (Melastomataceae), the Indonesian Loranthaceae species among which Elytranthe tubaeflora, E. maingayi, E. globosa and Scurrula ferruginea exhibited attractive antiviral and cytotoxic activities. Piper aduncum (Piperaceae) was found active on Poliovirus. S. ferruginea was selected for further studies because of its activity on the U251 glioblastoma cells.
Energy Technology Data Exchange (ETDEWEB)
Wu, Chia-Chang [School of Public Health, College of Public Health and Nutrition, Taipei Medical University, Taipei, Taiwan (China); Department of Urology, Taipei Medical University—Shuang Ho Hospital, Taipei, Taiwan (China); Huang, Yung-Kai [School of Oral Hygiene, College of Oral Medicine, Taipei Medical University, Taipei, Taiwan (China); Chung, Chi-Jung [Department of Health Risk Management, College of Public Health, China Medical University and Hospital, Taichung, Taiwan (China); Department of Medical Research, China Medical University Hospital, Taichung, Taiwan (China); Huang, Chao-Yuan; Pu, Yeong-Shiau [Department of Urology, National Taiwan University Hospital, College of Medicine National Taiwan University, Taipei, Taiwan (China); Shiue, Horng-Sheng [Department of Chinese Medicine, Chang Gung Memorial Hospital, Taipei, Taiwan (China); Lai, Li-An [School of Public Health, College of Public Health and Nutrition, Taipei Medical University, Taipei, Taiwan (China); Lin, Ying-Chin [Department of Family Medicine, Shung Ho Hospital, Taipei Medical University, Taipei, Taiwan (China); Department of Health Examination, Wan Fang Hospital, Taipei Medical University, Taipei, Taiwan (China); Su, Chien-Tien [Department of Family Medicine, Taipei Medical University Hospital, Taipei, Taiwan (China); Hsueh, Yu-Mei, E-mail: ymhsueh@tmu.edu.tw [School of Public Health, College of Public Health and Nutrition, Taipei Medical University, Taipei, Taiwan (China); Department of Public Health, School of Medicine, College of Medicine, Taipei Medical University, Taipei, Taiwan (China)
2013-10-01
Chronic exposure to arsenic can generate reactive oxidative species, which can induce certain proinflammatory cytokines such as tumor necrosis factor-alpha (TNF-α), interleukin-6 (IL-6) and interleukin-8 (IL-8). TNF-α, IL-6 and IL-8 have been shown to be involved in the development and progression of various cancers, including bladder cancer. This study aimed to investigate the joint effect of the polymorphism of TNF-α − 308 G/A, IL-6 − 174 G/C, IL-8 − 251 T/A and urinary arsenic profiles on urothelial carcinoma (UC) risk. This study evaluated 300 pathologically-confirmed cases of UC and 594 cancer-free controls. Urinary arsenic species were detected using high-performance liquid chromatography-linked hydride generator and atomic absorption spectrometry. The polymorphism of TNF-α − 308 G/A, IL-6 − 174 G/C and IL-8 − 251 T/A was determined using polymerase chain reaction-restriction fragment length polymorphism. The joint effects on UC risk were estimated by odds ratios and 95% confidence intervals using unconditional logistic regression. We found that the TNF-α − 308 A/A and IL-8 − 251 T/T polymorphisms were significantly associated with UC. Moreover, significant dose–response joint effect of TNF-α − 308 A/A or IL-8 − 251 T/T genotypes and arsenic methylation indices were seen to affect UC risk. The present results also showed a significant increase in UC risk in subjects with the IL-8 − 251 T/T genotype for each SD increase in urinary total arsenic and MMA%. In contrast, a significant decrease in UC risk was found in subjects who carried the IL-8 − 251 T/T genotype for each SD increase in DMA%. - Highlights: • Joint effect of the TNF-α -308 A/A genotype and urinary total arsenic affected UC. • Joint effect of the IL-8 -251 T/T genotype and urinary total arsenic affected UC. • Urinary total arsenic level, TNF-α -308 A/A and IL-8 -251 T/T genotype affected UC.
International Nuclear Information System (INIS)
Wu, Chia-Chang; Huang, Yung-Kai; Chung, Chi-Jung; Huang, Chao-Yuan; Pu, Yeong-Shiau; Shiue, Horng-Sheng; Lai, Li-An; Lin, Ying-Chin; Su, Chien-Tien; Hsueh, Yu-Mei
2013-01-01
Chronic exposure to arsenic can generate reactive oxidative species, which can induce certain proinflammatory cytokines such as tumor necrosis factor-alpha (TNF-α), interleukin-6 (IL-6) and interleukin-8 (IL-8). TNF-α, IL-6 and IL-8 have been shown to be involved in the development and progression of various cancers, including bladder cancer. This study aimed to investigate the joint effect of the polymorphism of TNF-α − 308 G/A, IL-6 − 174 G/C, IL-8 − 251 T/A and urinary arsenic profiles on urothelial carcinoma (UC) risk. This study evaluated 300 pathologically-confirmed cases of UC and 594 cancer-free controls. Urinary arsenic species were detected using high-performance liquid chromatography-linked hydride generator and atomic absorption spectrometry. The polymorphism of TNF-α − 308 G/A, IL-6 − 174 G/C and IL-8 − 251 T/A was determined using polymerase chain reaction-restriction fragment length polymorphism. The joint effects on UC risk were estimated by odds ratios and 95% confidence intervals using unconditional logistic regression. We found that the TNF-α − 308 A/A and IL-8 − 251 T/T polymorphisms were significantly associated with UC. Moreover, significant dose–response joint effect of TNF-α − 308 A/A or IL-8 − 251 T/T genotypes and arsenic methylation indices were seen to affect UC risk. The present results also showed a significant increase in UC risk in subjects with the IL-8 − 251 T/T genotype for each SD increase in urinary total arsenic and MMA%. In contrast, a significant decrease in UC risk was found in subjects who carried the IL-8 − 251 T/T genotype for each SD increase in DMA%. - Highlights: • Joint effect of the TNF-α -308 A/A genotype and urinary total arsenic affected UC. • Joint effect of the IL-8 -251 T/T genotype and urinary total arsenic affected UC. • Urinary total arsenic level, TNF-α -308 A/A and IL-8 -251 T/T genotype affected UC
DEFF Research Database (Denmark)
Varodayan, Florence P.; Bajo, Michal; Soni, Neeraj
2017-01-01
in BLA pyramidal neurons of rats exposed to 2–3 weeks intermittent ethanol. In the naïve rat BLA, the CB1 agonist WIN 55,212-2 (WIN) decreased GABA release, and this effect was prevented by the CB1 antagonist AM251. AM251 alone increased GABA release via a mechanism requiring postsynaptic calcium-dependent......1 influence on BLA GABAergic transmission that is dysregulated by chronic ethanol exposure and, thus, may contribute to the alcohol-dependent state....
Dicty_cDB: Contig-U04729-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U04729-1 no gap 251 5 1037629 1037880 PLUS 1 1 U04729 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U04729-1 Contig ID Contig-U04729-1 Contig update 2001. 8.29 Contig sequence >Contig-U04729-1 (Contig...-U04729-1Q) /CSM_Contig/Contig-U04729-1Q.Seq.d TGGATTTATAACAGAGGTTATTGTAGGTGGTAAAACTTTTAGAGGAATCG ...CATTATCTAATGGG T Gap no gap Contig length 251 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start ...ITEVIVGGKTFRGIVFEDLKSSNQTNNHSQNFSPNQSGTNLNNSNSNIPSSKKIKDKN ISPSSFLPTIGSTTSTSNPLSNG Translated Amino Acid seq
The Shock and Vibration Digest. Volume 18, Number 12
1986-12-01
Sfstem Subjected to Random Excitation K. Sato , S. Yamamoto, O. Kamada, N. Takatsu Utsuncmiya Univ., Utsunomiya, Japan Bull. JSME, 22 (251), pp... Sato Tokyo Institute of Technology, Yokohama, Japan Bull. JSME, IS! (251), pp 1605-1611 (May 1986) 15 figs, 2 tables, 18 refs KEY WORDS...Matiunaga, T Mattuahita, Mikio Matiuuchi, Kazuo Matteucci, M Matyiiak, S.J Matzen, V.C May, R.A Mayct , M.J Maye» , R.L 1340, Maye», W.H
Atomistic determinants of co-enzyme Q reduction at the Qi-site of the cytochrome bc1 complex
DEFF Research Database (Denmark)
Postila, Pekka A.; Kaszuba, Karol; Kuleta, Patryk
2016-01-01
into the Q i-site to facilitate binding of half-protonated semiquinone-a reaction intermediate that is potentially formed during substrate reduction. At this bent pose, the Lys251 forms a salt bridge with the Asp252, thus making direct proton transfer possible. In the neutral state, the lysine side chain...... stays close to the conserved binding location of cardiolipin (CL). This back-and-forth motion between the CL and Asp252 indicates that Lys251 functions as a proton shuttle controlled by pH-dependent negative feedback. The CL/K/D switching, which represents a refinement to the previously described CL...
International Nuclear Information System (INIS)
Hesketh, K.; Porsch, D.; Rimpault, G.; Taiwo, T.; Worrall, A.
2013-01-01
The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238 U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for
African Journals Online (AJOL)
Items 251 - 300 of 11090 ... SD Karou, WMC Nadembega, DP Ilboudo, D Ouermi, M Gbeassor, C De Souza, J Simpore. Vol 11, No 26 (2012), Spinacia oleracea ... Vol 11, No 18 (2012), Trichoderma spp. from rhizosphere soil and their antagonism against Fusarium sambucinum, Abstract PDF. Z Ru, W Di. Vol 8, No 11 (2009) ...
Posttraumatic Stress Disorder Among Bereaved Relatives of Cancer Patients
DEFF Research Database (Denmark)
Elklit, Ask; Reinholt, N.; Nielsen, Louise Hjort
2010-01-01
The aim of this study was to assess post-traumatic stress disorder (PTSD) and predictors of PTSD in individuals who experienced the loss of a close relative to cancer. A total of 251 bereaved relatives ages 14 to 76 (M = 41.3, SD = 16.8) were recruited at a counseling service for cancer patients...
East ad Central African Journal of Pharmaceutical Sciences Peak ...
African Journals Online (AJOL)
ant "le absorbance difference method of spectral suppression [5,6,8,23-251. 0:~ C1. This number study of examines deconvolution the possibility algorithms of for ... LDC-constametric 3000 dual piston pump (LDC-. Milton Roy, Rivera Beach, F1 USA) was employed. The HPLC column used for the experiment was a 100 x ...
Zhao, Zhijun; Wang, Bin; Hao, Junhai; Man, Weitao; Chang, Yongkai; Ma, Shunchang; Hu, Yeshuai; Liu, Fusheng; Yang, Jun
2018-03-01
Expression of the long non-coding RNA taurine-upregulated gene 1 (TUG1) is associated with various aggressive tumors. The present study aimed to investigate the biological function of TUG1 in regulating apoptosis, proliferation, invasion and cell cycle distribution in human glioma U251 cells. Lentivirus-mediated TUG1-specific microRNA was transfected into U251 cells to abrogate the expression of TUG1. Flow cytometry analysis was used to examine the cell cycle distribution and apoptosis of U251 cells. Cellular proliferation was examined using Cell Counting Kit-8 (CCK-8) assays and invasion was examined by Transwell assays. The apoptotic rate of cells in the TUG1-knockdown group was significantly higher than in the negative control (NC) group (11.58 vs. 9.14%, PTUG1-knockdown group was lower compared with that of the NC group. A Transwell invasion assay was performed, which revealed that the number of invaded cells from the TUG1-knockdown group was the less compared with that of the NC group. In addition, the G 0 /G 1 phase population was significantly increased within the treated group (44.85 vs. 38.45%, PTUG1 may inhibit proliferation and invasion, and promote glioma U251 cell apoptosis. In addition, knockdown of TUG1 may have an effect on cell cycle arrest. The data presented in the current study indicated that TUG1 may be a novel therapeutic target for glioma.
Kruhatka Matthiolova (Cortusa matthioli) v Sudetech aneb anti-Hendrych
Czech Academy of Sciences Publication Activity Database
Danihelka, Jiří
2012-01-01
Roč. 46, č. 2 (2012), s. 251-263 ISSN 1211-5258 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60050516 Keywords : Central Europe * C. Schwenckfelt * history of botany Subject RIV: EF - Botanics
Facebook Use and the Tendency to Ruminate among College Students: Testing Mediational Hypotheses
Locatelli, Sara M.; Kluwe, Katharina; Bryant, Fred B.
2012-01-01
Studies have found that general use of Facebook influences subjective well-being. However, fewer studies have explored the impact of specific use behaviors, such as information posted in status updates. The current study uses data collected from 251 Facebook-using undergraduate students through an online survey, and examines the valence and…
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
251, Taleghani Street, Tehran 1598618133, Iran; Department of Biology, Varamin Pishva Branch, Azad University, Varamin Pishva 7489-33817, Iran; Department of Biology, Science and Research Branch, Islamic Azad University, Tehran 1477892855, Iran; Department of Neurology, Tehran University of Medical Sciences ...
African Journals Online (AJOL)
Items 201 - 250 of 251 ... Vol 7, No 2 (2005), Study on colorectal cancer in the University of Nigeria Teaching Hospital, Enugu risk factors and evaluation of screening .... Vol 2, No 2 (2000), Thiocyanate concentrations in serum and tissues of guinea pigs fed cassava based diets containing graded levels of protein, Abstract.
Does interspecies hybridization affect the host specificity of parasites in cyprinid fish?
Czech Academy of Sciences Publication Activity Database
Šimková, A.; Dávidová, M.; Papoušek, Ivo; Vetešník, Lukáš
2013-01-01
Roč. 6, č. 95 (2013), s. 95 ISSN 1756-3305 R&D Projects: GA ČR GAP505/12/0375 Institutional support: RVO:68081766 Keywords : Cyprinid fish * Interspecies hybridization * Metazoan parasites * Monogenea * Host specificity Subject RIV: EG - Zoology Impact factor: 3.251, year: 2013
African Journals Online (AJOL)
Items 251 - 300 of 519 ... W Tamire, F Enqueselassie. Vol 25, No 3 (2011), Knowledge, attitude and practice towards strabismus in Cheha District, Central Ethiopia, Abstract PDF. K Geta, A Bejiga. Vol 16, No 2 (2002), Knowledge, Attitudes and Practices involved in Harmful Health Behavior in Dembia District, northwest Ethiopia ...
Tectonic phase separation applied to the Sudetic Marginal Fault Zone (NE part of the Czech Republic)
Czech Academy of Sciences Publication Activity Database
Nováková, Lucie
2015-01-01
Roč. 12, č. 2 (2015), s. 251-267 ISSN 1672-6316 R&D Projects: GA ČR GA205/09/1244 Institutional support: RVO:67985891 Keywords : Sudetic Marginal Fault Zone * paleostress reconstruction * active tectonics * frequency analysis Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.017, year: 2015
Czech Academy of Sciences Publication Activity Database
Sovilj, Milan
2017-01-01
Roč. 25, č. 1 (2017), s. 251-254 ISSN 0354-6497 Institutional support: RVO:68378114 Keywords : conference * Balkan studies * contemporary history Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)
Czech Academy of Sciences Publication Activity Database
Čeřovská, Noemi; Moravec, Tomáš; Plchová, Helena; Hoffmeisterová, Hana; Dědič, P.
2012-01-01
Roč. 160, č. 5 (2012), s. 251-254 ISSN 0931-1785 R&D Projects: GA MŠk 1M06030 Institutional research plan: CEZ:AV0Z50380511 Keywords : Potato virus M * recombinant protein * coat protein Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.000, year: 2012
African Journals Online (AJOL)
Items 251 - 300 of 475 ... OS Abbadi, KH Bakheit, HM Abdel Rahim. Vol 1, No 1 (2006) ... HA Eltilib, NA Hameed, A Munim, E Abdel Rahman, A Bassili. Vol 8, No 1 ... F-E Imad, LA El Hassan, R Elbadawi, MAR Arbab, AM El Hassan. Vol 9, No 2 ...
Pequi pulp ( Caryocar brasiliense Cambess): Drying kinetics and ...
African Journals Online (AJOL)
The entropy values found were -251.01, -250.38 and -250.05 (J.Mol-1K-1) for the same temperatures. The values obtained from the Gibbs free energy for the drying of Pequi pulp increased with increasing temperature. The obtained data were consistent to the drying process, and the mathematical equations were effective ...
Czech Academy of Sciences Publication Activity Database
Marigo, A. M.; Levron, Céline; Bâ, Ch. T.; Miquel, J.
2012-01-01
Roč. 251, č. 2 (2012), s. 147-159 ISSN 0044-5231 R&D Projects: GA AV ČR KJB600960813 Institutional research plan: CEZ:AV0Z60220518 Keywords : Spermiogenesis * Spermatozoon * Ultrastructure * Barsonella lafoni * Proteocephalinae * Proteocephalidae * Proteocephalidea * Cestoda Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.400, year: 2012
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 251 - 260 of 8494 ... ... of the demand for health service delivery in the Middle East and North Africa. ... As the agriculture community in Africa converges at the African Green ... Strengthening response capacity to African infectious disease outbreaks. The 2014 Ebola outbreak in West Africa claimed the lives of tens of ...
Detection of antineutrophil cytoplasmic antibodies (ANCAs)
DEFF Research Database (Denmark)
Damoiseaux, Jan; Csernok, Elena; Rasmussen, Niels
2017-01-01
of diagnosis) from 251 patients with ANCA-associated vasculitis (AAV), including granulomatosis with polyangiitis and microscopic polyangiitis, and from 924 disease controls were tested for the presence of cytoplasmic pattern/perinuclear pattern and atypical ANCA (A-ANCA) by indirect immunofluorescence (IIF...
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Genetics. STEFANOS BONOVAS. Articles written in Journal of Genetics. Volume 97 Issue 1 March 2018 pp 235-251 RESEARCH ARTICLE. Interleukin gene polymorphisms and susceptibility to HIV-1 infection: a meta-analysis · CHRISSA G TSIARA GEORGIOS K. NIKOLOPOULOS NIKI L. DIMOU ...
African Journals Online (AJOL)
Items 251 - 300 of 319 ... Vol 13, No 2 (2013), Quality and value chain analyses of Ethiopian coffee, Abstract PDF ... resource and threats to sustainable cultivation in Mbaise area of Imo State, ... in Rivers State, Nigeria: A Translog Model Approach, Abstract PDF ... Perception of Forestry and Wildlife Management in Rivers State, ...
Bedel, Emine Ferda
2016-01-01
This study is designed to explore academic motivation, academic self-efficacy and attitudes toward teaching in pre-service early childhood education teachers and to investigate the relationships among those variables. Data were gathered through questionnaires administered to 251 pre-service early childhood education teachers. Results indicated…
African Journals Online (AJOL)
Items 251 - 300 of 763 ... ... A Vision of Lake Victoria Basin as an Environmental Observatory ... Vol 4, No 8 (2010), Effect of leaching on heavy metals concentration of soil in some ... Vol 7, No 2 (2013), Effect of remediation on growth parameters, ...
Family Life Education for Young Inner-City Teens: Identifying Needs.
Herz, Elicia J.; Reis, Janet S.
1987-01-01
Sexual decision making, perceptions of responsibility for birth control and pregnancy, and knowledge of contraception and the consequences of teenage pregnancy were assessed among 251 high-risk seventh- and eighth-grade Black, inner-city adolescents to determine these young peoples' need for information. (Author/LMO)
Prevalence of camel tuberculosis and associated risk factors in ...
African Journals Online (AJOL)
Kremer, K. and Van-Soolingen, D., 2002. The last outbreak of bovine tuberculosis in cattle in the Czech Republic in 1995 was caused by Mycobacterium bovis subspe- cies caprae. Vet. Med., 47, 251–263. Pavlik, I., Trcka, I., Parmova, I., Svobodova, J., Melicharek, I., Nagy, G., Cvetnic, Z.,. Ocepek, M., Pate, M. and Lipiec, M., ...
Czech Academy of Sciences Publication Activity Database
Kučera, Jan; Byrne, A. R.; Mizera, Jiří; Lučaníková, M.; Řanda, Zdeněk
2006-01-01
Roč. 269, č. 2 (2006), s. 251-257 ISSN 0236-5731 R&D Projects: GA ČR(CZ) GA203/04/0943 Institutional research plan: CEZ:AV0Z10480505 Keywords : radiochemical neutron activation analysis * rhenium * biological and environmental samples Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.509, year: 2006
2013-04-19
... issued a sequestration order in accordance with section 251A of the Balanced Budget and Emergency Deficit... Act, 2013 (Pub. L. 113-2) for the purpose of assisting recovery in the most impacted and distressed... IV. Finding of No Significant Impact I. Background The Disaster Relief Appropriations Act, 2013 (Pub...
African Journals Online (AJOL)
Items 251 - 300 of 338 ... An exploratory study of psychological and developmental issues ... Psychosocial adjustment of children affected by HIV/AIDS in Ghana, Abstract ... a review of international and southern African research, Abstract ... social support and health behaviour among black students in South Africa, Abstract.
Effect of abandonment and plant classification on carbohydrate reserves of meadow plants
Czech Academy of Sciences Publication Activity Database
Janeček, Štěpán; Lanta, Vojtěch; Klimešová, Jitka; Doležal, Jiří
2010-01-01
Roč. 13, č. 2 (2010), s. 243-251 ISSN 1435-8603 R&D Projects: GA ČR GA526/09/0963; GA ČR(CZ) GA526/06/0723 Institutional research plan: CEZ:AV0Z60050516 Keywords : carbohydrates * meadow * abandonment Subject RIV: EF - Botanics Impact factor: 2.409, year: 2010
Dynamique de croissance et taux de mortalité de Rhizophora spp ...
African Journals Online (AJOL)
SARAH
30 janv. 2015 ... Dynamique des paysages végétaux du littoral centre-ouest du Gabon autour de. Port-Gentil : Approche spatiale et analyse des données de terrain. Thèse de doctorat. Univ. Paul-Valery Montpellier 3, France. 302 p. Spalding MD, Blasco F, Field CD, 1997. World. Mangrove Atlas. ISME, Okinawa, Japan. 251.
47 CFR 19.735-106 - Interpretation and advisory service.
2010-10-01
... through the employee's supervisor to the General Counsel, who is the Commission's Designated Agency Ethics Official pursuant to the delegation of authority at 47 CFR 0.251(a). (b) At the time of an employee's... Section 19.735-106 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL EMPLOYEE RESPONSIBILITIES...
Coventry, William; Anton-Mendez, Ines; Ellis, Elizabeth M.; Levisen, Christina; Byrne, Brian; van Daal, Victor H. P.; Ellis, Nick C.
2012-01-01
We present one of the first behavior-genetic studies of individual differences in school students' levels of achievement in instructed second language acquisition (ISLA). We assessed these language abilities in Australian twin pairs (maximum N pairs = 251) by means of teacher ratings, class rankings, and self-ratings of proficiency, and used the…
2013-11-25
...] Rigging Equipment for Material Handling; Extension of the Office of Management and Budget's (OMB) Approval... on Rigging Equipment for Material Handling (29 CFR 1926.251). These paragraphs require affixing... automated or other technological information collection and transmission techniques. III. Proposed Actions...
77 FR 52072 - Sunshine Act Meeting
2012-08-28
...: Commissioners' Conference Room, 11555 Rockville Pike, Rockville, Maryland. STATUS: Public and Closed. Week of...) (Contact: Richard Correia, 301-251-7430). This meeting will be webcast live at the Web address--www.nrc.gov. Friday, September 14, 2012 11:00 a.m. Discussion of Management and Personnel Issues (Closed--Ex. 2 and 6...
78 FR 23960 - Sunshine Act Meetings
2013-04-23
...' Conference Room, 11555 Rockville Pike, Rockville, Maryland. STATUS: Public and Closed. Week of April 22, 2013... Meeting) (Contact: Brett Rini, 301-251-7615). This meeting will be webcast live at the Web address--www.nrc.gov. 2:30 p.m. Discussion of Management and Personnel Issues (Closed--Ex. 2 and 6). Tuesday April...
78 FR 21171 - Sunshine Act Meetings
2013-04-09
...: Commissioners' Conference Room, 11555 Rockville Pike, Rockville, Maryland. STATUS: Public and Closed. Week of... Meeting) (Contact: Brett Rini, 301-251-7615) This meeting will be webcast live at the Web address--www.nrc.gov. 2:30 p.m. Discussion of Management and Personnel Issues (Closed-- Ex. 2 and 6) Tuesday, April 23...
78 FR 18376 - Sunshine Act Meetings
2013-03-26
...: Commissioners' Conference Room, 11555 Rockville Pike, Rockville, Maryland. STATUS: Public and Closed. Week of...-0223). This meeting will be webcast live at the Web address--www.nrc.gov. Week of April 8, 2013...) (Contact: Brett Rini, 301-251-7615). This meeting will be webcast live at the Web address--www.nrc.gov. 2...
African Journals Online (AJOL)
Items 251 - 300 of 559 ... Vol 15, No 1 (2016), Home-based rehabilitation interventions for adults living ... of the national programme for prevention of mother-to-child transmission of HIV: ... intervention for mental health co-morbidity in HIV-positive ...
Czech Academy of Sciences Publication Activity Database
Sláma, Karel; Lukáš, J.
2011-01-01
Roč. 57, č. 2 (2011), s. 251-259 ISSN 0022-1910 Grant - others:MZe ČR(CZ) 002 700 604 Institutional research plan: CEZ:AV0Z50070508 Keywords : autonomic heartbeat * myogenic heartbeat * anterograde heartbeat Subject RIV: ED - Physiology Impact factor: 2.236, year: 2011
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 251 - 260 of 272 ... Urban agriculture could boost food security in Arab countries ... Despite reforms, labour markets in the Middle East and North Africa (MENA) have been unable ... the brand of the bottled water and how it is stored affected its quality. ... Copyright · Open access policy · Privacy policy · Research ethics ...
Yankee Nuclear Power Station. Annual operating report: January--December 1976
International Nuclear Information System (INIS)
1977-01-01
Net electrical power generated was 1,251,255 MWH with the reactor on line 7887 hrs. Information is presented concerning operations, power generation, shutdowns, corrective maintenance, chemistry and radiochemistry, occupational radiation exposure, release of radioactive materials, reportable occurrences, containment penetration tests, and fuel performance
Reduction of the Misinformation Effect by Arousal Induced after Learning
English, Shaun M.; Nielson, Kristy A.
2010-01-01
Misinformation introduced after events have already occurred causes errors in later retrieval. Based on literature showing that arousal induced after learning enhances delayed retrieval, we investigated whether post-learning arousal can reduce the misinformation effect. 251 participants viewed four short film clips, each followed by a retention…
Czech Academy of Sciences Publication Activity Database
Havelková, P.; Hladík, Marek; Velemínský, P.
2013-01-01
Roč. 23, č. 2 (2013), s. 237-251 ISSN 1047-482X Institutional research plan: CEZ:AV0Z80010507 Institutional support: RVO:68081758 Keywords : Early Middle Ages * enthesopathies * factor analysis * grave goods * musculoskeletal stress markers * social status Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 1.070, year: 2013
African Journals Online (AJOL)
Items 251 - 300 of 2200 ... Vol 37, No 2 (2007), Body weight and growth rate of South African Angora ... Body weight, scrotal circumference and testosterone concentration in young ... Vol 37, No 4 (2007), Carcass and muscle yields of ostriches as ...
75 FR 1658 - Withdrawal of Regulatory Guide 7.5
2010-01-12
..., Washington, DC 20555-0001, telephone: 301-251-7447 or e-mail [email protected] . SUPPLEMENTARY..., e.g., Federal, State, or local government radioactive material shipments transported by government... 301- 415-3548, and by e-mail to [email protected] . Dated at Rockville, Maryland, this 5th day of...
Lifescience Database Archive (English)
Full Text Available QT98651 Cucumis sativus Cucurbitaceae Swf-2 resistance to Melon yellow spot virus ...resistance to Melon yellow spot virus MYSV-FuCu05P 3 CSN251 Chr03 ... 34.0-56.0 11 ... 10.1007/s10681-015-1444-x ...
Thermotransport of nitrogen and oxygen in β-zirconium
Vogel, D.L.; Rieck, G.D.
1971-01-01
An investigation of thermotransport of nitrogen in ß-zirconium is reported. Using a method previously described, the heat of transport turned out to be 25.1 kcal/mole with a standard deviation of 2.5 kcal/mole. The formerly published value of the heat of transport of oxygen in ß-zirconium, viz. 20
Teacher Grading Decisions: Influences, Rationale, and Practices
Kunnath, Joshua P.
2017-01-01
This mixed-methods study applied a decision-making theoretical framework to an investigation of teacher grading in a large urban school district in California. A sample of 251 high school teachers of core subjects were surveyed, and 15 teachers participated in four focus group interviews in order provide data on the influences, rationale, and…
Czech Academy of Sciences Publication Activity Database
Hypša, Václav; Křížek, J.
2007-01-01
Roč. 54, č. 2 (2007), s. 242-251 ISSN 0095-3628 Grant - others:GA ČR(CZ) GA206/04/0520 Institutional research plan: CEZ:AV0Z60220518 Keywords : Anoplura * endosymbionts * coevolution * molecular phylogeny Subject RIV: EE - Microbiology, Virology Impact factor: 2.558, year: 2007
THERMODYNAMICS AND ADSORPTION ISOTHERMS FOR THE ...
African Journals Online (AJOL)
BAFFA
The use of maize (Zea mays) cob for the biosorption of Cr(VI), Ni(II) and Cd(II) is ... Variations in the concentration of the different adsorbates during the adsorption process .... Langmuir isotherm is the dimensionless separation .... The use of Sago waste for the sorption of lead and copper. Water S. Afr., 24 (3), p251-256.
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
2016-01-27
Jan 27, 2016 ... Moscow Engineering Physics Institute, Kashirskoe Shosse 31, 115409 Moscow, Russia. Astronomical Institute, Czech Academy of Sciences, Fricova 298, 251 65 Ondrejov, Czech Republic. INAF/Observatorio Astronomico di Palermo and University of Palermo, Palazzo dei Normanni, I-90134 Palermo, Italy.
African Journals Online (AJOL)
Items 251 - 300 of 490 ... Issue, Title. Vol 6, No 2 (2010), Knowledge and patterns of use of highly active antiretroviral therapies in HIV management at Abuja, Nigeria, Abstract. Jill I Okpalugo, US Inyang, K Ibrahim, F Anita, Chinwe V Ukwe, NC Aguwa. Vol 5, No 4 (2009), Knowledge and utilization of the acts in two major ...
Numerical solution of modified fokker-planck equation with poissonian input
Czech Academy of Sciences Publication Activity Database
Náprstek, Jiří; Král, Radomil
2010-01-01
Roč. 17, 3/4 (2010), s. 251-268 ISSN 1802-1484 R&D Projects: GA AV ČR(CZ) IAA200710805; GA ČR(CZ) GA103/09/0094 Institutional research plan: CEZ:AV0Z20710524 Keywords : Fokker-Planck equation * poisson ian exciation * numerical solution * transition effects Subject RIV: JN - Civil Engineering
African Journals Online (AJOL)
Items 251 - 300 of 683 ... W Richard J Dean, Suzanne J Milton, Hugh P Forsyth, Dorrien R Tissiman. Vol 86 ... Shane C McPherson, Mark Brown, Colleen T Downs ... Katharine A. Howard, Thomas W. Schwertner, James P. Muir, Ara Monadjem.
African Journals Online (AJOL)
Items 251 - 300 of 1385 ... Vol 13, No 4 (2009), Chromium Uptake Efficiency of Spinacea olaracea from Contaminated Soil ... in the Mitigation of Crude Oil Toxicity in Tropical Soil, Abstract PDF ... chemical coagulation processes in the treatment of an effluent of a ... Kernel and Steel Fibre Reinforced Polyster+ Polymer Concrete ...
Evaluation of the predictive capacity of DNA variants associated with straight hair in Europeans
DEFF Research Database (Denmark)
Pośpiech, Ewelina; Karłowska-Pik, Joanna; Marcińska, Magdalena
2015-01-01
pattern baldness revealed a suggestive association with hair morphology for rs4679955 on 3q25.1. The study results reported provide the starting point for the development of a predictive test for hair morphology in Europeans. More studies are now needed to discover additional determinants of hair...
Mortaliteten hos multitraumatiserede trafiktilskadekomne. Deskriptiv undersøgelse 1986-1990
DEFF Research Database (Denmark)
Larsen, M S; Jørgensen, H R
1995-01-01
In the period 1986-1990, 16,307 patients were injured in road traffic accidents in the city of Odense, Denmark. 251 had multiple injuries according to the definition: AIS > or = 3 in at least two body regions. Overall mortality was 41%, while the mortality in hospital was 20%. 19 patients died...
Hvidston, David J.; Range, Bret G.; McKim, Courtney Ann; Mette, Ian M.
2015-01-01
This study examined the perspectives of novice and late career principals concerning instructional and organizational leadership within their performance evaluations. An online survey was sent to 251 principals with a return rate of 49%. Instructional leadership components of the evaluation that were most important to all principals were:…
Influence of rice sample preparation and milling procedures on milling quality appraisals
The objective of this research was to investigate the effect of sample preparation and milling procedure on milling quality appraisals of rough rice. Samples of freshly harvested medium-grain rice (M202) with different initial moisture contents (MCs) ranging from 20.2% to 25.1% (w.b.) were used for...
Kolísání a tendence v režimu odtoků povodí českého Labe
Czech Academy of Sciences Publication Activity Database
Buchtele, Josef; Buchtelová, Marie; Fořtová, Magda
2008-01-01
Roč. 58, č. 7 (2008), s. 251-255 ISSN 1211-0760 Grant - others:EU(CZ) NeWater No. 511179 Institutional research plan: CEZ:AV0Z20600510 Keywords : runoff changes * natural affection * antropogenic changes * identification of changes Subject RIV: BK - Fluid Dynamics
Effect of Platinum in Bifunctional Isomerization of n-Butane over Acid Zeolites
Czech Academy of Sciences Publication Activity Database
Babůrek, Evžen; Nováková, Jana
2000-01-01
Roč. 190, č. 1 (2000), s. 241-251 ISSN 0926-860X R&D Projects: GA AV ČR IAA4040710 Institutional research plan: CEZ:AV0Z4040901; CEZ:A54/98:Z4-040-9-ii Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.576, year: 2000
Zern, David S.
1989-01-01
Asked 251 college students to describe their own degree of religiousness and that of the home atmosphere in which they grew up. When measures of students' total religiousness, their belief in God, and their ritual observance were related separately to their cumulative grade point averages, no relationship was found for either present or past…
International Nuclear Information System (INIS)
Yamonouchi, T.; Fukuari, Y.; Hayashi, M.; Komatsu, M.; Suyama, N.; Uchida, T.
1982-01-01
This report describes the results of an operational field test of the automated electromanometer system installed at the input accountability vessel (251V10) and the plutonium product accountability vessel (266V23) in the Tokai Reprocessing Plant. This system has been in use since September 1979 when it was installed in the PNC plant by BNL as part of Task-E, one of the thirteen tasks, in the Tokai Advanced Safeguards Technology Exercise (TASTEX) program. The first report on the progress of this task was published by S. Suda, et al., in the Proceedings of the INMM 22nd Annual Meeting. In this paper, further results of measurement and data analysis are shown. Also, the reliability and applicability of this instrument for accountability, safeguards, and process control purposes are investigated using the data of 106 batches for 251V10 and 40 batches for 266V23 obtained during two campaigns in 1981. There were small but significant differences relative to the plant's measurements for both vessels of 251V10 and 266V23; however, the difference for 251V10 was slightly decreased in the latest vessel calibration. Initially, there were many spurious signals originating with the raw data caused by a software error in the system. However, almost normal conditions were obtained after corrections of the program were made
Survival of enteric bacteria in source-separated human urine used ...
African Journals Online (AJOL)
MAKAYA
Urine in Pumpkin (Cucurbita maxima) Cultivation. Agric. Food Sci. 18:57-68. Pronk W, Koné D (2010). Options for urine treatment in developing countries. Desalination 251:360-368. Schönning C, Leeming R, Stenström TA (2002). Faecal contamination of source-separated human urine based on the content of faecal sterols ...
African Journals Online (AJOL)
Items 251 - 300 of 364 ... Vol 30 (2014), Reviewing Some Implications of the Green Economy for Higher and ... Vol 26 (2009), Sigtuna Think Piece 1 Climate Change Education in Africa ... Vol 33 (2017), Students' attitudes to paper consumption in ...
14 CFR Appendix I to Part 25 - Installation of an Automatic Takeoff Thrust Control System (ATTCS)
2010-01-01
... Appendix I to Part 25—Installation of an Automatic Takeoff Thrust Control System (ATTCS) I25.1General. (a... crew to increase thrust or power. I25.2Definitions. (a) Automatic Takeoff Thrust Control System (ATTCS... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Installation of an Automatic Takeoff Thrust...
Data of evolutionary structure change: 1CG8A-2ZLWD [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1CG8A-2ZLWD 1CG8 2ZLW A D -VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQ...R VQLSGEEKAAVLALWDKV--NEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...> 2ZLW D 2ZLWD ARHFG...fEVID> 2 2ZLW D 2ZLWD LWD... CA 218 GLN CA 251 2ZLW D
African Journals Online (AJOL)
Items 1 - 50 of 251 ... ... status of students in three tertiary institutions in Enugu Metropolis, ... Vol 3, No 2 (2001), Breast cancer in Orlu - Nigeria, Abstract ... Vol 4, No 3 (2002), Child adoption: The psycho trauma of an adolescent single mother ...
2012-04-26
247–251. Barth, A., Alvera -Azcarate, A., Weisberg, R.H., 2008. Benefit of nesting a regional model into a large-scale ocean model instead of...Geophysical Research 108, 3184, http://dx.doi.org/10.1029/2002JC001407. Weisberg, R.H., Barth, A., Alvera -Azcárate, A., Zheng, L., 2009. A
DEFF Research Database (Denmark)
Soni, Neeraj; Kohlmeier, Kristi Anne
2016-01-01
-sensitive, inhibitory postsynaptic currents (IPSCs), which was an action sensitive to presence of a Ca(2+) chelator. Finally, actions of DHPG, a mGlu1R agonist, on IPSC activity were examined and found to result in an AM251- and BAPTA-sensitive inhibition of both the frequency and amplitude of sIPSCs. Taken...
75 FR 27002 - Petitions for Modification
2010-05-13
..., and prevents the diesel system from operating when the electrical system is running. The diesel engine for the tram is not an MSHA-approved permissible engine. The J251-D/E Face Drill has a methane... tram system requires a multi-step process to transport the permissible drill equipment between remote...
African Journals Online (AJOL)
Items 251 - 300 of 399 ... Vol 48, No 4 (2014), Pain, range of motion and activity level as correlates of ... attitudes and acceptability of Treatment of childhood malaria with .... Vol 39, No 2 (2005), Pregnant women's knowledge of and ... Vol 49, No 3 (2015), Prevalence and associated risk factors of asymptomatic bacteriuria in ...
Nonlinear Stress-Strain Behavior of Plasma Sprayed Ceramic Coatings
Czech Academy of Sciences Publication Activity Database
Nohava, Jiří; Kroupa, František
2005-01-01
Roč. 50, č. 3 (2005), s. 251-262 ISSN 0001-7043 R&D Projects: GA AV ČR KSK1010104 Institutional research plan: CEZ:AV0Z20430508 Keywords : plasma spraying * ceramic coatings * Young’s modulus * nonlinear behavior * microcracks Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass
A Study on Chocolate Consumption in Prospective Teachers
Ozgen, Leyla
2016-01-01
This study was planned and conducted to determine the chocolate consumption habits of prospective teachers. The study population was comprised of students attending the Faculty of Education at Gazi University in Ankara and the sample consisted of 251 prospective teachers selected with simple random sampling. 96.4% and 3.6% of the prospective…
Repeatless and Repeat-Based Centromeres in Potato: Implications for Centromere Evolution[C][W
Czech Academy of Sciences Publication Activity Database
Gong, Z.; Wu, Y.; Koblížková, Andrea; Torres, G.A.; Wang, K.; Iovene, M.; Neumann, Pavel; Zhang, W.; Novák, Petr; Buell, C.R.; Macas, Jiří; Jiang, J.
2012-01-01
Roč. 24, č. 9 (2012), s. 3559-3574 ISSN 1040-4651 R&D Projects: GA MŠk(CZ) LH11058 Institutional research plan: CEZ:AV0Z50510513 Institutional support: RVO:60077344 Keywords : repetitive sequences * plant satellite repeats * Arabidopsis thaliana * rice centromere * wild potatoes Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 9.251, year: 2012
Bulletin of Materials Science | News
Indian Academy of Sciences (India)
pp 235-241 Polymers. Synthesis, mechanical, thermal and chemical properties of ... pp 243-249 Polymers. Terpolymerization of 2-ethoxy ethylmethacrylate, styrene ... showed reduction in g value. pp 251-262 Polymers. Analysis of surface degradation of high density polyethylene (HDPE) insulation material due to tracking.
African Journals Online (AJOL)
Items 251 - 300 of 328 ... Issue, Title. Vol 7, No 1 (2003), Sexual Harassment in Academia in Nigeria: How Real? Details PDF. Olugbenga Jelil Ladebo. Vol 8, No 2 (2004), Shaping the internet for match-making/dating: a challenge for the contemporary Nigerian family institution, Abstract PDF. Wale Adesina. Vol 6, No 1 (2002) ...
Indian Academy of Sciences (India)
Date of birth: 6 September 1952. Specialization: Biostatistics, Human Genetics and Population Genetics Address: Distinguished Professor, National Institute of Biomedical Genomics, Post Netaji Subhas Sanitorium, Kalyani 741 251, W.B.. Contact: Office: (033) 2589 2150-51. Residence: (033) 2565 4314
77 FR 11598 - Thermal Overload Protection for Electric Motors on Motor-Operated Valves
2012-02-27
... application of thermal overload protection devices that are integral with the motor starter for electric... Research, U.S. Nuclear Regulatory Commission, Washington, DC 20555-0001, telephone: 301-251-7455; email... Development Branch, Division of Engineering, Office of Nuclear Regulatory Research. [FR Doc. 2012-4552 Filed 2...
African Journals Online (AJOL)
Items 251 - 290 of 290 ... Vol 23, No 1 (2011), The potential market demand for biokinetics in the ... The role of physical activity during pregnancy in determining maternal ... Vol 25, No 1 (2013), The state of women's rugby union in South Africa: ...
Czech Academy of Sciences Publication Activity Database
Kasatkin, A.V.; Plášil, Jakub; Pekov, V.I.; Belakovskiy, D. I.; Nestola, F.; Čejka, J.; Vigasina, M.F.; Zorzi, F.; Thorne, B.
2015-01-01
Roč. 60, č. 4 (2015), s. 251-257 ISSN 1802-6222 R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : karpenkoite * new mineral * cobalt divanadate * powder diffraction * Little Eva mine * Utah Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.326, year: 2015
Gene by Environment Investigation of Incident Lung Cancer Risk in African-Americans
Directory of Open Access Journals (Sweden)
Sean P. David
2016-02-01
Interpretation: These results suggest that chromosome 15q25.1 variants are robustly associated with CPD and lung cancer in African-Americans and that the allelic dose effect of these polymorphisms on lung cancer risk is most pronounced in lighter smokers.
The role of smoking and diet in explaining educational inequalities in lung cancer incidence
Menvielle, Gwenn; Boshuizen, Hendriek; Kunst, Anton E.; Dalton, Susanne O.; Vineis, Paolo; Bergmann, Manuela M.; Hermann, Silke; Ferrari, Pietro; Raaschou-Nielsen, Ole; Tjønneland, Anne; Kaaks, Rudolf; Linseisen, Jakob; Kosti, Maria; Trichopoulou, Antonia; Dilis, Vardis; Palli, Domenico; Krogh, Vittorio; Panico, Salvatore; Tumino, Rosario; Büchner, Frederike L.; van Gils, Carla H.; Peeters, Petra H. M.; Braaten, Tonje; Gram, Inger T.; Lund, Eiliv; Rodriguez, Laudina; Agudo, Antonio; Sánchez, Maria-José; Tormo, Maria-José; Ardanaz, Eva; Manjer, Jonas; Wirfält, Elisabet; Hallmans, Göran; Rasmuson, Torgny; Bingham, Sheila; Khaw, Kay-Tee; Allen, Naomi; Key, Tim; Boffetta, Paolo; Duell, Eric J.; Slimani, Nadia; Gallo, Valentina; Riboli, Elio; Bueno-de-Mesquita, H. Bas
2009-01-01
BACKGROUND: Studies in many countries have reported higher lung cancer incidence and mortality in individuals with lower socioeconomic status. METHODS: To investigate the role of smoking in these inequalities, we used data from 391,251 participants in the European Prospective Investigation into
The Role of Smoking and Diet in Explaining Educational Inequalities in Lung Cancer Incidence
Menvielle, Gwenn; Boshuizen, Hendriek; Kunst, Anton E.; Dalton, Susanne O.; Vineis, Paolo; Bergmann, Manuela M.; Hermann, Silke; Ferrari, Pietro; Raaschou-Nielsen, Ole; Tjonneland, Anne; Kaaks, Rudolf; Linseisen, Jakob; Kosti, Maria; Trichopoulou, Antonia; Dilis, Vardis; Palli, Domenico; Krogh, Vittorio; Panico, Salvatore; Tumino, Rosario; Buchner, Frederike L.; van Gils, Carla H.; Peeters, Petra H. M.; Braaten, Tonje; Gram, Inger T.; Lund, Eiliv; Rodriguez, Laudina; Agudo, Antonio; Sanchez, Maria-Jose; Tormo, Maria-Jose; Ardanaz, Eva; Manjer, Jonas; Wirfalt, Elisabet; Hallmans, Goran; Rasmuson, Torgny; Bingham, Sheila; Khaw, Kay-Tee; Allen, Naomi; Key, Tim; Boffetta, Paolo; Duell, Eric J.; Slimani, Nadia; Gallo, Valentina; Riboli, Elio; Bueno-de-Mesquita, H. Bas
2009-01-01
Studies in many countries have reported higher lung cancer incidence and mortality in individuals with lower socioeconomic status. To investigate the role of smoking in these inequalities, we used data from 391 251 participants in the European Prospective Investigation into Cancer and Nutrition
December, 2013 ISSN 1119-944X 39 Challenges and Prospects of ...
African Journals Online (AJOL)
ONIKOYI
0.62); lack of improved planting materials- seeds/seedlings (M=2.51; .... the second stage, two cells were selected in each of the three blocks to give a total of six ... reveal that most of the farmers are in their middle and productive age and as.
The Microclimate of a Tropical Evergreen Forest.
1980-08-01
of Human Bioclimate - A Review. World Meteorological Organization Bulletin, Geneva, 56 pp. REFERENCES (con’t) Lee, R., 1978. Forest Micrometeorology...Geophysics, and Bioclimatology , Ser. B 24, 243-251. Pinker, R. (1980): The Microclimate of a dry tropical forest. (Accepted for publication in
Modelling of Continual Induction Hardening in Quasi-Coupled Formulation
Czech Academy of Sciences Publication Activity Database
Barglik, J.; Doležel, Ivo; Karban, P.; Ulrych, B.
2005-01-01
Roč. 24, č. 1 (2005), s. 251-260 ISSN 0332-1649 Grant - others:PSRC(PL) 4T08C 04823 Institutional research plan: CEZ:AV0Z20570509 Keywords : mathematical modelling * electromagnetism * induction Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.188, year: 2005
African Journals Online (AJOL)
Items 251 - 300 of 522 ... Vol 21, No 1 (2015), Herbal and alternative medicine: the impact on anesthesia, Abstract PDF. JM Dippenaar. Vol 9, No 1 (2003), Herbal medications - harmless or harmful? Abstract PDF. SJB Johnston. Vol 21, No 1 (2015), How safe are regional techniques? Evidence from large studies with big data ...