WorldWideScience

Sample records for berkelium 249

  1. Characterization of berkelium(III) dipicolinate and borate compounds in solution and the solid state.

    Science.gov (United States)

    Silver, Mark A; Cary, Samantha K; Johnson, Jason A; Baumbach, Ryan E; Arico, Alexandra A; Luckey, Morgan; Urban, Matthew; Wang, Jamie C; Polinski, Matthew J; Chemey, Alexander; Liu, Guokui; Chen, Kuan-Wen; Van Cleve, Shelley M; Marsh, Matthew L; Eaton, Teresa M; van de Burgt, Lambertus J; Gray, Ashley L; Hobart, David E; Hanson, Kenneth; Maron, Laurent; Gendron, Frédéric; Autschbach, Jochen; Speldrich, Manfred; Kögerler, Paul; Yang, Ping; Braley, Jenifer; Albrecht-Schmitt, Thomas E

    2016-08-26

    Berkelium is positioned at a crucial location in the actinide series between the inherently stable half-filled 5f(7) configuration of curium and the abrupt transition in chemical behavior created by the onset of a metastable divalent state that starts at californium. However, the mere 320-day half-life of berkelium's only available isotope, (249)Bk, has hindered in-depth studies of the element's coordination chemistry. Herein, we report the synthesis and detailed solid-state and solution-phase characterization of a berkelium coordination complex, Bk(III)tris(dipicolinate), as well as a chemically distinct Bk(III) borate material for comparison. We demonstrate that berkelium's complexation is analogous to that of californium. However, from a range of spectroscopic techniques and quantum mechanical calculations, it is clear that spin-orbit coupling contributes significantly to berkelium's multiconfigurational ground state. PMID:27563098

  2. New berkelium isotope: 242Bk

    International Nuclear Information System (INIS)

    A new isotope of berkelium, 242Bk, was produced with a cross section of approx. 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7 +- 1.3 minutes. The branching ratio for this isotope for alpha decay is less than 1% and that for spontaneous fission is less than 0.03%. 2 figures, 2 tables

  3. Extraction of tetravalent berkelium and cerium by aliquate-336-S-NO3 quaternary ammonium salt

    International Nuclear Information System (INIS)

    Extraction of tetravalent berkelium and cerium by aliquate-336-S-NO3 quaternary ammonium salt from nitric acid solutions is investigated. The effect of concentrations of nitric acid and extracting agent, nature of an oxidant (potassium bromate, potassium bichromate, mixture of AgNO3 and (NH4)2S2O8) and solvent on the distribution coefficient of berkelium(4) and cerium(4) is studied. It is established that solutions of aliquate-336-S-NO3 in carbon tetrachloride and dichloroethane extract quantitatively tetravalent berkelium from 10-12 M nitric acid solutions and cerium - from 1-10 M nitric acid solutions containing potassium bichromate as an oxidant. It is shown that the value of distribution coefficient for berkelium and cerium depends on the nature of an oxidant and extracting agent concentration. It is established that in the case of extraction by quaternary ammonium salt with one berkelium(4) mole four aliquate-336-SNO3 moles are associated and 1.5-1.6 mole of extracting agent are associated with one cerium(4) mole. It permits to make a conclusion that stoichiometry of extraction reactions by quaternary ammonium salt is not the same for tetravalent berkelium and cerium. It is shown that trivalent transplutonium and rare earth elements are not practically extracted by aliquate-336-S-NO3 from nitric acid solutions

  4. NTC 249 Course Tutorial/ Indigohelp

    OpenAIRE

    raju

    2015-01-01

    For more classes visit www.indigohelp.com   NTC 249 Week 1 DQ 1   NTC 249 Week 1 DQ 2   NTC 249 Week 1 DQ 3   NTC 249 Week 1 Summary   NTC 249 Week 2 DQ 1   NTC 249 Week 2 DQ 2   NTC 249 Week 2 DQ 3   NTC 249 Week 2 Summary   NTC 249 Week 2 Team Assignment Network Design for Acme Manufacturing Network Draft   NTC 249 Week 2 Individual Assignment OSI Model Paper...

  5. 32 CFR 249.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Policy. 249.4 Section 249.4 National Defense... OF DoD-RELATED SCIENTIFIC AND TECHNICAL PAPERS AT MEETINGS § 249.4 Policy. It is DoD policy to: (a... understanding in accordance with foreign disclosure policies of the Department of Defense. Presentation of...

  6. 32 CFR 249.6 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 249.6 Section 249.6 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS PRESENTATION OF DoD-RELATED SCIENTIFIC AND TECHNICAL PAPERS AT MEETINGS § 249.6 Responsibilities. (a) The...

  7. 46 CFR 249.4 - Eligibility.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Eligibility. 249.4 Section 249.4 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS AFFECTING SUBSIDIZED VESSELS AND OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.4 Eligibility. In General. All required marine hull insurance...

  8. 46 CFR 249.12 - Waivers.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Waivers. 249.12 Section 249.12 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS AFFECTING SUBSIDIZED VESSELS AND OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.12 Waivers. The provision of this part may be waived in...

  9. 46 CFR 249.11 - Confidentiality.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Confidentiality. 249.11 Section 249.11 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS AFFECTING SUBSIDIZED VESSELS AND OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.11 Confidentiality. (a) If the data submitted under this...

  10. Dicty_cDB: SLB249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB249 (Link to dictyBase) - - - Contig-U16455-1 SLB249Z (Link... to Original site) - - SLB249Z 727 - - - - Show SLB249 Library SL (Link to library) Clone ID SLB249 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLB2-C/SLB249Q.Seq.d/ Representative seq. ID SLB24...9Z (Link to Original site) Representative DNA sequence >SLB249 (SLB249Q) /CSM/SL/SLB2-C/SLB249Q.Seq.d/ XXXXX...NA Score E Sequences producing significant alignments: (bits) Value SLB249 (SLB249Q) /CSM/SL/SLB2-C/SLB249Q.

  11. 7 CFR 249.13 - Program income.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Program income. 249.13 Section 249.13 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE.... Fines, penalties or assessments paid by local agencies or farmers, farmers' markets, roadside...

  12. 7 CFR 249.19 - Investigations.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Investigations. 249.19 Section 249.19 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE... appropriate, a review of pertinent practices and policies of any State and local agency, the...

  13. 46 CFR 249.6 - Application procedures.

    Science.gov (United States)

    2010-10-01

    ... OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.6 Application procedures. (a) MARAD may grant specific approval for underwriters described in § 249.5(c) to participate in the writing of marine hull insurance on MARAD program vessels, only in advance of any actual placement. (b) Only...

  14. 7 CFR 249.9 - Nutrition education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 249.9 Section 249.9 Agriculture... Nutrition education. (a) Goal. Nutrition education shall emphasize the relationship of proper nutrition to... agency shall integrate nutrition education into SFMNP operations and may satisfy nutrition...

  15. Dicty_cDB: SSA249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available utative transporter protein SSA662 (ssa662) mRNA, complete cds. 40 9e-04 2 AC1155...SS (Link to library) SSA249 (Link to dictyBase) - - - Contig-U07966-1 - (Link to Original site) SSA...249F 236 - - - - - - Show SSA249 Library SS (Link to library) Clone ID SSA249 (Link to dicty...iol.tsukuba.ac.jp/CSM/SS/SSA2-C/SSA249Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >SSA249 (SSA249Q) /CSM/SS/SSA2-C/SSA249Q.Seq.d/ ACTTATCGTCACAATTC

  16. Dicty_cDB: CHR249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR249 (Link to dictyBase) - - - Contig-U16497-1 - (Link to Original site) - - CHR...249Z 694 - - - - Show CHR249 Library CH (Link to library) Clone ID CHR249 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHR2-C/CHR249Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHR249 (CHR249Q) /CSM/CH/CHR2-C/CHR249Q.Seq.d/ XXXXXXXXXXAAATGGT...xxixknqemfnsvvqiiihfmnkiq Frame C: ---w*yfphtn*qmfrlydl*ssfw*l*firxrlprw**myyqcl*ik**cpwcmyklns *mrcyqh**mypill**shr

  17. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    The amalgamation of 5f elements from Am to Fm has been studied by using 241Am, 244Cm, 249Bk, 249Cf, 252Cf, 253Es, 254Es, 252Fm and 255Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10-16M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65<=Z<=71 and 97<=Z<=103)

  18. 7 CFR 249.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... identify and certify eligible SFMNP participants, provide program information and nutrition education to... CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) General § 249.3 Administration...' Market Nutrition Program (FMNP), one consolidated State Plan may be submitted for both programs,...

  19. 46 CFR 249.2 - Policy.

    Science.gov (United States)

    2010-10-01

    ... UNDERWRITERS FOR MARINE HULL INSURANCE § 249.2 Policy. (a) It is the policy of the Maritime Administration (MARAD) that companies subject to requirements for the placement of marine hull insurance shall be... vessels with ODS or Title XI obligation guarantees to allow the American marine insurance market...

  20. 46 CFR 249.1 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... UNDERWRITERS FOR MARINE HULL INSURANCE § 249.1 Purpose. This part prescribes certain regulations governing the placement of marine hull insurance on vessels built or operated with subsidy or covered by vessel obligation guarantees issued pursuant to Title XI of the Merchant Marine Act, 1936, as amended (Act). (46 U.S.C....

  1. 46 CFR 249.7 - Approval.

    Science.gov (United States)

    2010-10-01

    ... UNDERWRITERS FOR MARINE HULL INSURANCE § 249.7 Approval. (a) Approval of the applicant will be based upon an.... hull insurance market, if U.S. insurers are denied similar access to the hull insurance market in the... to MARAD's attention any discriminatory laws or practices relating to the placement of marine...

  2. 46 CFR 249.5 - Eligibility criteria.

    Science.gov (United States)

    2010-10-01

    ... OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.5 Eligibility criteria. (a) U.S...'s Insurance Reports, and the amount of insurance does not exceed the limitation on risk prescribed... paragraphs (b) (1) and (2) of this section, may also be eligible to participate in the writing of marine...

  3. 7 CFR 58.249 - Instant nonfat dry milk.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Instant nonfat dry milk. 58.249 Section 58.249... Products Bearing Usda Official Identification § 58.249 Instant nonfat dry milk. (a) Only instant nonfat dry milk manufactured and packaged in accordance with the requirements of this part and with the...

  4. 7 CFR 249.11 - Financial management system.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management system. 249.11 Section 249.11... § 249.11 Financial management system. (a) Disclosure of expenditures. The State agency must maintain a financial management system that provides accurate, current and complete disclosure of the financial...

  5. 12 CFR 303.249 - Management official interlocks.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Management official interlocks. 303.249 Section 303.249 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION PROCEDURE AND RULES OF PRACTICE FILING PROCEDURES Other Filings § 303.249 Management official interlocks. (a) Scope. This section contains the procedures to be followed by an...

  6. 46 CFR 249.3 - Amounts of insurance.

    Science.gov (United States)

    2010-10-01

    ... OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.3 Amounts of insurance. MARAD will inform... 46 Shipping 8 2010-10-01 2010-10-01 false Amounts of insurance. 249.3 Section 249.3 Shipping... initial placement and at least annually thereafter, of the minimum amount of insurance required to...

  7. 46 CFR 249.8 - Limitation on risk.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Limitation on risk. 249.8 Section 249.8 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS AFFECTING SUBSIDIZED VESSELS AND OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.8 Limitation on risk. (a)...

  8. 46 CFR 249.10 - Non-discrimination policy.

    Science.gov (United States)

    2010-10-01

    ... OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.10 Non-discrimination policy. To... described in §§ 249.6(b)(3) and 249.7(a), MARAD seeks the assistance of the American marine insurance...) concerning the existence of any discriminatory laws or practices in the marine hull insurance market...

  9. 42 CFR 24.9 - Removal from the Service.

    Science.gov (United States)

    2010-10-01

    ... in making such answer; and (4) A written decision on the proposal. (c) The decision may be made by an... 42 Public Health 1 2010-10-01 2010-10-01 false Removal from the Service. 24.9 Section 24.9 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES PERSONNEL SENIOR...

  10. Dicty_cDB: CHP249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP249 (Link to dictyBase) - - - Contig-U14444-1 - (Link to Original site) ... XXXXKIFFLKK--- Translated Amino Acid sequence (All Frames ) Frame A: KKXKKKKKKKKKKKKKKKKKKKKKKKKKKKXKKKKXXXXX ...

  11. 75 FR 69870 - Delegation of Authority Under 18 U.S.C. 249

    Science.gov (United States)

    2010-11-16

    ... Part 0 Delegation of Authority Under 18 U.S.C. 249 AGENCY: Department of Justice. ACTION: Final rule... 18 U.S.C. 249, relating to hate crimes, to the Assistant Attorney General for the Civil Rights....S.C. 249. The Shepard-Byrd Act expressly provides that no prosecution under section 249 may...

  12. Study of the high-j states in 249Cm

    International Nuclear Information System (INIS)

    The authors have performed the reaction 248Cm(4He, 3He) using 98.5-MeV alpha particles from the IUCF cyclotron to populate high-j states in 249Cm. A tentative assignment of the K17/2 component of the 1/2+[880] Nilsson state has been made

  13. 46 CFR 249.9 - American market participation.

    Science.gov (United States)

    2010-10-01

    ... OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.9 American market participation. (a... to the American marine insurance market the opportunity to compete for the placement of marine hull... less than 50 percent of the placement is made with the American marine insurance market, the owners,...

  14. 40 CFR 180.249 - Alachlor; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Alachlor; tolerances for residues. 180... PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.249 Alachlor; tolerances for residues. (a) General. Tolerances are established for combined residues...

  15. 48 CFR 52.249-4 - Termination for Convenience of the Government (Services) (Short Form).

    Science.gov (United States)

    2010-10-01

    ... Convenience of the Government (Services) (Short Form). 52.249-4 Section 52.249-4 Federal Acquisition... termination: Termination for Convenience of the Government (Services) (Short Form) (APR 1984) The Contracting... CONTRACT CLAUSES Text of Provisions and Clauses 52.249-4 Termination for Convenience of the...

  16. 17 CFR 249.331 - Form N-CSR, certified shareholder report.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form N-CSR, certified shareholder report. 249.331 Section 249.331 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... Required Under Sections 13 and 15(d) of the Securities Exchange Act of 1934 § 249.331 Form N-CSR,...

  17. Actinide production in 136Xe bombardments of 249Cf

    International Nuclear Information System (INIS)

    The production cross sections for the actinide products from 136Xe bombardments of 249Cf at energies 1.02, 1.09, and 1.16 times the Coulomb barrier were determined. Fractions of the individual actinide elements were chemically separated from recoil catcher foils. The production cross sections of the actinide products were determined by measuring the radiations emitted from the nuclides within the chemical fractions. The chemical separation techniques used in this work are described in detail, and a description of the data analysis procedure is included. The actinide production cross section distributions from these 136Xe + 249Cf bombardments are compared with the production cross section distributions from other heavy ion bombardments of actinide targets, with emphasis on the comparison with the 136Xe + 248Cm reaction. A technique for modeling the final actinide cross section distributions has been developed and is presented. In this model, the initial (before deexcitation) cross section distribution with respect to the separation energy of a dinuclear complex and with respect to the Z of the target-like fragment is given by an empirical procedure. It is then assumed that the N/Z equilibration in the dinuclear complex occurs by the transfer of neutrons between the two participants in the dinuclear complex. The neutrons and the excitation energy are statistically distributed between the two fragments using a simple Fermi gas level density formalism. The resulting target-like fragment initial cross section distribution with respect to Z, N, and excitation energy is then allowed to deexcite by emission of neutrons in competition with fission. The result is a final cross section distribution with respect to Z and N for the actinide products. 68 refs., 33 figs., 6 tabs

  18. Fusion and quasifission dynamics in the reactions $^{48}$Ca+$^{249}$Bk and $^{50}$Ti+$^{249}$Bk using TDHF

    CERN Document Server

    Umar, A S; Simenel, C

    2016-01-01

    Background: Synthesis of superheavy elements (SHE) with fusion-evaporation reactions is strongly hindered by the quasifission (QF) mechanism which prevents the formation of an equilibrated compound nucleus and which depends on the structure of the reactants. New SHE have been recently produced with doubly-magic $^{48}$Ca beams. However, SHE synthesis experiments with single-magic $^{50}$Ti beams have so far been unsuccessful. Purpose: In connection with experimental searches for $Z=117,119$ superheavy elements, we perform a theoretical study of fusion and quasifission mechanisms in $^{48}$Ca,$^{50}$Ti+$^{249}$Bk reactions in order to investigate possible differences in reaction mechanisms induced by these two projectiles. Methods: The collision dynamics and the outcome of the reactions are studied using unrestricted time-dependent Hartree-Fock (TDHF) calculations as well as the density-constrained TDHF method to extract the nucleus-nucleus potentials and the excitation energy in each fragment. Results: Nucleu...

  19. 7 CFR 249.22 - Nonprocurement debarment/suspension, drug-free workplace, and lobbying restrictions.

    Science.gov (United States)

    2010-01-01

    ... workplace, and lobbying restrictions. 249.22 Section 249.22 Agriculture Regulations of the Department of.../suspension, drug-free workplace, and lobbying restrictions. The State agency must ensure compliance with the... lobbying (part 3018 of this title), where applicable....

  20. 14 CFR 249.8 - Premature loss or destruction of records.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Premature loss or destruction of records. 249.8 Section 249.8 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION... Premature loss or destruction of records. If records are destroyed or lost before the expiration of...

  1. 17 CFR 249.1200 - Form X-17F-1A-Report for missing, lost, stolen or counterfeit securities.

    Science.gov (United States)

    2010-04-01

    ... Register citations affecting Form X-17F-1A, see the List of CFR Sections Affected, which appears in the... missing, lost, stolen or counterfeit securities. 249.1200 Section 249.1200 Commodity and Securities... Reporting and Inquiry With Respect to Missing, Lost, Stolen, or Counterfeit Securities § 249.1200 Form...

  2. 48 CFR 52.249-1 - Termination for Convenience of the Government (Fixed-Price) (Short Form).

    Science.gov (United States)

    2010-10-01

    ... Convenience of the Government (Fixed-Price) (Short Form). 52.249-1 Section 52.249-1 Federal Acquisition... Convenience of the Government (Fixed-Price) (Short Form) (APR 1984) The Contracting Officer, by written notice... CONTRACT CLAUSES Text of Provisions and Clauses 52.249-1 Termination for Convenience of the...

  3. 17 CFR 249.332 - Form N-Q, quarterly schedule of portfolio holdings of registered management investment company.

    Science.gov (United States)

    2010-04-01

    ... of portfolio holdings of registered management investment company. 249.332 Section 249.332 Commodity... Securities Exchange Act of 1934 § 249.332 Form N-Q, quarterly schedule of portfolio holdings of registered management investment company. This form shall be used by registered management investment companies,...

  4. 17 CFR 249.322 - Form 12b-25-Notification of late filing.

    Science.gov (United States)

    2010-04-01

    ... CFR Sections Affected, which appears in the Finding Aids section of the printed volume and on GPO...-annual, annual, or transition report on Form N-SAR (§§ 249.330; 274.101) or Form N-CSR (§§ 249.331; 274... to electronic difficulties should comply with either Rule 201 or Rule 202 of Regulation S-T (§...

  5. Bk and Cf chromatographic separation and 249Bk/248Cm and 249Cf/248Cm elemental ratios determination by inductively coupled plasma quadrupole mass spectrometry

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments for the study of minor-actinide transmutation processes in high intensity thermal neutron flux. In this context a Cm sample enriched in 248Cm (97%) was irradiated in a thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). The precise and accurate determination of Cf isotope ratios and of 249Bk/248Cm and 249Cf/248Cm elemental ratios in the 248Cm irradiated sample is crucial for the calculation of actinide neutron capture cross-sections.This work describes an analytical procedure for the separation and the isotope ratio measurement of Bk and Cf in the irradiated sample.The Bk and Cf separation is based on a lanthanides separation protocol previously developed by the laboratory. Well-defined retention times for Bk and Cf were obtained by coupling the Ionic Chromatography (IC) with an ICP-QMS. All conditions of element separation by IC and the different steps of the analytical protocol in order to obtain the isotopic and elemental ratios are presented. Relative uncertainties of Cf isotopic ratios range from 0.3% to 0.5% and the uncertainty of the 249Bk/248Cm and 249Cf/248Cm elemental ratios are respectively 6.1% and 3.2%.This level of uncertainty for both isotopic and elemental ratios is in perfect agreement with the requirement for transmutation studies. (authors)

  6. 249 TP53 mutation has high prevalence and is correlated with larger and poorly differentiated HCC in Brazilian patients

    Directory of Open Access Journals (Sweden)

    Paranaguá-Vezozzo Denise C

    2009-06-01

    Full Text Available Abstract Background Ser-249 TP53 mutation (249Ser is a molecular evidence for aflatoxin-related carcinogenesis in Hepatocellular Carcinoma (HCC and it is frequent in some African and Asian regions, but it is unusual in Western countries. HBV has been claimed to add a synergic effect on genesis of this particular mutation with aflatoxin. The aim of this study was to investigate the frequency of 249Ser mutation in HCC from patients in Brazil. Methods We studied 74 HCC formalin fixed paraffin blocks samples of patients whom underwent surgical resection in Brazil. 249Ser mutation was analyzed by RFLP and DNA sequencing. HBV DNA presence was determined by Real-Time PCR. Results 249Ser mutation was found in 21/74 (28% samples while HBV DNA was detected in 13/74 (16%. 249Ser mutation was detected in 21/74 samples by RFLP assay, of which 14 were confirmed by 249Ser mutant-specific PCR, and 12 by nucleic acid sequencing. All HCC cases with p53-249ser mutation displayed also wild-type p53 sequences. Poorly differentiated HCC was more likely to have 249Ser mutation (OR = 2.415, 95% CI = 1.001 – 5.824, p = 0.05. The mean size of 249Ser HCC tumor was 9.4 cm versus 5.5 cm on wild type HCC (p = 0.012. HBV DNA detection was not related to 249Ser mutation. Conclusion Our results indicate that 249Ser mutation is a HCC important factor of carcinogenesis in Brazil and it is associated to large and poorly differentiated tumors.

  7. Fusion and quasifission dynamics in the reactions 48Ca+249Bk and 50Ti+249Bk using a time-dependent Hartree-Fock approach

    Science.gov (United States)

    Umar, A. S.; Oberacker, V. E.; Simenel, C.

    2016-08-01

    Background: Synthesis of superheavy elements (SHEs) with fusion-evaporation reactions is strongly hindered by the quasifission (QF) mechanism which prevents the formation of an equilibrated compound nucleus and which depends on the structure of the reactants. New SHEs have been recently produced with doubly-magic 48Ca beams. However, SHE synthesis experiments with single-magic 50Ti beams have so far been unsuccessful. Purpose: In connection with experimental searches for Z =117 ,119 superheavy elements, we perform a theoretical study of fusion and quasifission mechanisms in 48Ca,50Ti+249Bk reactions in order to investigate possible differences in reaction mechanisms induced by these two projectiles. Methods: The collision dynamics and the outcome of the reactions are studied using unrestricted time-dependent Hartree-Fock (TDHF) calculations as well as the density-constrained TDHF method to extract the nucleus-nucleus potentials and the excitation energy in each fragment. Results: Nucleus-nucleus potentials, nuclear contact times, masses and charges of the fragments, as well as their kinetic and excitation energies strongly depend on the orientation of the prolate 249Bk nucleus. Long contact times associated with fusion are observed in collisions of both projectiles with the side of the 249Bk nucleus, but not on collisions with its tip. The energy and impact parameter dependencies of the fragment properties, as well as their mass-angle and mass-total kinetic energy correlations are investigated. Conclusions: Entrance channel reaction dynamics are similar with both 48Ca and 50Ti projectiles. Both are expected to lead to the formation of a compound nucleus by fusion if they have enough energy to get in contact with the side of the 249Bk target.

  8. 17 CFR 249.218 - Form 18, for foreign governments and political subdivisions thereof.

    Science.gov (United States)

    2010-04-01

    ... Federal Register citations affecting Form 18, see the List of CFR Sections Affected, which appears in the... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form 18, for foreign... for Registration of Securities on National Securities Exchanges and Similar Matters § 249.218 Form...

  9. Antibiotic Allergic Analysis on 249 Griess Test Negatives%249株革兰阴性杆菌抗生素敏感性分析

    Institute of Scientific and Technical Information of China (English)

    张月明; 刘新焕; 卢立新; 路向东; 步金慧

    2003-01-01

    @@ 随着新的抗生素不断使用,细菌对抗生素的敏感性也发生变化.为了解临床革兰阴性杆菌对抗生素的敏感性,将2000年1月~2001年7月分离的249株革兰阴性杆菌进行抗生素敏感性分析,现报告如下.

  10. In vitro and in vivo cytotoxic effects of PRIMA-1 on hepatocellular carcinoma cells expressing mutant p53ser249.

    Science.gov (United States)

    Shi, Hong; Lambert, Jeremy M R; Hautefeuille, Agnes; Bykov, Vladimir J N; Wiman, Klas G; Hainaut, Pierre; Caron de Fromentel, Claude

    2008-07-01

    Hepatocellular carcinoma (HCC) is highly lethal due to limited curative options. In high-incidence regions, such as parts of Africa and Southeastern Asia, >50% of cases carry an AGG to AGT mutation at codon 249 of the TP53 gene, considered as a 'signature' of mutagenesis by aflatoxins. The protein product, p53ser249, may represent a therapeutic target for HCC. The small molecule p53 reactivation and induction of massive apoptosis (PRIMA)-1 has been shown to induce apoptosis in tumour cells by reactivating the transactivation capacity of some p53 mutants. In this study, we have investigated the cytotoxic effects of PRIMA-1 on HCC cells expressing p53ser249. In p53-null Hep3B cells, over-expression of p53ser249 or p53gln248 by stable transfection increased the cytotoxicity of PRIMA-1 at 50 muM. Furthermore, PRIMA-1 treatment delayed the growth of p53ser249-expressing Hep3B cells xenografted in severe combined immunodeficiency mice. However, PRIMA-1 did not restore wild-type DNA binding and transactivation activities to p53ser249 or to p53gln248 in Hep3B cells. Moreover, in PLC/PRF/5, a HCC cell line constitutively expressing p53ser249, small interfering RNA (siRNA) silencing of the mutant increased the cytotoxic effect of PRIMA-1. These apparently contradictory effects can be reconciled by proposing that p53ser249 exerts a gain-of-function effect, which favours the survival of HCC cells. Thus, both inhibition of this effect by PRIMA-1 and removal of the mutant by siRNA can lead to the decrease of survival capacity of HCC cells. PMID:18048389

  11. INTEGRAL and Swift observations of the hard X-ray transient MAXI J1828-249

    CERN Document Server

    Filippova, E; Ferrigno, C

    2014-01-01

    In this paper we report on the observations performed with INTEGRAL and Swift of the first outburst detected from the hard X-ray transient MAXI J1828-249. During the first about two days of the outburst, the source was observed by MAXI to undergo a very rapid transition from a hard to a softer spectral state. While the hard state was not efficiently monitored because the transition occurred so rapidly, the evolution of the source outburst in the softer state was covered quasi-simultaneously in a broad energy range (0.6-150 keV) by the instruments on-board INTEGRAL and Swift. During these observations, the spectra measured from the source displayed both a prominent thermal emission with temperature kT 0.7 keV and a power-law hard component with a photon index gamma 2.2 extending to 200 keV. The properties of the source in the X-ray domain are reminiscent of those displayed by black hole transients during the soft intermediate state, which supports the association of MAXI J1828-249 with this class of objects.

  12. Actinide production in /sup 136/Xe bombardments of /sup 249/Cf

    Energy Technology Data Exchange (ETDEWEB)

    Gregorich, K.E.

    1985-08-01

    The production cross sections for the actinide products from /sup 136/Xe bombardments of /sup 249/Cf at energies 1.02, 1.09, and 1.16 times the Coulomb barrier were determined. Fractions of the individual actinide elements were chemically separated from recoil catcher foils. The production cross sections of the actinide products were determined by measuring the radiations emitted from the nuclides within the chemical fractions. The chemical separation techniques used in this work are described in detail, and a description of the data analysis procedure is included. The actinide production cross section distributions from these /sup 136/Xe + /sup 249/Cf bombardments are compared with the production cross section distributions from other heavy ion bombardments of actinide targets, with emphasis on the comparison with the /sup 136/Xe + /sup 248/Cm reaction. A technique for modeling the final actinide cross section distributions has been developed and is presented. In this model, the initial (before deexcitation) cross section distribution with respect to the separation energy of a dinuclear complex and with respect to the Z of the target-like fragment is given by an empirical procedure. It is then assumed that the N/Z equilibration in the dinuclear complex occurs by the transfer of neutrons between the two participants in the dinuclear complex. The neutrons and the excitation energy are statistically distributed between the two fragments using a simple Fermi gas level density formalism. The resulting target-like fragment initial cross section distribution with respect to Z, N, and excitation energy is then allowed to deexcite by emission of neutrons in competition with fission. The result is a final cross section distribution with respect to Z and N for the actinide products. 68 refs., 33 figs., 6 tabs.

  13. 75 FR 19880 - Safety Zone; BW PIONEER at Walker Ridge 249, Outer Continental Shelf FPSO, Gulf of Mexico

    Science.gov (United States)

    2010-04-16

    ... PIONEER at Walker Ridge 249, Outer Continental Shelf FPSO, Gulf of Mexico in the Federal Register (74 FR... recreational vessel. The deepwater area also includes an extensive system of fairways. Background Petrobras... facility and the environment. Petrobras America Inc. indicated that it is highly likely that any...

  14. 17 CFR 249.318 - Form 18-K, annual report for foreign governments and political subdivisions thereof.

    Science.gov (United States)

    2010-04-01

    .... Editorial Note: For Federal Register citations affecting Form 18-K, see the List of CFR Sections Affected... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form 18-K, annual report for... of 1934 § 249.318 Form 18-K, annual report for foreign governments and political subdivisions...

  15. 17 CFR 249.1001 - Form SIP, for application for registration as a securities information processor or to amend such...

    Science.gov (United States)

    2010-04-01

    ... Note: For Federal Register citations affecting Form SIP, see the List of CFR Sections Affected, which... registration as a securities information processor or to amend such an application or registration. 249.1001..., SECURITIES EXCHANGE ACT OF 1934 Form for Registration of, and Reporting by Securities Information...

  16. 17 CFR 249.819 - Form 19b-4, for electronic filing with respect to proposed rule changes by all self-regulatory...

    Science.gov (United States)

    2010-04-01

    ... filing with respect to proposed rule changes by all self-regulatory organizations. 249.819 Section 249..., SECURITIES EXCHANGE ACT OF 1934 Forms for Self-Regulatory Organization Rule Changes and Forms for....819 Form 19b-4, for electronic filing with respect to proposed rule changes by all...

  17. Results from the First {sup 249}Cf + {sup 48}Ca Experiment

    Science.gov (United States)

    Oganessian, Y. T.; Utyonkov, V. K.; Lobanov, Y. V.; Abdullin, F. S.; Polyakov, A. N.; Shirokovsky, I. V.; Tsyganov, Y. S.; Mezentsev, A. N.; Iliev, S.; Subbotin, V. G.; Sukhov, A. M.; Ivanov, O. V.; Voinov, A. A.; Subotic, K.; Zagrebaev, V. I.; Itkis, M. G.; Moody, K. J.; Wild, J. F.; Stoyer, M. A.; Stoyer, N. J.; Laue, C. A.; Shaughnessy, D. A.; Patin, J. B.; Lougheed, R. W.

    2003-02-03

    The present paper reports the results of an attempt aimed at the synthesis of element 118 in the reaction {sup 249}Cf({sup 48}Ca,3n){sup 294}118. The experiment was performed employing the Dubna Gas-filled Recoil Separator and the U400 heavy-ion cyclotron at FLNR, JINR, Dubna. In the course of a 2300-hour irradiation of an enriched {sup 249}Cf target (0.23 mg/cm{sup 2}) with a beam of 245-MeV {sup 48}Ca ions, we accumulated a total beam dose of 2.5 x 10{sup 19} ions. We detected two events that may be attributed to the formation and decay of nuclei with Z=118. For one event, we observed a decay chain of two correlated {alpha}-decays with corresponding energies and correlation times of E{sub {alpha}1} = 11.65 {+-} 0.06 MeV, t{sub {alpha}1} = 2.55 ms and E{sub {alpha}2} = 10.71 {+-} 0.17 MeV, t{sub {alpha}2} = 42.1 ms and, finally, a spontaneous fission with the sum of the kinetic energies of the fission fragments E{sub tot} = 207 MeV (TKE {approx} 230 MeV) and t{sub SF} = 0.52 s. In the second event chain, the recoil nucleus decayed into two fission fragments with E{sub tot} = 223 MeV (TKE {approx} 245 MeV) 3.16 ms later, without intervening {alpha} decays. The probabilities that these events were caused by the chance correlations of unrelated signals are negligible. Both events were observed at an excitation energy of the compound nucleus {sup 297}118 of E* = 30.0 {+-} 2.4 MeV, close to the expected maximum of the 3n-evaporation channel. The relationship between the decay energy Q{sub {alpha}} and decay period T{sub {alpha}} shows that sequential {alpha}-transitions in the first event correspond to the decay chain with Z = 118{_}116{_}114. Decay characteristics of the newly observed nuclides are compared with radioactive decay properties of the even-even isotopes with Z = 116, 114 and 112 previously produced in the reactions {sup 244}Pu, {sup 248}Cm + {sup 48}Ca and calculations made in various nuclear models.

  18. Essentials and guidelines for clinical medical physics residency training programs: executive summary of AAPM Report Number 249.

    Science.gov (United States)

    Prisciandaro, Joann I; Willis, Charles E; Burmeister, Jay W; Clarke, Geoffrey D; Das, Rupak K; Esthappan, Jacqueline; Gerbi, Bruce J; Harkness, Beth A; Patton, James A; Peck, Donald J; Pizzutiello, Robert J; Sandison, George A; White, Sharon L; Wichman, Brian D; Ibbott, Geoffrey S; Both, Stefan

    2014-01-01

    There is a clear need for established standards for medical physics residency training. The complexity of techniques in imaging, nuclear medicine, and radiation oncology continues to increase with each passing year. It is therefore imperative that training requirements and competencies are routinely reviewed and updated to reflect the changing environment in hospitals and clinics across the country. In 2010, the AAPM Work Group on Periodic Review of Medical Physics Residency Training was formed and charged with updating AAPM Report Number 90. This work group includes AAPM members with extensive experience in clinical, professional, and educational aspects of medical physics. The resulting report, AAPM Report Number 249, concentrates on the clinical and professional knowledge needed to function independently as a practicing medical physicist in the areas of radiation oncology, imaging, and nuclear medicine, and constitutes a revision to AAPM Report Number 90. This manuscript presents an executive summary of AAPM Report Number 249. PMID:24892354

  19. Bilanzrecht und Ökonomische Theorie des Rechts - Ansatzpunkte und Überlegungen zum § 249 HGB -

    OpenAIRE

    Lange, Gloria

    1999-01-01

    Mit zunehmender Globalisierung wird es für deutsche Unternehmen als notwendig angesehen, deutsches Bilanzrecht zu Gunsten internationaler Regeln aufzugeben, um Zugang zu den internationalen Kapitalmärkten zu erhalten. Aber ist das deutsche Bilanzrecht tatsächlich schlechter als internationale Bilanzierungsstandards und sollte es demzufolge an diese ange-paßt werden? Zur Beantwortung dieser Fragen wird versucht, die Ökonomische Theorie des Rechts auf Bilanzierungsregeln anzuwenden, wobei § 249...

  20. Energy levels of 249Bk populated in the α decay of 99253Es and β- decay of 96249Cm

    International Nuclear Information System (INIS)

    The level structure of 249Bk has been investigated by measuring the γ-ray spectra of an extremely pure 253Es sample obtained by milking this nuclide from 253Cf source material produced in the High Flux Isotope Reactor at Oak Ridge National Laboratory. Additional information on the 249Bk levels was obtained from the β--decay study of 249Cm, produced by neutron irradiation of 248Cm. Using the results of the present study together with the data from previous 248Cm(α,t) and 248Cm(3He,d) reactions, the following single-particle states have been identified in 249Bk: 7/2+[633], 0.0 keV; 3/2-[521], 8.78 keV; 1/2+[400], 377.55 keV; 5/2+[642], 389.17 keV; 1/2-[530], 569.20 keV; 1/2-[521], 643.0 keV; 5/2-[523], 672.9 keV; and 9/2+[624], 1075.1 keV. Four vibrational bands were identified at 767.9, 932.2, 1150.7, and 1223.0 keV with tentative assignments of {7/2+ [633] x1-}9/2-, {7/2+ [633] x 0-}7/2-, {7/2+ [633] x 1-}5/2-, and {7/2+ [633] x 0+}7/2+, respectively. A band at 899.9 keV was observed in γ-γ coincidence measurements and given a tentative spin assignment of 3/2. It is possibly associated with a 2- phonon coupled to the ground state, with configuration {7/2+ [633] x 2-}3/2-. Three levels at 624.3, 703.5, and 769.1 keV were assigned spins of 5/2, 7/2, and 9/2, respectively. These could be the members of the 3/2+ [651] band, expected in this energy region

  1. Synthesis of the isotopes of elements 118 and 116 in the 249Cf and 245Cm+48Ca fusion reactions

    Energy Technology Data Exchange (ETDEWEB)

    Oganessian, Y T; Utyonkov, V K; Lobanov, Y V; Abdullin, F S; Polyakov, A N; Sagaidak, R N; Shirokovsky, I V; Tsyganov, Y S; Voinov, A A; Gulbekian, G G; Bogomolov, S L; Gikal, B N; Mezentsev, A N; Iliev, S; Subbotin, V G; Sukhov, A M; Subotic, K; Zagrebaev, V I; Vostokin, G K; Itkis, M G; Moody, K J; . Patin, J B; Shaughnessy, D A; Stoyer, M A; Stoyer, N J; Wilk, P A; Kenneally, J M; Landrum, J H; Wild, J F; Lougheed, R W

    2006-01-31

    The decay properties of {sup 290}116 and {sup 291}116, and the dependence of their production cross sections on the excitation energies of the compound nucleus, {sup 293}116, have been measured in the {sup 245}Cm({sup 48}Ca,xn){sup 293-x}116 reaction. These isotopes of element 116 are the decay daughters of element 118 isotopes, which are produced via the {sup 249}Cf+{sup 48}Ca reaction. They performed the element 118 experiment at two projectile energies, corresponding to {sup 297}118 compound nucleus excitation energies of E* = 29.2 {+-} 2.5 and 34.4 {+-} 2.3 MeV. During an irradiation with a total beam dose of 4.1 x 10{sup 19} {sup 48}Ca projectiles, three similar decay chains consisting of two or three consecutive {alpha} decays and terminated by a spontaneous fission (SF) with high total kinetic energy of about 230 MeV were observed. The three decay chains originated from the even-even isotope {sup 294}118 (E{sub {alpha}} = 11.65 {+-} 0.06 MeV, T{sub {alpha}} = 0.89{sub -0.31}{sup +1.07} ms) produced in the 3n-evaporation channel of the {sup 249}Cf+{sup 48}Ca reaction with a maximum cross section of 0.5{sub -0.3}{sup +1.6} pb.

  2. Detection of human papilloma virus in 249 cases of patients with genital warts%249例生殖器疣患者人乳头瘤病毒检测分析

    Institute of Scientific and Technical Information of China (English)

    李蕾; 邹先彪

    2016-01-01

    Objective To investigate the distribution of human papilloma virus (HPV) genotypes from outpatients with genital wart in Beijing.Method Flow cytometry HPV genotyping technique were used to detect and identify HPV genotypes from individual lesions. Result Among 249 cases of genital warts, 232 (93.17%) were DNA HPV positive. The positive rate of HPV single type was 63.86%, the positive rate of multiple type of HPV was 36.14%. The infection rate of low-risk HPV was 55.4%, in which HPV6 and HPV11 were the most popular genotypes. HPV16, HPV58, HPV18 were the most prevalent high-risk genotypes.Conclusion The peak of HPV infection concentrates in sexually active population younger than 40 years old. HPV6, HPV11 and HPV16 are the predominant genotypes for genital wart in Beijing.%目的:调查生殖器疣患者人乳头瘤病毒(human papilloma virus,HPV)感染特点,为HPV感染的预防和诊治提供理论依据。方法采用流式荧光HPV基因分型技术检测249例生殖器疣患者皮损组织中HPV的型别。结果249例生殖器疣患者中,232例(93.17%)HPV DNA阳性。单一型感染率为63.86%,复合型感染率为36.14%。低危型HPV阳性率为55.4%,其中以HPV6、HPV11最多;高危型中以HPV16最多,其次为HPV58、HPV18型。结论本地区生殖器HPV感染集中于40岁以下性活跃期的人群。以单一型感染为主,最常见HPV6、HPV11和HPV16型感染。

  3. 17 CFR 249.325 - Form 13F, report of institutional investment manager pursuant to section 13(f) of the Securities...

    Science.gov (United States)

    2010-04-01

    ...). Editorial Note: For Federal Register citations affecting Form 13F, see the List of CFR Sections Affected... institutional investment manager pursuant to section 13(f) of the Securities Exchange Act of 1934. 249.325... manager pursuant to section 13(f) of the Securities Exchange Act of 1934. This form shall be used...

  4. Analysis of high risk factors and head MRI in 249 children with spastic cerebral palsy%249例痉挛性脑瘫患儿高危因素与 MRI分析

    Institute of Scientific and Technical Information of China (English)

    廖小艳; 田新姿

    2014-01-01

    Objective:To sum up the common high risk factors of children with spastic cerebral palsy and different types of magnetic results. Methods:The clinical data of 249 children with spastic cerebral palsy were analyzed retrospectively. Results: The high risk factors of 80% children patients were multifactors. The common factors included:(1) prenatal:intrauterine distress, threat-ened abortion, cord around neck, medical history, and meconium contamination;(2) intrapartum:anoxia, premature birth, low body weight, premature rupture of placenta, and delayed delivery;and (3) postpartum:jaundice, intracranial hemorrhage, and pneumonia of newborn. The abnormal rate of head MRI result was 90. 7%, in which periventricular leukomalacia was the common type (50. 4%) . Conclusions: The common high risk factors of children with spastic cerebral palsy are anoxia, premature birth, low body weight, pathologic jaundice. The head MRI has a high probability to found the abnormal. Common risk factors for different types of magnetic results are different.%目的::总结痉挛型脑瘫患儿常见的高危因素及头颅MRI改变。方法:对249例痉挛型脑瘫患儿资料进行回顾性分析。结果:80%的患儿高危因素为多因素。最常见的有:①产前为胎儿宫内窘迫、先兆流产、脐带绕颈、用药史、胎粪污染;②产时依次为缺氧、早产、低体重、胎盘早破、产程延长;③产后为黄疸、颅内出血、新生儿肺炎。头颅MRI检查异常率为90.7%,其中脑室周围白质异常占50.4%。结论:痉挛型脑瘫患儿常见的高危因素为缺氧、早产、低体重、病理性黄疸,头颅MRI改变检出率高,且依致病因素不同而表现各异。

  5. Effects of the TP53 p.R249S mutant on proliferation and clonogenic properties in human hepatocellular carcinoma cell lines: interaction with hepatitis B virus X protein.

    Science.gov (United States)

    Gouas, Doriane A; Shi, Hong; Hautefeuille, Agnès H; Ortiz-Cuaran, Sandra L; Legros, Pénélope C; Szymanska, Katarzyna J; Galy, Olivier; Egevad, Lars A; Abedi-Ardekani, Behnoush; Wiman, Klas G; Hantz, Olivier; Caron de Fromentel, Claude; Chemin, Isabelle A; Hainaut, Pierre L

    2010-08-01

    Aflatoxin B(1) (AFB(1)) is a risk factor for hepatocellular carcinoma (HCC) in many low-resource countries. Although its metabolites bind at several positions in TP53, a mutation at codon 249 (AGG to AGT, arginine to serine, p.R249S) accounts for 90% of TP53 mutations in AFB(1)-related HCC. This specificity suggests that p.R249S confers a selective advantage during hepatocarcinogenesis. Using HCC cell lines, we show that p.R249S has lost the capacity to bind to p53 response elements and to transactivate p53 target genes. In p53-null Hep3B cells, stable transfection of p.R249S or of another mutant, p.R248Q, did not induce significant changes in cell proliferation and survival after cytotoxic stress. In contrast, in a cell line that constitutively expresses both p.R249S and the hepatitis B virus antigen HBx (PLC/PRF/5), silencing of either p.R249S or HBx by RNA interference slowed down proliferation, with no additive effects when both factors were silenced. Furthermore, the two proteins appear to form a complex. In human HCC samples, mutation at codon 249 did not correlate with p.R249S protein accumulation or HBx truncation status. We suggest that p.R249S may contribute to hepatocarcinogenesis through interaction with HBx, conferring a subtle growth advantage at early steps of the transformation process, but that this interaction is not required for progression to advanced HCC. PMID:20538734

  6. Expression of the benign HEXA mutations, Arg247Trp and Arg249Trp, associated with beta-hexosaminidase A pseudodeficiency

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Z.; Petroulakis, E.; Salo, T. [Univ. of Manitoba (Canada)] [and others

    1994-09-01

    {beta}-Hexosaminidase (Hex A) is a heterodimer of {alpha} and {beta} subunits encoded by the HEXA and HEXB genes, respectively. Mutations in the HEXA gene typically cause Tay-Sachs disease or less severe forms of G{sub M2} gangliosidosis. However, two benign mutations (Arg247Trp and Arg249Trp) in the {alpha}-subunit of Hex A account for Hex A deficiency in {approximately}36% of non-Jewish enzyme-defined Tay-Sachs disease carriers. These mutations do not result in any apparent clinical phenotype in individuals who are genetic compounds with a second disease-causing mutation. We expressed the {alpha}-subunit harboring each of the benign mutations separately to study activity toward the synthetic substrate, 4-MUGS, for comparison to activity from enzymes containing mutations associated with other forms of G{sub M2} gangliosidosis. The C739T (Arg247Trp;benign), C745T (Arg 249Trp; benign), G805A (Gly269Ser; adult-onset), G749A (Gly250Asp; juvenile), and C508T (Arg170Trp; infantile) mutations were introduced into the {alpha}-subunit cDNA. These were transfected alone, or with the {beta}-subunit cDNA, to generate Hex S ({alpha}{alpha}) or Hex A ({alpha}{beta}), respectively. The activities were monitored using 4-MUGS, and the levels of {alpha}-subunit protein were assessed by Western blotting. Repeated experiments show that the benign mutations produce approximately 35% of normal Hex S and 40% of normal Hex A activity. This level is much higher than that of Hex A harbouring the Gly169Ser adult-onset mutation (12%). A sequential decrease in expressed Hex A activity is observed as mutations associated with more severe phenotypes are expressed. The benign mutations also result in lower levels of mature {alpha}-subunit protein compared to normal, and slightly reduced levels of {alpha}-subunit precursor protein. The Hex A deficiency resulting from benign mutations is not as great as that associated with disease-causing mutations.

  7. Recoil-range studies of heavy products of multinucleon transfer from 18O to 245Cm and 249Cf

    International Nuclear Information System (INIS)

    Recoil range distributions were measured for alpha and spontaneous fission activities made in the bombardment of 245Cm and 249Cf with 18O from 6.20 MeV/nucleon down to the interaction barrier. The shape of the distributions indicates tht transfers of up to four protons take place via a combination of quasi-elastic (QET) and deep inelastic (DIT) mechanisms, rather than complete fusion-de-excitation (CF) or massive transfer (MT). Angular distributions constructed from recoil range distributions, assuming QET/DIT, indicate that the QET component contributes more significantly to the heavy product residue cross section than the DIT, even though primary cross sections are expected to be higher for DIT than for QET. This may be explained qualitatively as a result of the high excitation energies associated with DIT; the very negative Q/sub gg/ of projectile stripping for these systems combined with the lower expected optimal Q/sub rxn/ of QET compared to DIT can give QET products comparatively low excitation

  8. X-ray nova MAXI J1828-249. Evolution of the broadband spectrum during its 2013-2014 outburst

    CERN Document Server

    Grebenev, S A; Burenin, R A; Krivonos, R A; Mescheryakov, A V

    2016-01-01

    Based on data from the SWIFT, INTEGRAL, MAXI/ISS orbital observatories, and the ground-based RTT-150 telescope, we have investigated the broadband (from the optical to the hard X-ray bands) spectrum of the X-ray nova MAXI J1828-249 and its evolution during the outburst of the source in 2013-2014. The optical and infrared emissions from the nova are shown to be largely determined by the extension of the power-law component responsible for the hard X-ray emission. The contribution from the outer cold regions of the accretion disk, even if the X-ray heating of its surface is taken into account, turns out to be moderate during the source's "high" state (when a soft blackbody emission component is observed in the X-ray spectrum) and is virtually absent during its "low" ("hard") state. This result suggests that much of the optical and infrared emissions from such systems originates in the same region of main energy release where their hard X-ray emission is formed. This can be the Compton or synchro-Compton radiati...

  9. Radiosensibility curve with 60 Co in guinea grass (Panicum maximum Jacq.) cv. 'K-249'

    International Nuclear Information System (INIS)

    In order to select the adequate radiosensibility criterion and useful dosis were studied the effects of gamma radiation on the embryogenic callus of guinea cv. K-249. The application dosages were 0, 10, 20, 40, 60, 80, 100, 150, 200, 250, 300 and 400 Gy and the measures evaluated were: increase of fresh mass of the callus in fresh medium, number of shoots, plantlets and total by callus and by gram of callus in regeneration medium. It was determined that the curves shaped with the number of shoots, plantlets and total by callus and by gram of callus were more radiosensible than that shoped with increase of fresh mass of the callus; as criterion of radiosensibility in this cultivar the total number of shoots and plantlets from gram of callus was selected for it's simplicity and veracity as much as in the evaluation and in the results. The useful dosis that determined one GR 10, 20, 50 and 70 percent were 16, 20, 29 and 160 Gy respectively. Albino shoots were also observed whose values were randomizely showed and it was observed albinism in 0 dosis. (author)

  10. Book review: Garden plots: the politics and poetics of gardens. By Shelley Saguaro. Aldershot, Hants and Burlington, VT: Ashgate Publishing Limited. 2006. xiii + 249 pp. #50.00 hardback. ISBN: 9780754637530

    OpenAIRE

    2008-01-01

    Book review: Garden plots: the politics and poetics of gardens. By Shelley Saguaro. Aldershot, Hants and Burlington, VT: Ashgate Publishing Limited. 2006. xiii + 249 pp. #50.00 hardback. ISBN: 9780754637530 Kingston University - (Preston, Rebecca)

  11. Evidence for association of D1S249 locus on human chromosome 1 with the susceptibility to essential hypertension in Han Chinese

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Essential hypertension (EH) is thought to result from theinteraction of environmental and genetic factors. The molecular genetics of EH has witnessed considerable progress during the past few years. However, the number of genes involved, their chromosomal location and the magnitude of their effect on EH susceptibility are unknown. We conducted the present study to screen susceptibility genes to essential hypertension using a genome-wide scanning method in a group of Han people from Fangshan district located in the southwest of Beijing. A case-control study and affected sibpair were performed. Genotyping was carried out using a fluorescence-based semiautomated technique on automated DNA sequencer (ABI 377, PE). The basis for the genome-screen was the ABI prism linkage mapping sets of 400 microsatellite markers (version 2, PE, Co.). PCR for amplification of markers was carried out as multiplex reactions with Ampli Taq gold (PE, Co.) following protocols developed in our laboratory. Data were exported as a text file from genotyper for subsequent two-point affected sibpair linkage analysis. The data from case-control association study showed a linkage disequilibrium between EH and marker D1S249 locus (X2 = 14.6, P = 0.002). There are 12 alleles in the D1S249 locus. The frequency of A9 allele in hypertension was higher than in normotensives, (13.6% v.s. 2.7%, X2 = 6.30, p = 0.01, OR = 4.57, 95%CI = 1.24-25.4). The data from two-point affected sibpair linkage analysis demonstrated a linkage between EH and A9 allele, P<0.05. It suggested that microsatellite marker D1S249 locus might be associated with the genetic susceptibility to essential hypertension in Han Chinese.

  12. Calculations of the cross sections for synthesis of new {293-296}118 isotopes in {249-252}Cf(48Ca,xn) reactions

    CERN Document Server

    Cap, T; Kowal, M; Wilczynski, J

    2013-01-01

    A project of using a target consisting of the mixture of (249-252)Cf isotopes to be bombarded with the 48Ca beam, aimed to synthesize new isotopes of the heaviest known element Z = 118, is under way at the FLNR in Dubna. In the present work excitation functions for all the reactions: 249Cf(48Ca,xn)(297-x)118, 250Cf(48Ca,xn)(298-x)118, 251Cf(48Ca,xn)(299-x)118 and 252Cf(48Ca,xn)(300-x)118 have been calculated in the framework of the fusion-by-diffusion model, assuming fission barriers, ground-state masses and shell effects of the superheavy nuclei predicted by Kowal et al. Energy dependence of the effective cross sections for the synthesis of selected new isotopes: (293)118, (294)118, (295)118 and (296)118 is predicted for the particular isotopic composition of the Cf target prepared for the Dubna experiment.

  13. Observation of high-j quasiparticle states in Cm249 by in-beam γ-ray spectroscopy using heavy-ion transfer reactions

    Science.gov (United States)

    Ishii, T.; Makii, H.; Asai, M.; Tsukada, K.; Toyoshima, A.; Matsuda, M.; Makishima, A.; Shigematsu, S.; Kaneko, J.; Shizuma, T.; Toume, H.; Hossain, I.; Kohno, T.; Ogawa, M.

    2008-11-01

    We have measured de-excitation γ rays in Cm249 populated by one-neutron stripping reactions with a Cm248 target and 162-MeV O16, 162-MeV O18, and 120-MeV C13 beams. γ rays in Cm249 were identified by measuring kinetic energies of outgoing particles using Si ΔE-E detectors. It was demonstrated that high-j orbitals were selectively populated in the (O16, O15) reaction having a large negative Q value. We have observed eight quasiparticle states above the deformed shell gap of N=152. The 1/2+[620], 1/2-[750], and 7/2+[613] bands were extended up to 19/2+, 19/2-, and 13/2+ states, respectively. We have established the 9/29/2+[615] state at 526 keV, the 9/29/2+[604] state with a short life of T1/2≪2 ps at 1030 keV, and the 11/211/2-[725] state with T1/2=19(1) ns at 375 keV. Furthermore, the 17/21/2+[880] state, having a large component of the k17/2 spherical single-particle state, has been identified at 1505 keV. We discuss the properties of those quasiparticle states in the framework of a deformed shell model.

  14. Observation of high-j quasiparticle states in 249Cm by in-beam γ-ray spectroscopy using heavy-ion transfer reactions

    International Nuclear Information System (INIS)

    We have measured de-excitation γ rays in 249Cm populated by one-neutron stripping reactions with a 248Cm target and 162-MeV 16O, 162-MeV 18O, and 120-MeV 13C beams. γ rays in 249Cm were identified by measuring kinetic energies of outgoing particles using Si ΔE-E detectors. It was demonstrated that high-j orbitals were selectively populated in the (16O, 15O) reaction having a large negative Q value. We have observed eight quasiparticle states above the deformed shell gap of N=152. The 1/2+[620], 1/2-[750], and 7/2+[613] bands were extended up to 19/2+, 19/2-, and 13/2+ states, respectively. We have established the 9/2 9/2+[615] state at 526 keV, the 9/2 9/2+[604] state with a short life of T1/2-[725] state with T1/2=19(1) ns at 375 keV. Furthermore, the 17/2 1/2+[880] state, having a large component of the k17/2 spherical single-particle state, has been identified at 1505 keV. We discuss the properties of those quasiparticle states in the framework of a deformed shell model

  15. Dense Fe-Rich Ejecta in Supernova Remnants DEM L238 and DEM L249: A New Class of Type Ia Supernova?

    CERN Document Server

    Borkowski, K J; Reynolds, S P

    2006-01-01

    We present observations of two LMC supernova remnants (SNRs), DEM L238 and DEM L249, with the Chandra and XMM-Newton X-ray satellites. Bright central emission, surrounded by a faint shell, is present in both remnants. The central emission has an entirely thermal spectrum dominated by strong Fe L-shell lines, with the deduced Fe abundance in excess of solar and not consistent with the LMC abundance. This Fe overabundance leads to the conclusion that DEM L238 and DEM L249 are remnants of thermonuclear (Type Ia) explosions. The shell emission originates in gas swept up and heated by the blast wave. A standard Sedov analysis implies about 50 solar masses in both swept-up shells, SNR ages between 10,000 and 15,000 yr, low (< 0.05 cm^-3) preshock densities, and subluminous explosions with energies of 3x10^50 ergs. The central Fe-rich supernova ejecta are close to collisional ionization equilibrium. Their presence is unexpected, because standard Type Ia SNR models predict faint ejecta emission with short ionizati...

  16. A Novel Substitution of The Heme-binding Residue Histidine-245 by Histidine-249 in Heme Oxygenase HugZ%血红素氧合酶HugZ组氨酸-249对组氨酸-245侧链缺失补偿的结构基础

    Institute of Scientific and Technical Information of China (English)

    沈溪辉; 胡永林; 王大成

    2012-01-01

    The heme oxygenase HugZ from Helicobacter pylori plays essential roles in the colonization of the bacteria in human hosts and is required for the utilization of heme as the sole iron source. Residue His245, which is highly conserved, coordinates the heme iron through its sidechain imidazole group. Surprisingly, this residue was not required for the enzymatic activities of HugZ. To investigate the roles played by His245 in heme binding and enzymatic mechanisms of HugZ, we have solved the crystal structure of HugZ mutant H245A at 2.55 (A) resolution and found that a nearby histidine residue, His249, coordinates the heme iron. This substitution is made possible by the fact that both residues 245 and 249 are located in a flexible loop region ranged from Gly239 to the C-terminus. Similar structural features have not been observed in other heme oxygenases so far. We have also performed spectroscopic studies on the heme-binding properties of HugZ and relevant mutants and our results suggest that the flexible C-terminal loop region of HugZ and the presence of multiple histidine residues in this region may play important roles in heme recruiting and in the catalytic mechanisms of HugZ.%血红素氧合酶HugZ是幽门螺旋杆菌(Helicobacter pylori)利用宿主血红素作为铁源的关键蛋白.HugZ的His245残基侧链咪唑基与血红素中心铁配位结合,是酶活中心的重要组成部分.用定点突变的方法构建HugZ突变体H245A、H249A和H245A/H249A基因,并将突变体蛋白表达纯化.通过X射线晶体学途径解析了突变体H245A与血红素复合物的2.55(A)分辨率晶体结构.结构解析表明,HugZ的His249残基侧链咪唑基团与血红素的铁原子结合,从而补偿了His245侧链缺失.这种结构特征在已知血红素氧合酶中未曾发现.Va1238ψ平面的可翻转和Gly239的柔性是His249能与血红素配位结合的关键原因,二者的共同作用改变了C端肽链的走向,使Va1238与His249之间的柔性

  17. Modified model of neutron resonances widths distributions. Results of reduced neutron widths approximation for mass region 35 ≤ A ≤ 249

    International Nuclear Information System (INIS)

    The distributions of the reduced neutron widths of s-, p- and d-resonances of nuclei of any type from nuclear mass region 35 ≤ A ≤ 249 were approximated with maximal precision by the model which presents experimental data set as a superposition of a maximum of four independent neutron amplitudes. Under the assumption that each of these amplitudes has the Gauss distribution with the unique maximum there were determined the most probable values of contribution of each amplitude in summary width distribution, their most probable mean values and dispersions. Comparison of the obtained χ2 values with value χ2 at description of the experimental data by one distribution of neutron amplitudes with best fitted parameters shows that all widths from more than 157 analyzed data sets can have different types of wave functions

  18. Comment on “Human impacts on headwater fluvial systems in the northern and central Andes” (Carol P. Harden, Geomorphology 79, 249 263)

    Science.gov (United States)

    Buytaert, Wouter; De Bièvre, Bert; Celleri, Rolando; Cisneros, Felipe; Wyseure, Guido; Deckers, Seppe

    2008-04-01

    The high altitude grasslands of the tropical Andes, known as páramo, are a very fragile and unique ecosystem. Despite increasing human activities, many of its geomorphological and hydrological processes are still very poorly understood. We therefore welcome the paper of Harden [Harden, C.P., 2006. Human impacts on headwater fluvial systems in the northern and central Andes. Geomorphology 79, 249-263.] about "Human impacts on headwater fluvial systems in the northern and central Andes" as a valuable contribution to a better understanding of this complex ecosystem. However, in view of the available literature, we would like to complement the interpretation of the presented results and discuss some of the claims made in the paper.

  19. Eleven new heaviest isotopes of elements Z=105 to Z=117 identified among the products of 249Bk+48Ca reactions

    International Nuclear Information System (INIS)

    The heaviest isotopes of elements Z=117 to Z=105, 294117, 293117, 290115, 289115, 286113, 285113, 282Rg, 281Rg, 278Mt, 274Bh, and 270Db, were identified by means of the Dubna gas-filled recoil separator among the products of the 249Bk + 48Ca reaction. The details of the observed six decay chains, indicating the production and decay of isotopes 293117 and 294117, are presented and discussed. The decay energies and resulting half-lives of these new nuclei show a strong rise of stability with increasing neutron number, validating the concept of the island of enhanced stability for superheavy nuclei [Oganessian et al., Phys. Rev. Lett. 104, 142502 (2010)].

  20. Creación de un manual para el diseño e implementación de videojuegos en Blender 2.49b

    OpenAIRE

    Peral Castro, Roberto

    2010-01-01

    El objetivo principal de este proyecto, es crear un manual de referencia rápida, que enseñe a diseñar un videojuego del modo más sencillo y guiado posible, con la herramienta Blender en su versión 2.49b. No se pretende que sea un manual teórico que explique las propiedades físicas de los objetos, los distintos tipos de texturas, o los métodos de programación aplicables a los videojuegos. Con las herramientas de diseño que existen hoy en día, y haciendo una medición basada en la experiencia...

  1. Crystal structure of apatite type Ca2.49Nd7.51(SiO4)6O1.75.

    Science.gov (United States)

    Le, Thu Hoai; Brooks, Neil R; Binnemans, Koen; Blanpain, Bart; Guo, Muxing; Van Meervelt, Luc

    2016-02-01

    The title compound, Ca2+x Nd8-x (SiO4)6O2-0.5x (x = 0.49), was synthesized at 1873 K and rapidly quenched to room temperature. Its structure has been determined using single-crystal X-ray diffraction and compared with results reported using neutron and X-ray powder diffraction from samples prepared by slow cooling. The single-crystal structure from room temperature data was found to belong to the space group P63/m and has the composition Ca2.49Nd7.51(SiO4)6O1.75 [dicalcium octa-neodymium hexa-kis-(ortho-silicate) dioxide], being isotypic with natural apatite and the previously reported Ca2Nd8(SiO4)6O2 and Ca2.2Nd7.8(SiO4)6O1.9. The solubility limit of calcium in the equilibrium state at 1873 K was found to occur at a composition of Ca2+x Nd8-x (SiO4)6O2-0.5x , where x = 0.49. PMID:26958389

  2. Recoil-range studies of heavy products of multinucleon transfer from /sup 18/O to /sup 245/Cm and /sup 249/Cf

    Energy Technology Data Exchange (ETDEWEB)

    McFarland, R.M.

    1982-09-01

    Recoil range distributions were measured for alpha and spontaneous fission activities made in the bombardment of /sup 245/Cm and /sup 249/Cf with /sup 18/O from 6.20 MeV/nucleon down to the interaction barrier. The shape of the distributions indicates tht transfers of up to four protons take place via a combination of quasi-elastic (QET) and deep inelastic (DIT) mechanisms, rather than complete fusion-de-excitation (CF) or massive transfer (MT). Angular distributions constructed from recoil range distributions, assuming QET/DIT, indicate that the QET component contributes more significantly to the heavy product residue cross section than the DIT, even though primary cross sections are expected to be higher for DIT than for QET. This may be explained qualitatively as a result of the high excitation energies associated with DIT; the very negative Q/sub gg/ of projectile stripping for these systems combined with the lower expected optimal Q/sub rxn/ of QET compared to DIT can give QET products comparatively low excitation.

  3. Crystal structure of apatite type Ca2.49Nd7.51(SiO46O1.75

    Directory of Open Access Journals (Sweden)

    Thu Hoai Le

    2016-02-01

    Full Text Available The title compound, Ca2+xNd8–x(SiO46O2–0.5x (x = 0.49, was synthesized at 1873 K and rapidly quenched to room temperature. Its structure has been determined using single-crystal X-ray diffraction and compared with results reported using neutron and X-ray powder diffraction from samples prepared by slow cooling. The single-crystal structure from room temperature data was found to belong to the space group P63/m and has the composition Ca2.49Nd7.51(SiO46O1.75 [dicalcium octaneodymium hexakis(orthosilicate dioxide], being isotypic with natural apatite and the previously reported Ca2Nd8(SiO46O2 and Ca2.2Nd7.8(SiO46O1.9. The solubility limit of calcium in the equilibrium state at 1873 K was found to occur at a composition of Ca2+xNd8–x(SiO46O2–0.5x, where x = 0.49.

  4. Characterization of CCR5△32、 CCR2b-64I、 CX3CR1-249I280M and SDF1-3'A Allelic Polymorphisms in the Chinese Uygur Population

    Institute of Scientific and Technical Information of China (English)

    LIU Mingxu(刘明旭); WANG Fusheng(王福生); JIN Lei(金磊); HONG Weiguo(洪卫国); LEI Zhouyun(雷周云); ZHANG Bing(张冰); HOU Jing(候静); ZHANG Zhanping(张战平); TANG Chunjun(唐纯军)

    2002-01-01

    Objectives: Allelic polymorphisms of CCR5△32 、CCR2b-64I,CX3CR1-249I280M and SDF1-3'A associatedwith HIV-1 infection and disease progression wereinvestigated in indigenous Uygur populations from theXinjiang Uygur Autonomous Region of China.Methods: The study population comprised 316 healthyUygur subjects with an age range of 1-80 years old, fromwhom whole peripheral blood samples were collected andnone were HIV-1 seropositive. Genomic DNA samples werepurified using a Qiagen Blood Kit. Genotyping of theaforementioned four alleles was performed using PCR orPCR/RFLP assay, and further confirmed by direct DNAsequencing.Results: The allelic frequencies in Chinese Uygurpopulation were as follows: 3.48% for CCR5△32; 19.45% forCCR2b-64I; 13.8% for CX3CR1-249I280M haplotype, and20.41% for SDF1-3'A. Mutant allele distributions amongUygur populations were in accordance with theHardy-Weinberg equilibrium. No statistical difference wasfound between the frequency of the three HIV coreceptors andtheir respective ligand genes.Conclusion: The frequency of SDF1-3'A andCX3CR1-249I280M haplotypes in these Uygur populationswas similar to that of Caucasian people, while the frequency ofthe CCR2b-64I haplotype more closely matched the HanChinese. The frequency of CCR5△32 in Uygur populationswas between Caucasian and Han frequencies, the more closelymatching the frequency in Medi-Asia people. No geneticlinkage between any two of the three HIV coreceptor geneswas found, but obvious genetic linkages existed betweenCX3CR1-249I and CX3CR1-280M,with even higher linkagedegrees than Caucasian people.

  5. Thomas Le Roux (dir.), « L’émergence du risque industriel (France, Grande-Bretagne, XVIIIe – XIXe siècles), Le Mouvement social, n° 249

    OpenAIRE

    El Hage, Fadi

    2015-01-01

    L’histoire de l’industrie ne peut être pensée en faisant abstraction des risques. L’ère de la révolution industrielle a par ailleurs attiré l’attention sur ceux-ci, les risques industriels ayant remplacé les risques urbains plus classiques, comme les incendies de quartiers majoritairement construits en bois. Cette mutation du risque est le point de départ chronologique de la riche réflexion proposée par le numéro 249 de la revue Le Mouvement social autour de « l’émergence du risque industriel...

  6. Evaluation of thermal neutron cross-sections and resonance integrals of protactinium, americium, curium, and berkelium isotopes

    International Nuclear Information System (INIS)

    Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs

  7. An experimental investigation of M-subshell fluorescence yields and of the L1-L3 radiative transition in neptunium and curium from the radioactive decays of 241Am and 249Cf

    International Nuclear Information System (INIS)

    The construction and performance of a wall-less multiwire proportional counter (MWPC) is described. The absolute emission rate of M x rays from a 241Am source was measured with the MWPC and with a single-wire proportional counter and a value of (6.35 +- 0.60) x 10-2 M x rays per decay, or (0.470 +- 0.045) M x rays per L/sub α/ x ray is obtained. High resolution Ge(Li) and Si(Li) x-ray spectrometers and the multiwire proportional counter (MWPC) were used for measuring coincidences, respectively, between various L x rays and the M x rays of neptunium (Z = 93) from a 241Am source. In addition, M x rays of curium from a 249Cf source were measured with a Si(Li) detector in coincidence with various K and L x rays detected with a Ge(Li) spectrometer. 81 refs., 24 figs., 23 tabs

  8. Solution of the Skyrme-Hartree-Fock-Bogolyubov equations in the Cartesian deformed harmonic-oscillator basis. (VII) HFODD (v2.49s): a new version of the program

    CERN Document Server

    Schunck, N; McDonnell, J; Satula, W; Sheikh, J A; Staszczak, A; Stoitsov, M; Toivanen, P

    2011-01-01

    We describe the new version (v2.49s) of the code HFODD which solves the nuclear Skyrme Hartree-Fock (HF) or Skyrme Hartree-Fock-Bogolyubov (HFB) problem by using the Cartesian deformed harmonic-oscillator basis. In the new version, we have implemented the following physics features: (i) the isospin mixing and projection, (ii) the finite temperature formalism for the HFB and HF+BCS methods, (iii) the Lipkin translational energy correction method, (iv) the calculation of the shell correction. A number of specific numerical methods have also been implemented in order to deal with large-scale multi-constraint calculations and hardware limitations: (i) the two-basis method for the HFB method, (ii) the Augmented Lagrangian Method (ALM) for multi-constraint calculations, (iii) the linear constraint method based on the approximation of the RPA matrix for multi-constraint calculations, (iv) an interface with the axial and parity-conserving Skyrme-HFB code HFBTHO, (v) the mixing of the HF or HFB matrix elements instead...

  9. Solution of the Skyrme-Hartree-Fock-Bogolyubov equations in the Cartesian deformed harmonic-oscillator basis. (VII) HFODD (v2.49t): A new version of the program

    International Nuclear Information System (INIS)

    We describe the new version (v2.49t) of the code HFODD which solves the nuclear Skyrme Hartree-Fock (HF) or Skyrme Hartree-Fock-Bogolyubov (HFB) problem by using the Cartesian deformed harmonic-oscillator basis. In the new version, we have implemented the following physics features: (i) the isospin mixing and projection, (ii) the finite temperature formalism for the HFB and HF+BCS methods, (iii) the Lipkin translational energy correction method, (iv) the calculation of the shell correction. A number of specific numerical methods have also been implemented in order to deal with large-scale multi-constraint calculations and hardware limitations: (i) the two-basis method for the HFB method, (ii) the Augmented Lagrangian Method (ALM) for multi-constraint calculations, (iii) the linear constraint method based on the approximation of the RPA matrix for multi-constraint calculations, (iv) an interface with the axial and parity-conserving Skyrme-HFB code HFBTHO, (v) the mixing of the HF or HFB matrix elements instead of the HF fields. Special care has been paid to using the code on massively parallel leadership class computers. For this purpose, the following features are now available with this version: (i) the Message Passing Interface (MPI) framework, (ii) scalable input data routines, (iii) multi-threading via OpenMP pragmas, (iv) parallel diagonalization of the HFB matrix in the simplex breaking case using the ScaLAPACK library. Finally, several little significant errors of the previous published version were corrected.

  10. Identification of a novel BRCA1 nucleotide 4803delCC/c.4684delCC mutation and a nucleotide 249T>A/c.130T>A (p.Cys44Ser) mutation in two Greenlandic Inuit families

    DEFF Research Database (Denmark)

    Hansen, Thomas van Overeem; Jønson, Lars; Albrechtsen, Anders;

    2010-01-01

    >A/c.130T>A (p.Cys44Ser) mutation in another Greenlandic individual with ovarian cancer. This patient share a 1-2 Mb genomic fragment, containing the BRCA1 gene, with four Danish families harbouring the same mutation, suggesting that the 249T>A/c.130T>A (p.Cys44Ser) mutation originates from a Danish...

  11. Identification of a novel BRCA1 nucleotide 4803delCC/c.4684delCC mutation and a nucleotide 249T>A/c.130T>A (p.Cys44Ser) mutation in two Greenlandic Inuit families: implications for genetic screening of Greenlandic Inuit families with high risk for breast and/or ovarian cancer

    DEFF Research Database (Denmark)

    Hansen, Thomas V O; Jønson, Lars; Albrechtsen, Anders;

    2010-01-01

    >A/c.130T>A (p.Cys44Ser) mutation in another Greenlandic individual with ovarian cancer. This patient share a 1-2 Mb genomic fragment, containing the BRCA1 gene, with four Danish families harbouring the same mutation, suggesting that the 249T>A/c.130T>A (p.Cys44Ser) mutation originates from a Danish...

  12. 7 CFR 249.4 - State Plan.

    Science.gov (United States)

    2010-01-01

    ... procedures for identifying and certifying eligible SFMNP participants, including the specific age and income... description of age- and circumstance-appropriate nutrition education to be provided to SFMNP participants.../proxy and (if applicable) farmer are required to sign, stamp, or otherwise endorse the coupon before...

  13. 7 CFR 249.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... of Columbia, the Commonwealth of Puerto Rico, the Virgin Islands, Guam, and as applicable, American..., vegetables, honey, and herbs for human consumption. Eligible foods may not be processed or prepared...

  14. 7 CFR 249.12 - SFMNP costs.

    Science.gov (United States)

    2010-01-01

    ...-up; (2) The costs associated with the provision of nutrition education that meets the requirements of... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) State Agency Provisions §...

  15. 7 CFR 249.7 - Nondiscrimination.

    Science.gov (United States)

    2010-01-01

    ... discrimination, under the SFMNP: (i) Title VI of the Civil Rights Act of 1964; (ii) Title IX of the Education Amendments of 1972; (iii) Section 504 of the Rehabilitation Act of 1973; (iv) The Age Discrimination Act of... title); and (vi) Applicable FNS Instructions, including requirements for racial and ethnic...

  16. 25 CFR 249.3 - Identification cards.

    Science.gov (United States)

    2010-04-01

    ... the issuance of an appropriate identification card to any Indian entitled thereto as prima facie... any Federal, State, or tribal enforcement officer shall be prima facie evidence that the person is...

  17. Solution of the Skyrme-Hartree-Fock-Bogolyubov equations in the Cartesian deformed harmonic-oscillator basis.. (VII) HFODD (v2.49t): A new version of the program

    Science.gov (United States)

    Schunck, N.; Dobaczewski, J.; McDonnell, J.; Satuła, W.; Sheikh, J. A.; Staszczak, A.; Stoitsov, M.; Toivanen, P.

    2012-01-01

    We describe the new version (v2.49t) of the code HFODD which solves the nuclear Skyrme-Hartree-Fock (HF) or Skyrme-Hartree-Fock-Bogolyubov (HFB) problem by using the Cartesian deformed harmonic-oscillator basis. In the new version, we have implemented the following physics features: (i) the isospin mixing and projection, (ii) the finite-temperature formalism for the HFB and HF + BCS methods, (iii) the Lipkin translational energy correction method, (iv) the calculation of the shell correction. A number of specific numerical methods have also been implemented in order to deal with large-scale multi-constraint calculations and hardware limitations: (i) the two-basis method for the HFB method, (ii) the Augmented Lagrangian Method (ALM) for multi-constraint calculations, (iii) the linear constraint method based on the approximation of the RPA matrix for multi-constraint calculations, (iv) an interface with the axial and parity-conserving Skyrme-HFB code HFBTHO, (v) the mixing of the HF or HFB matrix elements instead of the HF fields. Special care has been paid to using the code on massively parallel leadership class computers. For this purpose, the following features are now available with this version: (i) the Message Passing Interface (MPI) framework, (ii) scalable input data routines, (iii) multi-threading via OpenMP pragmas, (iv) parallel diagonalization of the HFB matrix in the simplex-breaking case using the ScaLAPACK library. Finally, several little significant errors of the previous published version were corrected. New version program summaryProgram title:HFODD (v2.49t) Catalogue identifier: ADFL_v3_0 Program summary URL:http://cpc.cs.qub.ac.uk/summaries/ADFL_v3_0.html Program obtainable from: CPC Program Library, Queen's University, Belfast, N. Ireland Licensing provisions: GNU General Public Licence v3 No. of lines in distributed program, including test data, etc.: 190 614 No. of bytes in distributed program, including test data, etc.: 985 898 Distribution

  18. 7 CFR 2.49 - Administrator, Rural Housing Service.

    Science.gov (United States)

    2010-01-01

    ... joint regulations issued pursuant thereto by the Attorney General and the Comptroller General (4 CFR... Executive Order 12580, 3 CFR, 1987 Comp., p. 193, under the following provisions of the Comprehensive... section 1-601 of Executive Order 12088, 3 CFR, 1978 Comp., p. 243, to enter into an inter-agency...

  19. 7 CFR 249.23 - Records and reports.

    Science.gov (United States)

    2010-01-01

    ..., delivery receipts, equipment purchases and inventory, nutrition education, fair hearings, and civil rights... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) Miscellaneous Provisions §...

  20. 7 CFR 249.17 - Management evaluations and reviews.

    Science.gov (United States)

    2010-01-01

    ... management, accountability, certification, nutrition education, financial management systems, and coupon and..., DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP... SFMNP and the WIC Farmers' Market Nutrition Program are in operation, these reviews may be...

  1. Dicty_cDB: SHK249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available olorF (JM107 adapted methyl filtered) Sorghum bicolor genomic clone ht56c07 5', DNA sequence. 32 0.11 3 BZ35...0960 |BZ350960.1 ht62h04.g1 WGS-SbicolorF (JM107 adapted methyl filtered) Sorghum bicolor genomic clone ht62...h04 5', DNA sequence. 32 0.12 3 CW043777 |CW043777.1 104_279_10508575_114_30273 Sorghum methylation filtered...ence. 32 0.12 3 CW183669 |CW183669.1 104_599_11164737_116_36675_037 Sorghum methylation filtered library (Li

  2. Dicty_cDB: CHS249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tii PhoA (PH... 171 4e-41 ( P32811 ) RecName: Full=Alpha-glucan phosphorylase, H isozyme; ... 170 9e-41 AB435244_1( AB435244 |pid...PNDINAISIERLSPLTFVKQTSASPLSVISGGDKTNNTLKPKQTTKGF NIGVNQVIQQIN*iiiikkxk Translated Amino Acid sequence (All Frames) Fram...e A: eiknnkinnlnnnnknkhqinqkilllnylh*nlkvikkknklyfglswqaifqrirvhf kknllnmlnilwlkprvnvlisqvskhfhivpgid...ments: (bits) Value N M77492 |M77492.1 Dictyostelium discoideum glycoprotein phosphorylase 2 (glpD) gene, co...mplete cds. 1417 0.0 2 X62142 |X62142.1 D. discoideum glpV gene for glycogen phosphorylase 1. 127 2e-46 6 BX

  3. 1935 15' Quad #249 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  4. 48 CFR 249.501-70 - Special termination costs.

    Science.gov (United States)

    2010-10-01

    ... of $100 million; and (3) Adequate funds are available to cover the contingent reserve liability for... associated with contingent special termination costs is expected to fluctuate extensively over the period...

  5. Dicty_cDB: VFE249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SEQUENCING IN PROGRESS ***, 20 unordered pieces. 54 7e-04 5 AC125395 |AC125395.1 Mus musculus chromosome UN...8600_1( BC078600 |pid:none) Xenopus laevis hypothetical protei... 43 0.009 BT075193_1( BT075193 |pid:none) Osmer... 2009. 6.18 PSORT psg: 0.83 gvh: 0.33 alm: 0.39 top: 0.53 tms: 0.00 mit: 0.28 mip: 0.00 nuc: 0.00 erl: 0.00 er...skplldlvvqeirqldf*lklkamlmlll Frame C: ffkhtnt*iifiylsthpkysy*wqk*qyqlkmkisfk*iynqikqlki*nve*nlkpqf **tikf*hlme...lium discoideum chromosome 2 map 2779865-2840915 strain AX4, *** SEQUENCING IN PROGRESS ***, in ordered piec

  6. Use of trioctylphosphine oxide for transplutonium element extraction and purification

    International Nuclear Information System (INIS)

    Investigated was extraction of tri-valent curium, berkelium, californium, einsteinium as well as cerium and europium with trioctylphosphin oxide from lactic acid solutions, containing DTPA and aluminium nitrate depending on the aluminium nitrate and TOPO concentrations and nitric acid solutions of variable concentration as well. Under optimum conditions of extraction chromatography of berkelium studied was the distribution of cobalt, nickel, chromium, iron, aluminium, titanium, zirconium and niobium ions, and the coefficients of berkelium purification from cations investigated were determined. The effect of weight quantities of cation impurities on extraction chromatographic yield of berkelium has been investigated. Examples of practice application of the extraction chromatography with the use of TOPO are given

  7. 14 CFR 249.20 - Preservation of records by certificated air carriers.

    Science.gov (United States)

    2010-01-01

    ... Do. 4. Accounts receivables and payables: (a) Traffic accounts receivable or payable, detailed journals and ledgers or their equivalents, together with supporting papers Do. (b) General accounts receivable or payable, detailed journals and ledgers or their equivalents, together with supporting papers...

  8. People and things. CERN Courier, Nov 1984, v. 24(9)

    International Nuclear Information System (INIS)

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A landmark event took place at Stanford on 3-4 August in the form of a ' Pief-fest', a celebration tacked onto the end of the traditional annual Stanford Linear Accelerator Center (SLAC) Summer Institute to mark the retirement of Wolfgang 'Pief Panofsky as the Laboratory's Director.The University of California's Lawrence Berkeley Laboratory has been chosen as the host institution for the Central Design Group for the Superconducting Super Collider (SSC). The fifth Topical Workshop on Proton-Antiproton Collider Physics will be held in Saint-Vincent, Aosta Valley, Italy, from 25 February to 2 March 1985. The local users' organization at the Stanford Linear Accelerator Center is organizing a Workshop on Electron-Positron Physics at High Luminosities, to be held at SLAC from 30 November to 1 December. The Aspen (Colorado, USA) Center for Physics announces a Winter Physics Conference Series - Collider Physics at Ultrahigh Energies from 6-12 January 1985 and Electro weak Interactions from 13- 19 January. As this edition was going to press, the CERN SPS protonantiproton collider was back in action for physics for the first time since the historic run last year which produced the Z particle and the first evidence for the sixth ('top') quark

  9. S.I. No 249 of 1972, Factories Ionising Radiations (Unsealed Radioactive Substances) Regulations, 1972

    International Nuclear Information System (INIS)

    The Regulations which entered into force on 1 December 1972 apply to factories in which a process involving the use of unsealed radioactive substances is carried on and where the total activity of the unsealed radioactive substances exceeds specified levels, or where there are objects contaminated in excess of certain levels. The Schedules specify the maximum radiation doses and the maximum permissible levels of contamination and provide for a classification of radionuclides

  10. Association analyses of 249,796 individuals reveal eighteen new loci associated with body mass index

    Science.gov (United States)

    Speliotes, Elizabeth K.; Willer, Cristen J.; Berndt, Sonja I.; Monda, Keri L.; Thorleifsson, Gudmar; Jackson, Anne U.; Allen, Hana Lango; Lindgren, Cecilia M.; Luan, Jian’an; Mägi, Reedik; Randall, Joshua C.; Vedantam, Sailaja; Winkler, Thomas W.; Qi, Lu; Workalemahu, Tsegaselassie; Heid, Iris M.; Steinthorsdottir, Valgerdur; Stringham, Heather M.; Weedon, Michael N.; Wheeler, Eleanor; Wood, Andrew R.; Ferreira, Teresa; Weyant, Robert J.; Segré, Ayellet V.; Estrada, Karol; Liang, Liming; Nemesh, James; Park, Ju-Hyun; Gustafsson, Stefan; Kilpeläinen, Tuomas O.; Yang, Jian; Bouatia-Naji, Nabila; Esko, Tõnu; Feitosa, Mary F.; Kutalik, Zoltán; Mangino, Massimo; Raychaudhuri, Soumya; Scherag, Andre; Smith, Albert Vernon; Welch, Ryan; Zhao, Jing Hua; Aben, Katja K.; Absher, Devin M.; Amin, Najaf; Dixon, Anna L.; Fisher, Eva; Glazer, Nicole L.; Goddard, Michael E.; Heard-Costa, Nancy L.; Hoesel, Volker; Hottenga, Jouke-Jan; Johansson, Åsa; Johnson, Toby; Ketkar, Shamika; Lamina, Claudia; Li, Shengxu; Moffatt, Miriam F.; Myers, Richard H.; Narisu, Narisu; Perry, John R.B.; Peters, Marjolein J.; Preuss, Michael; Ripatti, Samuli; Rivadeneira, Fernando; Sandholt, Camilla; Scott, Laura J.; Timpson, Nicholas J.; Tyrer, Jonathan P.; van Wingerden, Sophie; Watanabe, Richard M.; White, Charles C.; Wiklund, Fredrik; Barlassina, Christina; Chasman, Daniel I.; Cooper, Matthew N.; Jansson, John-Olov; Lawrence, Robert W.; Pellikka, Niina; Prokopenko, Inga; Shi, Jianxin; Thiering, Elisabeth; Alavere, Helene; Alibrandi, Maria T. S.; Almgren, Peter; Arnold, Alice M.; Aspelund, Thor; Atwood, Larry D.; Balkau, Beverley; Balmforth, Anthony J.; Bennett, Amanda J.; Ben-Shlomo, Yoav; Bergman, Richard N.; Bergmann, Sven; Biebermann, Heike; Blakemore, Alexandra I.F.; Boes, Tanja; Bonnycastle, Lori L.; Bornstein, Stefan R.; Brown, Morris J.; Buchanan, Thomas A.; Busonero, Fabio; Campbell, Harry; Cappuccio, Francesco P.; Cavalcanti-Proença, Christine; Chen, Yii-Der Ida; Chen, Chih-Mei; Chines, Peter S.; Clarke, Robert; Coin, Lachlan; Connell, John; Day, Ian N.M.; den Heijer, Martin; Duan, Jubao; Ebrahim, Shah; Elliott, Paul; Elosua, Roberto; Eiriksdottir, Gudny; Erdos, Michael R.; Eriksson, Johan G.; Facheris, Maurizio F.; Felix, Stephan B.; Fischer-Posovszky, Pamela; Folsom, Aaron R.; Friedrich, Nele; Freimer, Nelson B.; Fu, Mao; Gaget, Stefan; Gejman, Pablo V.; Geus, Eco J.C.; Gieger, Christian; Gjesing, Anette P.; Goel, Anuj; Goyette, Philippe; Grallert, Harald; Gräßler, Jürgen; Greenawalt, Danielle M.; Groves, Christopher J.; Gudnason, Vilmundur; Guiducci, Candace; Hartikainen, Anna-Liisa; Hassanali, Neelam; Hall, Alistair S.; Havulinna, Aki S.; Hayward, Caroline; Heath, Andrew C.; Hengstenberg, Christian; Hicks, Andrew A.; Hinney, Anke; Hofman, Albert; Homuth, Georg; Hui, Jennie; Igl, Wilmar; Iribarren, Carlos; Isomaa, Bo; Jacobs, Kevin B.; Jarick, Ivonne; Jewell, Elizabeth; John, Ulrich; Jørgensen, Torben; Jousilahti, Pekka; Jula, Antti; Kaakinen, Marika; Kajantie, Eero; Kaplan, Lee M.; Kathiresan, Sekar; Kettunen, Johannes; Kinnunen, Leena; Knowles, Joshua W.; Kolcic, Ivana; König, Inke R.; Koskinen, Seppo; Kovacs, Peter; Kuusisto, Johanna; Kraft, Peter; Kvaløy, Kirsti; Laitinen, Jaana; Lantieri, Olivier; Lanzani, Chiara; Launer, Lenore J.; Lecoeur, Cecile; Lehtimäki, Terho; Lettre, Guillaume; Liu, Jianjun; Lokki, Marja-Liisa; Lorentzon, Mattias; Luben, Robert N.; Ludwig, Barbara; Manunta, Paolo; Marek, Diana; Marre, Michel; Martin, Nicholas G.; McArdle, Wendy L.; McCarthy, Anne; McKnight, Barbara; Meitinger, Thomas; Melander, Olle; Meyre, David; Midthjell, Kristian; Montgomery, Grant W.; Morken, Mario A.; Morris, Andrew P.; Mulic, Rosanda; Ngwa, Julius S.; Nelis, Mari; Neville, Matt J.; Nyholt, Dale R.; O’Donnell, Christopher J.; O’Rahilly, Stephen; Ong, Ken K.; Oostra, Ben; Paré, Guillaume; Parker, Alex N.; Perola, Markus; Pichler, Irene; Pietiläinen, Kirsi H.; Platou, Carl G.P.; Polasek, Ozren; Pouta, Anneli; Rafelt, Suzanne; Raitakari, Olli; Rayner, Nigel W.; Ridderstråle, Martin; Rief, Winfried; Ruokonen, Aimo; Robertson, Neil R.; Rzehak, Peter; Salomaa, Veikko; Sanders, Alan R.; Sandhu, Manjinder S.; Sanna, Serena; Saramies, Jouko; Savolainen, Markku J.; Scherag, Susann; Schipf, Sabine; Schreiber, Stefan; Schunkert, Heribert; Silander, Kaisa; Sinisalo, Juha; Siscovick, David S.; Smit, Jan H.; Soranzo, Nicole; Sovio, Ulla; Stephens, Jonathan; Surakka, Ida; Swift, Amy J.; Tammesoo, Mari-Liis; Tardif, Jean-Claude; Teder-Laving, Maris; Teslovich, Tanya M.; Thompson, John R.; Thomson, Brian; Tönjes, Anke; Tuomi, Tiinamaija; van Meurs, Joyce B.J.; van Ommen, Gert-Jan; Vatin, Vincent; Viikari, Jorma; Visvikis-Siest, Sophie; Vitart, Veronique; Vogel, Carla I. G.; Voight, Benjamin F.; Waite, Lindsay L.; Wallaschofski, Henri; Walters, G. Bragi; Widen, Elisabeth; Wiegand, Susanna; Wild, Sarah H.; Willemsen, Gonneke; Witte, Daniel R.; Witteman, Jacqueline C.; Xu, Jianfeng; Zhang, Qunyuan; Zgaga, Lina; Ziegler, Andreas; Zitting, Paavo; Beilby, John P.; Farooqi, I. Sadaf; Hebebrand, Johannes; Huikuri, Heikki V.; James, Alan L.; Kähönen, Mika; Levinson, Douglas F.; Macciardi, Fabio; Nieminen, Markku S.; Ohlsson, Claes; Palmer, Lyle J.; Ridker, Paul M.; Stumvoll, Michael; Beckmann, Jacques S.; Boeing, Heiner; Boerwinkle, Eric; Boomsma, Dorret I.; Caulfield, Mark J.; Chanock, Stephen J.; Collins, Francis S.; Cupples, L. Adrienne; Smith, George Davey; Erdmann, Jeanette; Froguel, Philippe; Grönberg, Henrik; Gyllensten, Ulf; Hall, Per; Hansen, Torben; Harris, Tamara B.; Hattersley, Andrew T.; Hayes, Richard B.; Heinrich, Joachim; Hu, Frank B.; Hveem, Kristian; Illig, Thomas; Jarvelin, Marjo-Riitta; Kaprio, Jaakko; Karpe, Fredrik; Khaw, Kay-Tee; Kiemeney, Lambertus A.; Krude, Heiko; Laakso, Markku; Lawlor, Debbie A.; Metspalu, Andres; Munroe, Patricia B.; Ouwehand, Willem H.; Pedersen, Oluf; Penninx, Brenda W.; Peters, Annette; Pramstaller, Peter P.; Quertermous, Thomas; Reinehr, Thomas; Rissanen, Aila; Rudan, Igor; Samani, Nilesh J.; Schwarz, Peter E.H.; Shuldiner, Alan R.; Spector, Timothy D.; Tuomilehto, Jaakko; Uda, Manuela; Uitterlinden, André; Valle, Timo T.; Wabitsch, Martin; Waeber, Gérard; Wareham, Nicholas J.; Watkins, Hugh; Wilson, James F.; Wright, Alan F.; Zillikens, M. Carola; Chatterjee, Nilanjan; McCarroll, Steven A.; Purcell, Shaun; Schadt, Eric E.; Visscher, Peter M.; Assimes, Themistocles L.; Borecki, Ingrid B.; Deloukas, Panos; Fox, Caroline S.; Groop, Leif C.; Haritunians, Talin; Hunter, David J.; Kaplan, Robert C.; Mohlke, Karen L.; O’Connell, Jeffrey R.; Peltonen, Leena; Schlessinger, David; Strachan, David P.; van Duijn, Cornelia M.; Wichmann, H.-Erich; Frayling, Timothy M.; Thorsteinsdottir, Unnur; Abecasis, Gonçalo R.; Barroso, Inês; Boehnke, Michael; Stefansson, Kari; North, Kari E.; McCarthy, Mark I.; Hirschhorn, Joel N.; Ingelsson, Erik; Loos, Ruth J.F.

    2010-01-01

    Obesity is globally prevalent and highly heritable, but the underlying genetic factors remain largely elusive. To identify genetic loci for obesity-susceptibility, we examined associations between body mass index (BMI) and ~2.8 million SNPs in up to 123,865 individuals, with targeted follow-up of 42 SNPs in up to 125,931 additional individuals. We confirmed 14 known obesity-susceptibility loci and identified 18 new loci associated with BMI (P<5×10−8), one of which includes a copy number variant near GPRC5B. Some loci (MC4R, POMC, SH2B1, BDNF) map near key hypothalamic regulators of energy balance, and one is near GIPR, an incretin receptor. Furthermore, genes in other newly-associated loci may provide novel insights into human body weight regulation. PMID:20935630

  11. 7 CFR 249.10 - Coupon, market, and CSA program management.

    Science.gov (United States)

    2010-01-01

    ... than the price charged to other customers; (iv) Assure that the shareholder receives eligible foods... stands. (5) The State agency must limit the value of shares awarded to CSA programs to no more than 50... redeemed only for eligible foods; (iii) Provide eligible foods at or less than the price charged to...

  12. Preserved urethral plate urethroplasty for failed hypospadias repair: report of 249 cases

    Institute of Scientific and Technical Information of China (English)

    ZHANG Wei-ping; TIAN Jun; LI Ming-lei; SONG Hong-cheng; BAI Ji-wu; HUANG Cheng-ru; SUN Ning

    2008-01-01

    @@ Hypospadias is one of the most common abnormalities of the external male genitalia but is very difficult to repair. Hypospadias reoperation is also a common practice for pediatric urologists, though repair of hypospadias at reoperation is much more difficult.

  13. Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index

    NARCIS (Netherlands)

    E.K. Speliotes (Elizabeth); C.J. Willer (Cristen); S.I. Berndt (Sonja); K.L. Monda (Keri); G. Thorleifsson (Gudmar); A.U. Jackson (Anne); H.L. Allen; C.M. Lindgren (Cecilia); J. Luan; R. Mägi (Reedik); J.C. Randall (Joshua); S. Vedantam (Sailaja); T.W. Winkler (Thomas); L. Qi (Lu); T. Workalemahu (Tsegaselassie); I.M. Heid (Iris); V. Steinthorsdottir (Valgerdur); H.M. Stringham (Heather); E. Wheeler (Eleanor); A.R. Wood (Andrew); T. Ferreira (Teresa); R.J. Weyant (Robert); A.V. Segrè (Ayellet); K. Eestrada (Karol); L. Liang (Liming); J. Nemesh (James); J.H. Park; S. Gustafsson (Stefan); T.O. Kilpeläinen (Tuomas); J. Yang (Joanna); N. Bouatia-Naji (Nabila); T. Eesko (Tõnu); M.F. Feitosa (Mary Furlan); Z. Kutalik (Zoltán); M. Mangino (Massimo); S. Raychaudhuri (Soumya); A. Scherag (Andre); A.V. Smith (Albert Vernon); R.P. Welch (Ryan); J.H. Zhao; K.K.H. Aben (Katja); D. Absher (Devin); N. Amin (Najaf); A.L. Dixon (Anna); E. Fisher (Eeva); N.L. Glazer (Nicole); M.E. Goddard (Michael); N.L. Heard-Costa (Nancy); V. Hoesel (Volker); J.J. Hottenga (Jouke Jan); A. Johansson (Åsa); T. Johnson (Toby); S. Ketkar (Shamika); C. Lamina (Claudia); S. Li (Shengxu); M.F. Moffatt (Miriam); R.H. Myers (Richard); N. Narisu (Narisu); J.R.B. Perry (John); M.J. Peters (Marjolein); M. Preuss (Michael); S. Ripatti (Samuli); F. Rivadeneira Ramirez (Fernando); C. Sandholt (Camilla); L.J. Scott (Laura); N. Timpson (Nicholas); J.P. Tyrer (Jonathan); S. van Wingerden (Sophie); C.C. White (Charles); F. Wiklund (Fredrik); C. Barlassina (Christina); D.I. Chasman (Daniel); M.N. Cooper (Matthew); J.O. Jansson; R.W. Lawrence (Robert); N. Pellikka (Niina); I. Prokopenko (Inga); J. Shi (Jianxin); E. Thiering (Eelisabeth); H. Alavere (Helene); M.T.S. Alibrandi (Maria); P. Almgren (Peter); A.M. Arnold (Alice); T. Aspelund (Thor); L.D. Atwood (Larry); B. Balkau (Beverley); A.J. Balmforth (Anthony); A.J. Bennett (Amanda); Y. Ben-Shlomo; R.N. Bergman (Richard); S.M. Bergmann (Sven); H. Biebermann (Heike); A.I.F. Blakemore (Alexandra); T. Boes (Tanja); L.L. Bonnycastle (Lori); S.R. Bornstein (Stefan); M.J. Brown (Morris); T.A. Buchanan (Thomas); F. Busonero; H. Campbell (Harry); F.P. Cappuccio (Francesco); C. Cavalcanti-Proença (Christine); Y.D.I. Chen (Yii-Der Ida); C.-M. Chen (Chih-Mei); P.S. Chines (Peter); R. Clarke; L. Coin (Lachlan); J. Connell (John); I.N.M. Day (Ian); M. den Heijer (Martin); J. Duan (Jubao); S. Eebrahim (Shah); P. Eelliott (Paul); R. Eelosua (Roberto); G. Eeiriksdottir (Gudny); M.R. Eerdos (Micheal); J.G. Eeriksson (Johan); M.F. Facheris (Maurizio); S.B. Felix (Stephan); P. Fischer-Posovszky (Pamela); A.R. Folsom (Aaron); N. Friedrich (Nele); N.B. Freimer (Nelson); M. Fu (Mao); S. Gaget (Stefan); P.V. Gejman (Pablo); E.J. Geus (Eeco); C. Gieger (Christian); A.P. Gjesing (Anette); A. Goel (Anuj); P. Goyette (Philippe); H. Grallert (Harald); J. Gräßler (Jürgen); D. Greenawalt (Danielle); C.J. Groves (Christopher); V. Gudnason (Vilmundur); C. Guiducci (Candace); A.L. Hartikainen; N. Hassanali (Neelam); A.S. Hall (Alistair); A.S. Havulinna (Aki); C. Hayward (Caroline); A.C. Heath (Andrew); C. Hengstenberg (Christian); A.A. Hicks (Andrew); A. Hinney (Anke); A. Hofman (Albert); G. Homuth (Georg); J. Hui (Jennie); W. Igl (Wilmar); C. Iribarren (Carlos); B. Isomaa (Bo); K.B. Jacobs (Kevin); I. Jarick (Ivonne); E. Jewell (Eelizabeth); U. John (Ulrich); T. Jørgensen (Torben); P. Jousilahti (Pekka); A. Jula (Antti); M. Kaakinen (Marika); E. Kajantie (Eero); R.C. Kaplan (Robert); S. Kathiresan (Sekar); J. Kettunen (Johannes); L. Kinnunen (Leena); J.W. Knowles (Joshua); I. Kolcic (Ivana); I.R. König (Inke); S. Koskinen (Seppo); P. Kovacs (Peter); J. Kusisto (Johanna); P. Kraft (Peter); K. Kvaløy (Kirsti); J. Laitinen (Jaana); O. Lantieri (Olivier); C. Lanzani (Chiara); L.J. Launer (Lenore); C. Lecoeur (Cécile); T. Lehtimäki (Terho); G. Lettre (Guillaume); J. Liu (Jianjun); M.L. Lokki; M. Lorentzon (Mattias); R.N. Luben (Robert); B. Ludwig (Barbara); P. Manunta (Paolo); D. Marek (Diana); M. Marre (Michel); N.G. Martin (Nicholas); W.L. McArdle (Wendy); M.I. McCarthy (Mark); B. McKnight (Barbara); T. Meitinger (Thomas); O. Melander (Olle); D. Meyre (David); K. Midthjell (Kristian); G.W. Montgomery (Grant); M.A. Morken (Mario); A.D. Morris (Andrew); R. Mulic (Rosanda); J.S. Ngwa; M. Nelis (Mari); M.J. Neville (Matthew); D.R. Nyholt (Dale); C.J. O'Ddonnell (Christopher); S. O'Rahilly (Stephen); K. Ong (Ken); B.A. Oostra (Ben); G. Paré (Guillaume); A.N. Parker (Alex); M. Perola (Markus); I. Pichler (Irene); K.H. Pietilainen (Kirsi Hannele); C.P. Platou (Carl); O. Polasek (Ozren); A. Pouta (Anneli); S. Rafelt (Suzanne); O. Raitakari (Olli); N.W. Rayner (Nigel William); M. Ridderstråle (Martin); W. Rief (Winfried); A. Ruokonen (Aimo); N.R. Robertson (Neil); P. Rzehak (Peter); V. Salomaa (Veikko); A.R. Sanders (Alan); M.S. Sandhu (Manjinder); S. Sanna (Serena); J. Saramies (Jouko); M.J. Savolainen (Markku); S. Schipf (Sabine); S. Schreiber (Stefan); H. Schunkert (Heribert); K. Silander (Kaisa); J. Sinisalo (Juha); D.S. Siscovick (David); J.H. Smit (Jan); N. Soranzo (Nicole); U. Sovio (Ulla); J. Stephens (Jonathan); I. Surakka (Ida); A.J. Swift (Amy); M.L. Tammesoo; J.-C. Tardif (Jean-Claude); M. Teder-Laving (Maris); T.M. Teslovich (Tanya); J.R. Thompson (John); B. Thomson (Brian); A. Tönjes (Anke); T. Tuomi (Tiinamaija); J.B.J. van Meurs (Joyce); G.J. van OMen; V. Vatin (Vincent); J. Viikari (Jorma); S. Visvikis-Siest (Sophie); V. Vitart (Veronique); C.I. Vogel (Carla); B.F. Voight (Benjamin); L. Waite (Lindsay); H. Wallaschofski (Henri); G.B. Walters (Bragi); E. Widen (Elisabeth); S. Wiegand (Susanna); S.H. Wild (Sarah); G.A.H.M. Willemsen (Gonneke); D.R. Witte (Deniel); J.C.M. Witteman (Jacqueline); J. Xu (Jianfeng); Q. Zhang (Qunyuan); L. Zgaga (Lina); A. Ziegler (Andreas); P. Zitting (Paavo); J.P. Beilby (John); I.S. FarOqi (Ssadaf); J. Hebebrand (Johannes); H.V. Huikuri (Heikki); A. James (Alan); M. Kähönen (Mika); D.F. Levinson (Douglas); F. MacCiardi (Fabio); M.S. Nieminen (Markku); C. Ohlsson (Claes); C. Palmer (Cameron); P.M. Ridker (Paul); M. Stumvoll (Michael); J.S. Beckmann (Jacques); H. Boeing (Heiner); E. Boerwinkle (Eric); D.I. Boomsma (Dorret); M. Caulfield (Mark); S.J. Chanock (Stephen); F.S. Collins (Francis); L.A. Cupples (Adrienne); J. Eerdmann (Jeanette); P. Frogue (Philippe); H. Grönberg (Henrik); U. Gyllensten (Ulf); T. Hansen (Torben); T.B. Harris (Tamara); A.T. Hattersley (Andrew); R.B. Hayes (Richard); J. Heinrich (Joachim); F.B. Hu (Frank); K. Hveem (Kristian); T. Illig (Thomas); M.R. Järvelin; J. Kaprio (Jaakko); F. Karpe (Fredrik); K-T. Khaw (Kay-Tee); L.A.L.M. Kiemeney (Bart); H. Krude; M. Laakso (Markku); D.A. Lawlor (Debbie); A. Metspalu (Andres); P. Munroe (Patricia); W.H. Ouwehand (Willem); O. Pedersen (Oluf); B.W.J.H. Penninx (Brenda); P.P. Pramstaller (Peter Paul); T. Quertermous (Thomas); T. Reinehr (Thomas); A. Rissanen (Aila); I. Rudan (Igor); N.J. Samani (Nilesh); P.E.H. Schwarz (Peter); A.R. Shuldiner (Alan); T.D. Spector (Timothy); J. Tuomilehto (Jaakko); M. Uda (Manuela); A.G. Uitterlinden (André); T.T. Valle (Timo); M. Wabitsch (Martin); G. Waeber (Gérard); N.J. Wareham (Nick); H. Watkins (Hugh); J.F. Wilson (James); A.F. Wright (Alan); M.C. Zillikens (Carola); N. ChatterjE (Nilanjan); S.A. McCarroll (Steve); S. Purcell (Shaun); E.E. Schadt (Eric); P.M. Visscher (Peter); T.L. Assimes (Themistocles); I.B. Borecki (Ingrid); P. Deloukas (Panagiotis); C.S. Fox (Caroline); L. Groop (Leif); T. Haritunians (Talin); D.J. Hunter (David); K.L. Mohlke (Karen); J.R. O'ConneL (Jeffrey); L. Peltonen (Leena Johanna); D. SchleSinger (David); D.P. Strachan (David); R.M. Watanabe (Richard); C.M. van Duijn (Cock); H.E. Wichmann (Heinz Erich); T.M. Frayling (Timothy); U. Thorsteinsdottir (Unnur); G.R. Abecasis (Gonçalo); M. Boehnke (Michael); K. StefanSon (Kari); K.E. North (Kari); M.I. McArthy (Mark); J.N. Hirschhorn (Joel); E. IngelSon (Erik); R.J.F. Loos (Ruth); M.N. Weedon (Michael)

    2010-01-01

    textabstractObesity is globaLy prevalent and highly heritable, but its underlying genetic factors remain largely elusive. To identify genetic loci for obesity susceptibility, we examined aSociations betwEn body maS index and ĝ̂1/42.8 miLion SNPs in up to 123,865 individuals with targeted foLow up of

  14. Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index

    DEFF Research Database (Denmark)

    Speliotes, Elizabeth K; Willer, Cristen J; Berndt, Sonja I;

    2010-01-01

    in up to 125,931 additional individuals. We confirmed 14 known obesity susceptibility loci and identified 18 new loci associated with body mass index (P R, POMC, SH2B1 and BDNF) map near key hypothalamic regulators...

  15. Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index

    NARCIS (Netherlands)

    Speliotes, Elizabeth K.; Willer, Cristen J.; Berndt, Sonja I.; Monda, Keri L.; Thorleifsson, Gudmar; Jackson, Anne U.; Allen, Hana Lango; Lindgren, Cecilia M.; Luan, Jian'an; Maegi, Reedik; Randall, Joshua C.; Vedantam, Sailaja; Winkler, Thomas W.; Qi, Lu; Workalemahu, Tsegaselassie; Heid, Iris M.; Steinthorsdottir, Valgerdur; Stringham, Heather M.; Weedon, Michael N.; Wheeler, Eleanor; Wood, Andrew R.; Ferreira, Teresa; Weyant, Robert J.; Segre, Ayellet V.; Estrada, Karol; Liang, Liming; Nemesh, James; Park, Ju-Hyun; Gustafsson, Stefan; Kilpelaenen, Tuomas O.; Yang, Jian; Bouatia-Naji, Nabila; Esko, Tonu; Feitosa, Mary F.; Kutalik, Zoltan; Mangino, Massimo; Raychaudhuri, Soumya; Scherag, Andre; Smith, Albert Vernon; Welch, Ryan; Zhao, Jing Hua; Aben, Katja K.; Absher, Devin M.; Amin, Najaf; Dixon, Anna L.; Fisher, Eva; Glazer, Nicole L.; Goddard, Michael E.; Heard-Costa, Nancy L.; Hoesel, Volker; Hottenga, Jouke-Jan; Johansson, Asa; Johnson, Toby; Ketkar, Shamika; Lamina, Claudia; Li, Shengxu; Moffatt, Miriam F.; Myers, Richard H.; Narisu, Narisu; Perry, John R. B.; Peters, Marjolein J.; Preuss, Michael; Ripatti, Samuli; Rivadeneira, Fernando; Sandholt, Camilla; Scott, Laura J.; Timpson, Nicholas J.; Tyrer, Jonathan P.; van Wingerden, Sophie; Watanabe, Richard M.; White, Charles C.; Wiklund, Fredrik; Barlassina, Christina; Chasman, Daniel I.; Cooper, Matthew N.; Jansson, John-Olov; Lawrence, Robert W.; Pellikka, Niina; Prokopenko, Inga; Shi, Jianxin; Thiering, Elisabeth; Alavere, Helene; Alibrandi, Maria T. S.; Almgren, Peter; Arnold, Alice M.; Aspelund, Thor; Atwood, Larry D.; Balkau, Beverley; Balmforth, Anthony J.; Bennett, Amanda J.; Ben-Shlomo, Yoav; Bergman, Richard N.; Bergmann, Sven; Biebermann, Heike; Blakemore, Alexandra I. F.; Boes, Tanja; Bonnycastle, Lori L.; Bornstein, Stefan R.; Brown, Morris J.; Buchanan, Thomas A.; Busonero, Fabio; Campbell, Harry; Cappuccio, Francesco P.; Cavalcanti-Proenca, Christine; Chen, Yii-Der Ida; Chen, Chih-Mei; Chines, Peter S.; Clarke, Robert; Coin, Lachlan; Connell, John; Day, Ian N. M.; den Heijer, Martin; Duan, Jubao; Ebrahim, Shah; Elliott, Paul; Elosua, Roberto; Eiriksdottir, Gudny; Erdos, Michael R.; Eriksson, Johan G.; Facheris, Maurizio F.; Felix, Stephan B.; Fischer-Posovszky, Pamela; Folsom, Aaron R.; Friedrich, Nele; Freimer, Nelson B.; Fu, Mao; Gaget, Stefan; Gejman, Pablo V.; Geus, Eco J. C.; Gieger, Christian; Gjesing, Anette P.; Goel, Anuj; Goyette, Philippe; Grallert, Harald; Graessler, Juergen; Greenawalt, Danielle M.; Groves, Christopher J.; Gudnason, Vilmundur; Guiducci, Candace; Hartikainen, Anna-Liisa; Hassanali, Neelam; Hall, Alistair S.; Havulinna, Aki S.; Hayward, Caroline; Heath, Andrew C.; Hengstenberg, Christian; Hicks, Andrew A.; Hinney, Anke; Hofman, Albert; Homuth, Georg; Hui, Jennie; Igl, Wilmar; Iribarren, Carlos; Isomaa, Bo; Jacobs, Kevin B.; Jarick, Ivonne; Jewell, Elizabeth; John, Ulrich; Jorgensen, Torben; Jousilahti, Pekka; Jula, Antti; Kaakinen, Marika; Kajantie, Eero; Kaplan, Lee M.; Kathiresan, Sekar; Kettunen, Johannes; Kinnunen, Leena; Knowles, Joshua W.; Kolcic, Ivana; Koenig, Inke R.; Koskinen, Seppo; Kovacs, Peter; Kuusisto, Johanna; Kraft, Peter; Kvaloy, Kirsti; Laitinen, Jaana; Lantieri, Olivier; Lanzani, Chiara; Launer, Lenore J.; Lecoeur, Cecile; Lehtimaeki, Terho; Lettre, Guillaume; Liu, Jianjun; Lokki, Marja-Liisa; Lorentzon, Mattias; Luben, Robert N.; Ludwig, Barbara; Manunta, Paolo; Marek, Diana; Marre, Michel; Martin, Nicholas G.; McArdle, Wendy L.; McCarthy, Anne; McKnight, Barbara; Meitinger, Thomas; Melander, Olle; Meyre, David; Midthjell, Kristian; Montgomery, Grant W.; Morken, Mario A.; Morris, Andrew P.; Mulic, Rosanda; Ngwa, Julius S.; Nelis, Mari; Neville, Matt J.; Nyholt, Dale R.; O'Donnell, Christopher J.; O'Rahilly, Stephen; Ong, Ken K.; Oostra, Ben; Pare, Guillaume; Parker, Alex N.; Perola, Markus; Pichler, Irene; Pietilaeinen, Kirsi H.; Platou, Carl G. P.; Polasek, Ozren; Pouta, Anneli; Rafelt, Suzanne; Raitakari, Olli; Rayner, Nigel W.; Ridderstrale, Martin; Rief, Winfried; Ruokonen, Aimo; Robertson, Neil R.; Rzehak, Peter; Salomaa, Veikko; Sanders, Alan R.; Sandhu, Manjinder S.; Sanna, Serena; Saramies, Jouko; Savolainen, Markku J.; Scherag, Susann; Schipf, Sabine; Schreiber, Stefan; Schunkert, Heribert; Silander, Kaisa; Sinisalo, Juha; Siscovick, David S.; Smit, Jan H.; Soranzo, Nicole; Sovio, Ulla; Stephens, Jonathan; Surakka, Ida; Swift, Amy J.; Tammesoo, Mari-Liis; Tardif, Jean-Claude; Teder-Laving, Maris; Teslovich, Tanya M.; Thompson, John R.; Thomson, Brian; Toenjes, Anke; Tuomi, Tiinamaija; van Meurs, Joyce B. J.; van Ommen, Gert-Jan; Vatin, Vincent; Viikari, Jorma; Visvikis-Siest, Sophie; Vitart, Veronique; Vogel, Carla I. G.; Voight, Benjamin F.; Waite, Lindsay L.; Wallaschofski, Henri; Walters, G. Bragi; Widen, Elisabeth; Wiegand, Susanna; Wild, Sarah H.; Willemsen, Gonneke; Witte, Daniel R.; Witteman, Jacqueline C.; Xu, Jianfeng; Zhang, Qunyuan; Zgaga, Lina; Ziegler, Andreas; Zitting, Paavo; Beilby, John P.; Farooqi, I. Sadaf; Hebebrand, Johannes; Huikuri, Heikki V.; James, Alan L.; Kaehoenen, Mika; Levinson, Douglas F.; Macciardi, Fabio; Nieminen, Markku S.; Ohlsson, Claes; Palmer, Lyle J.; Ridker, Paul M.; Stumvoll, Michael; Beckmann, Jacques S.; Boeing, Heiner; Boerwinkle, Eric; Boomsma, Dorret I.; Caulfield, Mark J.; Chanock, Stephen J.; Collins, Francis S.; Cupples, L. Adrienne; Smith, George Davey; Erdmann, Jeanette; Froguel, Philippe; Greonberg, Henrik; Gyllensten, Ulf; Hall, Per; Hansen, Torben; Harris, Tamara B.; Hattersley, Andrew T.; Hayes, Richard B.; Heinrich, Joachim; Hu, Frank B.; Hveem, Kristian; Illig, Thomas; Jarvelin, Marjo-Riitta; Kaprio, Jaakko; Karpe, Fredrik; Khaw, Kay-Tee; Kiemeney, Lambertus A.; Krude, Heiko; Laakso, Markku; Lawlor, Debbie A.; Metspalu, Andres; Munroe, Patricia B.; Ouwehand, Willem H.; Pedersen, Oluf; Penninx, Brenda W.; Peters, Annette; Pramstaller, Peter P.; Quertermous, Thomas; Reinehr, Thomas; Rissanen, Aila; Rudan, Igor; Samani, Nilesh J.; Schwarz, Peter E. H.; Shuldiner, Alan R.; Spector, Timothy D.; Tuomilehto, Jaakko; Uda, Manuela; Uitterlinden, Andre; Valle, Timo T.; Wabitsch, Martin; Waeber, Gerard; Wareham, Nicholas J.; Watkins, Hugh; Wilson, James F.; Wright, Alan F.; Zillikens, M. Carola; Chatterjee, Nilanjan; McCarroll, Steven A.; Purcell, Shaun; Schadt, Eric E.; Visscher, Peter M.; Assimes, Themistocles L.; Borecki, Ingrid B.; Deloukas, Panos; Fox, Caroline S.; Groop, Leif C.; Haritunians, Talin; Hunter, David J.; Kaplan, Robert C.; Mohlke, Karen L.; O'Connell, Jeffrey R.; Peltonen, Leena; Schlessinger, David; Strachan, David P.; van Duijn, Cornelia M.; Wichmann, H-Erich; Frayling, Timothy M.; Thorsteinsdottir, Unnur; Abecasis, Goncalo R.; Barroso, Ines; Boehnke, Michael; Stefansson, Kari; North, Kari E.; McCarthy, Mark I.; Hirschhorn, Joel N.; Ingelsson, Erik; Loos, Ruth J. F.

    2010-01-01

    Obesity is globally prevalent and highly heritable, but its underlying genetic factors remain largely elusive. To identify genetic loci for obesity susceptibility, we examined associations between body mass index and similar to 2.8 million SNPs in up to 123,865 individuals with targeted follow up of

  16. Foreign Investment in the U.S.: Costs and Benefits. Headline Series 249.

    Science.gov (United States)

    Zupnick, Elliot

    The document discusses the implications and positive and negative aspects of foreign direct investment in the United States. The objective is to determine whether a restrictive U.S. policy as it relates to foreign direct investment in the United States is desirable. It is presented in five chapters. Chapter I defines foreign direct investment…

  17. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248Cm with 18O, 86Kr and 136Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48Ca and 238U bombardments of 248Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136Xe and 238U the new species 248Am, 249Am and 247Pu should be produced with large cross sections from a 248Cm target. A preliminary, unsuccessful attempt to isolate 247Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251Bk decay, necessary for calculating the 251Bk cross section, are also determined

  18. 249株流感嗜血杆菌的分离与耐药性分析%Analysis on Isolation and Antibiotic Resistance of 249 Strains of Haemophilus influenzae

    Institute of Scientific and Technical Information of China (English)

    曹敏晖; 曹友德; 李浩; 蔡瑞云

    2011-01-01

    目的 了解流感嗜血杆菌(Hi)的检出状况与耐药情况,指导临床合理用药.方法 统计分析2007-2010年我院Hi的分离与耐药情况.结果 在1052份痰及咽拭子标本中分离出Hi 210株,在242份胆汁标本中分离出Hi 16株,在203份胸腹水标本中分离出Hi 12株,在163份眼、耳拭子标本中分离出Hi 11株.体外药敏结果显示Hi对复方磺胺甲恶哇耐药性最高为63.5%,氨苄西林次之为46.2%,而对阿莫西林/棒酸、利福平、头孢呋辛、头孢噻肟、亚氨培南敏感,耐药率≤2.0%.结论 Hi在呼吸道标本中的检出率最高,眼、耳拭子标本中次之,在胆汁、胸腹水中亦有检出.建议眼、耳拭子及胆汁、胸腹水标本作细菌培养时也应同时接种哥伦比亚血平板(COS)、淋球菌选择性平板(VCA)及嗜血杆菌选择性平板(HAE),Hi感染的治疗应首选复方阿莫西林、头孢二代或三代类抗生素.%Objective To investigate the isolation rate and antibiotic resistance rate of Haemophilus influenzae, and to guide the rational use of antibiotic therapy in clinical practice. Methods The data about the isolation rate and antibiotic resistance rate of Haemophilus influenzae from 2007 to 2010 were analyzed with SPSS11.0 statistical software. Results Totally 210 strains of Haemophilus influenzae were isolated from 1,052 specimens of sputum and pharyngeal secretion, 16 strains isolated from 242 bile specimens, 12 strains isolated from 203 hydrothoraxs specimens, and 11 strains isolated from 163 specimens of eye or ear secretion. In vitro drug- sensitivity test showed that the resistance rate of Haemophilus influenzae to trimethoprime sulfanomicles was the highest (63.5%), followed by ampicillin (46.2%). But the resistance rates to amoxicillin/clavalanic acid, rifampicine, cefuroxime, cefotaxime and imipenem were very low (≤2.0%). Conclusions Heamophilus influenzae could be isolated from the secretions of respiratory track, eye, ear, bile, and hydrothoraxs. It is necessary that using COS, VCA f- lat, and HAE while performing bacterial culture of the secretions of eye, ear, bile, and hydrothoraxs. The therapy of Heamophilus influenzae infection should choose the antibiotics, such as amoxicillin/ clavalanic acid, cefuroxime and cefotaxime.

  19. The House of Commons of Canada, Bill C-249: An act to amend the nuclear liability act

    International Nuclear Information System (INIS)

    The purpose of this bill is to increase the maximum level of liability for which a private sector nuclear facility operator may be required to have insurance coverage from 75 million dollars to 500 million dollars. If the Governor in Council is of the opinion that liability could exceed the insured amount and a Commission created under Part II of the Act orders that further compensation should be made. At present, the Crown may make such payments but is not required to do so

  20. Photo-induced effects of the virgin Ge24.9Sb11.6S63.5 film

    Czech Academy of Sciences Publication Activity Database

    Knotek, P.; Tichý, Ladislav; Kutálek, P.

    594 Part A, Nov 2 (2015), s. 67-73. ISSN 0040-6090 Institutional support: RVO:61389013 Keywords : chalcogenides * thin film * photo induced effects Subject RIV: CA - Inorganic Chemistry Impact factor: 1.759, year: 2014 http://www.sciencedirect.com/science/article/pii/S0040609015009372

  1. Are taxonomists required to bend to the will of bioinformatics? A response to Johnson (Skaphion 2:49)

    Science.gov (United States)

    Author names on the end of a species epithet are essential to stable taxonomy. These names are absolutely required in the case of homonymy, but they are also useful for obtaining original descriptions, locating type depositories, and determining the quality of a species concept. In this paper I ar...

  2. SU-E-J-249: Correlation of Mean Lung Ventilation Value with Ratio of Total Lung Volumes

    Energy Technology Data Exchange (ETDEWEB)

    Yu, N; Qu, H; Xia, P [Cleveland Clinic, Cleveland, OH (United States)

    2014-06-01

    Purpose: Lung ventilation function measured from 4D-CT and from breathing correlated CT images is a novel concept to incorporate the lung physiologic function into treatment planning of radiotherapy. The calculated ventilation functions may vary from different breathing patterns, affecting evaluation of the treatment plans. The purpose of this study is to correlate the mean lung ventilation value with the ratio of the total lung volumes obtained from the relevant CTs. Methods: A ventilation map was calculated from the variations of voxel-to-voxel CT densities from two breathing phases from either 4D-CT or breathing correlated CTs. An open source image registration tool of Plastimatch was used to deform the inhale phase images to the exhale phase images. To calculate the ventilation map inside lung, the whole lung was delineated and the tissue outside the lung was masked out. With a software tool developed in house, the 3D ventilation map was then converted in the DICOM format associated with the planning CT images. The ventilation map was analyzed on a clinical workstation. To correlate ventilation map thus calculated with lung volume change, the total lung volume change was compared the mean ventilation from our method. Results: Twenty two patients who underwent stereotactic body irradiation for lung cancer was selected for this retrospective study. For this group of patients, the ratio of lung volumes for the inhale (Vin ) and exhale phase (Vex ) was shown to be linearly related to the mean of the local ventilation (Vent), Vin/Vex=1.+0.49*Vent (R2=0.93, p<0.01). Conclusion: The total lung volume change is highly correlated with the mean of local ventilation. The mean of local ventilation may be useful to assess the patient's lung capacity.

  3. List of research reports with reportnumbers from RCN-1 to RCN-249 published by RCN between 1960 and 1976

    International Nuclear Information System (INIS)

    The Stichting Reactor Centrum Nederland (RCN) was founded on 6 July 1955.On 20 July 1976, the name was changed to Netherlands Energy Research Foundation ECN. Before, research reports were published with the reportcode RCN-. After, a new series of reports was started commencing with reportnumber ECN-1. This list constitutes all research reports with reportcode RCN- published between 1960 and 1976. In addition to the compilation of bibliographic descriptions, an author list and a KWOC list on all significant words in the report titles have been given

  4. SU-E-T-249: Neutron Model Upgrade for Radiotherapy Patients Monitoring Using a New Online Detector

    Energy Technology Data Exchange (ETDEWEB)

    Irazola, L; Sanchez Doblado, F. [Departamento de Fisiologia Medica y Biofisica, Universidad de Sevilla (Spain); Servicio de Radiofisica, Hospital Universitario Virgen Macarena, Sevilla (Spain); Lorenzoli, M; Pola, A. [Politecnico di Milano, Departimento di Ingegneria Nuclear, Milano (Italy); Terron, J.A. [Servicio de Radiofisica, Hospital Universitario Virgen Macarena, Sevilla (Spain); Bedogni, R. [Laboratori Nazionali di Frascati, Istituto Nazionale di Fisica Nucleare (INFN) (Italy); Sanchez Nieto, B. [Instituto de Fisica, Pontificia Universidad Catolica de Chile, Santiago (Chile); Romero-Exposito, M. [Departamento de Fisica, Universitat Autonoma de Barcelona (Spain)

    2014-06-01

    Purpose: The purpose of this work is to improve the existing methodology to estimate neutron equivalent dose in organs during radiotherapy treatments, based on a Static Random Access Memory neutron detector (SRAMnd) [1]. This is possible thanks to the introduction of a new digital detector with improved characteristics, which is able to measure online the neutron fluence rate in the presence of an intense photon background [2]. Its reduced size, allows the direct estimation of doses in specific points inside an anthropomorphic phantom (NORMA) without using passive detectors as TLD or CR-39. This versatility will allow not only to improve the existing models (generic abdomen and H and N [1]) but to generate more specific ones for any technique. Methods: The new Thermal Neutron Rate Detector (TNRD), based on a diode device sensitized to thermal neutrons, have been inserted in 16 points of the phantom. These points are distributed to infer doses to specific organs. Simultaneous measurements of these devices and a reference one, located in front of the gantry, have been performed for the mentioned generic treatments, in order to improve the existing model. Results: These new devices have shown more precise since they agree better with Monte Carlo simulations. The comparison of the thermal neutron fluence, measured with TNRD, and the existing models, converted from events to fluence, shows an average improvement of (3.90±3.37) % for H and N and (12.61±9.43) % for abdomen, normalized to the maximum value. Conclusion: This work indicates the potential of these new devices for more precise neutron equivalent dose estimation in organs, as a consequence of radiotherapy treatments. The simplicity of the process makes possible to establish more specific models that will provide a better dose estimation. References[1] Phys Med Biol 2012; 57:6167–6191.[2] A new active thermal neutron detector. Radiat. Prot. Dosim. (in press)

  5. Evidence for association of D1S249 locus on human chromosome 1 with the susceptibility to essential hypertension in Han Chinese

    Institute of Scientific and Technical Information of China (English)

    ZHENG; Yong; (

    2001-01-01

    [1]Jeunemaitre, X., Soubrier, F., Kotelevtsev, Y. V. et al., Molecular basis of hypertension: role of angiotensinogen, Cell, 1993, 71: 169.[2]Hingorani, A. D., Sharma, P., Jia, H. et al., Blood pressure and M235T polymorphism of the angiotensinogen gene, Hypertension, 1996, 28: 907.[3]Liu, Y., Zhou, W. Y., Qiu, C. C. et al., Association analysis of polymorphisms of ACE gene and AGT gene with essential hypertension in Chinese Han's population, Chin. Med. Sci. J., 1998, 13(2): 71.[4]Davies, E., Bonnar, D. A., Lathrop, G. M. et al., Human angiotensin II type I receptor locus, CA repeat polymorphism and genetic mapping, Hum. Mol. Genet., 1994, 3: 838.[5]Kainulainen, K., Perola, M., Terwilliger, J. et al., Evidence for involvement of the type I angiotensin II receptor locus in essential hypertension, Hypertension, 1999, 33: 844.[6]Wang, W. Y. S., Zee, R. Y. L., Morris, B. J. et al., Association of angiotensin II type I receptor gene polymorphism with essential hypertension, Clin. Genet., 1997, 51: 31.[7]Mastana, S., Nunn, J., Angiotensin-converting enzyme deletion polymorphism is associated with hypertension in a sikh population, Human Hered., 1997, 47: 250.[8]Poirier, O., Georges, J. L., Ricard, S. et al., New polymorphisms of the angiotensin II type I receptor gene and their associations with myocardial infarction and blood pressure: the ECTIM study, J. of Hypertension, 1998, 16: 1443.[9]Liu, Y., Qiu, C. C., Zhou, W. Y. et al., Gene polymorphisms of the renin-angiotensin system in essential hypertension, Chinese Medical Journal, 1999, 112(2): 115.[10] Todd, J. A., Genetic analysis of type I diabetes using whole genome approaches, Proc. Natl. Acad. Sci. USA, 1995, 92: 8560.[11] Hanis, C. L., Boerwinkle, E., Chakraborty, R. et al., A genome-wide search for human non-insulin-dependent (type II) diabetes genes reveals a major susceptibility locus on chromosome 2, Nature Genetics, 1996, 13: 161.[12] Hager, J., Dina, C., Franke, S. et al., A genome-wide scan for human obesity genes reveals a major susceptibility locus on chromosome 10, Nature Genetics, 1998, 20: 304.[13] Schuster, H., Wienker, T. F., Bahring, S. et al., Severe autosomal dominant hypertension and brachydactyly in a unique Turkish Kindred maps to human chromosome 12, Nature Genetics, 1996, 13: 98.[14] Baima, J., Nicolaou, M., Schwartz, F. et al., Evidence for linkage between essential hypertension and a putative locus on human chromosome 17, Hypertension, 1999, 34: 4.[15] Wright, F. A., O'connor, D. T., Roberts, E. et al., Genome scan for blood pressure loci in mice, Hypertension, 1999, 34: 625.[16] Cox, N. J., Baker, L., Spielman, R. S., Insulin-gene sharing in sib pairs with insulin dependent diabetes mellitus: no evidence for linkage, Am. J. Hum. Genet., 1988, 42: 167.[17] Bonnardeaux, A., Davies, E., Jeunemaitre, X. et al., Angiotensin II type I receptor gene polymorphisms in human essential hypertension, Hypertension, 1994, 24: 63.

  6. 17 CFR 249.822 - Form 19b-7, for electronic filing with respect to proposed rule changes by self-regulatory...

    Science.gov (United States)

    2010-04-01

    ... filing with respect to proposed rule changes by self-regulatory organizations under Section 19(b)(7)(A... SECURITIES AND EXCHANGE COMMISSION (CONTINUED) FORMS, SECURITIES EXCHANGE ACT OF 1934 Forms for Self... proposed rule changes by self-regulatory organizations under Section 19(b)(7)(A) of the Securities...

  7. Measurement of the total cross section difference ΔσL in np transmission at 1.19, 2.49 and 3.65 GeV

    International Nuclear Information System (INIS)

    Results of the total cross section difference ΔσL in a np transmission experiment are presented. Results were obtained with a polarized beam of free quasi-monochromatic neutrons passing through the new Dubna frozen spin proton target. The beam and target polarizations were oriented longitudinally. The new results are compared with ΔσL(pn) data determined as a difference between ΔσL(pd) and ΔσL(pp) ANL-ZGS measurements. The values of ΔσL for the isospin state I=0 were deduced using known pp data. (author)

  8. 17 CFR 249.820 - Form 19b-4(e) for the listing and trading of new derivative securities products by self...

    Science.gov (United States)

    2010-04-01

    ... self-regulatory organization's listing and trading of a new derivative securities product that is not deemed a proposed rule change, pursuant to Rule 19b-4(e) under the Act (17 CFR 240.19b-4(e)). Editorial Note: For Federal Register citations affecting Form 19b-4(e), see the List of CFR Sections...

  9. SU-E-J-249: Characterization of Gynecological Tumor Heterogeneity Using Texture Analysis in the Context of An 18F-FDG PET Adaptive Protocol

    International Nuclear Information System (INIS)

    Purpose: We propose a method to examine gynecological tumor heterogeneity using texture analysis in the context of an adaptive PET protocol in order to establish if texture metrics from baseline PET-CT predict tumor response better than SUV metrics alone as well as determine texture features correlating with tumor response during radiation therapy. Methods: This IRB approved protocol included 29 women with node positive gynecological cancers visible on FDG-PET treated with EBRT to the PET positive nodes. A baseline and intra-treatment PET-CT was obtained. Tumor outcome was determined based on RECIST on posttreatment PET-CT. Primary GTVs were segmented using 40% threshold and a semi-automatic gradient-based contouring tool, PET Edge (MIM Software Inc., Cleveland, OH). SUV histogram features, Metabolic Volume (MV), and Total Lesion Glycolysis (TLG) were calculated. Four 3D texture matrices describing local and regional relationships between voxel intensities in the GTV were generated: co-occurrence, run length, size zone, and neighborhood difference. From these, 39 texture features were calculated. Prognostic power of baseline features derived from gradientbased and threshold GTVs were determined using the Wilcoxon rank-sum test. Receiver Operating Characteristics and logistic regression was performed using JMP (SAS Institute Inc., Cary, NC) to find probabilities of predicting response. Changes in features during treatment were determined using the Wilcoxon signed-rank test. Results: Of the 29 patients, there were 16 complete responders, 7 partial responders, and 6 non-responders. Comparing CR/PR vs. NR for gradient-based GTVs, 7 texture values, TLG, and SUV kurtosis had a p < 0.05. Threshold GTVs yielded 4 texture features and TLG with p < 0.05. From baseline to intra-treatment, 14 texture features, SUVmean, SUVmax, MV, and TLG changed with p < 0.05. Conclusion: Texture analysis of PET imaged gynecological tumors is an effective method for early prognosis and should be used complimentary to SUV metrics, especially when using gradient based segmentation

  10. SU-E-J-249: Characterization of Gynecological Tumor Heterogeneity Using Texture Analysis in the Context of An 18F-FDG PET Adaptive Protocol

    Energy Technology Data Exchange (ETDEWEB)

    Nawrocki, J [Duke University Medical Physics Graduate Program, Durham, NC (United States); Chino, J; Craciunescu, O [Duke University Medical Center Department of Radiation Oncology, Durham, NC (United States); Das, S [University of North Carolina School of Medicine, Chapel Hill, NC (United States)

    2015-06-15

    Purpose: We propose a method to examine gynecological tumor heterogeneity using texture analysis in the context of an adaptive PET protocol in order to establish if texture metrics from baseline PET-CT predict tumor response better than SUV metrics alone as well as determine texture features correlating with tumor response during radiation therapy. Methods: This IRB approved protocol included 29 women with node positive gynecological cancers visible on FDG-PET treated with EBRT to the PET positive nodes. A baseline and intra-treatment PET-CT was obtained. Tumor outcome was determined based on RECIST on posttreatment PET-CT. Primary GTVs were segmented using 40% threshold and a semi-automatic gradient-based contouring tool, PET Edge (MIM Software Inc., Cleveland, OH). SUV histogram features, Metabolic Volume (MV), and Total Lesion Glycolysis (TLG) were calculated. Four 3D texture matrices describing local and regional relationships between voxel intensities in the GTV were generated: co-occurrence, run length, size zone, and neighborhood difference. From these, 39 texture features were calculated. Prognostic power of baseline features derived from gradientbased and threshold GTVs were determined using the Wilcoxon rank-sum test. Receiver Operating Characteristics and logistic regression was performed using JMP (SAS Institute Inc., Cary, NC) to find probabilities of predicting response. Changes in features during treatment were determined using the Wilcoxon signed-rank test. Results: Of the 29 patients, there were 16 complete responders, 7 partial responders, and 6 non-responders. Comparing CR/PR vs. NR for gradient-based GTVs, 7 texture values, TLG, and SUV kurtosis had a p < 0.05. Threshold GTVs yielded 4 texture features and TLG with p < 0.05. From baseline to intra-treatment, 14 texture features, SUVmean, SUVmax, MV, and TLG changed with p < 0.05. Conclusion: Texture analysis of PET imaged gynecological tumors is an effective method for early prognosis and should be used complimentary to SUV metrics, especially when using gradient based segmentation.

  11. Sylvie Schweitzer, Femmes de pouvoir. Une histoire de l’égalité professionnelle en Europe (XIXe - XXIe siècle, Paris, Payot, 2010, 249 p.

    Directory of Open Access Journals (Sweden)

    Isabelle Ernot

    2010-07-01

    Full Text Available Avec cet ouvrage, Sylvie Schweitzer poursuit son investigation autour de l’histoire du travail des femmes. L’étude se focalise particulièrement sur la voie du savoir, à travers la question des diplômées et de leur accession progressive à des professions valorisantes et de pouvoir, dans le cadre d’un temps long de cent cinquante années, courant du milieu du XIXe au début du XXIe siècle. Si la France constitue le cadre de référence essentiel, cet essai d’histoire comparée regarde aussi vers l’e...

  12. Characterization of the in vitro expressed autoimmune rippling muscle disease immunogenic domain of human titin encoded by TTN exons 248-249

    International Nuclear Information System (INIS)

    Highlights: → Affinity purification of the autoimmune rippling muscle disease immunogenic domain of titin. → Partial sequence analysis confirms that the peptides is in the I band region of titin. → This region of the human titin shows high degree of homology to mouse titin N2-A. -- Abstract: Autoimmune rippling muscle disease (ARMD) is an autoimmune neuromuscular disease associated with myasthenia gravis (MG). Past studies in our laboratory recognized a very high molecular weight skeletal muscle protein antigen identified by ARMD patient antisera as the titin isoform. These past studies used antisera from ARMD and MG patients as probes to screen a human skeletal muscle cDNA library and several pBluescript clones revealed supporting expression of immunoreactive peptides. This study characterizes the products of subcloning the titin immunoreactive domain into pGEX-3X and the subsequent fusion protein. Sequence analysis of the fusion gene indicates the cloned titin domain (GenBank ID: (EU428784)) is in frame and is derived from a sequence of N2-A spanning the exons 248-250 an area that encodes the fibronectin III domain. PCR and EcoR1 restriction mapping studies have demonstrated that the inserted cDNA is of a size that is predicted by bioinformatics analysis of the subclone. Expression of the fusion protein result in the isolation of a polypeptide of 52 kDa consistent with the predicted inferred amino acid sequence. Immunoblot experiments of the fusion protein, using rippling muscle/myasthenia gravis antisera, demonstrate that only the titin domain is immunoreactive.

  13. Characterization of the in vitro expressed autoimmune rippling muscle disease immunogenic domain of human titin encoded by TTN exons 248-249

    Energy Technology Data Exchange (ETDEWEB)

    Zelinka, L. [Biomedical Sciences Program, Kent State University, Kent, OH (United States); McCann, S.; Budde, J.; Sethi, S.; Guidos, M.; Giles, R. [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Walker, G.R., E-mail: grwalker@ysu.edu [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Biomedical Sciences Program, Kent State University, Kent, OH (United States)

    2011-08-05

    Highlights: {yields} Affinity purification of the autoimmune rippling muscle disease immunogenic domain of titin. {yields} Partial sequence analysis confirms that the peptides is in the I band region of titin. {yields} This region of the human titin shows high degree of homology to mouse titin N2-A. -- Abstract: Autoimmune rippling muscle disease (ARMD) is an autoimmune neuromuscular disease associated with myasthenia gravis (MG). Past studies in our laboratory recognized a very high molecular weight skeletal muscle protein antigen identified by ARMD patient antisera as the titin isoform. These past studies used antisera from ARMD and MG patients as probes to screen a human skeletal muscle cDNA library and several pBluescript clones revealed supporting expression of immunoreactive peptides. This study characterizes the products of subcloning the titin immunoreactive domain into pGEX-3X and the subsequent fusion protein. Sequence analysis of the fusion gene indicates the cloned titin domain (GenBank ID: (EU428784)) is in frame and is derived from a sequence of N2-A spanning the exons 248-250 an area that encodes the fibronectin III domain. PCR and EcoR1 restriction mapping studies have demonstrated that the inserted cDNA is of a size that is predicted by bioinformatics analysis of the subclone. Expression of the fusion protein result in the isolation of a polypeptide of 52 kDa consistent with the predicted inferred amino acid sequence. Immunoblot experiments of the fusion protein, using rippling muscle/myasthenia gravis antisera, demonstrate that only the titin domain is immunoreactive.

  14. 33 CFR 207.249 - Ouachita and Black Rivers, Ark. and La., Mile 0.0 to Mile 338.0 (Camden, Ark.) above the mouth of...

    Science.gov (United States)

    2010-07-01

    ... other lockages, then separate lockages shall be made. Dangerous cargoes are described in 46 CFR part 146.... and La., Mile 0.0 to Mile 338.0 (Camden, Ark.) above the mouth of the Black River; the Red River, La.... and La., Mile 0.0 to Mile 338.0 (Camden, Ark.) above the mouth of the Black River; the Red River,...

  15. Discovery of Isotopes of the Transuranium Elements with 93 <= Z <= 98

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium and californium have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  16. Neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    This paper continues, with respect to the transplutonium nuclides, earlier efforts to collate and evaluate data from the scientific literature on the prompt neutron multiplicity distribution from fission and its first moment = ΣnuPnu. The isotopes considered here for which P/sub nu/ and or data (or both) were found in the literature are of americium (Am), curium (Cm), berkelium (Bk), californium (Cf), einsteinium (Es), fermium (Fm), and nobelium (No)

  17. 17 CFR 41.11 - Method for determining market capitalization and dollar value of average daily trading volume...

    Science.gov (United States)

    2010-04-01

    ... Form F-6 (17 CFR 239.36). (d) Definitions. For purposes of this section: (1) SEC means the Securities...-QSB, or Form 20-F (17 CFR 249.310, 249.308a, 249.310b, 249.308b, or 249.220f) filed with the... outstanding shares subsequently reported by the issuer on a Form 8-K (17 CFR 249.308). (8) Preceding 6...

  18. RESGPSPNTS_JD249.SHP: Navigation and Bathymetry Points of Ship Position During Continuous Resistivity Profile Data Collection in the Potomac River/Chesapeake Bay on Sept. 6, 2006 on USGS Cruise 06018

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — In order to test hypotheses about groundwater flow under and into Chesapeake Bay, geophysical surveys were conducted by U.S. Geological Survey (USGS) scientists on...

  19. Vlasov B. Natural properties of Karst lakes in Belarus / B. Vlasov // Lakes and artificial water reservoirs – functioning, revitalization and protection. – Cosnowiec, 2005. – Р. 249–255.

    OpenAIRE

    Vlasov, Boris

    2005-01-01

    Abstract: Karst lakes of Belarus belong to the azonal type and are distributed in Polesje region in the area of superficial deposition of chalk rocks. Specific features of these type lakes include: small water surface, tunneled form of a hollow, low water exchange rate and increased level of water mineralization; the lakes refer to mesotrophic or eutrophic types.

  20. Nuclear Liability Act of 8 March 1968 (No. 45) as amended by an Act of 10 May 1974 (No. 249) and by an Act of 22 December 1982 (No. 1275)

    International Nuclear Information System (INIS)

    The amendments to this Act fall into two categories. The first category of amendments enabled Sweden to ratify two 1982 Protocols amending the Paris Convention and the Brussels Supplementary Convention respectively. The other amendments raise the nuclear operator's liability from 50 million to 500 million Swedish crowns per incident and introduce a State liability over and above compensation available under the Brussels Convention, thus raising the aggregate amount of compensation to 3,000 million Swedish crowns. (NEA)

  1. The activation of N-glycosidic bond cleavage performed by base-excision repair enzyme hOGG1; Theoretical study of the role of Lys 249 residue in activation of G, OxoG and FapyG

    Czech Academy of Sciences Publication Activity Database

    Šebera, Jakub; Trantírek, L.; Tanaka, Y.; Nencka, Radim; Fukal, J.; Sychrovský, Vladimír

    2014-01-01

    Roč. 4, č. 83 (2014), s. 44043-44051. ISSN 2046-2069 R&D Projects: GA ČR GA13-27676S Grant ostatní: GA AV ČR(CZ) M200551205; GA MŠk(CZ) ED1.1.00/02.0068; GA MŠk(CZ) EE2.3.20.0042 Institutional support: RVO:61388963 Keywords : DFT * QM/MM * Fukui indices * hOGG1 * aromaticity * 8-OxoG Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.840, year: 2014

  2. RESGPSLNS_JD249.SHP: Ship Trackline along which Continuous Resistivity Profile Data was Collected in the Potomac River/Chesapeake Bay on Sept., 6, 2006 on USGS Cruise 06018

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — In order to test hypotheses about groundwater flow under and into Chesapeake Bay, geophysical surveys were conducted by U.S. Geological Survey (USGS) scientists on...

  3. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT249-258 during 2013 (NODC Accession 0125648)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. The program began in 1988....

  4. Niskin bottle data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT249-258 during 2013 (NODC Accession 0125579)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  5. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT249-258 during 2013 (NODC Accession 0125647)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. The program began in 1988....

  6. Avaliação nutricional da casca de soja integral ou moída, ensilada ou não, para suínos em fase de crescimento - DOI: 10.4025/actascianimsci.v29i1.249 Nutritional evaluation of whole or grinder soybean hull, ensilaged or not, for growing pigs - DOI: 10.4025/actascianimsci.v29i1.249

    OpenAIRE

    Cleber Rogério Ribeiro; Diovani Paiano; Ivan Moreira; Arlei Rodrigues Bonet Quadros; Nikychiella Silvestrim; Antônio Cláudio Furlan

    2007-01-01

    Foi conduzido um experimento com 11 suínos híbridos, machos castrados, com peso vivo de 41,42 ± 0,99 kg. Os animais foram alojados individualmente em gaiolas de metabolismo e distribuídos em um delineamento experimental inteiramente casualizado, com parcelas subdivididas, com quatro tratamentos em esquema fatorial 2 x 2 (moagem x ensilagem). Os alimentos avaliados foram: a casca de soja (CS) integral (CSI), CS moída (CSM), silagem de CSI (SCSI) e silagem de CSM (SCSM), que substituíram, com b...

  7. Protein (Viridiplantae): 225469115 [

    Lifescience Database Archive (English)

    Full Text Available XP_002269781.1 33090:8648 35493:7702 131221:7702 3193:7702 58023:874 78536:4279 58024:4279 3398: ... 91834:249 403667:249 3602:249 3603:249 29760:249 PRE DICTE D: (E ,E )-alpha-farne se ne ... synthase ... Vitis vinife ... ra MDSANHIQNSQE FLQCQAKSE GVGTISQRRSANYKPNIWKYDCVQSLTSE YMGE PYTRQVQQL ... KGE VRRVFVE VVE PLAKLE FIDSIKKLGLGNFFEEE IRE ALDTIMSDKNNSPGI ... KANLYAAALCFRLLRQHGYGVSQDMFSGFMEE VGMFSKSTCTNVKGMIE LFE ASHLALE GE NILDE AKAFSSGYLKE IISNL ...

  8. Protein (Viridiplantae): 359496694 [

    Lifescience Database Archive (English)

    Full Text Available XP_002264134.2 33090:8648 35493:7702 131221:7702 3193:7702 58023:874 78536:4279 58024:4279 3398: ... 91834:249 403667:249 3602:249 3603:249 29760:249 PRE DICTE D: (E ,E )-alpha-farne se ne ... synthase -like ... Vitis v ... inife ra MDSANHIQNSQE FLQCQAKSE GVGTISQRRSANYKPNIWKYDCVQSLT ... SE YMGE PYTRQVQQLKGE VRRVFVE VVE PLAKLE FIDSIKKLGLGNFFEEE IR E ALDTIMSDKNNSPGIKANLYAAALCFRLLRQHGYGVSQDMFSGFMEE VGMFSKSTCTNVKGMIE LFE ASHLALE GE NILDE AKAFSSGYLKE IISNL ...

  9. Protein (Viridiplantae): 359496696 [

    Lifescience Database Archive (English)

    Full Text Available XP_003635303.1 33090:8648 35493:7702 131221:7702 3193:7702 58023:874 78536:4279 58024:4279 3398: ... 91834:249 403667:249 3602:249 3603:249 29760:249 PRE DICTE D: (E ,E )-alpha-farne se ne ... synthase -like ... Vitis v ... inife ra MDSANHIQNSQE FLQCQAKSE GVGTISQRRSANYKPNIWKYDCVQSLT ... SE YMGE PYTRQVQQLKGE VRRVFVE VVE PLAKLE FIDSIKKLGLGNFFEEE XV ... GMFSKSTCTNVKGMIE LFE ASHLALE GE NILDE AKAFSSGYLKE IISNLDNNLAKQVVHSLE RPLHW ...

  10. Protein (Viridiplantae): 359497519 [

    Lifescience Database Archive (English)

    Full Text Available XP_003635550.1 33090:8648 35493:7702 131221:7702 3193:7702 58023:874 78536:4279 58024:4279 3398: ... 91834:249 403667:249 3602:249 3603:249 29760:249 PRE DICTE D: (E ,E )-ge ranyllinalool synthase -like , partia ... l Vitis vinife ra IE HE LSLPWIARLDHLDHRMWIE QQYKNNTLWTGKASFYRLSCFHDE G ... LMQLAVKNYE LRQAIFKSE LEE LKRWCKDWGLTDMGFGRE KTTYCYFAVAASSSLPHDSAV ... RTIVAKSAILVTVADDFFDTKGSLDE LE SLTE AVGRWNGKGLSSHSKTIFDALDNLVRDMTE KHLHQQGSDITNDLQ ...

  11. Protein (Viridiplantae): 359494876 [

    Lifescience Database Archive (English)

    Full Text Available XP_002279869.2 33090:8648 35493:7702 131221:7702 3193:7702 58023:874 78536:4279 58024:4279 3398: ... 91834:249 403667:249 3602:249 3603:249 29760:249 PRE DICTE D: (E ,E )-ge ranyllinalool synthase -like ... Vitis v ... inife ra ME SSHSIIE ALVRKIKDE MFSSVDLYSFVSPSAYDTAWLAMVPDPAGG ... NDGRPMFGE CLNWVVNNQRE DGFWGE SDGYGNPTIDCLPATLACMLALKTWGVGSGNLE R ... GLAFIHDNTE KLLAE NHGRCPRWFAIVFPTMIE LAQKTGLE IVFSDE LEE VLTNIFHHRQR ...

  12. Protein (Viridiplantae): 359497234 [

    Lifescience Database Archive (English)

    Full Text Available XP_003635459.1 33090:8648 35493:7702 131221:7702 3193:7702 58023:874 78536:4279 58024:4279 3398: ... 91834:249 403667:249 3602:249 3603:249 29760:249 PRE DICTE D: (E ,E )-ge ranyllinalool synthase -like ... Vitis v ... inife ra ME SSHSIIE ALVRKIKDE MFSSVDLYSFVSPSAYDTAWLAMVPGGNDG ... RPMFGE CLNWVVNNQRE GGFWGE SDGYGNPTIDCLPATLACMLALKTWGVGSGNLE R ... GLAFIHDNTE KLLAE NHGRCPRWFAIVFPAMIE LAQKTGFE IVFSDE LEE VLTNIFHHRQR ...

  13. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  14. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  15. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  16. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  17. Gclust Server: 76570 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 76570 HSA_8923040 Cluster Sequences Related Sequences(249) 580 NP_060102.1 collabor...elated sequences Related Sequences(249) Sequence length 580 Representative annotation NP_060102.1 collabor

  18. Protein (Viridiplantae): 357439925 [

    Lifescience Database Archive (English)

    Full Text Available XP_003590240.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  19. Protein (Viridiplantae): 357439975 [

    Lifescience Database Archive (English)

    Full Text Available XP_003590265.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  20. Protein (Viridiplantae): 357478871 [

    Lifescience Database Archive (English)

    Full Text Available XP_003609721.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  1. Protein (Viridiplantae): 357521229 [

    Lifescience Database Archive (English)

    Full Text Available XP_003630903.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  2. Safety and reliability of plant technology: Application of knowledge based systems technology in analysis and management of power and process plant components and systems. Vol. 3. SPRINT/KBS dissemination workshops of MPA seminar

    International Nuclear Information System (INIS)

    The third volume of this report covers the following topics: 1) SPRINT SP249 and RA230 dissemination workshop: Implementation of power plant component life assessment technology using a knowledge-based system, 2) SPRINT RA230 and SP249 dissemination workshop: Methodologies, tools and systems, 3) SPRINT SP249 and RA230 dissemination workshop: KBS-dissemination and case studies, 4) SPRINT SP249 and RA230 dissemination workshop: KBS-dissemination and data, 5) SPRINT SP249 and RA230 dissemination workshop: KBS-dissemination and plant operating. (orig./GL)

  3. Struggling to Improve Our Understanding of Nursing Student Information Needs. A review of: Gannon‐Leary, Pat, Graham Walton, Raffik Cader, Julie Derbyshire, and Ann Smith. “Use of Evidence by Nursing Students: An Interdisciplinary Study.” Library & Information Science Research 28.2 (Mar. 2006: 249‐64.

    Directory of Open Access Journals (Sweden)

    Michael Corkett

    2007-06-01

    Full Text Available Objective – To identify the sources used by student nurses when undertaking a health needs analysis of particular client groups, and to determine students’ ease in accessing source materials.Design – Case series, incorporating citation analysis and focus groups.Setting – Honours Nursing Studies program (Adult Branch, Northumbria University, Newcastle upon Tyne, United Kingdom.Subjects – Citation analysis: 40 students undertaking health needs analysis assignment. Focus groups: 2 groups of 8 students.Methods – Subjects for the citation analysis were not randomly selected. Citation analysis was performed and references tabulated using a previously piloted proforma. Distribution of references between sources was measured using quantitative analysis. Focus groups consisted of self selecting volunteers from the student cohort undertaking the assignment. Issues of potential bias/coercion relating to research team members being group participant tutors were addressed. Results were analysed through the categorisation of key themes.Main results – The mean number of sources cited per assignment was 16. More than half( 56% of the sources were published after 1999. Twenty‐nine percent of citations were published between 1996 and 1999, and 12% between 1990 and 1995. Only small percentages were published in the 1980s (2% and 1970s (1%. Journals (37% formed the largest body of references, followed by books at 27%. UK government publications accounted for 14% of total references; Web based resources totalled 12%. Students acknowledged the importance of supporting assignments with references. Government publications were recognised as high quality pieces of evidence. Difficulty was experienced extrapolating evidence from different care settings and moving outside of usual parameters. Students indicated that statistical data was hard to find. Those without home Internet facilities had greater difficulty in accessing information than students with such facilities. Support from information professionals was received, but quality was variable.Conclusion – Doubts exist as to whether opportunities for student learning to inform educators are being fully exploited. Upon completion of assignments students are arguably in a better position to debate subjects more deeply and so advance understanding. Potential for peer group development may be lost. Collaboration between nursing academics and information professionals offers potential for nursing students and health professionals to advance their exploitation and evaluation of information resources.

  4. Dietary exposure to benzoates (E210-E213), parabens (E214-E219), nitrites (E249-E250), nitrates (E251-E252), BHA (E320), BHT (E321) and aspartame (E951) in children less than 3 years old in France.

    Science.gov (United States)

    Mancini, F R; Paul, D; Gauvreau, J; Volatier, J L; Vin, K; Hulin, M

    2015-01-01

    This study aimed to estimate the exposure to seven additives (benzoates, parabens, nitrites, nitrates, BHA, BHT and aspartame) in children aged less than 3 years old in France. A conservative approach, combining individual consumption data with maximum permitted levels, was carried out for all the additives. More refined estimates using occurrence data obtained from products' labels (collected by the French Observatory of Food Quality) were conducted for those additives that exceeded the acceptable daily intake (ADI). Information on additives' occurrence was obtained from the food labels. When the ADI was still exceeded, the exposure estimate was further refined using measured concentration data, if available. When using the maximum permitted level (MPL), the ADI was exceeded for benzoates (1.94 mg kg(-1) bw day(-1)), nitrites (0.09 mg kg(-1) bw day(-1)) and BHA (0.39 mg kg(-1) bw day(-1)) in 25%, 54% and 20% of the entire study population respectively. The main food contributors identified with this approach were current foods as these additives are not authorised in specific infant food: vegetable soups and broths for both benzoates and BHA, delicatessen and meat for nitrites. The exposure estimate was significantly reduced when using occurrence data, but in the upper-bound scenario the ADI was still exceeded significantly by the age group 13-36 months for benzoates (2%) and BHA (1%), and by the age group 7-12 months (16%) and 13-36 months (58%) for nitrites. Measured concentration data were available exclusively for nitrites and the results obtained using these data showed that the nitrites' intake was below the ADI for all the population considered in this study. These results suggest that refinement of exposure, based on the assessment of food levels, is needed to estimate the exposure of children to BHA and benzoates for which the risk of exceeding the ADI cannot be excluded when using occurrence data. PMID:25686474

  5. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC249 (Link to dictyBase) - - - Contig-U16272-1 VFC249P (Link... to Original site) VFC249F 500 VFC249Z 585 VFC249P 1085 - - Show VFC249 Library VF (Link to library) Clone ID VFC249 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...te 2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dict...0.00 mNt: 0.00 m3a: 0.00 m3b: 0.00 m_ : 1.00 88.0 %: cytoplasmic 8.0 %: mitochondrial 4.0 %: nuclear >> predict

  6. An atomic beam source for actinide elements: concept and realization

    International Nuclear Information System (INIS)

    For ultratrace analysis of actinide elements and studies of their atomic properties with resonance ionization mass spectroscopy (RIMS), efficient and stable sources of actinide atomic beams are required. The thermodynamics and kinetics of the evaporation of actinide elements and oxides from a variety of metals were considered, including diffusion, desorption, and associative desorption. On this basis various sandwich-type filaments were studied. The most promising system was found to consist of tantalum as the backing material, an electrolytically deposited actinide hydroxide as the source of the element, and a titanium covering layer for its reduction to the metal. Such sandwich sources were experimentally proven to be well suited for the production of atomic beams of plutonium, curium, berkelium and californium at relatively low operating temperatures and with high and reproducible yields. (orig.)

  7. EC decay of 244Bk

    Science.gov (United States)

    Sodaye, Suparna; Tripathi, R.; Sudarshan, K.; Sharma, S. K.; Pujari, P. K.; Palit, R.; Mukhopadhyay, S.

    2014-12-01

    Berkelium isotopes have been produced in 11B-induced reaction on 238U. The EC decay of 244Bk → 244Cm has been studied by carrying out the single and coincidence measurements of the γ-rays emitted during the de-excitation of the 244Cm levels. Radiochemical separations have been carried out to minimize the contribution from the fission products and target. The new half-life of 244Bk is obtained as 5.02 ± 0.03 h, which is close to the theoretically calculated value. The relative intensities of the decay γ-rays have been re-evaluated. Based on the coincidence measurements, a tentative partial level scheme for 244Bk → 244Cm decay has been proposed.

  8. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  9. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  10. EC decay of 244Bk

    International Nuclear Information System (INIS)

    Berkelium isotopes have been produced in 11B-induced reaction on 238U. The EC decay of 244Bk → 244Cm has been studied by carrying out the single and coincidence measurements of the γ-rays emitted during the de-excitation of the 244Cm levels. Radiochemical separations have been carried out to minimize the contribution from the fission products and target. The new half-life of 244Bk is obtained as 5.02 ± 0.03 h, which is close to the theoretically calculated value. The relative intensities of the decay γ-rays have been re-evaluated. Based on the coincidence measurements, a tentative partial level scheme for 244Bk → 244Cm decay has been proposed. (paper)

  11. Production of transuranium elements

    International Nuclear Information System (INIS)

    The Radiochemical Engineering Development Center (REDC) has the programmatic responsibility for the Department of Energy's Transuranium Element Program. Principle elements from the program are einsteinium, berkelium, and fermium. Targets containing curium oxide mixed with aluminum powder are fabricated by the REDC and irradiated in the Oak Ridge National Laboratory (ORNL) High Flux Isotope Reactor. Following an irradiation period of 6-12 months, targets are returned to the REDC for chemical processing. Processing operations consists of aluminum dejacketing in a caustic-nitrate solution, filtration, acid dissolution, solvent extraction, anion exchange, and finally a cation exchange to recover the actinides. The processing operations take place in heavily shielded hot cell facilities and all operations are carried out remotely. The chemistry for the separations has been well established over the 26-yr. operating life of the facility

  12. EST Table: BP120097 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP120097 ceN-1828 10/09/28 98 %/249 aa ref|NP_001036916.1| G protein alpha subunit Go isoform 1 ... 8 86 %/249 aa C26C6.2#CE05311#WBGene00001648#locus:goa -1#guanine nucleotide-binding protein#status:Confir ...

  13. EST Table: BP120113 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP120113 ceN-1846 10/09/28 98 %/249 aa ref|NP_001036916.1| G protein alpha subunit Go isoform 1 ... 8 86 %/249 aa C26C6.2#CE05311#WBGene00001648#locus:goa -1#guanine nucleotide-binding protein#status:Confir ...

  14. Strategic tariff protection, market conduct, and government commitment levels in developing economies

    Czech Academy of Sciences Publication Activity Database

    Ionascu, D.; Žigić, Krešimir

    -, č. 249 (2005), s. 1-43. ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : optimal tariff protection * government non-commitment regime * symmetric versus asymmetric information Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp249.pdf

  15. Review of: Islam, Migration and Integration: The Age of Securitization

    DEFF Research Database (Denmark)

    Vinding, Niels Valdemar

    2010-01-01

    Islam, Migration and Integration: The Age of Securitization. By Ayhan Kaya. (Migration, Minorities and Citizenship). Houndmills, Basingstoke: Palgrave Macmillan, 2009. Pp. xiv+249. Hbk 978-0-230-51679-3. £55.......Islam, Migration and Integration: The Age of Securitization. By Ayhan Kaya. (Migration, Minorities and Citizenship). Houndmills, Basingstoke: Palgrave Macmillan, 2009. Pp. xiv+249. Hbk 978-0-230-51679-3. £55....

  16. 17 CFR 229.407 - (Item 407) Corporate governance.

    Science.gov (United States)

    2010-04-01

    ... company's annual report on Form 10-K (17 CFR 249.310) (or, for closed-end investment companies registered... CFR 270.30d-1) thereunder) for the last fiscal year for filing with the Commission. (ii) The name of... annual report pursuant to General Instruction G(3) to Form 10-K (17 CFR 249.310). 2. If a...

  17. Significance of mangrove swamps for aquaculture

    Digital Repository Service at National Institute of Oceanography (India)

    Wafar, S.; Untawale, A.G.

    stream_size 9 stream_content_type text/plain stream_name I.O_21_Century_Linkage_Networking_1998_249.pdf.txt stream_source_info I.O_21_Century_Linkage_Networking_1998_249.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  18. Drug: D00314 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D00314 Drug Etidronate disodium (JP16/USP); Didronel (TN) C2H6O7P2. 2Na 249.9384 249.9919 D00314 ... rapeutic category: 3999 ATC code: M05BA01 map07047 Osteoporosis ... drugs Therapeutic category of drugs in Japan [BR:b ...

  19. Drug: D07119 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07119 Drug Alendronic acid (INN) C4H13NO7P2 249.0167 249.096 D07119.gif Calcium regulating agen ... 900(2224) Terpenoid backbone biosynthesis map07047 Osteoporosis ... drugs Anatomical Therapeutic Chemical (ATC) classi ...

  20. Analysis of the complex between amyloid beta peptides and mitochondrial enzyme 17beta-HSD in cerebrospinal fluid

    Czech Academy of Sciences Publication Activity Database

    Krištofíková, Z.; Hegnerová, Kateřina; Bocková, Markéta; Vaisocherová, Hana; Bartoš, A.; Říčný, J.; Řípová, D.; Homola, J.

    2008-01-01

    Roč. 275, podzim (2008), s. 249-249. ISSN 1742-464X. [EUROPTRODE /9./. Dublin, 30.03.2008-02.04.2008] Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance * alzheimer disease * 17beta-HSD10 Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.139, year: 2008

  1. Transferring of environmentally important genes for dioxygenase ISPtol into plants

    Czech Academy of Sciences Publication Activity Database

    Nováková, M.; Macková, M.; Sylvestre, M.; Prokešová, J.; Macek, Tomáš

    Chania: Technical University of Crete, 2008 - (Kalogerakis, N.; Fava, F.; Banwart, S.). s. 249-249 ISBN 978-960-8475-12-0. [European Bioremediation Conference /4./. 03.09.2008-06.09.2008, Chania] R&D Projects: GA MŠk 1M06030 Institutional research plan: CEZ:AV0Z40550506 Keywords : dioxygenase ISPtol * phytoremediation Subject RIV: EI - Biotechnology ; Bionics

  2. 75 FR 65442 - Disclosure for Asset-Backed Securities Required by Section 943 of the Dodd-Frank Wall Street...

    Science.gov (United States)

    2010-10-25

    ... Register of October 13, 2010, in FR Doc. 2010-25361, the reference ``249.1300'' is corrected to read ``249... Securities Required by Section 943 of the Dodd-Frank Wall Street Reform and Consumer Protection Act AGENCY...-Backed Securities Required by Section 943 of the Dodd-Frank Wall Street Reform and Consumer...

  3. 17 CFR 240.19b-4 - Filings with respect to proposed rule changes by self-regulatory organizations.

    Science.gov (United States)

    2010-04-01

    ... organizations. Preliminary Note: A self-regulatory organization also must refer to Form 19b-4 (17 CFR 249.819... paragraph (e), a self-regulatory organization shall submit Form 19b-4(e) (17 CFR 249.820) to the Commission... proposed rule changes by a self-regulatory organization submitted on Form 19b-4 (17 CFR...

  4. Drug: D07383 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07383 Drug Erdosteine (INN); Mucotec (TN) C8H11NO4S2 249.0129 249.3072 D07383.gif Mucolytic ATC ... assification [BR:br08303] R RESPIRATORY SYSTEM R05 COUGH ... AND COLD PREPARATIONS R05C EXPECTORANTS, EXCL. COM ... BINATIONS WITH COUGH ... SUPPRESSANTS R05CB Mucolytics R05CB15 Erdosteine D ...

  5. The Moravian Karst: and interconnection between surface and subsurface natural sceneries

    Czech Academy of Sciences Publication Activity Database

    Kadlec, Jaroslav; Neruda, P.

    Cham: Springer, 2016 - (Pánek, T.; Hradecký, J.), s. 249-262 ISBN 978-3-319-27536-9 Institutional support: RVO:67985530 Keywords : Moravian Karst * morphology * tectonics Subject RIV: DB - Geology ; Mineralogy

  6. Ionic conductivity study of Lil-Ga2S3-GeS2 chalcogenide glasses using a random – walk approach

    Czech Academy of Sciences Publication Activity Database

    Patil, S. D.; Konale, M. S.; Kolář, J.; Shimakawa, K.; Zima, Vítězslav; Wágner, T.

    2015-01-01

    Roč. 87, č. 3 (2015), s. 249-259. ISSN 0033-4545 Institutional support: RVO:61389013 Keywords : chalcogenide glasses * impedance spectroscopy * ionic conductivity Subject RIV: CA - Inorganic Chemistry Impact factor: 2.492, year: 2014

  7. Od Pavla Eisnera k Pavlu Železnému? Pražský kulturní prostředník v období mezi světovými válkami

    Czech Academy of Sciences Publication Activity Database

    Wögerbauer, Michael

    Passau : Stutz, 2012 - (Džambo, J.), s. 99-113 ISBN 978-3-88849-249-5 Institutional support: RVO:68378068 Keywords : Czech literature * German, literature * Eisner, Paul Subject RIV: AJ - Letters, Mass-media, Audiovision

  8. Fúzní palivo a obnovitelné zdroje

    Czech Academy of Sciences Publication Activity Database

    Entler, Slavomír

    2015-01-01

    Roč. 65, č. 5 (2015), s. 249-252. ISSN 0375-8842 Keywords : nuclear fusion * fusion fuel power plant * renewable source * fusion energy Subject RIV: JF - Nuclear Energetics http://www.casopisenergetika.cz

  9. EST Table: BB985913 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ar to putative lysosomal glucocerebrosidase [Tribolium castaneum] 10/08/28 30 %/249 aa FBpp0129766|DereGG112...EDICTED: similar to putative lysosomal glucocerebrosidase [Tribolium castaneum] BB985877 MSV3 ...

  10. 1983 walrus harvest, health, and welfare study at Gambell, Alaska: Progress report

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The total documented harvest during the period of observation in 1983 was 642 walruses. This included 249 adult males (38.8%), 203 adult females (31.6%), and 190...

  11. Devitrification kinetics of Sb2O3-PbI2 glasses

    Czech Academy of Sciences Publication Activity Database

    Legouera, M.; Rahal, F.; Kostka, Petr; Poulain, M.

    2009-01-01

    Roč. 34, č. 4 (2009), s. 249-266. ISSN 0151-9107 Institutional research plan: CEZ:AV0Z40320502 Keywords : crystallization kinetics * nucleation Subject RIV: CA - Inorganic Chemistry Impact factor: 0.250, year: 2009

  12. Prevalence, dynamics, and biochemical predictors of optic nerve remyelination after methanol-induced acute optic neuropathy: a 2-year prospective study in 54 patients

    Czech Academy of Sciences Publication Activity Database

    Nurieva, O.; Kotíková, K.; Urban, P.; Pelclová, D.; Petřík, V.; Navrátil, Tomáš; Zakharov, S.

    2016-01-01

    Roč. 147, č. 1 (2016), s. 239-249. ISSN 0026-9247 Institutional support: RVO:61388955 Keywords : methanol optic neuropathy * visual evoked potentials * remyelination Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.222, year: 2014

  13. Temperature, salinity, oxygen, nutrients and productivity profile data from THOMAS G. THOMPSON Cruise 001, 19651014 to 19651207 in the Caribbean Sea and the northeastern tropical Pacific Ocean (NODC Accession 7100507)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains a copy of University of Washington Department of Oceanography Technical Report No. 249, Physical, chemical, and productivity data from a...

  14. 76 FR 1492 - Notice of Actions Taken at December 16, 2010, Meeting

    Science.gov (United States)

    2011-01-10

    ...: Hughesville-Wolf Township Joint Municipal Authority. Project Facility: Wastewater Treatment Plant, Wolf Township, Lycoming County, Pa. Withdrawal of treated wastewater effluent of up to 0.249 mgd. 6....

  15. Partial genetic characterization of Sedlec virus (Orthobunyavirus, Bunyaviridae)

    Czech Academy of Sciences Publication Activity Database

    Bakonyi, T.; Kolodziejek, J.; Rudolf, Ivo; Berčič, R.; Nowotny, N.; Hubálek, Zdeněk

    2013-01-01

    Roč. 19, October (2013), s. 244-249. ISSN 1567-1348 Institutional support: RVO:68081766 Keywords : Sedlec virus * Leanyer virus * Simbu group * Orthobunyavirus * Acrocephalus Subject RIV: EE - Microbiology, Virology Impact factor: 3.264, year: 2013

  16. Disease: H00156 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available osity. Clin Exp Nephrol 11:174-9 (2007) PMID:15630634 Smelt AH, de Beer F Apolipoprotein E and familial dysbetalipoproteinemia: clini...cal, biochemical, and genetic aspects. Semin Vasc Med 4:249-57 (2004) ...

  17. Accumulation of Ag and Cu in Amanita strobiliformis and characterization of its Cu and Ag uptake transporter genes AsCTR2 and AsCTR3

    Czech Academy of Sciences Publication Activity Database

    Beneš, V.; Hložková, K.; Matěnová, M.; Borovička, Jan; Kotrba, P.

    2016-01-01

    Roč. 29, č. 2 (2016), s. 249-264. ISSN 0966-0844 Institutional support: RVO:67985831 Keywords : heavy metals * metal uptake * metallothionein * Copper transporter protein family * ectomycorrhizal fungi Impact factor: 2.503, year: 2014

  18. Bez těla

    Czech Academy of Sciences Publication Activity Database

    Bydžovská, Lenka; Srp, K.

    Praha: Scriptorium, 2002 - (Bydžovská, L.; Prahl, R.), s. 231-249 ISBN 80-86197-35-2 Institutional research plan: CEZ:AV0Z8033913 Keywords : surrealism Subject RIV: AL - Art, Architecture, Cultural Heritage

  19. Výstava Václav Šebele (1835-1899), v Písku ztracený venkovan, Prácheňské muzeum v Písku, 1. 3. - 3. 5. 2015

    Czech Academy of Sciences Publication Activity Database

    Kafka, Luboš

    2015-01-01

    Roč. 102, č. 2 (2015), s. 249-250. ISSN 0009-0794 Institutional support: RVO:68378076 Keywords : exhibition * South Bohemia * painter * folk architecture Subject RIV: AC - Archeology, Anthropology, Ethnology

  20. Dynamic scaling and kinetic roughening of poly(ethylene) islands grown by vapor phase deposition

    Czech Academy of Sciences Publication Activity Database

    Choukourov, A.; Melnichuk, I.; Gordeev, I.; Kylián, O.; Hanuš, J.; Kousal, J.; Solař, P.; Hanyková, L.; Brus, Jiří; Slavínská, D.; Biederman, H.

    2014-01-01

    Roč. 565, 28 August (2014), s. 249-260. ISSN 0040-6090 Institutional support: RVO:61389013 Keywords : poly(ethylene) * physical vapor deposition * island growth Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.759, year: 2014

  1. 17 CFR 270.23c-1 - Repurchase of securities by closed-end companies.

    Science.gov (United States)

    2010-04-01

    ... losses realized from the sale of securities or other properties, was distributed to its shareholders... Commission, as an exhibit to Form N-CSR (§ 249.331 and § 274.128), a copy of any written solicitation...

  2. A numerical study of two different specimen fixtures for the modified compact tension test – their influence on concrete fracture parameters

    Czech Academy of Sciences Publication Activity Database

    Holušová, Táňa; Seitl, Stanislav; Cifuentes, H.; Canteli, A.

    2016-01-01

    Roč. 10, č. 35 (2016), s. 242-249. ISSN 1971-8993 Institutional support: RVO:68081723 Keywords : Modified Compact Tension Test * Fracture Parameters * Cementitious Composites * FEM Subject RIV: JL - Materials Fatigue, Friction Mechanics

  3. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... count__/__total__ Find out why Close Pediatric Palliative Care: A Personal Story NINRnews Subscribe Subscribed Unsubscribe 249 ... and her family. The story demonstrates how palliative care can positively influence a patient's and family's experience ...

  4. 47 CFR 73.606 - Table of allotments.

    Science.gov (United States)

    2010-10-01

    .... 155) Editorial Note: For Federal Register citations affecting § 73.606, see the List of CFR Sections...+, 24, *34 Centralia *15+ East Wenatchee 249A Everett 16- Kennewick 42+ Morton 39 Olympia 67 Pasco...

  5. Gene : CBRC-MDOM-02-0481 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available his domestica protamine 1 (PRM1), mRNA /cds=p(73,249) /gb=NM_001032967 /gi=74136486 /ug=Mdm.246 /len=400 0.17 37% MERVEEREEKRREEKRRE...EKRREEKRREEKRREEKRREEKRREEKRREEKRREEKRREEKRREEKRREEKRRGREEDREEKRREEKRREEKRRE...EKREDKRRQERREEKRREEKRREEKRREEKRREEKRREEKREKKREEKRREKKKEKRREEKRREEKRREEKRREEKRREEKRREEKRREEKRRGREEDREEKRREEKRRE...EKRREKTREDKREEKRREEKRREEKRREEKRREEKRRERRKEKRREEKKRKRREEKRREEKRREEKRREEKRREEKRREEKRREEKRREKRSNAQLRVAKT ...

  6. Hydrodynamic characteristics of mechanical heart valve prostheses in steady and pulsatile flow

    Czech Academy of Sciences Publication Activity Database

    Klimeš, František; Kořenář, Josef

    2002-01-01

    Roč. 9, č. 4 (2002), s. 249-258. ISSN 1210-2717 Institutional research plan: CEZ:AV0Z2060917 Keywords : mechanical heart valve prostheses * flow visualization- steady and pulsatile flow Subject RIV: BO - Biophysics

  7. Podíl "paleolitických" versus "neolitických" haploskupin Y chromozomu u české populace

    Czech Academy of Sciences Publication Activity Database

    Kráčmarová, A.; Bruchová, H.; Černý, Viktor; Brdička, R.

    2006-01-01

    Roč. 58, č. 2 (2006), s. 237-249. ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : archaeogenetics * Y chromosome * migrations Subject RIV: AC - Archeology, Anthropology, Ethnology

  8. The ecological motivation of ethics and the moral critique of the value orientations of society

    Czech Academy of Sciences Publication Activity Database

    Hála, Vlastimil

    Sofia : Commission nationale de la République de la Bulgarie pour l' UNESCO, 1998, s. 235-249. ["Philosophie et démocratie". Sofia (BG), 00.00.1996-00.00.1997] Subject RIV: AA - Philosophy ; Religion

  9. Nuclear Chemistry Institute, Mainz University. Annual Report 1995

    International Nuclear Information System (INIS)

    The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR)

  10. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  11. Investigations for the influence of geochemical parameters on the sorption and desorption of lanthanides and uranium onto opalinus clay as potential host rock for a repository

    International Nuclear Information System (INIS)

    The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.

  12. An exact exponential time algorithm for counting bipartite cliques

    DEFF Research Database (Denmark)

    Kutzkov, Konstantin

    2012-01-01

    We present a simple exact algorithm for counting bicliques of given size in a bipartite graph on n vertices. We achieve running time of O(1.249^n), improving upon known exact algorithms for finding and counting bipartite cliques.......We present a simple exact algorithm for counting bicliques of given size in a bipartite graph on n vertices. We achieve running time of O(1.249^n), improving upon known exact algorithms for finding and counting bipartite cliques....

  13. 17 CFR 240.3a55-1 - Method for determining market capitalization and dollar value of average daily trading volume...

    Science.gov (United States)

    2010-04-01

    ... market capitalization and dollar value of average daily trading volume; application of the definition of... Securities Act of 1933 (15 U.S.C. 77a et seq.) on Form F-6 (17 CFR 239.36). (d) Definitions. For purposes of... recent Form 10-K, Form 10-Q, Form 10-KSB, Form 10-QSB, or Form 20-F (17 CFR 249.310, 249.308a,...

  14. Oxygen bubble development on a platinum electrode in borosilicate glass melt by the effect of alternating current

    Czech Academy of Sciences Publication Activity Database

    Matěj, J.; Jebavá, Marcela

    2014-01-01

    Roč. 58, č. 4 (2014), s. 249-259. ISSN 0862-5468 R&D Projects: GA TA ČR TA01010844 Institutional support: RVO:67985891 Keywords : glass melt * platinum electrode * alternating current * oxygen bubble Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 0.435, year: 2014 http://www.ceramics-silikaty.cz/2014/pdf/2014_04_249.pdf

  15. Recension: Efectos personales del divorcio respecto de los hijos – Review: Personal Effects of Divorce in Relation to Children

    OpenAIRE

    Teresa Dupla Marin

    2013-01-01

    Recension: Carmen López‐Rendo Rodríguez, Efectos personales del divorcio respecto de los hijos, De Roma al Codigo civil español, RIDROM (online) 9, 2012, Pág. 249–270Review: Carmen López‐Rendo Rodríguez, Personal Effects of Divorce in Relation to Children, from Classical Rome to the Spanish Civil Code, RIDROM (online) 9, 2012, pp. 249–270

  16. Recension: Efectos personales del divorcio respecto de los hijos – Review: Personal Effects of Divorce in Relation to Children

    Directory of Open Access Journals (Sweden)

    Teresa Dupla Marin

    2013-05-01

    Full Text Available Recension: Carmen López‐Rendo Rodríguez, Efectos personales del divorcio respecto de los hijos, De Roma al Codigo civil español, RIDROM (online 9, 2012, Pág. 249–270Review: Carmen López‐Rendo Rodríguez, Personal Effects of Divorce in Relation to Children, from Classical Rome to the Spanish Civil Code, RIDROM (online 9, 2012, pp. 249–270

  17. Die Wirksamkeit der stereotaktischen Radiochirurgie und der fraktionierten stereotaktischen Radiotherapie bei Vestibularisschwannomen (Akustikusneurinomen)

    OpenAIRE

    Müllner, Stefanie Barbara

    2015-01-01

    Background: Vestibular schwannoma are benigne, slow growing tumors susceptible to various treatment regimes. Methods: From 1998 to 2008 249 patients had treatment for vestibular schwannoma using a linear accelerator. We investigated change in tumor volume as well as change in tumor specific clinical symptomsfor example like facial nerve dysfunction, tinnitus, vertigo or hearing loss. Results: Of these 249 patients 190 patients (46,3% male, 53% female, median age 59y) underwent stereot...

  18. Obstetric Outcomes in Chinese Women with Endometriosis: A Retrospective Cohort Study

    OpenAIRE

    Hong Lin; Jin-Hua Leng; Jun-Tao Liu; Jing-He Lang

    2015-01-01

    Background: The effect of endometriosis on obstetric outcomes is still ambiguous. The aim of our study was to determine the association between endometriosis and adverse obstetric outcomes in a cohort of Chinese women. Methods: A retrospective cohort study was undertaken to compare obstetric outcomes between 249 women with endometriosis and 249 women without endometriosis. All women were nulliparous and achieved singleton pregnancies naturally. Women with endometriosis were diagnosed duri...

  19. 17 CFR 270.30a-3 - Controls and procedures.

    Science.gov (United States)

    2010-04-01

    ... and procedures, within the 90-day period prior to the filing date of each report on Form N-CSR (§§ 249... to be disclosed by the investment company on Form N-CSR (§§ 249.331 and 274.128 of this chapter) and... disclosed by an investment company in the reports that it files or submits on Form N-CSR and Form N-Q...

  20. 17 CFR 240.10b-18 - Purchases of certain equity securities by the issuer and others.

    Science.gov (United States)

    2010-04-01

    ... report their repurchasing activity as required by Item 8 of Form N-CSR (17 CFR 249.331; 17 CFR 274.128... report their repurchasing activity as required by Item 703 of Regulations S-K and S-B (17 CFR 229.703 and 228.703) and Item 15(e) of Form 20-F (17 CFR 249.220f) (regarding foreign private issuers), and...

  1. Factors affecting haematological indices in free-living fish populations

    Czech Academy of Sciences Publication Activity Database

    Lusková, Věra

    1998-01-01

    Roč. 67, č. 4 (1998), s. 249-255. ISSN 0001-7213. [International ichthyohaematology conference /5./. Protivín, 30.11.1998-03.12.1998] R&D Projects: GA ČR GA514/95/0203; GA AV ČR IAA6087704 Subject RIV: EH - Ecology, Behaviour Impact factor: 0.288, year: 1998 http://vfu-www.vfu.cz/acta-vet/vol67/249-98.htm

  2. Fire exposed facades: Numerical modelling of the LEPIR2 testing facility

    OpenAIRE

    Dréan Virginie; Schillinger Renaud; Auguin Gildas

    2016-01-01

    LEPIR2 testing facility is aimed to evaluate the fire behaviour of construction solutions implemented on facade according with the experimental evaluation required by the French Technical Specification 249 (IT249) of the safety regulation. It aims to limit the risks of fire spreading by facades to upper levels. This facility involves a wood crib fire in the lower compartment of a full scale two levels high structure. Flames are coming outside from the compartment through windows openings and ...

  3. Electronic Health Record in Continuous Shared Dental Care

    Czech Academy of Sciences Publication Activity Database

    Dostálová, T.; Hanzlíček, Petr; Teuberová, Z.; Zvárová, Jana; Pieš, Martin; Nagy, Miroslav; Špidlen, Josef

    Luxembourg: Luxexpo, 2006 - (Jordanova, M.; Lievens, F.). s. 249-249 [Med-e-tel 2006. International Conference for eHealth, Telemedicine and Health ICT. 05.04.2006-07.04.2006, Luxembourg] R&D Projects: GA AV ČR 1ET200300413 Institutional research plan: CEZ:AV0Z10300504 Keywords : electronic health record * dental medicine * data model * medical informatics Subject RIV: IN - Informatics, Computer Science

  4. AcEST: DK959142 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TKQVDSRRKS 97 Query: 249 AEVTSGRGSKRAINQIMR*ESHTNAEKD 332 + T +GS + + R +NAEK+ Sbjct: 98 GDATDKQGSTQTTDTPSRR...FTSSRTSYKEKAPPSEDAPENAENNDGAEGKDTTKQVDSRRKS 97 Query: 249 AEVTSGRGSKRAINQ.../57 (3%) Frame = +3 Query: 126 LRRRTSRKVSLPLTSNRRRCHKTNARENVSDEKESSSKAKTAEVTSGR--GSKRAIN 290 +RR + VS L +NR ...R + K++LP + R +C H+T++ N S SSS + Sbjct: 62 TKTRYPDIFMREEVAMKINLPESRVQVWFKNRRAKCRQQLQHQTSSNLNSSKTSSSSSSS 121 ...+ S Sbjct: 404 ETIPENAERIMDENFKEKLEKLLEENTNTLSKENSKENTKDNTKDNAKESEAVITSKQAS 463 Query: 276 KRAINQ 293 ++A ++ Sbjct: 464 EKAASE 469 ...

  5. HIV-1 Thai B strain has spread out of former plasma donors into general population through sexual contact in Henan, China.

    Science.gov (United States)

    Li, Lin; Sun, Guoqing; Zhong, Ping; Han, Jingwan; Li, Tianyi; Jia, Dijing; Liu, Yongjian; Sun, Changrong; Wang, Zhe; Li, Hanping; Wang, Xiaolin; Li, Jingyun

    2016-04-01

    Henan, China is characterized by the outbreak of HIV epidemic of Thai B strain in former plasma donors in 1990s. After the forbidden of paid blood donation, whether Thai B strain will spread out of former plasma donors into sexual transmitted population is unknown. To answer the question, phylogenetic analysis was used to explore relationships of HIV strains circulating in those two populations in the study. HIV-1 sero-positive drug-naïve patients infected through sexual contact were enrolled into the study. Full length gag and pol genes were amplified with nested RT-PCR followed by sequencing and phylogenetic analysis. The genotypes of anti-HIV drug resistance were also analyzed with available pol genes. HIV subtypes were determined in 249 individuals from 288 participants. Subtype B was dominant (202/249, 81.1%), followed by CRF01_AE (25/249, 10.0%), CRF07_BC (14/249, 5.6%), C (4/249, 1.6%), URF (3/249, 1.2%), and CRF08_BC (1/249, 0.4%). Most of subtype B strains belong to Thailand B lineage. All of Thai B strains identified in sexual transmitted population intermixed with those from former blood donors in phylogenetic tree, suggesting close phylogenetic relationship between strains epidemic in those two populations. TDR was identified in 9.9% individuals. Thai B strain has spread out of former blood donors in Henan province. The finding will contribute to understanding the distribution and evolution of HIV-1 in Henan province and also provide clue to behavior change intervention. PMID:26381060

  6. Pseudomonas cepacia adherence to respiratory epithelial cells is enhanced by Pseudomonas aeruginosa

    International Nuclear Information System (INIS)

    Pseudomonas aeruginosa and Pseudomonas cepacia are both opportunistic pathogens of patients with cystic fibrosis. The binding characteristics of these two species were compared to determine if they use similar mechanisms to adhere to respiratory epithelial cells. P. cepacia 249 was shown to be piliated, but there was no detectable homology between P. aeruginosa pilin gene probes and P. cepacia genomic DNA. P. cepacia and P. aeruginosa did not appear to compete for epithelial receptors. In the presence of purified P. aeruginosa pili, the adherence of 35S-labeled strain 249 to respiratory epithelial monolayers was unaffected, while that of P. aeruginosa PAO1 was decreased by 55%. The binding of P. cepacia 249 and 715j was increased by 2.4-fold and 1.5-fold, respectively, in the presence of an equal inoculum of PAO1. Interbacterial agglutination contributed to the increased adherence of P. cepacia, as the binding of 249 was increased twofold in the presence of irradiated PAO1. PAO1 exoproducts had a marked effect in enhancing the ability of the P. cepacia strains to adhere to the epithelial monolayers. A PAO1 supernatant increased the binding of 249 by eightfold and that of 715j by fourfold. Thus, there appears to be a synergistic relationship between P. aeruginosa and P. cepacia in which PAO1 exoproducts modify the epithelial cell surface, exposing receptors and facilitating increased P. cepacia attachment

  7. Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

    International Nuclear Information System (INIS)

    The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for

  8. Radiological safety considerations in the design and operation of the Oak Ridge National Laboratory Transuranium Research Laboratory (TRL)

    International Nuclear Information System (INIS)

    The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure that is followed in planning and approving individual research projects. This procedure should provide an ''optimum margin of safety'' and should permit the accomplishment of successful research. Steps in the procedure are as follows: (1) Evaluate the external and internal exposure radioactivity hazards. (2) Establish any concurrent conventional industrial safety risks that may be encountered in the operation. (3) Consider, in the proper perspective, the potential consequences of possible interactions of radioactivity risks with associated industrial safety risks and problems, applying the concepts of credibility and probability. (4) Design equipment, develop operating procedures, and ensure the proficiency of operating personnel to provide necessary safeguards to accomplish programme objectives with minimum risks and minimum operational constraints. (5) Ensure that necessary safeguards are, in fact, incorporated in equipment and procedures before actual work is begun. (6) Ensure that appropriate monitoring instrumentation, surveillance, and other necessary protective technical and craft support are available and are used during operation. (7) Make certain that appropriate measures exist to manage credible radiation accidents and other emergencies properly. (8) Inform others, in sufficient detail, of the success or deficiency of design

  9. Radiochemical studies of neutron deficient actinide isotopes

    International Nuclear Information System (INIS)

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, 242Bk, was produced with a cross-section of approximately 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, αxn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,αxn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z1 + Z2 = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,αxn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of 228Pu, 230Pu, 232Cm, or 238Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes

  10. Transuranium Processing Plant semiannual report of production, status, and plans for period ending December 31, 1975

    Energy Technology Data Exchange (ETDEWEB)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-10-01

    Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity /sup 248/Cm, were separated from /sup 252/Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown /sup 248/Cm and the residual /sup 252/Cf. Eight pellets, each containing 100 ..mu..g of high-purity /sup 248/Cm were prepared for irradiation in HFIR to study the production of /sup 250/Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated.

  11. Radiochemical studies of neutron deficient actinide isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Williams, K.E.

    1978-04-01

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, /sup 242/Bk, was produced with a cross-section of approximately 10 ..mu..b in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, ..cap alpha..xn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,..cap alpha..xn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z/sub 1/ + Z/sub 2/ = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,..cap alpha..xn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of /sup 228/Pu, /sup 230/Pu, /sup 232/Cm, or /sup 238/Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes.

  12. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  13. Dicty_cDB: Contig-U16528-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 DQ925126_1( DQ925126 |pid:none) Oxymonadida environmental sample c... 243 2e-62 AF157293_1( AF157293 |pid:none) Sporodiniell...ofi... 249 2e-64 U81804_1( U81804 |pid:none) Filobasidiella neoformans translation ... 249 2e-64 AY643820_1(...57273 |pid:none) Parasitella parasitica translation... 249 3e-64 U81803_1( U81803 |pid:none) Filobasidiell...AF157260_1( AF157260 |pid:none) Mortierella multidivaricata transl... 248 7e-64 AB253792_1( AB253792 |pid:no...ongation... 247 1e-63 EU016386_1( EU016386 |pid:none) Trichoplusia ni clone L608 elo

  14. Actinide targets for the synthesis of super-heavy elements

    Science.gov (United States)

    Roberto, J. B.; Alexander, C. W.; Boll, R. A.; Burns, J. D.; Ezold, J. G.; Felker, L. K.; Hogle, S. L.; Rykaczewski, K. P.

    2015-12-01

    Since 2000, six new super-heavy elements with atomic numbers 113 through 118 have been synthesized in hot fusion reactions of 48Ca beams on actinide targets. These target materials, including 242Pu, 244Pu, 243Am, 245Cm, 248Cm, 249Cf, and 249Bk, are available in very limited quantities and require specialized production and processing facilities resident in only a few research centers worldwide. This report describes the production and chemical processing of heavy actinide materials for super-heavy element research, current availabilities of these materials, and related target fabrication techniques. The impact of actinide materials in super-heavy element discovery is reviewed, and strategies for enhancing the production of rare actinides including 249Bk, 251Cf, and 254Es are described.

  15. Differential expression of carotenoid biosynthetic pathway genes in two contrasting tomato genotypes for lycopene content

    Indian Academy of Sciences (India)

    Shilpa Pandurangaiah; Kundapura V Ravishankar; Kodthalu S Shivashankar; Avverahally T Sadashiva; Kavitha Pillakenchappa; Sunil Kumar Narayanan

    2016-06-01

    Tomato (Solanum lycopersicum L.) is one of the model plants to study the carotenoid biosynthesis. In the present study, the fruit carotenoid content were quantified at different developmental stages for two contrasting genotypes viz. IIHR-249-1and IIHR-2866 by UPLC. Lycopene content was high in IIHR-249-1(19.45 mg/100g fresh weight) compared to IIHR-2866 ((1.88 mg/100g fresh weight) at the ripe stage. qPCR was performed for genes that are involved in the carotenoid biosynthetic pathway to study the difference in lycopene content in fruits of both the genotypes. The expression of Phytoene Synthase (PSY) increased by 36 fold and Phytoene desaturase (PDS) increased by 14fold from immature green stage to ripe stage in IIHR-249-1. The expression of Chloroplast lycopene β cyclase (LCY-B) and Chromoplast lycopene β cyclase (CYC-B) decreased gradually from the initial stage to the ripe stage in IIHR-249-1. IIHR 249-1 showed 3 and 1.8 fold decrease in gene expression for Chloroplast lycopene β cyclase ((LCY-B) and Chromoplast lycopene β cyclase (CYC-B) .The F2 hybrids derived from IIHR-249-1 and IIHR-2866 were analyzed at the ripe stage for lycopene content. The gene expression of Chloroplast lycopene β cyclase (LCY-B) and Chromoplast lycopene β cyclase (CYC-B) in high and low lycopene lines from F2 progenies also showed the decrease in transcript levels of both the genes in high lycopene F2 lines. We wish to suggest that the differential expression of Lycopene β -cyclases can be used in marker assisted breeding.

  16. 轻机枪为士兵减负

    Institute of Scientific and Technical Information of China (English)

    2013-01-01

    战士打仗想得胜,除了勇敢和坚强外,武器还要轻巧好用。这不,一款新型轻机枪在美国诞生,它名叫“LSAT”轻机枪。它可真是轻啊,自重仅为4.27千克(相当于1桶食用油的重量),比有名的轻机枪M249还轻。M249重8千克。

  17. Secular evolution of exoplanetary systems and close encounters

    Czech Academy of Sciences Publication Activity Database

    Šidlichovský, Miloš; Gerlach, E.

    Cambridge: Cambridge University Press, 2008 - (Sun, Y.; Ferraz-Mello, S.; Zhou, J.), s. 479-484. (Proceedings of the International Astronomical Union. IAU S249). ISBN 978-0-521-87471-7. ISSN 1743-9213. [Symposium of the International Astronomical Union /249./. Suzhou (CN), 21.10.2007-27.10.2007] R&D Projects: GA MŠk(CZ) LC06014 Institutional research plan: CEZ:AV0Z10030501 Keywords : celestial mechanics * exoplanets * stability Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  18. Communication of nuclear data progress: No.6 Supplement (1992)

    International Nuclear Information System (INIS)

    This is a supplement to No.6 of Communication of Nuclear Data Progress (CNDP), in which the second and final part of the papers of CENDL-2 (Chinese Evaluated Nuclear Data Library, Version 2.0) is published. It includes the evaluation reports of 17 elements and isotopes with incident neutron energy from 10-5 eV to 20 MeV, they are 16O, 23Na, 31P, Ca, Zn, Mn, 59Co, Cd, In, Hf, 232Th, 235U, 239Pu, 240Pu, 241Am, 249Bk, 249Cf

  19. 新款PSP GO PSP-N1000正式发布

    Institute of Scientific and Technical Information of China (English)

    魏晓燕

    2009-01-01

    如图1所示,索尼终于在E3前发布了最新款的PSP掌上游戏机-全新的PSP GO掌上游戏机,型号为PSP—N1000。全新的PSP GO掌上游戏机在北美售价249.99美元,在欧洲售价249.99欧元,日本售价26800日元。如图2所示。

  20. PSP Go

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    索尼官方正式公布的消息,PSP新机型“PSP GO”(PSP-N1000),将于2009年10月1日在欧美和亚洲部分地区发售预定价格为249美元、249欧元,至于日版则将会延后一个月在日本发售也就是2009年的11月1日,预定发售价格为26800日元。

  1. First dedicated observations of runaway electrons in the COMPASS tokamak

    Czech Academy of Sciences Publication Activity Database

    Vlainić, M.; Mlynář, Jan; Weinzettl, Vladimír; Papřok, Richard; Imríšek, Martin; Ficker, Ondřej; Vondráček, Petr; Havlíček, Josef

    2015-01-01

    Roč. 60, č. 2 (2015), s. 249-255. ISSN 0029-5922. [Kudowa Summer School 2014 "Towards Fusion Energy"/12./. Kudowa Zdrój, 09.06.2014-13.06.2014] R&D Projects: GA MŠk(CZ) LM2011021 Institutional support: RVO:61389021 Keywords : plasma diagnostics * runaway electrons * tokamak Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.477, year: 2014 http://www.nukleonika.pl/www/back/full/vol60_2015/v60n2p249f.pdf

  2. Prompt neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    The direct determination of the average prompt neutron emission values is reviewed, and a method of comparing different sites of neutron emission multiplicity distribution values is described. Measured and recommended values are tabulated for these nuclides: 241Am, 242Am, 242Cm, 243Cm, 244Cm, 246Cm, 247Cm, 248Cm, 250Cm, 245Cm, 249Bk, 246Cf, 249Cf, 250Cf, 252Cf, 254Cf, 251Cf, 253Es, 254Es, 244Fm, 246Fm, 255Fm, 252No, 254Fm, 256Fm, 257Fm. 59 refs., 24 tabs

  3. Dicty_cDB: SFB134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1( BT075193 |pid:none) Osmerus mordax clone omor-eva-507-... 43 0.011 protein update 2009. 5.22 PSORT psg: 0.83 gvh: 0.33 alm....1 Dictyostelium discoideum chromosome 2 map 2779865-2840915 strain AX4, *** SEQUENCING IN PROGRESS ***, in ordere...t*iifiylsthpkysy*wqk*qyqlkmkisfk*iynqikqlki*nve*nlkpqf** tikf*hlmeky*imkrnyqtiqlkvvisy**qkmf*ehhnkdhnnpnnhnn...s*rqc Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VFE249 (VFE249Q)...cus clone CH230-414I23, *** SEQUENCING IN PROGRESS ***, 20 unordered pieces. 52 2

  4. 17 CFR 232.104 - Unofficial PDF copies included in an electronic submission.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Unofficial PDF copies included... Filing Requirements § 232.104 Unofficial PDF copies included in an electronic submission. (a) An... (§ 249.101 of this chapter) or a Form D (§ 239.500 of this chapter), may include one unofficial PDF...

  5. An Improved Consensus Linkage Map of Barley Based on Flow-Sorted Chromosomes and Single Nucleotide Polymorphism Markers

    Czech Academy of Sciences Publication Activity Database

    Munoz-Amatriain, M.; Moscou, M. J.; Bhat, P. R.; Bartoš, Jan; Suchánková, Pavla; Šimková, Hana; Endo, T. R.; Fenton, R. D.; Lonardi, S.; Castillo, A. M.; Doležel, Jaroslav; Close, T. J.

    2011-01-01

    Roč. 4, č. 3 (2011), s. 238-249. ISSN 1940-3372 R&D Projects: GA MŠk(CZ) LC06004; GA MŠk ED0007/01/01 Institutional research plan: CEZ:AV0Z50380511 Keywords : Chromosomes sorting * Barley * Nucleotide polymorphism Subject RIV: EB - Genetics ; Molecular Biology

  6. 78 FR 4766 - Adoption of Updated EDGAR Filer Manual

    Science.gov (United States)

    2013-01-23

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION 17 CFR Parts 232, 239, 249, 269, 274 Adoption of Updated EDGAR Filer Manual AGENCY: Securities and.... Along with the adoption of the Filer Manual, we are amending Rule 301 of Regulation S-T to provide...

  7. Liposomal formulation of alpha-tocopheryl maleamide: In vitro and in vivo toxicological profile and anticancer effect against spontaneous breast carcinomas in mice

    Czech Academy of Sciences Publication Activity Database

    Turánek, J.; Wang, X. F.; Knötigová, P.; Koudelka, Š.; Dong, L. F.; Vrublová, E.; Mahdavian, E.; Procházka, L.; Sangsura, S.; Vacek, A.; Salvatore, B. A.; Neužil, Jiří

    2009-01-01

    Roč. 237, č. 3 (2009), s. 249-257. ISSN 0041-008X R&D Projects: GA AV ČR KAN200520703; GA AV ČR(CZ) IAA500520602 Institutional research plan: CEZ:AV0Z50520701 Keywords : Liposome * apoptosis * vitamin E analogues Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 3.359, year: 2009

  8. Self-Efficacy, Gender and Trait Anxiety as Moderators of Test Anxiety

    Science.gov (United States)

    Onyeizugbo, Euckay U.

    2010-01-01

    Introduction: Test anxiety inhibits students from performing according to their full potential in academic setting. Objectives: This study investigated self-efficacy, gender and trait anxiety as moderators of test anxiety. Method: Two hundred and forty nine (249) psychology majors drawn from a university in Eastern Nigeria participated in the…

  9. Locomotor diseases among male long-haul truck drivers and other professional drivers

    DEFF Research Database (Denmark)

    Jensen, Anker; Kaerlev, Linda; Tüchsen, Finn;

    2007-01-01

    -haul truck drivers and bus drivers had higher SHR for intervertebral disc disorders (SHR: 133, 95% CI: 114-155/SHR: 141, 95% CI: 129-154, respectively) than other truck drivers (SHR: 109, 95% CI: 102-116). The SHR for carpal tunnel syndrome was high among long-haul drivers (SHR: 163, 95% CI: 101-249) and for...

  10. Literatura jako výzva k obraně subjektu

    Czech Academy of Sciences Publication Activity Database

    Kanda, Roman

    Opava: Slezská univerzita v Opavě, 2014 - (Mainx, O.), s. 242-249 ISBN 978-80-7510-131-0 Institutional support: RVO:68378068 Keywords : Kundera, Milan * Gombrowicz, Witold * modernism * post- modernism * Central European novel * Czech and Polish prose Subject RIV: AJ - Letters, Mass-media, Audiovision

  11. Andromeda's Liberation in Monastery. Kosmas Damian Asam’s Fresco Painting at Břevnov (1726) Revisited

    Czech Academy of Sciences Publication Activity Database

    Bažant, Jan

    2010-01-01

    Roč. 46, č. 46 (2010), s. 234-249. ISSN 0046-1628 R&D Projects: GA AV ČR(CZ) IAA800090902 Institutional research plan: CEZ:AV0Z90090514 Keywords : frescoes * ancient mythology * monastery * Baroque Subject RIV: AA - Philosophy ; Religion

  12. Production and investigation of thin films of metal actinides (Pu, Am, Cm, Bk, Cf)

    Science.gov (United States)

    Radchenko, V. M.; Ryabinin, M. A.; Stupin, V. A.

    2010-03-01

    Under limited availability of transplutonium metals some special techniques and methods of their production have been developed that combine the process of metal reduction from a chemical compound and preparation of a sample for examination. In this situation the evaporation and condensation of metal onto a substrate becomes the only possible technology. Thin film samples of metallic 244Cm, 248Cm and 249Bk were produced by thermal reduction of oxides with thorium followed by deposition of the metals in the form of thin layers on tantalum substrates. For the production of 249Cf metal in the form of a thin layer the method of thermal reduction of oxide with lanthanum was used. 238Pu and 239Pu samples in the form of films were prepared by direct high temperature evaporation and condensation of the metal onto a substrate. For the production of 241Am films a gram sample of plutonium-241 metal was used containing about 18 % of americium at the time of production. Thermal decomposition of Pt5Am intermetallics in vacuum was used to produce americium metal with about 80% yield. Resistivity of the metallic 249Cf film samples was found to decrease exponentially with increasing temperature. The 249Cf metal demonstrated a tendency to form preferably a DHCP structure with the sample mass increasing. An effect of high specific activity on the crystal structure of 238Pu nuclide thin layers was studied either.

  13. Production and investigation of thin films of metal actinides (Pu, Am, Cm, Bk, Cf)

    International Nuclear Information System (INIS)

    Under limited availability of transplutonium metals some special techniques and methods of their production have been developed that combine the process of metal reduction from a chemical compound and preparation of a sample for examination. In this situation the evaporation and condensation of metal onto a substrate becomes the only possible technology. Thin film samples of metallic 244Cm, 248Cm and 249Bk were produced by thermal reduction of oxides with thorium followed by deposition of the metals in the form of thin layers on tantalum substrates. For the production of 249Cf metal in the form of a thin layer the method of thermal reduction of oxide with lanthanum was used. 238Pu and 239Pu samples in the form of films were prepared by direct high temperature evaporation and condensation of the metal onto a substrate. For the production of 241Am films a gram sample of plutonium-241 metal was used containing about 18 % of americium at the time of production. Thermal decomposition of Pt5Am intermetallics in vacuum was used to produce americium metal with about 80% yield. Resistivity of the metallic 249Cf film samples was found to decrease exponentially with increasing temperature. The 249Cf metal demonstrated a tendency to form preferably a DHCP structure with the sample mass increasing. An effect of high specific activity on the crystal structure of 238Pu nuclide thin layers was studied either.

  14. Copper(I) Chelation by Tetradentate NSSN Donor Ligands: Reversible Oxidation but no Oxygenation

    Czech Academy of Sciences Publication Activity Database

    Schnödt, J.; Sieger, M.; Sarkar, B.; Fiedler, Jan; Manzur, J.; Su, Ch. Y.; Kaim, W.

    2011-01-01

    Roč. 637, 7-8 (2011), s. 930-934. ISSN 0044-2313 R&D Projects: GA ČR GA203/09/0705 Institutional research plan: CEZ:AV0Z40400503 Keywords : benzimidazole ligands * coordination geometry * copper Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.249, year: 2011

  15. Lead-vacancy-related hole centers in lead tungstate crystals

    Czech Academy of Sciences Publication Activity Database

    Laguta, Valentyn; Nikl, Martin; Zazubovich, S.

    2012-01-01

    Roč. 249, č. 11 (2012), s. 2161-2166. ISSN 0370-1972 R&D Projects: GA AV ČR IAA100100810 Institutional research plan: CEZ:AV0Z10100521 Keywords : hole centers * lead tungstate * thermally stimulated luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.489, year: 2012

  16. Distribution analysis of ultra-high molecular mass poly(ethylene oxide) containing silica particles by size-exclusion chromatography with dual light scattering and refractometric detection

    Czech Academy of Sciences Publication Activity Database

    Porsch, Bedřich; Welinder, A.; Körner, A.; Wittgren, B.

    2005-01-01

    Roč. 1068, č. 2 (2005), s. 249-260. ISSN 0021-9673 R&D Projects: GA AV ČR(CZ) KSK4050111 Keywords : size-exclusion chromatography * poly(ethylene oxide) * molecular mass distribution Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.096, year: 2005

  17. Attitudes toward Physical Education and Class Preferences of Turkish Adolescents in Terms of School Gender Composition

    Science.gov (United States)

    Koca, Canan; Asci, F. Hulya; Demirhan, Giyasettin

    2005-01-01

    The purpose of this study was to examine attitudes toward physical education (PE and PE class preferences of high school Turkish students in terms of school gender composition; 213 girls and 249 boys from coeducational public schools, and 196 girls and 210 boys from single-sex vocational schools participated in the study. The Attitudes Toward…

  18. Relative Calibration of Galileo receivers within the Time Validation Facility (TVF)

    Czech Academy of Sciences Publication Activity Database

    Piriz, A.; Rodriguez, D.; Roldan, P.; Mudrak, A.; Bauch, A.; Leute, J.; Pánek, Petr; Kuna, Alexander

    Piscataway: IEEE, 2015, s. 245-249. ISBN 978-1-4799-8865-5. [Frequency Control Symposium & the European Frequency and Time Forum (FCS), 2015 Joint Conference of the IEEE International. Denver (US), 12.04.2015-16.04.2015] Institutional support: RVO:67985882 Keywords : receiver calibration * Galileo * ground infrastructure Subject RIV: JB - Sensors, Measurment, Regulation

  19. "Euroopa viimased metslased" : eestlased saksa koloniaaldiskursis 1770-1870 / Ulrike Plath

    Index Scriptorium Estoniae

    Plath, Ulrike

    2008-01-01

    Eesti ja läti pärisorjade võrdlemisest metslastega, eestlaste "eksoteerimisest", põhjuseks keelesugulus saamide ja samojeedidega. Pikemalt Johann Georg Kohli teosest "Die Völker Europas" (1868). Baltisaksa koloniaaldiskursi kujunemisest 19. sajandil. Sisaldab bibliograafiat. Autorist lk. 249

  20. 17 CFR 243.100 - General rule regarding selective disclosure.

    Science.gov (United States)

    2010-04-01

    ... a disclosure made: (i) To a person who owes a duty of trust or confidence to the issuer (such as an...(f)(5)), that filed a report on Form 13F (17 CFR 249.325) with the Commission for the most recent... disclosed information in confidence; (iii) To the following entities solely for the purpose of...

  1. 17 CFR 243.101 - Definitions.

    Science.gov (United States)

    2010-04-01

    ..., or agent of an issuer who discloses material nonpublic information in breach of a duty of trust or confidence to the issuer shall not be considered to be acting on behalf of the issuer. (d) Promptly... or filing with the Commission a Form 8-K (17 CFR 249.308) disclosing that information. (2) An...

  2. Archeologie a hračky

    Czech Academy of Sciences Publication Activity Database

    Mašková, Pavlína

    Praha: Lidové noviny, 2014 - (Dvořáčková-Malá, D.; Zelenka, J.), s. 249-252 ISBN 978-80-7422-276-4 Institutional support: RVO:67985955 Keywords : archaeology * medieval toys * childhood Subject RIV: AB - History

  3. 76 FR 63573 - Roundtable on Issues Relating to Conflict Minerals

    Science.gov (United States)

    2011-10-13

    ... COMMISSION 17 CFR Parts 229 and 249 Roundtable on Issues Relating to Conflict Minerals AGENCY: Securities and... conflict minerals originating in the Democratic Republic of the Congo and adjoining countries. Roundtable... reporting regulations regarding the use of conflict minerals from the Democratic Republic of the Congo...

  4. 76 FR 6110 - Conflict Minerals

    Science.gov (United States)

    2011-02-03

    ... FR 80948 (December 23, 2010)]. The original comment period for Release No. 34-63547 is scheduled to... COMMISSION 17 CFR Parts 229 and 249 RIN 3235-AK84 Conflict Minerals AGENCY: Securities and Exchange... 1934 (the ``Exchange Act'') and would require any such issuer for which conflict minerals are...

  5. 25 CFR 170.471 - How are projects administered?

    Science.gov (United States)

    2010-04-01

    ... under ISDEAA, BIA will monitor performance under the requirements of 25 CFR 900.130 and 900.131(b)(9) or 25 CFR 1000.243 and 1000.249(c) and (e), as appropriate. If BIA discovers a problem during an on-site... PROGRAM Planning, Design, and Construction of Indian Reservation Roads Program Facilities Construction...

  6. 25 CFR 170.474 - Who conducts the project closeout?

    Science.gov (United States)

    2010-04-01

    ... responsible for closeout and preparing the report (1) Meet the requirements of ISDEAA;(2) Comply with 25 CFR 900.130(d) and 131(b) (10) and 25 CFR 1000.249, as applicable; (3) Be completed within 120 calendar... ROADS PROGRAM Planning, Design, and Construction of Indian Reservation Roads Program...

  7. A comparison of three activation analysis methods for iodine determination in foodstuffs

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Řanda, Zdeněk; Soukal, Ladislav

    2001-01-01

    Roč. 249, č. 1 (2001), s. 61-65. ISSN 0236-5731 R&D Projects: GA ČR GV202/97/K038; GA AV ČR KSK4055109 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.398, year: 2001

  8. The Relations between Student Motivational Beliefs and Cognitive Engagement in High School

    Science.gov (United States)

    Walker, Christopher O.; Greene, Barbara A.

    2009-01-01

    The authors examined relations among student perceptions of classroom achievement goals, self-efficacy, perceived instrumentality of classroom work, and sense of belonging within a classroom. Participants were 249 high school students. The authors also examined how cognitive engagement was predicted by those variables along with personal…

  9. Gas scrubbers used in pollution control. 1976-February, 1980 (citations from the American Petroleum Institute). Report for 1976-February 1980

    Energy Technology Data Exchange (ETDEWEB)

    Cavagnaro, D.M.

    1980-05-01

    The citations from a worldwide literature survey relate to particle and gas scrubbers. The reports discuss design, performance, gas flow characteristics, and chemistry of the pollutants. Pollution control of SO/sub 2/, NOx, CO, Co/sub 2/, hydrocarbons, and particles is considered. (This updated bibliography contains 249 abstracts, 47 of which are new entries to the previous edition.)

  10. 17 CFR 240.14a-101 - Schedule 14A. Information required in proxy statement.

    Science.gov (United States)

    2010-04-01

    ... attorneys, accountants, public relations or financial advisers, solicitors, advertising, printing..., accountant, or advertising, public relations or financial adviser, and whose activities are limited to the... in the registrant's Form 10-Q (17 CFR 249.308a) or services that are normally provided by...

  11. MOOC & B-Learning: Students' Barriers and Satisfaction in Formal and Non-Formal Learning Environments

    Science.gov (United States)

    Gutiérrez-Santiuste, Elba; Gámiz-Sánchez, Vanesa-M.; Gutiérrez-Pérez, Jose

    2015-01-01

    The study presents a comparative analysis of two virtual learning formats: one non-formal through a Massive Open Online Course (MOOC) and the other formal through b-learning. We compare the communication barriers and the satisfaction perceived by the students (N = 249) by developing a qualitative analysis using semi-structured questionnaires and…

  12. Multiple product channels in the collision-free UV photodissociation of 2-nitropropane

    Science.gov (United States)

    Radhakrishnan, G.; Parr, T.; Wittig, C.

    1984-10-01

    The one-photon, collision-free, UV (222, 249, and 308 nm) photodissociation of 2-nitropropane leads to several chemically distinct sets of products. We report the detection of OH, HONO and NO 2 and discuss mechanisms as well as implications concerning condensed phase reactions.

  13. Etude comparative d'extraction de l'huile essentielle d'Ylang-Ylang

    Czech Academy of Sciences Publication Activity Database

    Kristiawan, K.; Sobolík, Václav; Allaf, K.

    Nantes: TEC@DOC, 2004, s. 241-249. ISBN 2-7430-0754-0. [rencontres Agoral Nantes 2004 /16./. Nantes (FR), 30.11.2004-01.12.2004] Grant ostatní: DIC SME(XE) IPS/2000/00087 Institutional research plan: CEZ:AV0Z4072921 Keywords : ylang-ylang * essential oil * extraction Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  14. EST Table: FY020340 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 7 11/11/04 79 %/249 aa gnl|Amel|GB19218-PA 11/11/04 75 %/246 aa gi|189241909|ref|XP_970822.2| PREDICTED: similar to Darkener of apricot CG33553-PG [Tribolium castaneum] FS779323 bmov ...

  15. Using Fun in the Statistics Classroom: An Exploratory Study of College Instructors' Hesitations and Motivations

    Science.gov (United States)

    Lesser, Lawrence M.; Wall, Amitra A.; Carver, Robert H.; Pearl, Dennis K.; Martin, Nadia; Kuiper, Shonda; Posner, Michael A.; Erickson, Patricia; Liao, Shu-Min; Albert, Jim; Weber, John J., III

    2013-01-01

    This study examines statistics instructors' use of fun as well as their motivations, hesitations, and awareness of resources. In 2011, a survey was administered to attendees at a national statistics education conference, and follow-up qualitative interviews were conducted with 16 of those ("N" = 249) surveyed to provide further…

  16. ABA and Diverse Cultural and Linguistic Environments: A Welsh Perspective

    Science.gov (United States)

    Jones, E. W.; Hoerger, M.; Hughes, J. C.; Williams, B. M.; Jones, B.; Moseley, Y.; Hughes, D. R.; Prys, D.

    2011-01-01

    Gwynedd Local Education Authority (LEA) in North West Wales, UK, is funding a small-scale autism-specific specialist education service using ABA methodology. The program is available through the medium of Welsh, English or bilingually, depending on the individual needs of the child (Jones and Hoerger in Eur J Behav Anal 10:249-253, "2009").…

  17. Bk and Cf chromatographic separation and ²⁴⁹Bk/²⁴⁸Cm and ²⁴⁹Cf/²⁴⁸Cm elemental ratios determination by inductively coupled plasma quadrupole mass spectrometry.

    Science.gov (United States)

    Gourgiotis, A; Isnard, H; Nonell, A; Aubert, M; Stadelmann, G; Dupont, E; AlMahamid, I; Tiang, G; Rao, L; Lukens, W; Cassette, P; Panebianco, S; Letourneau, A; Chartier, F

    2013-03-15

    The French Atomic Energy Commission has carried out several experiments for the study of minor-actinide transmutation processes in high intensity thermal neutron flux. In this context a Cm sample enriched in (248)Cm (∼97%) was irradiated in a thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). The precise and accurate determination of Cf isotope ratios and of (249)Bk/(248)Cm and (249)Cf/(248)Cm elemental ratios in the (248)Cm irradiated sample is crucial for the calculation of actinide neutron capture cross-sections. This work describes an analytical procedure for the separation and the isotope ratio measurement of Bk and Cf in the irradiated sample. The Bk and Cf separation is based on a lanthanides separation protocol previously developed by the laboratory. Well-defined retention times for Bk and Cf were obtained by coupling the Ionic Chromatography (IC) with an ICP-QMS. All conditions of element separation by IC and the different steps of the analytical protocol in order to obtain the isotopic and elemental ratios are presented. Relative uncertainties of Cf isotopic ratios range from 0.3% to 0.5% and the uncertainty of the (249)Bk/(248)Cm and (249)Cf/(248)Cm elemental ratios are respectively 6.1% and 3.2%. This level of uncertainty for both isotopic and elemental ratios is in perfect agreement with the requirement for transmutation studies. PMID:23598093

  18. Degradation of PET, PEEK and PI induced by irradiation with 150 keV Ar+ and 1.76 MeV He+ ions

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Havránek, Vladimír; Švorčík, V.; Suzuki, T.; Djourelov, N.

    2005-01-01

    Roč. 240, 1/2 (2005), s. 245-249. ISSN 0168-583X R&D Projects: GA MŠk(CZ) OC 527.100 Institutional research plan: CEZ:AV0Z10480505 Keywords : irradiated polymers * ion beam modification * ERDA Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.181, year: 2005

  19. AcEST: DK951813 [AcEST

    Lifescience Database Archive (English)

    Full Text Available dase OS=Pinus pinaster GN... 332 7e-90 tr|B8XF08|B8XF08_ONCHC Ascorbate peroxidase OS=Oncidium Gower Ra... 3...CHC Ascorbate peroxidase OS=Oncidium Gower Ramsey PE=2 SV=1 Length = 249 Score = 332 bits (850), Expect = 1e

  20. 75 FR 64752 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-10-20

    .... Extension: Form N-CSR, SEC File No. 270-512, OMB Control No. 3235-0570. Notice is hereby given that... extension of the previously approved collection of information discussed below. Form N-CSR (17 CFR 249.331... N-CSR is to be used for reports under Section 30(b)(2) of the Investment Company Act and Section...

  1. Measurements of phytoplankton of sub-nanomolar chlorophyll concentrations by a modified double-modulation fluorometer

    Czech Academy of Sciences Publication Activity Database

    Dijkman, N.; Kaftan, David; Trtílek, M.; Nedbal, Ladislav

    1999-01-01

    Roč. 37, č. 2 (1999), s. 249-254. ISSN 0300-3604. [Regional Photosynthesis Workshop /2./. Lipno, 31.01.1999-03.02.1999] R&D Projects: GA MŠk OK 271 Grant ostatní: INCO-COPERNICUS(EC) IC15CT95-0105 Subject RIV: BO - Biophysics Impact factor: 0.734, year: 1999

  2. Domain Modeling: NP_001020371.3 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_001020371.3 chr16 Eukaryotic proteases d1bmla_ chr16/NP_001020371.3/NP_001020371.3..._apo_16-263.pdb d1buib_ chr16/NP_001020371.3/NP_001020371.3_holo_16-263.pdb blast 28L,29S,249V,250A 34I,35

  3. Species and hybrid richness in spined loaches of the genus Cobitis (Teleostei:Cobitidae), with a checklist of European forms and suggestions for conservation

    Czech Academy of Sciences Publication Activity Database

    Bohlen, Jörg; Ráb, Petr

    2001-01-01

    Roč. 59, - (2001), s. 75-89. ISSN 0022-1112 R&D Projects: GA ČR GA206/00/0668; GA AV ČR KSK6005114 Keywords : biodiversity * unisexual fish * conservation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.249, year: 2001

  4. Complete Genome Sequence of Corynebacterium camporealensis DSM 44610, Isolated from the Milk of a Manchega Sheep with Subclinical Mastitis.

    Science.gov (United States)

    Rückert, Christian; Albersmeier, Andreas; Winkler, Anika; Tauch, Andreas

    2015-01-01

    Corynebacterium camporealensis has been isolated in pure culture from milk samples of dairy sheep affected by subclinical mastitis. The complete genome sequence of the type strain DSM 44610, recovered from milk of a Manchega sheep, comprises 2,451,810 bp with a mean G+C content of 59.41% and 2,249 protein-coding genes. PMID:26021938

  5. Comparison of Inhibitory Mold Agar to Sabouraud Dextrose Agar as a Primary Medium for Isolation of Fungi▿

    OpenAIRE

    Scognamiglio, Theresa; Zinchuk, Riva; Gumpeni, Pramod; Larone, Davise H.

    2010-01-01

    Clinical specimens cultured on two selective fungal media, inhibitory mold agar (IMA) and Sabouraud dextrose agar (SDA), were compared with respect to recovery of fungi. Of the 840 fungal isolates recovered, 69.3% grew on both IMA and SDA; 24.9% grew only on IMA; and 5.8% grew only on SDA, showing that IMA is superior (P = 0.003).

  6. The effectiveness of selected housing subsidies in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Lux, Martin; Sunega, Petr; Boelhouwer, P.

    2009-01-01

    Roč. 24, č. 3 (2009), s. 249-269. ISSN 1566-4910 R&D Projects: GA ČR GA403/09/1915 Institutional research plan: CEZ:AV0Z70280505 Keywords : Housing policy * Welfare economics * Subsidy effectiveness Subject RIV: AH - Economics http://www.springerlink.com/content/y8km555k622v8vu0/

  7. Measurement equivalence of the dispositional resistance to change scale

    Czech Academy of Sciences Publication Activity Database

    Oreg, S.; Bayazıt, M.; Vakola, M.; Arciniega, L.; Armenakis, A.; Barkauskiene, R.; Bozionelos, N.; Fujimoto, Y.; González, L.; Han, J.; Hřebíčková, Martina; Jimmieson, N.; Kordačová, J.; Mitsuhashi, H.; Mlačić, B.; Ferič, I.; Kotrla Topič, M.; Ohly, S.; Oystein Saksvik, P.; Hetland, H.; Saksvik, I.B.; van Dam, K.

    New York : Routledge, 2011 - (Davidov, E.; Schmidt, P.; Billiet, J.), s. 249-278 ISBN 978-1-84872-823-3 R&D Projects: GA AV ČR IAA700250702 Institutional research plan: CEZ:AV0Z70250504 Keywords : dispositional resistance to change * measurement * validation across cultures Subject RIV: AN - Psychology

  8. Experience in the separation and purification of transplutonium elements in the transuranium processing plant at the Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    Since 1966, TRU has been the main center of production for transcurium elements in the US, producing 460 mg 249Bk, 4 g 252Cf, 18 mg 253Es, and 10 pg 257Fm. During the 14 years operation, 39 chemical processing campaigns were conducted to process 265 HFIR targets and 195 SRP production reactor targets

  9. 75 FR 28228 - Federal Acquisition Regulation; FAR Case 2009-031, Terminating Contracts

    Science.gov (United States)

    2010-05-20

    ... Federal Acquisition Regulation; FAR Case 2009-031, Terminating Contracts AGENCIES: Department of Defense... Regulations Council (Councils) are proposing to amend the Federal Acquisition Regulation (FAR) to provide clarification to the prescription for the FAR clause at 52.249-1, Termination for Convenience of the...

  10. Analysis of the Decision Making in the Personnel Selection Process

    Czech Academy of Sciences Publication Activity Database

    Navrátil, Marek; Klimusová, Helena

    Lanškroun: GOSC Group, s.r.o., 2001. s. 249. [The Tenth European Congress on Work and Organizational Psychology. 16.05.2001-19.05.2001, Praha] Institutional research plan: CEZ:AV0Z7025918 Keywords : Personnel Selection Process * Judgement Analysis * Decision-making process Subject RIV: AN - Psychology

  11. Hemoglobin, Growth, and Attention of Infants in Southern Ethiopia

    Science.gov (United States)

    Aubuchon-Endsley, Nicki L.; Grant, Stephanie L.; Berhanu, Getenesh; Thomas, David G.; Schrader, Sarah E.; Eldridge, Devon; Kennedy, Tay; Hambidge, Michael

    2011-01-01

    Male and female infants from rural Ethiopia were tested to investigate relations among hemoglobin (Hb), anthropometry, and attention. A longitudinal design was used to examine differences in attention performance from 6 (M = 24.9 weeks, n = 89) to 9 months of age (M = 40.6 weeks, n = 85), differences hypothesized to be related to changes in iron…

  12. Vizuální kultura: mezi lokálním a globálním pohledem

    Czech Academy of Sciences Publication Activity Database

    Kreuzzieger, Milan

    Dolní Břežany : Scriptorium, 2007 - (Prahl, R.; Winter, T.), 23-27, 248-249 ISBN 978-80-86197-89-0 Institutional research plan: CEZ:AV0Z90090514 Keywords : global isation * visual culture * history of art Subject RIV: AA - Philosophy ; Religion

  13. Physical Activity of Male and Female Adolescents Living in a Town and a City in the Context of Public Health Recommendations

    Science.gov (United States)

    Mynarski, Wladyslaw; Nawrocka, Agnieszka; Rozpara, Michal; Garbaciak, Wieslaw

    2012-01-01

    Study aim: To assess the physical activity of male and female adolescents from Poland living in a town (Czechowice-Dziedzice) and in a city (Katowice). Material and methods: The research involved 431 high school students aged 16-18 years (249 from Czechowice-Dziedzice and 182 from Katowice). Physical activity was measured by the short form of the…

  14. Dicty_cDB: Contig-U14580-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14580-1 no gap 249 5 1838993 1838745 MINUS 1 2 U14580 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show C ... 2 1.6 2 ( DD293979 ) SUSCEPTIBILITY GENE FOR HUMAN STROKE ; METHODS OF ... 44 2.2 1 ( AX573239 ) Sequence 85 ...

  15. Joint location and source mechanism inversion of microseismic events: benchmarking on seismicity induced by hydraulic fracturing

    Czech Academy of Sciences Publication Activity Database

    Anikiev, D.; Valenta, Jan; Staněk, František; Eisner, Leo

    2014-01-01

    Roč. 198, č. 1 (2014), s. 249-258. ISSN 0956-540X R&D Projects: GA ČR GAP210/12/2451 Institutional support: RVO:67985891 Keywords : inverse theory * probability distributions * wave scattering and diffraction * fractures and faults Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.724, year: 2013

  16. Establishment of target and invasive plant species on a reclaimed coal mining dump in relation to their occurrence in the surroundings

    Czech Academy of Sciences Publication Activity Database

    Kabrna, M.; Hendrychová, M.; Prach, Karel

    2014-01-01

    Roč. 28, č. 4 (2014), s. 242-249. ISSN 1748-0930 R&D Projects: GA ČR(CZ) GAP505/11/0256 Institutional support: RVO:67985939 Keywords : mining * reclamation * vascular plants Subject RIV: EH - Ecology, Behaviour Impact factor: 0.562, year: 2014

  17. 77 FR 50114 - Food and Drug Administration Modernization Act of 1997: Modifications to the List of Recognized...

    Science.gov (United States)

    2012-08-20

    .... Radiology 12-102 ANSI/IESNA RP-27.2-00 CFR citation and product Recommended Practice for codes, devices.... Radiology 12-249 Photobiological safety of IEC 62471 First lamps and lamp systems. edition 2006-07. I... the Federal Register of February 25, 1998 (63 FR 9561), FDA announced the availability of a...

  18. 12 CFR 335.311 - Forms for annual, quarterly, current, and other reports of issuers.

    Science.gov (United States)

    2010-01-01

    ... Results of Operations can be found at 17 CFR 229.300. Industry Guide 3, Statistical Disclosure by Bank..., and other reports are codified in subpart D of 17 CFR part 249. All forms shall be filed with the FDIC... for Financial Statements can generally be found in Regulation S-X (17 CFR part 210). Banks may...

  19. HEMATOPOIETIC SYSTEM

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    12.1 Leukocyte and leukocyte function2003360 Expression of vascular endothelial growth factor and its receptors KDR and Fltl in acute myeloid leukemia. WANG Yi(王一), et al. Instit Hematol, CAMS & PUMC, Tianjin 300020. Chin J Hematol 2003;24(5):249-252Objective: To evaluate the expression of vascular endothelial growth factor (VEGF) and its receptors KDR

  20. QTL Information Table: 198 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available Morphological trait Panicle/flower grains/plant RFLP C)Interval RIL Lemont Teqing A G249 RG418 p ... c Loci Are the Primary Genetic Basis of Inbreeding Depression ... and Heterosis in Rice. II. Grain Yield Components. ...

  1. Birth weight and systolic blood pressure in adolescence and adulthood

    DEFF Research Database (Denmark)

    Gamborg, Michael; Byberg, Liisa; Rasmussen, Finn;

    2007-01-01

    The authors investigated the shape, sex- and age-dependency, and possible confounding of the association between birth weight and systolic blood pressure (SBP) in 197,954 adults from 20 Nordic cohorts (birth years 1910-1987), one of which included 166,249 Swedish male conscripts. Random...

  2. Occupational Employment in Nuclear-Related Activities, 1981.

    Science.gov (United States)

    Baker, Joe G.; Olsen, Kathryn

    Employment in nuclear- and nuclear energy-related activities in 1981 was examined and compared to that in previous years. Survey instruments were returned by 784 establishments. Total 1981 nuclear-related employment was estimated to be 249,500--a growth of 22,600 (10%) workers over the 1977 total. Government-owned, contractor-operated (GOCO)…

  3. Nuclear power plant decommissioning. January 1972-September 1989 (Citations from the NTIS data base). Report for January 1972-September 1989

    International Nuclear Information System (INIS)

    This bibliography contains citations concerning nuclear power plant phase-out and decommissioning. Included are case histories of the dismantling process, hazardous-waste management, site monitoring, and economic aspects of the phase-out. (This updated bibliography contains 249 citations, 71 of which are new entries to the previous edition.)

  4. Myths and Misconceptions in Popular Psychology: Comparing Psychology Students and the General Public

    Science.gov (United States)

    Furnham, Adrian; Hughes, David J.

    2014-01-01

    This study examined the prevalence of psychological myths and misconceptions among psychology students and within the general population. In total, 829 participants completed a 249-item questionnaire designed to measure a broad range of psychological myths. Results revealed that psychological myths and misconceptions are numerous and widely held.…

  5. K názvům moruše ve slovanských jazycích

    Czech Academy of Sciences Publication Activity Database

    Janyšková, Ilona

    Warszawa : Instytut Slawistyki PAN, Fundacja Slawistyczna, 2014 - (Jakubowicz, M.; Raszewska-Zurek, B.), s. 249-260 ISBN 978-83-64031-07-6 R&D Projects: GA ČR GA13-17435S Institutional support: RVO:68378092 Keywords : Slavonic languages * etymology * semantics * names of trees * mulberry Subject RIV: AI - Linguistics

  6. Cyanobacterial water bloom of Limnoraphis robusta in the Lago Mayor of Lake Titicaca. Can it develop?

    Czech Academy of Sciences Publication Activity Database

    Komárková, Jaroslava; Montoya, H.; Komárek, J.

    2016-01-01

    Roč. 764, č. 1 (2016), s. 249-258. ISSN 0018-8158 Institutional support: RVO:60077344 Keywords : Titicaca Lake * cyanobacterial water bloom * Limnoraphis robusta * Diazocytes * Atitlan Lake * N:P ratio Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.275, year: 2014

  7. A general method for the calculation of absolute trace gas concentrations in air and breath from selected ion flow tube mass spectrometry data

    Czech Academy of Sciences Publication Activity Database

    Španěl, Patrik; Dryahina, Kseniya; Smith, D.

    249-250, - (2006), s. 230-239. ISSN 1387-3806 R&D Projects: GA ČR GA202/03/0827 Institutional research plan: CEZ:AV0Z40400503 Keywords : selected ion flow tube * mass spectrometry * SIFT-MS * trace gas analysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.337, year: 2006

  8. QTL Information Table: 42 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available qGW5 Morphological trait Seed 1,000-grain weight SSR d)Co-segregated BC4F4 Guichao 2 Chinese com ... rufipogon Griff.) A RM249 pha Tian, F., Li, D.J., Fu , Q., Zhu, Z.F., Fu , Y.C., Wang, X.K., and Sun, C.Q ...

  9. Pesticide residues in fruit and vegetables from Africa - a Nordic Project

    DEFF Research Database (Denmark)

    Petersen, Annette

    . Most of the samples came from South Africa (249), followed by Egypt (129), Morocco (92) and Kenya (88). In total 45 different commodities were analyzed, oranges (162) being the largest group, followed by beans with pods (80) and table grapes (71). In the analytical scope 220 to 345 pesticides and...

  10. Use of asthma medication during pregnancy and risk of specific congenital anomalies

    DEFF Research Database (Denmark)

    Garne, Ester; Hansen, Anne Vinkel; Morris, Joan;

    2015-01-01

    addition, exploratory analyses were done for each nonsignal anomaly. The data set included 76,249 registrations of congenital anomalies from 13 EUROmediCAT registries. RESULTS: Cleft palate (OR, 1.63; 95% CI, 1.05-2.52) and gastroschisis (OR, 1.89; 95% CI, 1.12-3.20) had significantly increased odds of...

  11. Clinical and cytogenetic features of a population-based consecutive series of 285 pediatric T-cell acute lymphoblastic leukemias: rare T-cell receptor gene rearrangements are associated with poor outcome

    DEFF Research Database (Denmark)

    Karrman, Kristina; Forestier, Erik; Heyman, Mats; Andersen, Mette K; Autio, Kirsi; Blennow, Elisabeth; Borgström, Georg; Ehrencrona, Hans; Golovleva, Irina; Heim, Sverre; Heinonen, Kristiina; Hovland, Randi; Johannsson, Johann H; Kerndrup, Gitte; Nordgren, Ann; Palmqvist, Lars; Johansson, Bertil

    2009-01-01

    Clinical characteristics and cytogenetic aberrations were ascertained and reviewed in a population-based consecutive series of 285 pediatric T-cell acute lymphoblastic leukemias (T-ALLs) diagnosed between 1992 and 2006 in the Nordic countries. Informative karyotypic results were obtained in 249 (...

  12. The Developmental Trajectories of Executive Function of Children and Adolescents with Attention Deficit Hyperactivity Disorder

    Science.gov (United States)

    Qian, Ying; Shuai, Lan; Chan, Raymond C. K.; Qian, Qiu-Jin; Wang, Yufeng

    2013-01-01

    This study examined the developmental trajectories of executive function (EF) of children and adolescents with Attention Deficit Hyperactivity Disorder (ADHD) in Han Chinese. Five hundred and fifteen children and adolescents with ADHD and 249 healthy controls took part in this study. All of them were administered four EF tests capturing…

  13. DNA instability in low-risk myelodysplastic syndromes: refractory anemia with or without ring sideroblasts.

    Czech Academy of Sciences Publication Activity Database

    Novotná, Božena; Neuwirtová, R.; Šišková, M.; Bagryantseva, Yana

    2008-01-01

    Roč. 17, č. 14 (2008), s. 2144-2149. ISSN 0964-6906 R&D Projects: GA MZd NR8265 Institutional research plan: CEZ:AV0Z50390512 Keywords : Anemia * DNA Subject RIV: FD - Oncology ; Hematology Impact factor: 7.249, year: 2008

  14. KSČ a věda. Hlavní koncepty vědní politiky v Československu 1945-1989

    Czech Academy of Sciences Publication Activity Database

    Kostlán, Antonín

    Praha : Ústav pro soudobé dějiny AV ČR, 2012 - (Kalous, J.; Kocian, J.), s. 239-249 ISBN 978-80-7285-156-0 R&D Projects: GA ČR GA409/08/1621 Institutional support: RVO:68378114 Keywords : Communist Party of Czechoslovakia * science policy Subject RIV: AB - History

  15. Diel variations in the photosynthetic parameters of Prochlorococcus strain PCC 9511: Combined effects of light and cell cycle

    Czech Academy of Sciences Publication Activity Database

    Bruyant, F.; Babin, M.; Genty, B.; Prášil, Ondřej; Behrenfeld, M. J.; Claustre, H.; Bricaud, A.; Garczarek, L.; Holtzendorff, J.; Koblížek, Michal; Doušová, Helena; Partensky, F.

    2005-01-01

    Roč. 50, č. 3 (2005), s. 850-863. ISSN 0024-3590 R&D Projects: GA MŠk LN00A141 Institutional research plan: CEZ:AV0Z50200510 Keywords : prochlorococcus * phytoplankton Subject RIV: EE - Microbiology, Virology Impact factor: 3.249, year: 2005

  16. Současné psychologické přístupy k autobiografické paměti

    Czech Academy of Sciences Publication Activity Database

    Vlčková, Irena; Čermák, Ivo

    Brno: Psychologický ústav AV ČR, 2006, s. 243-249. [Kognice 2006. Praha (CZ), 06.10.2006-07.10.2006] Institutional research plan: CEZ:AV0Z70250504 Keywords : autobiographical memory * self-story * cognitive psychology Subject RIV: AN - Psychology

  17. Diskurzivní analýza v soudobé sociální psychologii: teorie, koncepty a aplikace

    Czech Academy of Sciences Publication Activity Database

    Zábrodská, Kateřina

    2010-01-01

    Roč. 54, č. 3 (2010), s. 249-262. ISSN 0009-062X R&D Projects: GA ČR GPP407/10/P146 Institutional research plan: CEZ:AV0Z70250504 Keywords : discourse analysis * conversation analysis * critical discursive psychology Subject RIV: AN - Psychology Impact factor: 0.230, year: 2010

  18. Academic Expectations and Actual Achievements: The Roles of Hope and Effort

    Science.gov (United States)

    Levi, Uzi; Einav, Michal; Ziv, Orit; Raskind, Ilana; Margalit, Malka

    2014-01-01

    This study sought to extend the research on adolescents' hope, academic expectations, and average grades. The hope theory (Snyder, "Psychological Inquiry" 13(4):249-275, 2002), the salutogenic paradigm (with a focus on sense of coherence (SOC) (Antonovsky 1987)), and Bandura's ("Journal of Management" 38(1):9-44,…

  19. Osteoporosis or Low Bone Mass at the Femur Neck or Lumbar Spine in Older Adults: United States, 2005-2008

    Science.gov (United States)

    ... HW, Dunn WL, Calvo MS, et al. Updated data on proximal femur bone mineral levels of U.S. adults. Osteoporos Int 8:468–89. 1998. Kelly TJ. Bone mineral density reference databases for American men and women. J Bone Miner Res 5 (Suppl1):S249. 1990. Centers for Disease ...

  20. Investigation of Problem Solving Ability of Students in School of Physical Education and Sports (Kafkas University Sample)

    Science.gov (United States)

    Ozmutlu, Ilker

    2014-01-01

    The aim of this research is to examine the problem solving abilities of School of Physical Education and Sports students. To achieve this aim, in the academic year 2013-2014, a research group did a study of 433 students of the School of Physical Education and Sports, Kafkas University. This sample consisted of 184 female and 249 male students.…

  1. The shear-flow properties of electro-rheological liquid polymeric blends

    Czech Academy of Sciences Publication Activity Database

    Říha, Pavel; Kimura, H.; Aikawa, K.; Masubuchi, Y.; Takimoto, J.; Koyama, K.

    1999-01-01

    Roč. 85, 2-3 (1999), s. 249-256. ISSN 0377-0257 R&D Projects: GA AV ČR IAA2060703 Keywords : electro-rheological effect * urethane- modified polypropylene glycol/dimethylsiloxane liquid blend * stochastic process * Maxwell-like rheological equation Subject RIV: BK - Fluid Dynamics Impact factor: 1.861, year: 1999

  2. Preface to the injection tables

    International Nuclear Information System (INIS)

    Twelve groups of dogs received intravenous injections of various doses of 226Ra, 239Pu, 228Ra, 228Th, 90Sr, 241Am, 249Cf, or 252Cf at approximately 17 months of age. The animals were euthanized when death appeared imminent. Data are presented on the calculated radiation dose to the skeleton and pathological changes observed at autopsy

  3. Information Systems and Technology Sourcing Strategies and Performance of E-Retailers

    Science.gov (United States)

    Tsai, Juliana Yuh-Shun

    2012-01-01

    The e-Retail industry has grown rapidly over the last few years and is projected to continue its upward trend as consumers shift from traditional channels to online channels. In March 2010, Forrester Research forecasted that online retail sales will grow by 10% a year for the next 5 years and e-Retail sales will amount to $249 billion by 2014.…

  4. Best Practices in Faculty Development in North American Higher Education: Distinctions and Dilemmas.

    Science.gov (United States)

    King, Kathleen P.; Lawler, Patricia A.

    2003-01-01

    Uses quantitative and qualitative methods to analyze interview and survey data concerning best practices, goals, purposes, and influences among faculty developers in the U.S. and Canada. Presents the current state of the field, an interpretation of its meaning, and recommendations for future directions. Authors sent out 976 surveys; 249 were…

  5. EST Table: FY754787 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY754787 E_FL_famL_16C13_R_0 11/11/04 47 %/249 aa ref|XP_001606351.1| PREDICTED: similar to MGC6 ... .1| PREDICTED: similar to regulator of microtubule dynamics ... 1 [Tribolium castaneum] FS783762 famL ...

  6. Measuring Attitude Functions.

    Science.gov (United States)

    Anderson, Deborah S.; Kristiansen, Connie M.

    1990-01-01

    Discusses the Attitude Functions Inventory (AFI), which assesses the extent to which a person's attitude fulfills each of four psychological functions. Reports findings of a study, involving 249 undergraduates, that tested the construct validity of the AFI. Suggests that the AFI provides conceptually meaningful measures of the functions of…

  7. Evaluation of flooring produced from small diameters logs of Eucalyptus sp. clones

    Directory of Open Access Journals (Sweden)

    José Reinaldo Moreira da Silva

    2010-12-01

    Full Text Available This study evaluated two Eucalyptus clones, MN 249 and MN 89, for the flooring production using small diameters logs. It was considered the wood physical properties - NBR 7190/97 (ABNT, 1997 and simulation of the product in service (ASTM D 2394/83 with two thicknesses, 8 and 14 mm. The basic density of the clone 89 NM was the highest one (0,615 g/cm3. The contractions were more pronounced in clone NM 249, however, the anisotropy coefficient of this clone was small. In the simulation tests, the floor produced by clone MN 249 presented the lowest deformation rate. The floor of 8 mm, in addition to the differences between clones, there was significant interaction between the positions for the indentation test caused by loads applied in small areas. The deformations obtained for the floor with 14 mm thickness, produced with the MN clone 89, were higher than those found in the literature for the indentation load applied on a small area test. The clone MN 249 presented the best results in both thicknesses.

  8. Corporate Governance Country Assessment : Chile

    OpenAIRE

    World Bank

    2003-01-01

    Chile's equity market is fairly large and successful. The market capitalization of the 249 listed firms represented 89 percent of GDP at year-end, 2001. Corporate ownership is concentrated and pyramid structures are common. Business groups/conglomerates are the predominant corporate form. Institutional investors, especially pension funds, are active equity investors. The Securities Market ...

  9. "I Like to Plan Events": A Document Analysis of Essays Written by Applicants to a Public Relations Program

    Science.gov (United States)

    Taylor, Ronald E.

    2016-01-01

    A document analysis of 249 essays written during a 5-year period by applicants to a public relations program at a major state university in the southeast suggests that there are enduring reasons why students choose to major in public relations. Public relations is described as a major that allows for and encourages creative expression and that…

  10. AcEST: BP915463 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_H06 283 Adiantum capillus-veneris mRNA. clone: YMU001_000071_H06. BP915463 CL1305C ... Frame = +1 Query: 97 ADGHTFQVDSNHSVHG*LCWLP--LSSS*AVC TKSLTKGFDYVDSNPRAWIAK 249 A GHT H + + W P + AVC ... KS ... VD+ R WIAK Sbjct: 302 AKGHTSPKRRTHGILTGVIWSPDKAGGNRAVC RKSTDGTYAYVDNTTRKWIAK 354 ...

  11. Helical screw type magnetic structure of the multiferroic CaMn.sub.7./sub.O.sub.12./sub. with low Cu-doping

    Czech Academy of Sciences Publication Activity Database

    Slawinski, W.; Przenioslo, R.; Sosnowska, I.; Petříček, Václav

    2012-01-01

    Roč. 68, č. 3 (2012), s. 240-249. ISSN 0108-7681 Grant ostatní: AV ČR(CZ) Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : magnetic modulated structure * powder neutron scattering * structural refinement Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.175, year: 2012

  12. Ultraviolet photodissociation of the van der Waals dimer (CH3I)(2) revisited. II. Pathways giving rise to neutral molecular iodine

    NARCIS (Netherlands)

    Vidma, K.V.; Baklanov, A.V.; Zhang, Y.W.; Parker, D.H.

    2006-01-01

    The formation of neutral I-2 by the photodissociation of the methyl iodide dimer, (CH3I)(2), excited within the A band at 249.5 nm is evaluated using velocity map imaging. In previous work [J. Chem. Phys. 122, 204301 (2005)], we showed that the formation of I-2(+) from photodissociation of the methy

  13. Financial Information Source, Knowledge, and Practices of College Students from Diverse Backgrounds

    Science.gov (United States)

    Mimura, Yoko; Koonce, Joan; Plunkett, Scott W.; Pleskus, Lindsey

    2015-01-01

    Using cross-sectional data, we examined the financial information sources, financial knowledge, and financial practices of young adults, many of whom are first generation college students, ethnic minorities, and immigrants or children of immigrants. Participants (n = 1,249) were undergraduate students at a large regional comprehensive university.…

  14. Information Activities and Appropriation in Teacher Trainees' Digital, Group-Based Learning

    Science.gov (United States)

    Hanell, Fredrik

    2016-01-01

    Introduction: This paper reports results from an ethnographic study of teacher trainees' information activities in digital, group-based learning and their relation to the interplay between use and appropriation of digital tools and the learning environment. Method: The participants in the present study are 249 pre-school teacher trainees in…

  15. ISOLATION OF TOXOPLASMA GONDII FROM ANIMALS IN DURANGO, MEXICO

    Science.gov (United States)

    Little is known concerning the epidemiology of Toxoplasma gondii infection in people and animals in rural Mexico. Serum samples and tissues from 150 dogs, 150 cats, 65 opossums (Didelphis virginianus), 249 rats (Rattus spp.), 127 mice (Mus musculus), and 69 squirrels (Spermophilus variegatus) from t...

  16. Vliv vegetačního krytu na disipaci energie a vodní režim v krajině - dopady na interakce biotických a abiotických složek v povrchových vodách

    Czech Academy of Sciences Publication Activity Database

    Pechar, Libor; Pokorný, Jan; Procházka, J.; Wotavová, K.; Pecharová, E.; Švehla, J.

    2004-01-01

    Roč. 3, č. 21 (2004), s. 249-255. ISSN 1212-0731. [Agroregion 2004. České Budějovice, 06.09.2004-07.09.2004] Institutional research plan: CEZ:AV0Z6087904 Keywords : Landscape function * water cycle * remote sensing Subject RIV: DO - Wilderness Conservation

  17. Temporal in vitro expansion of the luminal lineage of human mammary epithelial cells achieved with the 3T3 feeder layer technique

    Czech Academy of Sciences Publication Activity Database

    Matoušková, Eva; Dudorkinová, D.; Krásná, Luboslava; Veselý, Pavel

    2000-01-01

    Roč. 60, č. 3 (2000), s. 241-249. ISSN 0167-6806 R&D Projects: GA ČR GA312/97/1222; GA MZd NC5614; GA AV ČR KSK2039602 Institutional research plan: CEZ:AV0Z5052915 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.720, year: 2000

  18. Bacterial Surface Display of Metal-Binding Sites

    Czech Academy of Sciences Publication Activity Database

    Kotrba, P.; Rulíšek, Lubomír; Ruml, T.

    Dordrecht: Springer, 2011 - (Kotrba, P.; Macková, M.; Macek, T.), s. 249-283 ISBN 978-94-007-0442-8 Grant ostatní: GA MŠk(CZ) 1M0520 Institutional research plan: CEZ:AV0Z40550506 Keywords : bioremediation * biosorption * metal-binding peptide * cell-surface display Subject RIV: EI - Biotechnology ; Bionics

  19. 76 FR 71872 - Rescission of Outdated Rules and Forms, and Amendments To Correct References

    Science.gov (United States)

    2011-11-21

    ... Accountants, Accounting, Securities. 17 CFR Parts 229, 230, 232, 239, 240, 243, and 249 Reporting and... CONTENT OF AND REQUIREMENTS FOR FINANCIAL STATEMENTS, SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF... Act of 1935,'' from the third sentence of the introductory text; 0 b. Removing the phrase...

  20. Some duality relations in the theory of tensor products

    Czech Academy of Sciences Publication Activity Database

    Hájek, Petr Pavel; Smith, R. J.

    2012-01-01

    Roč. 30, č. 3 (2012), s. 239-249. ISSN 0723-0869 R&D Projects: GA ČR(CZ) GAP201/11/0345 Institutional support: RVO:67985840 Keywords : tensor * projective * injective Subject RIV: BA - General Mathematics Impact factor: 0.780, year: 2012 http://www.sciencedirect.com/science/article/pii/S072308691200045X

  1. El modelo de la diversidad. La Bioética y los Derechos Humanos como herramientas para alcanzar la plena dignidad en la diversidad funcional [book review

    OpenAIRE

    Morente Parra, Vanesa

    2007-01-01

    Este artículo reseña: Palacios, Agustina; Romañach, Javier. El modelo de la diversidad. La Bioética y los Derechos Humanos como herramientas para alcanzar la plena dignidad en la diversidad funcional. Madrid: Diversitás Ediciones, 2006. 249 p.

  2. Magnetic measurements of the transuranium elements. Progress report, January 1, 1984-December 31, 1984

    International Nuclear Information System (INIS)

    Measurements of the magnetic properties of dhcp californium-249 metal indicated the presence of three regions of differing magnetic character. Additional measurements are also reported. Magnetic moments and valence states of terbium in TbF3, BaTbO3, and TbO18 are discussed. Progress on high-field operation of the micro-magnetic susceptometer is reported

  3. 48 CFR 970.5223-7 - Sustainable acquisition program.

    Science.gov (United States)

    2010-10-01

    ... Management, and Executive Order 13514, Federal Leadership in Environmental, Energy, and Economic Performance... may request an equitable adjustment to the terms of its contract using the procedures at 48 CFR 970..., see 48 CFR 52.249-6, Termination (Cost Reimbursement). (h) These provisions shall be flowed down...

  4. Sociolinguistic Variation and Change in British Sign Language Number Signs: Evidence of Leveling?

    Science.gov (United States)

    Stamp, Rose; Schembri, Adam; Fenlon, Jordan; Rentelis, Ramas

    2015-01-01

    This article presents findings from the first major study to investigate lexical variation and change in British Sign Language (BSL) number signs. As part of the BSL Corpus Project, number sign variants were elicited from 249 deaf signers from eight sites throughout the UK. Age, school location, and language background were found to be significant…

  5. Structural evolution of the Prague synform (Czech Republic) during Silurian times: An AMS, rock magnetism, and palomagnetic study of the Svatý Jan pod Skalou dikes. Consequences for the nappes emplacement

    Czech Academy of Sciences Publication Activity Database

    Aifa, T.; Pruner, Petr; Chadima, Martin; Štorch, Petr

    Colorado : Boulder, 2007 - (Linnemann, U.), s. 249-265 ISBN 978-0-8137-2423-2. - (Special papers- Geological Society of America . 423) R&D Projects: GA AV ČR IAA3013406 Institutional research plan: CEZ:AV0Z30130516 Keywords : magnetic properies * dikes * Variscan orogen * stress * rheic * AMS * magnetization * Variscan orogen Subject RIV: DB - Geology ; Mineralogy

  6. 78 FR 6132 - Agency Information Collection Activities; Submission for OMB Review; Comment Request; Petition...

    Science.gov (United States)

    2013-01-29

    ... published in the Federal Register on September 6, 2012 (77 FR 54929). Interested parties are encouraged to...: Section 221 (a) of Title II, Chapter 2 of the Trade Act of 1974, as amended by the Trade and Globalization..., and 249 of the Trade Act of 1974, as amended by the Trade and Globalization Adjustment Assistance...

  7. Patterns of bryophyte and vascular plant richness in European subalpine springs

    Czech Academy of Sciences Publication Activity Database

    Sekulová, L.; Hájek, Michal; Hájková, Petra; Mikulášková, E.; Buttler, A.; Syrovátka, V.; Rozbrojová, Zuzana

    2012-01-01

    Roč. 213, č. 2 (2012), s. 237-249. ISSN 1385-0237 Institutional research plan: CEZ:AV0Z60050516 Keywords : springs * spesies richness * environmental factors Subject RIV: EF - Botanics Impact factor: 1.534, year: 2012 http://www.springerlink.com/content/m6gq67w137746672/

  8. 75 FR 33901 - Physical Protection of Byproduct Material

    Science.gov (United States)

    2010-06-15

    ...; manufacturer and distributor licensees; medical facilities with gamma knife devices; self-shielded irradiator...-249; June 6, 2003) (68 FR 35458; June 13, 2003). The next series of orders were issued to certain manufacturing and distribution (M&D) licensees (EA- 03-225; January 12, 2004) (69 FR 5375; February 4,...

  9. 78 FR 16921 - Physical Protection of Byproduct Material

    Science.gov (United States)

    2013-03-19

    ... and distributor licensees; medical facilities with gamma knife devices; self-shielded irradiator... material (EA- 02-249; June 6, 2003) (68 FR 35458; June 13, 2003). The next series of orders were issued to certain manufacturing and distribution (M&D) licensees (EA-03-225; January 12, 2004) (69 FR 5375;...

  10. Practice (Rather than Graded) Quizzes, with Answers, May Increase Introductory Psychology Exam Performance

    Science.gov (United States)

    Wickline, Virginia B.; Spektor, Valeriya G.

    2011-01-01

    The authors investigated whether practice (or graded) quizzes, with or without provision of correct answers, would be more beneficial for introductory psychology exam performance. In six sections (N = 249) of an introductory psychology class, taught by the same professor, different approaches to quizzes were applied across sections to measure…

  11. Root-sprouting in myco-heterotrophic plants: prepackaged symbioses or overcoming meristem limitation?

    Czech Academy of Sciences Publication Activity Database

    Klimešová, Jitka

    2007-01-01

    Roč. 173, - (2007), s. 8-10. ISSN 0028-646X Institutional research plan: CEZ:AV0Z60050516 Keywords : root sprouting * bud bank * Myco-heterotrophic plants Subject RIV: EF - Botanics Impact factor: 5.249, year: 2007

  12. The Relationship between Experiences of Discrimination and Mental Health among Lesbians and Gay Men: An Examination of Internalized Homonegativity and Rejection Sensitivity as Potential Mechanisms

    Science.gov (United States)

    Feinstein, Brian A.; Goldfried, Marvin R.; Davila, Joanne

    2012-01-01

    Objective: The current study used path analysis to examine potential mechanisms through which experiences of discrimination influence depressive and social anxiety symptoms. Method: The sample included 218 lesbians and 249 gay men (total N = 467) who participated in an online survey about minority stress and mental health. The proposed model…

  13. Subjektivní blahobyt v České republice a střední Evropě: makro- a mikro-determinanty

    Czech Academy of Sciences Publication Activity Database

    Večerník, Jiří

    2014-01-01

    Roč. 62, č. 2 (2014), s. 249-270. ISSN 0032-3233 R&D Projects: GA ČR(CZ) GAP404/11/1521 Institutional support: RVO:68378025 Keywords : subjective well-being * life satisfaction * Central Europe Subject RIV: AO - Sociology, Demography Impact factor: 0.650, year: 2014

  14. Das Minoriten- und Klarissenkloster in Znaim und seine mittelalterliche Gestalt

    Czech Academy of Sciences Publication Activity Database

    Benešovská, Klára

    Prag: Philosophische Fakultät der Karlsuniversität, 1998 - (Bláhová, M.; Hlaváček, I.), s. 249-272 ISBN 80-85899-42-6. [Böhmisch-österreichische Beziehungen im 13. Jahrhundert. Znojmo (CZ), 26.09.1996-27.09.1996] Subject RIV: AL - Art, Architecture, Cultural Heritage

  15. Effect of heavy metals on the structure and function of photosystem II: potential and prospects for use as bioindicator

    Czech Academy of Sciences Publication Activity Database

    Masojídek, Jiří; Malý, Jan; Alessandrelli, S.; Koblížek, Michal; Rizzuto, M.; Geiken, B.; Kopecký, Jiří; Komenda, Josef; Prášil, Ondřej; Giardi, M. T.

    Roma : Italian National Agency for new Technology, Energy and the Environment, 2000 - (Mazzei, F.; Pilloton, R.), s. 249-256 ISBN 88-8286-072-8. [Workshop on Chemical Sensors and Biosensors /2./. Casaccia (IT), 18.03.1999-19.03.1999] R&D Projects: GA MŽP MR/340/2/97 Subject RIV: EI - Biotechnology ; Bionics

  16. Mitochondria: An intriguing target for killing tumour-initiating cells

    Czech Academy of Sciences Publication Activity Database

    Yan, B.; Dong, L.; Neužil, Jiří

    2016-01-01

    Roč. 26, JAN 2016 (2016), s. 86-93. ISSN 1567-7249 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:86652036 Keywords : Tumour-initiating cells * ALPHA-TOCOPHERYL SUCCINATE * Therapeutic resistance * Mitochondria Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.249, year: 2014

  17. Categorizing Moving Objects into Film Genres: The Effect of Animacy Attribution, Emotional Response, and the Deviation from Non-Fiction

    Science.gov (United States)

    Visch, Valentijn T.; Tan, Ed S.

    2009-01-01

    The reported study follows the footsteps of Heider, and Simmel (1944) [Heider, F., & Simmel, M. (1944). An experimental study of apparent behavior. "American Journal of Psychology," 57, 243-249] and Michotte (1946/1963) [Michotte, A. (1963). "The perception of causality" (T.R. Miles & E. Miles, Trans.). London: Methuen (Original work published…

  18. Characterization of spirochetal isolates from arthropods collected in South Moravia, Czech Republic, using fatty acid methyl esters analysis

    Czech Academy of Sciences Publication Activity Database

    Čechová, L.; Durnová, E.; Šikutová, Silvie; Halouzka, Jiří; Němec, M.

    2004-01-01

    Roč. 808, č. 2 (2004), s. 249-254. ISSN 1570-0232 R&D Projects: GA ČR GA206/03/0726 Institutional research plan: CEZ:AV0Z6093917 Keywords : spirochetes * arthropods * fatty acid methyl esters Subject RIV: EE - Microbiology, Virology Impact factor: 2.176, year: 2004

  19. EST Table: DC534780 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DC534780 E_ET_J150_25E10_R_0 10/09/28 42 %/249 aa ref|NP_001116815.1| carboxylesterase CarE -11 [ ... Bombyx mori] gb|ACB12415.1| carboxylesterase CarE -11 [Bombyx mori] 10/09/01 34 %/185 aa FBpp0159923| ...

  20. EST Table: BB986106 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BB986106 E_ET_MSV3_13F05_F_0 10/09/28 35 %/249 aa ref|NP_001121786.1| alpha-esterase 3 [Bombyx m ... ori] gb|ACD80423.1| carboxylesterase CarE -14 [Bombyx mori] 10/08/28 low homology 10/08/27 n. ...

  1. 75 FR 64120 - Technical Amendments to Forms N-CSR and N-SAR in Connection With the Comprehensive Iran Sanctions...

    Science.gov (United States)

    2010-10-19

    ... COMMISSION 17 CFR Parts 249 and 274 Technical Amendments to Forms N-CSR and N-SAR in Connection With the... adopting technical amendments to Forms N-CSR and N-SAR under the Securities Exchange Act of 1934 and the... Securities and Exchange Commission (``Commission'') is adopting technical amendments to Form N-CSR \\1\\...

  2. Combination of micropreparative solution isoelectric focusing and high-performance liquid chromatography for differentiation of biofilm-positive and biofilm-negative Candida parapsilosis group from vascular catheter

    Czech Academy of Sciences Publication Activity Database

    Vykydalová, Marie; Horká, Marie; Růžička, F.; Duša, Filip; Moravcová, Dana; Kahle, Vladislav; Šlais, Karel

    2014-01-01

    Roč. 812, Feb (2014), s. 243-249. ISSN 0003-2670 R&D Projects: GA MV VG20112015021 Institutional support: RVO:68081715 Keywords : Candida parapsilosis group * biofilm * sonicate from vascular cathether * sIEF * HPLC Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.513, year: 2014 http://hdl.handle.net/11104/0230766

  3. 78 FR 46656 - Program for Allocation of Regulatory Responsibilities Pursuant to Rule 17d-2; Notice of Filing of...

    Science.gov (United States)

    2013-08-01

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE... of 1975, Report of the Senate Committee on Banking, Housing, and Urban Affairs to Accompany S. 249, S... Exchange Act Release No. 12352 (April 20, 1976), 41 FR 18808 (May 7, 1976). To address...

  4. 75 FR 57998 - Program for Allocation of Regulatory Responsibilities Pursuant to Rule 17d-2; Notice of Filing of...

    Science.gov (United States)

    2010-09-23

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE... of the Senate Committee on Banking, Housing, and Urban Affairs to Accompany S. 249, S. Rep. No. 94-75... No. 12352 (April 20, 1976), 41 FR 18808 (May 7, 1976). To address regulatory duplication in these...

  5. Dependence of the human skin protection against the UV solar carcinoma radiation on the sunscreens and cosmetics layer thickness

    Czech Academy of Sciences Publication Activity Database

    Stádník, Bohumil; Jirásková, M.

    2000-01-01

    Roč. 45, č. 3 (2000), s. 241-249. ISSN 0001-7043 R&D Projects: GA ČR GA102/99/0548 Institutional research plan: CEZ:AV0Z2067918 Keywords : cancer * fluorescence * patient diagnosis Subject RIV: JB - Sensors, Measurment, Regulation

  6. Factors related to oral health-related quality of life of independent brazilian elderly

    DEFF Research Database (Denmark)

    Ulinski, Karla Giovana Bavaresco; do Nascimento, Mariele Andrade; Lima, Arinilson Moreira Chaves;

    2013-01-01

    95%: 1.15-2.00); poor self-perception of oral health (PR = 2.49; CI 95%: 1.92-3.24); and poor perception of dental care provided (PR = 1.34; CI 95%: 1.12-1.59). The younger elderly also noticed this negative impact. These findings showed that the clinical, sociodemographic, and subjective factors...

  7. 17 CFR 232.311 - Documents submitted in paper under cover of Form SE.

    Science.gov (United States)

    2010-04-01

    ... English summary or English translation of the foreign language document in accordance with § 232.306(b) or... filing in electronic format an English translation of its latest annual budget submitted as Exhibit B to... SE (§§ 239.64, 249.444, 259.601, 269.8, and 274.403 of this chapter) no later than one business...

  8. Glass melting and its innovation potentials : the role of glass flow in the bubble-removal process

    Czech Academy of Sciences Publication Activity Database

    Němec, Lubomír; Cincibusová, P.

    2008-01-01

    Roč. 52, č. 4 (2008), s. 240-249. ISSN 0862-5468 R&D Projects: GA MPO 2A-1TP1/063 Institutional research plan: CEZ:AV0Z40320502 Keywords : bubble removal * temperature gradients * glass-flow pattern s, Subject RIV: CA - Inorganic Chemistry Impact factor: 0.644, year: 2008

  9. Theta-paced flickering between place-cell maps in the hippocampus

    Czech Academy of Sciences Publication Activity Database

    Ježek, Karel; Henriksen, E. J.; Treves, A.; Moser, E. I.; Moser, M.B.

    2011-01-01

    Roč. 478, č. 7368 (2011), s. 246-249. ISSN 0028-0836 R&D Projects: GA MŠk(CZ) LC554; GA MŠk(CZ) 1M0517 Institutional research plan: CEZ:AV0Z50110509 Keywords : memory * theta * hippocampus * place cells * teleportation Subject RIV: FH - Neurology Impact factor: 36.280, year: 2011

  10. Rudolf Winternitz

    Czech Academy of Sciences Publication Activity Database

    Šimůnek, Michal V.

    Červený Kostelec : Pavel Mervart, 2013 - (Šimůnek, M.; Kostlán, A.), s. 249-251 ISBN 978-80-7465-041-3. - (Studies in the History of Sciences and Humanities. 29) Institutional support: RVO:68378114 Keywords : holocaust * intellectual elite * history of science Subject RIV: AB - History

  11. Attention-Deficit, Fear and Aggression in Iranian Preschool Students with Regard to Gender Differences

    Science.gov (United States)

    Sheikhzade, Mostafa; Assemi, Arezoo

    2013-01-01

    The cause of most adult psychopathologies or behavioural disorders can be traced back to childhood. In this study, we examine the attention-deficit, fear and aggression in Iran's preschool students in Oshnaviye city. In this analytical-descriptive study, 50 students were selected through stratified sampling method from 249 students. Data were…

  12. Deformation effects in rock massifs and their long-term monitoring

    Czech Academy of Sciences Publication Activity Database

    Košťák, Blahoslav

    2006-01-01

    Roč. 39, č. 3 (2006), s. 249-258. ISSN 1470-9236 R&D Projects: GA MŠk(CZ) OC 625.10 Institutional research plan: CEZ:AV0Z30460519 Keywords : anchors * extensometers * monitoring Subject RIV: DO - Wilderness Conservation Impact factor: 0.778, year: 2006

  13. Association of variants in the PCSK1 gene with obesity in the EPIC-Norfolk study

    DEFF Research Database (Denmark)

    Oskari Kilpeläinen, Tuomas; Bingham, Sheila A; Khaw, Kay-Tee; Wareham, Nicholas J; Loos, Ruth J F

    2009-01-01

    -based cohort consisting of 20 249 individuals of European descent from Norfolk, UK. Logistic regression and generalized linear models were used to test the associations of the risk alleles with obesity and related quantitative traits, respectively. Neither of the SNPs was significantly associated with obesity...

  14. Intergenerational Relationships in Cross-Cultural Comparison: How Social Networks Frame Intergenerational Relations between Mothers and Grandmothers in Japan, Korea, China, Indonesia, Israel, Germany, and Turkey

    Science.gov (United States)

    Nauck, Bernhard; Suckow, Jana

    2006-01-01

    The article explores the relevance of intergenerational relationships within the overall network of young mothers and grandmothers in seven societies: Japan, Korea, China, Indonesia, Turkey, Israel, and Germany. The empirical base is 2,945 named network members in 249 pairs of interviews of grandmothers and their daughters from a cross-cultural…

  15. 17 CFR 239.13 - Form S-3, for registration under the Securities Act of 1933 of securities of certain issuers...

    Science.gov (United States)

    2010-04-01

    ... on the same registration statement as are the guaranteed non-convertible securities. (d) Automatic... amendment pursuant to Rule 413(b) (§ 230.413(b) of this chapter); and (5) An automatic shelf registration... statements were included in the registrant's latest filing on Form 20-F (17 CFR 249.220f). In complying...

  16. Accumulation of Ag and Cu in Amanita strobiliformis and characterization of its Cu and Ag uptake transporter genes AsCTR2 and AsCTR3

    Czech Academy of Sciences Publication Activity Database

    Beneš, V.; Hložková, K.; Matěnová, M.; Borovička, Jan; Kotrba, P.

    2016-01-01

    Roč. 29, č. 2 (2016), s. 249-264. ISSN 0966-0844 R&D Projects: GA ČR(CZ) GAP504/11/0484 Institutional support: RVO:61389005 Keywords : heavy metals * metal uptake * Metallothionein * copper transporter protein family * Ectomycorrhizal fungi Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.503, year: 2014

  17. Accumulation of Ag and Cu in Amanita strobiliformis and characterization of its Cu and Ag uptake transporter genes AsCTR2 and AsCTR3

    Czech Academy of Sciences Publication Activity Database

    Beneš, V.; Hložková, K.; Matěnová, M.; Borovička, Jan; Kotrba, P.

    2016-01-01

    Roč. 29, č. 2 (2016), s. 249-264. ISSN 0966-0844 Institutional support: RVO:67985831 Keywords : Copper transporter protein family * Ectomycorrhizal fungi * heavy metals * metal uptake * metallothionein Subject RIV: CE - Biochemistry Impact factor: 2.503, year: 2014

  18. Quasi-linear heating and acceleration in bi-Maxwellian plasmas

    Czech Academy of Sciences Publication Activity Database

    Hellinger, Petr; Passot, T.; Sulem, P. L.; Trávníček, Pavel M.

    2013-01-01

    Roč. 20, č. 12 (2013), 122306/1-122306/6. ISSN 1070-664X Institutional support: RVO:68378289 Keywords : plasma electromagnetic waves * plasma nonlinear phenomena * diffusion Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.249, year: 2013 http://scitation.aip.org/content/aip/journal/pop/20/12/10.1063/1.4846955

  19. Effect of disorder on spin and charge excitations in the FQHE

    Czech Academy of Sciences Publication Activity Database

    Výborný, Karel; Müller, Ch.; Dethlefsen, A.F.; Haug, R.J.; Wójs, A.

    2007-01-01

    Roč. 112, č. 2 (2007), s. 249-254. ISSN 0587-4246 R&D Projects: GA AV ČR KAN400100652 Institutional research plan: CEZ:AV0Z10100521 Keywords : disorder * activated transport * gap * fractional quantum Hall effect Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.340, year: 2007

  20. Sex Differences in the Expression of Depression in Adolescents.

    Science.gov (United States)

    Baron, Pierre; Joly, Elisabeth

    1988-01-01

    Examination of 249 Quebec adolescents on the Beck Depression Inventory (BDI) revealed in 67.8 percent of the cases that depressed males show a symptomatology characterized by irritability, work inhibition, social withdrawal and sleep disturbance. Depressed females present symptoms characterized by body image distortion, weight loss, loss of…

  1. p16 as a diagnostic marker of cervical neoplasia: a tissue microarray study of 796 archival specimens

    DEFF Research Database (Denmark)

    Lesnikova, Iana; Lidang, Marianne; Hamilton-Dutoit, Stephen;

    2009-01-01

    1 (180/249; 72.3%) - CIN2 (212/233; 91.0%) - CIN3 (178/181; 98.3%) - invasive carcinoma (131/133; 98.5%). Using semi-quantitative scoring, all normal cervical samples had low scores (from 0 to 2 points), whilst the number of specimens with high scores was proportional to the degree of cervical...

  2. Taxonomy of Late Jurassic - Early Cretaceous aptychi from Bulgaria

    Czech Academy of Sciences Publication Activity Database

    Vašíček, Zdeněk; Motchurova; Dekova, N.; Ilcheva, A.; Metodiev, L.

    2012-01-01

    Roč. 265, č. 3 (2012), s. 249-274. ISSN 0077-7749 Institutional research plan: CEZ:AV0Z30860518 Keywords : Late Jurassic * Early Cretaceous * Bulgaria * aptychi * ammonites * parataxonomy Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.923, year: 2012 http://www.schweizerbart.de/papers/njgpa/detail/265/78431/Taxonomy_of_Late_Jurassic_Early_Cretaceous_aptychi

  3. Powerhouse down: Complex II dissociation in the respiratory chain

    Czech Academy of Sciences Publication Activity Database

    Hwang, M.-S.; Rohlena, Jakub; Dong, L.-F.; Neužil, Jiří; Grimm, S.

    2014-01-01

    Roč. 19, Part A SI (2014), 20-28. ISSN 1567-7249 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109; GA ČR GAP301/12/1851 Institutional support: RVO:86652036 Keywords : Mitochondria * Apoptosis * Complex II Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.249, year: 2014

  4. "My Family and Friends": Six- to Twelve-Year-Old Children's Perceptions of Social Support.

    Science.gov (United States)

    Reid, Molly; And Others

    1989-01-01

    Investigated perceptions of social support of 249 children of 6-12 years. Data indicated that subjective impressions about social support can be measured with reliability and validity and that children understand and care about the quality and differentiation of support. (RJC)

  5. Theoretical Analysis and Preparation of Tapered Suspended Core Microstructure Fibers

    Czech Academy of Sciences Publication Activity Database

    Martan, Tomáš; Kaňka, Jiří; Kašík, Ivan; Matějec, Vlastimil

    2009-01-01

    Roč. 3, č. 3 (2009), s. 233-249. ISSN 1559-9612 Institutional research plan: CEZ:AV0Z20670512 Keywords : tapered fibers * optical sensors Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.354, year: 2009

  6. The Role of Psychosocial Characteristics in Criminal Convictions among Cocaine and Gambling Clients in Treatment

    Science.gov (United States)

    Martin, Gina; Macdonald, Scott; Ishiguro, Sonya

    2013-01-01

    This study assessed the relative importance of problem gambling, cocaine use and selected psychosocial characteristics in predicting criminal convictions. A self-administered questionnaire was completed by clients when admitted to a treatment program for a primary problem with cocaine (n = 300), gambling (n = 199), or tobacco (n = 249). The…

  7. Accuracy of Teacher Assessments of Second-Language Students at Risk for Reading Disability.

    Science.gov (United States)

    Limbos, Marjolaine M.; Geva, Esther

    2001-01-01

    This study examined the accuracy of teacher (N=51) assessments in screening for reading disabilities among Grade 1 students of English as a second language (N=249) and as a first language (N=120). Results indicated that teacher rating scales and nominations had low sensitivity in identifying reading disability in either group as determined by a…

  8. Mechanism of reactive compatibilization of a blend of recycled LDPE/HIPS using an EPDM/SB/aromatic diamine co-additive system

    Czech Academy of Sciences Publication Activity Database

    Pospíšil, Jan; Fortelný, Ivan; Michálková, Danuše; Kruliš, Zdeněk; Šlouf, Miroslav

    2005-01-01

    Roč. 90, č. 2 (2005), s. 244-249. ISSN 0141-3910 R&D Projects: GA AV ČR KSK4050111; GA ČR GA106/02/1248 Keywords : pre-aged LDPE * blends LDPE-HIPS * recycled upgrading Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.749, year: 2005

  9. UniProt search blastx result: AK287918 [KOME

    Lifescience Database Archive (English)

    Full Text Available dase A) (APA) (Differentiation antigen gp160) (CD249 antigen) - Homo sapiens (Human) 2.00E-16 ... ...AK287918 J065214O12 Q07075|AMPE_HUMAN Glutamyl aminopeptidase (EC 3.4.11.7) (EAP) (Aminopepti

  10. The Family Backpack Project: Responding to Dual-Language Texts through Family Journals

    Science.gov (United States)

    Rowe, Deborah; Fain, Jeanne Gilliam

    2013-01-01

    The Family Backpack Project provided 249 low-income, prekindergarten children and their families with opportunities to read and listen to audio recordings of 3 sets of books in their homes. Families received English or dual-language texts (English plus Spanish, Arabic, Kurdish, or Somali) matched to their home languages. Children and their…

  11. 7 CFR 2003.18 - Functional organization of RHS.

    Science.gov (United States)

    2010-01-01

    ... (CONTINUED) ADMINISTRATIVE REGULATIONS ORGANIZATION Functional Organization of the Rural Development Mission... Administrator. According to 7 CFR 2.49, the Administrator has responsibility for implementing programs aimed at... Waste Management Fund, coordinating the Debarment and Suspension process for RHS, tracking the use...

  12. AcEST: DK951388 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0011_E12 664 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0011_E12. 5' end seq ... rame = +1 Query: 70 VVDKGADFANYFCTYAFLYHQKEMLSDSVRMDAY HASIFKNTKHFKNKIVLDVGTGSGIL 249 VVDK DFANYFCTY++LYHQ ... KEML D VRMDAY H+++F+N HF+ K+VLDVGTGSGIL Sbjct: 22 VVDKEVDFANYFCTY ...

  13. Coping with Workplace Stress: A Multiple-Group Comparison of Female Managers and Clerical Workers.

    Science.gov (United States)

    Long, Bonita C.

    1998-01-01

    A causal model of workplace stress was refined and cross-validated. Multivariate analysis and multiple-group structural equation modeling were used to investigate the effects of social roles on patterns of coping with workplace stress and job satisfaction. Differences found between managers (n=249) and clerical workers (n=214) suggest power and…

  14. In some symmetric spaces monotonicity properties can be reduced to the cone of rearrangements

    Czech Academy of Sciences Publication Activity Database

    Hudzik, H.; Kaczmarek, R.; Krbec, Miroslav

    2016-01-01

    Roč. 90, č. 1 (2016), s. 249-261. ISSN 0001-9054 Institutional support: RVO:67985840 Keywords : symmetric space s * K-monotone symmetric Banach space s * strict monotonicity * lower local uniform monotonicity Subject RIV: BA - General Mathematics Impact factor: 0.918, year: 2014 http://link.springer.com/article/10.1007%2Fs00010-015-0379-6

  15. Statistical forecasting of met-ocean parameters in the Cochin estuarine system, southwest coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Srinivas, K.; Revichandran, C.; DineshKumar, P.K.

    , Cochin backwaters: A sad story of manipulations, Ambio, 26 (1997) 249-260. 10 Srinivas K, Coherence between interannual variability of sea level with some surface met-ocean parameters at Cochin, southwest coast of India, Indian J. Mar. Sci., 31 (2002...

  16. AcEST: DK950630 [AcEST

    Lifescience Database Archive (English)

    Full Text Available KILAMDINRENYELGPPVIEK 126 Query: 648 AG 653 AG Sbjct: 127 AG 128 >tr|A9QWL5|A9QWL5_9FABA Caffeoyl-CoA-O-methyltransferase OS=Acacia... auriculiformis x Acacia mangium PE=2 SV=1 Length = 249 Score = 200 bits (508), Expec

  17. Length distribution of long interspersed nuclear elements (LINEs) and processed pseudogenes of human endogenous retroviruses: implications for retrotransposition and pseudogene detection

    Czech Academy of Sciences Publication Activity Database

    Pavlíček, Adam; Pačes, Jan; Zíka, Radek; Hejnar, Jiří

    2002-01-01

    Roč. 300, 1-2 (2002), s. 246-249. ISSN 0378-1119 R&D Projects: GA ČR GA204/01/0632 Institutional research plan: CEZ:AV0Z5052915 Keywords : Alu * L1 * target-primed reverse transcription Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.778, year: 2002

  18. Parental Academic Socialization: Effects of Home-Based Parental Involvement on Locus of Control across U.S. Ethnic Groups

    Science.gov (United States)

    Suizzo, Marie-Anne; Soon, Kokyung

    2006-01-01

    This study investigates the relations between three academic socialisation processes and late adolescents' internal locus of control. A sample of 249 college students from four ethnic groups completed three measures. Three factors explained 46.44% of the variance in academic socialisation, and the following differences were found: emotional…

  19. EST Table: FS917107 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS917107 E_FL_fufe_40F15_F_0 10/09/28 99 %/249 aa ref|NP_001138804.1| lipid storage droplet 2-li ... LIN [Bombyx mori] 10/09/12 38 %/242 aa FBpp0110268|Lsd -2-PB 10/08/29 n.h 10/09/10 40 %/247 aa AGAP000167- ...

  20. Four new non-marine diatom taxa from the Subantactic and Antarctic Regions

    Czech Academy of Sciences Publication Activity Database

    Van de Vijver, B.; Sterken, M.; Vyverman, W.; Mataloni, G.; Nedbalová, L.; Kopalová, K.; Elster, Josef; Verleyen, E.; Sabbe, K.

    2010-01-01

    Roč. 25, č. 2 (2010), s. 431-443. ISSN 0269-249X R&D Projects: GA MŠk ME 945 Institutional research plan: CEZ:AV0Z60050516 Keywords : South Shetland islands * East Antarctica * diatoms Subject RIV: EF - Botanics Impact factor: 1.030, year: 2010

  1. Spirituality in Psychology: The Concept and its Context

    Czech Academy of Sciences Publication Activity Database

    Říčan, Pavel

    2003-01-01

    Roč. 45, č. 3 (2003), s. 249-257. ISSN 0039-3320 R&D Projects: GA AV ČR IAA7025301 Institutional research plan: CEZ:AV0Z7025918 Keywords : spirituality * idealization of religion * implicit religion Subject RIV: AN - Psychology Impact factor: 0.197, year: 2003

  2. Music during Lectures: Will Students Learn Better?

    Science.gov (United States)

    Dosseville, Fabrice; Laborde, Sylvain; Scelles, Nicolas

    2012-01-01

    We investigated the influence of music during learning on the academic performance of undergraduate students, and more particularly the influence of affects induced by music. Altogether 249 students were involved in the study, divided into a control group and an experimental group. Both groups attended the same videotaped lecture, with the…

  3. Comparative evaluation of efficacy and safety of carboxymethylcellulose either alone or in combination with non-steroidal anti-inflammatory drug in the treatment of dry eye in a tertiary care teaching hospital

    Directory of Open Access Journals (Sweden)

    Saubhagya Sindhu

    2015-04-01

    Conclusion: Both groups showed significant improvement in Schirmer's test and TBUT test value and OSDI score at the end of the study. Intergroup comparison showed a significant difference with reference to OSDI score. Patients receiving NSAID reported more adverse effects. [Int J Basic Clin Pharmacol 2015; 4(2.000: 245-249

  4. 75 FR 80947 - Conflict Minerals

    Science.gov (United States)

    2010-12-23

    ... indirectly finance or benefit armed groups'' in the DRC countries.\\22\\ Each person must make their Conflict... or benefit'' these armed groups, the issuer may describe such products as ``DRC conflict free... Exchange Commission 17 CFR Parts 229 and 249 Conflict Minerals; Proposed Rule #0;#0;Federal Register /...

  5. AcEST: BP921195 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000146_G10 543 Adiantum capillus-veneris mRNA. clone: YMU001_000146_G10. BP921195 CL2869C ... = 24/50 (48%) Frame = -2 Query: 419 NGMHIDQVVLYEAFCTLC VISLCDYFWICQSRSWLNLGACGYFKLTTMVC 270 N + + + Y + CT ... /126 (38%) Frame = -2 Query: 428 LISNGMHIDQVVLYEAFCTLC VISLCDYFWICQSRSWLNLGACGYFKLTTMVCSAMLYDI 249 L++ GM ...

  6. 75 FR 64641 - Facilitating Shareholder Director Nominations

    Science.gov (United States)

    2010-10-20

    ... state law rights to nominate and elect directors to company boards of directors. We are publishing this... rules published on September 16, 2010 (75 FR 56668) amending 17 CFR parts 200, 232, 240 and 249, which... September 16, 2010, the Commission published final rules \\1\\ in the Federal Register (75 FR 56668) with...

  7. O- centers in LuAG:Ce,Mg ceramics

    Czech Academy of Sciences Publication Activity Database

    Hu, C.; Liu, S.; Fasoli, M.; Vedda, A.; Nikl, Martin; Feng, X. Q.; Pan, Y.B.

    2015-01-01

    Roč. 9, č. 4 (2015), s. 245-249. ISSN 1862-6254 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : scintillator * hole center * EPR * LuAG * Ce 3+ Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.142, year: 2014

  8. Psychiatric Residents' Needs for Education about Informed Consent, Principles of Ethics and Professionalism, and Caring for Vulnerable Populations: Results of a Multisite Survey

    Science.gov (United States)

    Jain, Shaili; Lapid, Maria I.; Dunn, Laura B.; Roberts, Laura Weiss

    2011-01-01

    Objective: The authors examined psychiatric residents' perceived needs for education in informed consent, principles of ethics and professionalism, and treating vulnerable populations. Method: A written survey was distributed to psychiatric residents (N = 249) at seven U.S. residency programs in 2005. The survey contained 149 questions in 10…

  9. Subjektivní tělesnost mysli a otázka subjektivity jevení

    Czech Academy of Sciences Publication Activity Database

    Novotný, Karel

    Bratislava: Filozofický ústav v spolupráci s OZ Schola Philosophica, 2008 - (Karul, R.; Muransky, M.), s. 237-249 ISBN 978-80-969770-2-4 R&D Projects: GA AV ČR(CZ) IAA900090603 Institutional research plan: CEZ:AV0Z90090514 Keywords : subjectivity * awareness * phenomenon * intentionality Subject RIV: AA - Philosophy ; Religion

  10. Effects of the endemic earthworm .i.Allolobophora hrabei./i. (Černosvitov, 1935) on soil microbial communities of steppe grasslands

    Czech Academy of Sciences Publication Activity Database

    Jirout, Jiří; Pižl, Václav

    2014-01-01

    Roč. 76, September (2014), s. 249-256. ISSN 0038-0717 R&D Projects: GA ČR GAP504/12/0536 Institutional support: RVO:60077344 Keywords : bacteria * archaea * fungi * community composition * DGGE * earthworm Subject RIV: EH - Ecology, Behaviour Impact factor: 3.932, year: 2014

  11. Dvě pojetí pravdy u Michela Foucaulta

    Czech Academy of Sciences Publication Activity Database

    Fulka, Josef

    Červený Kostelec : Pavel Mervart, 2008 - (Novotný, K.; Fridmanová, M.), s. 249-259 ISBN 978-80-86818-61-0 Institutional research plan: CEZ:AV0Z90090514 Keywords : Michel Foucault * truth Subject RIV: AA - Philosophy ; Religion

  12. The list of cyanobacterial species of the Czech Republic to the end of 2009

    Czech Academy of Sciences Publication Activity Database

    Kaštovský, J.; Hauer, Tomáš; Komárek, Jiří; Skácelová, O.

    2010-01-01

    Roč. 10, č. 2 (2010), s. 245-249. ISSN 1802-5439 R&D Projects: GA ČR GA206/08/0318 Institutional research plan: CEZ:AV0Z60050516 Keywords : checklist * cyanobacteria * Czech Republic Subject RIV: EF - Botanics Impact factor: 0.978, year: 2010

  13. ER disruption and GFP degradation during non-regenerable transformation of flax with Agrobacterium tumefaciens

    Czech Academy of Sciences Publication Activity Database

    Bleho, J.; Obert, B.; Takáč, T.; Petrovská, Beáta; Heym, C.; Menzel, D.; Šamaj, J.

    2012-01-01

    Roč. 249, č. 1 (2012), s. 53-63. ISSN 0033-183X Grant ostatní: GA MŠk(CZ) ED0007/01/01 Institutional research plan: CEZ:AV0Z50380511 Keywords : Agrobacterium rhizogenes * Agrobacterium tumefaciens * Endoplasmic reticulum Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.855, year: 2012

  14. Intuitive visualizations of pitch and loudness in speech

    NARCIS (Netherlands)

    Schaefer, R.S.; Beijer, L.J.; Seuskens, W.L.J.B.; Rietveld, A.C.M.; Sadakata, M.

    2016-01-01

    Visualizing acoustic features of speech has proven helpful in speech therapy; however, it is as yet unclear how to create intuitive and fitting visualizations. To better understand the mappings from speech sound aspects to visual space, a large web-based experiment (n = 249) was performed to evaluat

  15. 78 FR 58351 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2013-09-23

    ... Extension: Form N-CSR; OMB Control No. 3235-0570, SEC File No. 270-512 Notice is hereby given that, pursuant... extension of the previously approved collection of information discussed below. Form N-CSR (17 CFR 249.331....) (``Exchange Act''). Specifically, Form N-CSR is to be used for reports under section 30(b)(2) of...

  16. An evaluation of selected Neidium species from the Antarctic Region

    Czech Academy of Sciences Publication Activity Database

    Hamilton, P. B.; De Haan, M.; Kopalová, Kateřina; Zidarova, R.; Van de Vijver, B.

    2014-01-01

    Roč. 29, č. 1 (2014), s. 27-40. ISSN 0269-249X R&D Projects: GA MŠk ME 934; GA MŠk ME 945 Institutional support: RVO:67985939 Keywords : Bacillariophyta * biogeography * Neidium Subject RIV: EF - Botanics Impact factor: 1.746, year: 2014

  17. Characterisation of antioxidant and antiproliferative acidic polysaccharides from Chinese wolfberry fruits

    NARCIS (Netherlands)

    He, N.W.; Yang, X.B.; Jiao, Y.D.; Tian, L.; Zhao, Y.

    2012-01-01

    Wolfberry fruit polysaccharides (WFPs) were isolated by hot-water extraction and ethanol precipitation. With HPLC analysis, WFPs were for the first time identified as acidic polysaccharides with galacturonic acid being the main component monosaccharide (24.9%), followed by galactose (21.3%), arabino

  18. Indikátory změn půdní biodiverzity

    Czech Academy of Sciences Publication Activity Database

    Rusek, Josef

    první. Praha : Academia, 2005 - (Vačkář, D.), s. 249-261 ISBN 80-200-1386-5 Institutional research plan: CEZ:AV0Z60660521 Keywords : biodiversity of soil organisms * biodiversity monitoring in soils * monitoring network Subject RIV: EH - Ecology, Behaviour

  19. Evaluation of MRI artifacts caused by metallic dental implants and classification of the dental materials in use

    Czech Academy of Sciences Publication Activity Database

    Starčuk jr., Zenon; Bartušek, Karel; Hubálková, H.; Bachorec, T.; Starčuková, Jana; Krupa, P.

    Bratislava: IMS SAS, 2005, s. 246-249. ISBN 80-967402-8-8. [International Conference on Measurement 2005 /5./. Smolenice (SK), 15.05.2005-19.05.2005] R&D Projects: GA MZd(CZ) NR8110 Keywords : magnetic resonance imaging * artifacts * metallic implants * dental alloys * magnetic susceptibility Subject RIV: FS - Medical Facilities ; Equipment

  20. Intervence rizikových faktorů aterosklerózy a kardiovaskulární úmrtnost. 20letá primárně preventivní studie z pohledu statistika

    Czech Academy of Sciences Publication Activity Database

    Reissigová, Jindra; Tomečková, Marie

    2003-01-01

    Roč. 45, - (2003), s. 249-255. ISSN 0010-8650 R&D Projects: GA MŠk LN00B107 Keywords : primary prevention study * longitudinal study * risk factors * atherosclerosis * mortality * cardiovascular disease Subject RIV: BA - General Mathematics

  1. Neutron dosimeters of CSOD - harmonisation in the frame of EC related to the uncertainties in limited cases

    Czech Academy of Sciences Publication Activity Database

    Trousil, J.; Plichta, J.; Spurný, František

    Liptovský Ján, 2005, s. 245-249. ISBN 80-88806-53-4. [Dni radiačnej ochrany /27./. Liptovský Ján (SK), 28.11.2005-02.12.2005] Institutional research plan: CEZ:AV0Z10480505 Keywords : personal dosimetry * neutrons * track etch detectors Subject RIV: DN - Health Impact of the Environment Quality

  2. Geotermický scénář vzniku a zániku permafrostu

    Czech Academy of Sciences Publication Activity Database

    Šafanda, Jan

    2004-01-01

    Roč. 54, č. 4 (2004), s. 247-249. ISSN 0009-0700 R&D Projects: GA ČR GA205/03/0998; GA AV ČR IAA3012005 Institutional research plan: CEZ:AV0Z3012916 Keywords : subsurface temperature * permafrost formation * permafrost decay Subject RIV: DB - Geology ; Mineralogy

  3. The significance of the tail projections in female entomopathogenic nematodes within the family Steinernematidae

    Czech Academy of Sciences Publication Activity Database

    Mráček, Zdeněk; Půža, Vladimír; Nermuť, Jiří

    2016-01-01

    Roč. 90, č. 2 (2016), s. 249-251. ISSN 0022-149X R&D Projects: GA MŠk LH12105 Institutional support: RVO:60077344 Keywords : Steinernematidae * nematodes * Steinernema arenarium Subject RIV: EG - Zoology Impact factor: 1.421, year: 2014

  4. A School-Based Survey of Recurrent Non-Specific Low-Back Pain Prevalence and Consequences in Children

    Science.gov (United States)

    Jones, M. A.; Stratton, G.; Reilly, T.; Unnithan, V. B.

    2004-01-01

    The aim of this investigation was to provide evidence of the prevalence and consequences of recurrent low-back pain in children from Northwest England. A cross-sectional survey was conducted involving a standardized questionnaire with established reliability and validity. A cross-sectional sample of 500 boys (n = 249) and girls (n = 251) aged…

  5. A survey for piroplasmids in horses and Bactrian camels in North-Eastern Mongolia

    Czech Academy of Sciences Publication Activity Database

    Sloboda, M.; Jirků, Milan; Lukešová, D.; Qablan, M.; Batsukh, Z.; Fiala, Ivan; Horin, P.; Modrý, David; Lukeš, Julius

    2011-01-01

    Roč. 179, 1-3 (2011), 246-249. ISSN 0304-4017 R&D Projects: GA ČR GA523/09/1972 Institutional research plan: CEZ:AV0Z60220518 Keywords : Piroplasmosis * Babesia * Theileria * Horse * Bactrian camel * Dog Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.579, year: 2011

  6. Determinants of Linear Judgment: A Meta-Analysis of Lens Model Studies

    Science.gov (United States)

    Karelaia, Natalia; Hogarth, Robin M.

    2008-01-01

    The mathematical representation of E. Brunswik's (1952) lens model has been used extensively to study human judgment and provides a unique opportunity to conduct a meta-analysis of studies that covers roughly 5 decades. Specifically, the authors analyzed statistics of the "lens model equation" (L. R. Tucker, 1964) associated with 249 different…

  7. West Nile Virus Temperature Sensitivity and Avian Virulence Are Modulated by NS1-2B Polymorphisms.

    Science.gov (United States)

    Dietrich, Elizabeth A; Langevin, Stanley A; Huang, Claire Y-H; Maharaj, Payal D; Delorey, Mark J; Bowen, Richard A; Kinney, Richard M; Brault, Aaron C

    2016-08-01

    West Nile virus (WNV) replicates in a wide variety of avian species, which serve as reservoir and amplification hosts. WNV strains isolated in North America, such as the prototype strain NY99, elicit a highly pathogenic response in certain avian species, notably American crows (AMCRs; Corvus brachyrhynchos). In contrast, a closely related strain, KN3829, isolated in Kenya, exhibits a low viremic response with limited mortality in AMCRs. Previous work has associated the difference in pathogenicity primarily with a single amino acid mutation at position 249 in the helicase domain of the NS3 protein. The NY99 strain encodes a proline residue at this position, while KN3829 encodes a threonine. Introduction of an NS3-T249P mutation in the KN3829 genetic background significantly increased virulence and mortality; however, peak viremia and mortality were lower than those of NY99. In order to elucidate the viral genetic basis for phenotype variations exclusive of the NS3-249 polymorphism, chimeric NY99/KN3829 viruses were created. We show herein that differences in the NS1-2B region contribute to avian pathogenicity in a manner that is independent of and additive with the NS3-249 mutation. Additionally, NS1-2B residues were found to alter temperature sensitivity when grown in avian cells. PMID:27548738

  8. Complete Genome Sequence of Corynebacterium camporealensis DSM 44610, Isolated from the Milk of a Manchega Sheep with Subclinical Mastitis

    OpenAIRE

    Rückert, Christian; Albersmeier, Andreas; Winkler, Anika; Tauch, Andreas

    2015-01-01

    Corynebacterium camporealensis has been isolated in pure culture from milk samples of dairy sheep affected by subclinical mastitis. The complete genome sequence of the type strain DSM 44610, recovered from milk of a Manchega sheep, comprises 2,451,810 bp with a mean G+C content of 59.41% and 2,249 protein-coding genes.

  9. Interference of Bifidobacterium choerinum or Escherichia coli Nissle 1917 with Salmonella Typhimurium in gnotobiotic piglets correlates with cytokine patterns in blood and intestine

    Czech Academy of Sciences Publication Activity Database

    Šplíchalová, Alla; Trebichavský, Ilja; Rada, V.; Vlková, E.; Sonnenborn, U.; Šplíchal, Igor

    2011-01-01

    Roč. 163, č. 2 (2011), s. 242-249. ISSN 0009-9104 R&D Projects: GA ČR GA523/07/0572 Institutional research plan: CEZ:AV0Z50200510 Keywords : Bifidobacterium * gnotobiotic pig * cytokine Subject RIV: EC - Immunology Impact factor: 3.360, year: 2011

  10. Recent natural hybridization between two allopolyploid wheatgrasses (Elytrigia, Poaceae): Ecological and evolutionary implications

    Czech Academy of Sciences Publication Activity Database

    Mahelka, Václav; Fehrer, Judith; Krahulec, František; Jarolímová, Vlasta

    2007-01-01

    Roč. 100, - (2007), s. 249-260. ISSN 0305-7364 R&D Projects: GA ČR GA206/05/0778; GA ČR(CZ) GD206/03/H137 Institutional research plan: CEZ:AV0Z60050516 Keywords : Triticeae * polyploidy * gene flow Subject RIV: EF - Botanics Impact factor: 2.939, year: 2007

  11. Preparation of Bimetallic CoO-MoO3/gamma-Al2O3 Hydrodesulfurization Catalysts by Deposition of Co, Ni, and Mo onto alpha-AlOOH during Paste Processing.

    Czech Academy of Sciences Publication Activity Database

    Kaluža, Luděk; Zdražil, Miroslav

    2007-01-01

    Roč. 91, 2 (2007) , s. 249-255. ISSN 0133-1736 R&D Projects: GA ČR(CZ) GP104/06/P034 Institutional research plan: CEZ:AV0Z40720504 Keywords : paste processing * slurry impregnation * hydrodesulfurization Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.584, year: 2007

  12. Balti kirjakultuuri mitmekeelsest loomust / Liina Lukas

    Index Scriptorium Estoniae

    Lukas, Liina, 1970-

    2008-01-01

    Poleemika senise rahvuslik-keelelise lähenemisega eesti varasemale kirjandusloole. 17. saj. Eestimaal viljeldud uusladina luulest Euroopa kirjandusnähtuste taustal (ka Reiner Brockmanni eestikeelsest juhuluuleharrastusest) ning 19. saj. lõpuni püsinud mitmekeelsusest siinses kultuuris. Ka ettepanek kasutada seoses Eestimaa mitmekeelse kultuuriga "balti kirjakultuuri" mõistet. Sisaldab bibliograafiat. Autorist lk. 249

  13. Fluorescence Spectroscopy as a Tool for Investigating the Self-Organized Polyelectrolyte Systems

    Czech Academy of Sciences Publication Activity Database

    Procházka, K.; Limpouchová, Z.; Uhlík, F.; Košovan, P.; Matějíček, P.; Štěpánek, M.; Uchman, M.; Kuldová, J.; Šachl, Radek; Humpolíčková, Jana; Hof, Martin

    Heidelberg: Springer, 2011 - (Müller, H.; Borisov, O.), s. 187-249. (Advances in Polymer Science . Vol. 241). ISBN 978-3-642-22485-0 Institutional research plan: CEZ:AV0Z40400503 Keywords : Block copolymer micelles * Fluorescence anisotropy * Fluorescence correlation spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry

  14. Stress wave propagation and impact modeling

    Czech Academy of Sciences Publication Activity Database

    Okrouhlík, Miloslav

    Vol. AMD N205. New York : Applied Mechanics Division, ASME, 1995, s. 249-273. ISBN 0-7918-1320-7. [1995 Joint ASME Applied Mechanics and Materials Summer Meeting. Los Angeles (US), 28.07.1995-30.07.1995] R&D Projects: GA ČR GA101/95/1006

  15. Charge distribution within hypercarbon-halogenated 1-Ph-2-X-1,2-dicarba-closo-dodecaboranes, (X = F, Cl, Br, I): A dipole moment and computational study

    Czech Academy of Sciences Publication Activity Database

    Hnyk, Drahomír; Všetečka, V.; Drož, L.

    2010-01-01

    Roč. 978, 1-3 (2010), s. 246-249. ISSN 0022-2860 R&D Projects: GA MŠk LC523 Institutional research plan: CEZ:AV0Z40320502 Keywords : halogens * carboranes * dipole moments Subject RIV: CA - Inorganic Chemistry Impact factor: 1.599, year: 2010

  16. "Sa oled mul teine" : teisesusest eesti kultuuri eneseanalüüsis / Aare Pilv

    Index Scriptorium Estoniae

    Pilv, Aare, 1976-

    2008-01-01

    Kolmest eesti kultuuri eneseanalüüsi kontseptsioonist: "katkestus" (Hasso Krull), "eksistentsialistlik absurdiprojekt" (Jaan Undusk), "enesekolonisatsioon" (Tiit Hennoste). Poleemikat T. Hennoste enesekolonisatsiooni teooriaga (olulisim tekst selle kohta on 2006. a. avaldatud artikkel "Noor-Eesti kui lõpetamata enesekoloniseerimisprojekt"). Sisaldab bibliograafiat. Autorist lk. 249

  17. Gclust Server: 92012 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 92012 NGR_4263 Cluster Sequences Related Sequences(249) 181 gw1.16.122.1; no annota...tion 1 1.00e-99 0.0 11.11 0.0 0.0 0.0 0.0 Show 92012 Cluster ID 92012 Sequence ID NGR_4263 Link to cluster s

  18. Bronzefunde des 7. Jahrhunderts aus Městec Králové (Bez. Nymburk, Böhmen)

    Czech Academy of Sciences Publication Activity Database

    Profantová, Naďa

    Rahden/Westf: Marie Leidorf, 2015 - (Heinrich-Tamáska, O.; Herold, H.; Straub, P.; Vida , T.), s. 249-263. (Castellum pannonicum pelsonense. 6). ISBN 978-3-89646-156-8 Institutional support: RVO:67985912 Keywords : Early Middle Ages * bronze objects * bow-fibula Subject RIV: AC - Archeology, Anthropology, Ethnology

  19. AcEST: BP920718 [AcEST

    Lifescience Database Archive (English)

    Full Text Available RS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE... 76 8e-14 sp|Q9NDJ2|DOM_DROME Helicase domino O... HLDF+VGQTE+YS +L++ Sbjct: 191 LRRIASTMAKDVRQFWSNVEKVVQFKQQSRLEEKRKKALDLHLDFIVGQTEKYSDLLSQ 249 >sp|Q9NDJ2|DOM_DROME Helicase domino

  20. AcEST: BP912286 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=Homo sapiens GN=SRCAP PE... 72 3e-12 sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster G... ...VGQTE+YS +L++ Sbjct: 194 IASTMAKDVRQFWSNVEKVVQFKQQSRLEEKRKKALDLHLDFIVGQTEKYSDLLSQ 249 >sp|Q9NDJ2|DOM_DROME Helicase domino

  1. AcEST: BP914857 [AcEST

    Lifescience Database Archive (English)

    Full Text Available UMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE... 48 2e-05 sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophil...MLAE 199 + +K Q LE +KKALD HLDF+VGQTE+YS +L++ Sbjct: 213 VQFKQQSRLEEKRKKALDLHLDFIVGQTEKYSDLLSQ 249 >sp|Q9NDJ2|DOM_DROME Helicase domin

  2. AcEST: BP920558 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ue sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE... 81 3e-15 sp|Q9NDJ2|DOM_DROME Helicase domino...FKQQSRLEEKRKKALDLHLDFIVGQTEKYSD 245 Query: 347 MLAE 336 +L++ Sbjct: 246 LLSQ 249 >sp|Q9NDJ2|DOM_DROME Helicase domino

  3. AcEST: BP915811 [AcEST

    Lifescience Database Archive (English)

    Full Text Available N=SRCAP PE... 48 3e-05 sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster G... 44 3e-04 sp|P4996... 213 VQFKQQSRLEEKRKKALDLHLDFIVGQTEKYSDLLSQ 249 >sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogast

  4. AcEST: BP919933 [AcEST

    Lifescience Database Archive (English)

    Full Text Available case SRCAP OS=Homo sapiens GN=SRCAP PE... 66 1e-10 sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanog...QFWSNVEKVVQFKQQSRLEEKRKKALDLHLDFIVGQTEKYSDLLSQ 249 >sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melano

  5. AcEST: BP920230 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 76 5e-14 sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster G... 70 3e-12 sp|Q9NEL2|SSL1_CAEE...IVGQTEKYSDLLSQ 249 >sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 Length =

  6. Data Banks; Bibliography.

    Science.gov (United States)

    van der Aa, H. J., Comp.; And Others

    This 249 item, mostly annotated bibliography cites literature on the general themes of basic principles, hardware, software and application studies of data bases. The broad categories are principles, development possibilities, organizational design, bibliographies, economic aspects, data structure-design, file organization, programing, aviation,…

  7. PROPped up graph cohomology

    Czech Academy of Sciences Publication Activity Database

    Markl, Martin; Voronov, A.A.

    Boston : Birkhäuser, 2009 - (Tschinkel, Y.; Zahrin, Y.), s. 249-282 ISBN 978-0-8176-4746-9. - (Progress in Mathematics. Vol. 270) R&D Projects: GA ČR GA201/02/1390 Institutional research plan: CEZ:AV0Z10190503 Keywords : PROP * graph * complex * cohomology Subject RIV: BA - General Mathematics

  8. The relationship between difficulties in psychological adjustment in young adulthood and exposure to bullying behaviour in childhood and adolescence

    OpenAIRE

    Kristina Sesar; Marijana Barišić; Maja Pandža; Arta Dodaj

    2012-01-01

    Objective. This study investigates the relationship between involvement in bullying in childhood and adolescence and psychological difficulties in young adulthood. Materials and method. A total of 249college students completed the Retrospective Bullying Questionnaireand Trauma Symptom Checklist. Results. The results showed significantdifferences in psychological adjustment among respondents whowere exposed to bullying compared to respondents who were not exposedto bullying. Those exposed to b...

  9. Psychometric Properties of the "Reminiscence Functions Scale" for the Portuguese Population: A Preliminary Report

    Science.gov (United States)

    Goncalves, Daniela C.; Guedes, Joana Martins; Fonseca, Antonio M.; Martin, Inacio

    2010-01-01

    The aim of the present study was to assess the psychometric properties of a version in Portuguese of the "Reminiscence Functions Scale." Total sample was composed of 628 participants aged between 18 and 92 years, divided into three groups according to their age (18-24 years, "n" = 249; 26-54 years, "n" = 174; 55 and older, "n" = 205). Results…

  10. Kala töötlemine : [andmeid aastatest 1995-2004] / Maarja Purik

    Index Scriptorium Estoniae

    Purik, Maarja

    2005-01-01

    Ilmunud ka: Agriculture and the development of rural life : overview 2004/2005. - Tallinn, 2005, lk. 49-52. Kalatöötlemise osatähtsus toiduainetööstuses moodustas 2004. a. 11,9% ja ekspordis 24,9%. Tabelid. Diagrammid

  11. Dicty_cDB: SFH501 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFH501 (Link to dictyBase) - - - Contig-U16243-1 SFH501P (Link to Original ... o... 433 0.0 X75329_1( X75329 |pid:none) M.indica (Manila ) THMF5 mRNA for 3-ket... 249 e-110 AM474896_9( AM4 ...

  12. Spatial aspects of seed dispersal and seedling recruitment in orchids

    Czech Academy of Sciences Publication Activity Database

    Jersáková, Jana; Malinová, T.

    2007-01-01

    Roč. 176, č. 2 (2007), s. 237-241. ISSN 0028-646X Institutional research plan: CEZ:AV0Z60870520 Keywords : orchids * seed dispersal * seed germination * seed sowing technique * seedling recruitment * spatial analysis Subject RIV: EH - Ecology, Behaviour Impact factor: 5.249, year: 2007

  13. Jan Evangelista Purkyn/Purkinje (1787-1869) and the establishment of cellular physiology-Wrocaw/Breslau as a central European cradle for a new science

    Czech Academy of Sciences Publication Activity Database

    Žárský, Viktor

    2012-01-01

    Roč. 249, č. 4 (2012), s. 1173-1179. ISSN 0033-183X Institutional research plan: CEZ:AV0Z50380511 Keywords : Purkyne * Physiology * Cellular theory Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.855, year: 2012

  14. 77 FR 73589 - Positive Train Control Systems (RRR)

    Science.gov (United States)

    2012-12-11

    ... of processor-based train control systems. See 70 FR 11,052 (Mar. 7, 2005) (codified at 49 CFR part... passenger trains operating at greater than 59 miles per hour under Sec. 236.0(c)(2). See 75 FR 2598 at 2607...); Louisville Jeffersonville Bridge Co. v. United States, 249 U.S. 543 (1919); see also 66 FR 4104, 4148 (Jan...

  15. Size-Resolved Penetration Through High-Efficiency Filter Media Typically Used for Aerosol Sampling

    Czech Academy of Sciences Publication Activity Database

    Zíková, Naděžda; Ondráček, Jakub; Ždímal, Vladimír

    2015-01-01

    Roč. 49, č. 4 (2015), s. 239-249. ISSN 0278-6826 R&D Projects: GA ČR(CZ) GBP503/12/G147 Institutional support: RVO:67985858 Keywords : filters * size-resolved penetration * atmospheric aerosol sampling Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.413, year: 2014

  16. GenBank blastx search result: AK103945 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK103945 001-014-A05 AL591852.10 Human DNA sequence from clone RP11-249H20 on chromosome 9 Conta ... ins part of the DAPK1 gene for death -assodeath -associated protein kinase 1, complete se ...

  17. Fenomenologie prostoru: o geografii místa, krajiny i nepřítomnosti

    Czech Academy of Sciences Publication Activity Database

    Gibas, Petr

    Praha : Karolinum, 2014 - (Matoušek, R.; Osman, R.), s. 231-249 ISBN 978-80-246-2733-5 R&D Projects: GA ČR(CZ) GAP404/12/1446 Institutional support: RVO:68378025 Keywords : space * phenomenology * home Subject RIV: AO - Sociology, Demography

  18. Refinement of the basis and impact of common 11q23.1 variation to the risk of developing colorectal cancer

    Czech Academy of Sciences Publication Activity Database

    Pittman, A.M.; Webb, E.; Carvajal-Carmona, L.; Howarth, K.; Di-Bernardo, M.; Broderick, P.; Spain, S.; Walther, A.; Price, A.; Sullivan, K.; Twiss, P.; Fielding, S.; Rowan, A.; Jaeger, E.; Vijayakrishnan, J.; Chandler, I.; Penegar, S.; Qureshi, M.; Lubbe, S.; Domingo, E.; Kemp, Z.; Barclay, E.; Wood, W.; Martin, L.; Gorman, M.; Thomas, H.; Peto, J.; Bishop, T.; Gray, R.; Maher, E.R.; Lucassen, A.; Kerr, D.; Evans, G.; van Wezel, T.; Morreau, H.; Wijnen, J.T.; Hopper, J.L.; Southey, M.C.; Giles, G.G.; Försti, A.; Hemminki, K.; Vodička, Pavel; Naccarati, Alessio; Lipton, L.; Ho, J.W.C.; Cheng, K.K.; Sham, P.C.; Luk, J.; Agúndez, J.A.G.; Ladero, J.M.; de la Hoya, M.; Caldés, T.; Niittymäki, I.; Tuupanene, S.; Karhu, A.; Aaltonen, L.; Cazier, J.B.; Tomlinson, I.P.M.; Houlston, R.S.

    2008-01-01

    Roč. 17, č. 23 (2008), s. 3720-3727. ISSN 0964-6906 R&D Projects: GA ČR GA310/07/1430 Institutional research plan: CEZ:AV0Z50390703 Keywords : Polymorphism * CRC Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 7.249, year: 2008

  19. Task Value Profiles across Subjects and Aspirations to Physical and IT-Related Sciences in the United States and Finland

    Science.gov (United States)

    Chow, Angela; Eccles, Jacquelynne S.; Salmela-Aro, Katariina

    2012-01-01

    Two independent studies were conducted to extend previous research by examining the associations between task value priority patterns across school subjects and aspirations toward the physical and information technology- (IT-) related sciences. Study 1 measured task values of a sample of 10th graders in the United States (N = 249) across (a)…

  20. Oxidative C-C bond cleavage of ketone enolates by nitrosation

    Czech Academy of Sciences Publication Activity Database

    Mašek, Tomáš; Champalet, Valentine; Jahn, Ullrich

    Lisboa : -, 2015 - (Rauter, A.; Martins, A.; Matos, A.; Dias, C.; Xavier, N.; Nunes, R.; Lucas, S.; Cachatra, V.; Paiva, A.; Batista, D.). s. 249 ISBN 978-989-8124-11-1. [ESOC 2015. European Symposium on Organic Chemistry /19./. 12.07.2015-16.07.2015, Lisboa] Institutional support: RVO:61388963 Keywords : ketone enolates * nitrosation * C-C bond Subject RIV: CC - Organic Chemistry

  1. Radiation hardness properties of full-3D active edge silicon sensors

    Czech Academy of Sciences Publication Activity Database

    Da Via, C.; Hasi, J.; Kenney, C.; Linhart, V.; Parker, S.; Slavíček, T.; Watts, S. J.; Bém, Pavel; Horažďovský, T.; Pospíšil, S.

    2008-01-01

    Roč. 587, 2-3 (2008), s. 243-249. ISSN 0168-9002 Institutional research plan: CEZ:AV0Z10480505 Keywords : silicon detectors * radiation hardness * 3D Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.019, year: 2008

  2. 肿瘤标志对煤矿工人尘肺并发肺癌的鉴别诊断价值%Differential diagnosis of pneumoconiosis complicated with lung cancer by detection of tumor markers in coal miner

    Institute of Scientific and Technical Information of China (English)

    万传远

    2011-01-01

    OBJECTIVE: To investigate the diagnostic value of serum tumor markers for pneumoconiosis complicated with lung cancer. METHODS: The serum tumor markers Cy-fra21-l, NSE, CEA and CA125 were measured with electrochemistry iluminescence in 98 cases of pneumoconiosis complicated with lung cancer, 151 cases of pneumoconiosis and 252 healthy coal miners. RESULTS: All the 4 tumor markers in lung cancer patients were significantly higher than that in pneumoconiosis and healthy controls (P< 0.001). The levels of CEA and CA125 in adenocarcinoma, Cyfra21-1 in squamous carcinoma, NSE in small cell lung cancer were higher than other pathological types of lung cancer statistically CP<0. 001). The accuracy of single marker to discriminate complicated with lung cancer and pneumoconiosis was 81. 1% (202/249), 71. L%(177/249), 71. 5%(178/249), 74. 7% (186/249), respectively. Combined detection was 87. 6% (218/249). CONCLUSION: The combined detection of Cyfra21-1, NSE, CEA, and CA125 is useful for differential diagnosis of pneumoconiosis complicated with lung cancer, and helpful to judge pathological types of lung cancer.%目的:探讨肿瘤标志在煤矿工人尘肺并发肺癌中的诊断价值.方法:应用电化学发光技术,检测98例尘肺并发肺癌患者、151例尘肺患者和252位健康煤矿工人血清细胞角蛋白21-1(Cyfra21-1)、神经元特异性烯醇化酶(NSE)、癌胚抗原(CEA)以及糖类抗原125(CA125)水平.结果:尘肺并发肺癌患者血清Cyfra21-1、NSE、CEA和CA125表达水平均显著高于患尘肺或健康煤矿工人,P<0.001.其中腺癌的CEA及CAt25水平、鳞癌的Cyfra21-1表达水平以及小细胞癌的NSE表达水平比其他2种类型均高,且差异有统计学意义,P<0.001.以上单项肿瘤标志鉴别诊断尘肺和尘肺并发肺癌的准确性分别达到81.1%(202/249)、71.1% (177/249)、71.5% (178/249)和74.7% (186/249),联合检测准确性达87.6%(218/249).结论:Cyfra21-1、NSE、CEA 和CA125联合检测

  3. Identification of a disulfide bridge important for transport function of SNAT4 neutral amino acid transporter.

    Directory of Open Access Journals (Sweden)

    Rugmani Padmanabhan Iyer

    Full Text Available SNAT4 is a member of system N/A amino acid transport family that primarily expresses in liver and muscles and mediates the transport of L-alanine. However, little is known about the structure and function of the SNAT family of transporters. In this study, we showed a dose-dependent inhibition in transporter activity of SNAT4 with the treatment of reducing agents, dithiothreitol (DTT and Tris(2-carboxyethylphosphine (TCEP, indicating the possible involvement of disulfide bridge(s. Mutation of residue Cys-232, and the two highly conserved residues Cys-249 and Cys-321, compromised the transport function of SNAT4. However, this reduction was not caused by the decrease of SNAT4 on the cell surface since the cysteine-null mutant generated by replacing all five cysteines with alanine was equally capable of being expressed on the cell surface as wild-type SNAT4. Interestingly, by retaining two cysteine residues, 249 and 321, a significant level of L-alanine uptake was restored, indicating the possible formation of disulfide bond between these two conserved residues. Biotinylation crosslinking of free thiol groups with MTSEA-biotin provided direct evidence for the existence of a disulfide bridge between Cys-249 and Cys-321. Moreover, in the presence of DTT or TCEP, transport activity of the mutant retaining Cys-249 and Cys-321 was reduced in a dose-dependent manner and this reduction is gradually recovered with increased concentration of H2O2. Disruption of the disulfide bridge also decreased the transport of L-arginine, but to a lesser degree than that of L-alanine. Together, these results suggest that cysteine residues 249 and 321 form a disulfide bridge, which plays an important role in substrate transport but has no effect on trafficking of SNAT4 to the cell surface.

  4. Proton Single-Particle States In The Heaviest Actinide Nuclei

    International Nuclear Information System (INIS)

    The level structure of 249Bk has been investigated by measuring the γ-ray spectra following the α decay of a chemically and isotopically pure 253Es sample. Alpha-gamma coincidence measurement was performed using a Si detector for α particles and a 25% Ge detector for γ rays. A gamma-gamma coincidence measurement was performed with the Gammasphere spectrometer. The Es sample was obtained by extracting the 253Es which grew in a 253Cf source material produced in the High Flux Isotope Reactor (HFIR) at Oak Ridge National Laboratory. Additional information on the 249Bk levels was obtained from the study of γ rays produced in the β- decay of 249Cm. The 249Cm sample was produced by neutron irradiation of 248Cm. Using the results of the present study and the results of previous 248Cm(α,t) and 248Cm(3He,d) reaction spectra, the following single-particle states have been identified in 249Bk: 7/2+[633], 0.0 keV; 3/2-[521], 8.78 keV; 1/2+[400], 377.55 keV: 5/2+[642], 389.17 keV; 1/2-[530], 569.19 keV; 1/2-[521], 643.0 keV; 5/2-[523], 672.8 keV; 9/2+[624], 1075.1 keV. Four vibrational bands were identified at 767.9, 932.2, 1150.7 and 1223.0 keV with tentative assignments of {7/2+[633]x1-}9/2-, {7/2+[633]x0-}7/2-, {7/2+[633]x1-}5/2- and {7/2+[633]x0+}7/2+, respectively

  5. Tuberculosis management practices of private practitioners in Pune municipal corporation, India.

    Directory of Open Access Journals (Sweden)

    Sandeep Bharaswadkar

    Full Text Available BACKGROUND: Private Practitioners (PP are the primary source of health care for patients in India. Limited representative information is available on TB management practices of Indian PP or on the efficacy of India's Revised National Tuberculosis Control Programme (RNTCP to improve the quality of TB management through training of PP. METHODS: We conducted a cross-sectional survey of a systematic random sample of PP in one urban area in Western India (Pune, Maharashtra. We presented sample clinical vignettes and determined the proportions of PPs who reported practices consistent with International Standards of TB Care (ISTC. We examined the association between RNTCP training and adherence to ISTC by calculating odds ratios and 95% confidence intervals. RESULTS: Of 3,391 PP practicing allopathic medicine, 249 were interviewed. Of these, 55% had been exposed to RNTCP. For new pulmonary TB patients, 63% (158/249 of provider responses were consistent with ISTC diagnostic practices, and 34% (84/249 of responses were consistent with ISTC treatment practices. However, 48% (120/249 PP also reported use of serological tests for TB diagnosis. In the new TB case vignette, 38% (94/249 PP reported use of at least one second line anti-TB drug in the treatment regimen. RNTCP training was not associated with diagnostic or treatment practices. CONCLUSION: In Pune, India, despite a decade of training activities by the RNTCP, high proportions of providers resorted to TB serology for diagnosis and second-line anti-TB drug use in new TB patients. Efforts to achieve universal access to quality TB management must account for the low quality of care by PP and the lack of demonstrated effect of current training efforts.

  6. Single amino acid mutation alters thermostability of the alkaline protease from Bacillus pumilus: thermodynamics and temperature dependence.

    Science.gov (United States)

    Huang, Rong; Yang, Qingjun; Feng, Hong

    2015-02-01

    Dehairing alkaline protease (DHAP) from Bacillus pumilus BA06 has been demonstrated to have high catalytic efficiency and good thermostability, with potential application in leather processing. In order to get insights into its catalytic mechanism, two mutants with single amino acid substitution according to the homology modeling and multiple sequence alignment were characterized in thermodynamics of thermal denaturation and temperature dependence of substrate hydrolysis. The results showed that both mutants of V149I and R249E have a systematic increase in catalytic efficiency (kcat/Km) in a wide range of temperatures, mainly due to an increase of k1 (substrate diffusion) and k2 (acylation) for V149I and of k2 and k3 (deacylation) for R249E. In comparison with the wild-type DHAP, the thermostability is increased for V149I and decreased for R249E. Thermodynamic analysis indicated that the free energy (ΔGa°) of activation for thermal denaturation may govern the thermostability. The value of ΔGa° is increased for V149I and decreased for R249E. Based on these data and the structural modeling, it is suggested that substitution of Val149 with Ile may disturb the local flexibility in the substrate-binding pocket, leading to enhancement of binding affinity for the substrate. In contrast, substitution of Arg249 with Glu leads to interruption of interaction with the C-terminal of enzyme, thus resulting in less thermostability. This study indicates that amino acid residues in the active center or in the substrate-binding pocket may disturb the catalytic process and can be selected as the target for protein engineering in the bacterial alkaline proteases. PMID:25534779

  7. Evaluation of anticonvulsant actions of dibromophenyl enaminones using in vitro and in vivo seizure models.

    Directory of Open Access Journals (Sweden)

    Mohamed G Qaddoumi

    Full Text Available Epilepsy and other seizure disorders are not adequately managed with currently available drugs. We recently synthesized a series of dibromophenyl enaminones and demonstrated that AK6 and E249 were equipotent to previous analogs but more efficacious in suppressing neuronal excitation. Here we examined the actions of these lead compounds on in vitro and in vivo seizure models. In vitro seizures were induced in the hippocampal slice chemically (zero Mg2+ buffer and picrotoxin and electrically using patterned high frequency stimulation (HFS of afferents. In vivo seizures were induced in rats using the 6 Hz and the maximal electroshock models. AK6 (10 µM and E249 (10 µM depressed the amplitude of population spikes recorded in area CA1 of the hippocampus by -50.5±4.3% and -40.1±3.1% respectively, with partial recovery after washout. In the zero Mg2+ model, AK6 (10 µM depressed multiple population spiking (mPS by -59.3±6.9% and spontaneous bursts (SBs by -65.9±7.2% and in the picrotoxin-model by -43.3±7.2% and -50.0±8.3%, respectively. Likewise, E249 (10 µM depressed the zero-Mg2+-induced mPS by -48.8±9.5% and SBs by -55.8±15.5%, and in the picrotoxin model by -37.1±5.5% and -56.5±11.4%, respectively. They both suppressed post-HFS induced afterdischarges and SBs. AK6 and E249 dose-dependently protected rats in maximal electroshock and 6 Hz models of in vivo seizures after 30 min pretreatment. Their level of protection in both models was similar to that obtained with phenytoin Finally, while AK6 had no effect on locomotion in rats, phenytoin significantly decreased locomotion. AK6 and E249, suppressed in vitro and in vivo seizures to a similar extent. Their in vivo activities are comparable with but not superior to phenytoin. The most efficacious, AK6 produced no locomotor suppression while phenytoin did. Thus, AK6 and E249 may be excellent candidates for further investigation as potential agents for the treatment of epilepsy syndromes

  8. NUCLEAR SPECTROSCOPIC STUDIES OF SOME VERY HEAVY ODD-MASS NUCLIDES

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, Irshad

    1966-09-20

    The nuclear radiations of nuclides: U{sup 233}, Pu{sup 239}, Bk{sup 243}, Bk{sup 244}, Bk{sup 245}, Bk{sup 246}, Bk{sup 249}, Cf{sup 249}, and Fm{sup 255} were investigated with high-resolution spectrometers. The {alpha}-particle spectra of all nuclides except Bk{sup 249} were measured with 6 mm diameter surface-barrier detectors. Bk{sup 249} {alpha}-particles were analyzed with a double-focusing magnetic spectrograph. The {gamma}-singles were examined with the recently developed Ge(Li) and Si(Li) detectors coupled with very-low noise 'internal FET' preamplifiers. Weak alpha groups were observed in coincidence with {gamma}-rays, detected with a NaI(Tl) scintillation spectrometer. To improve the over-all coincidence efficiency a new coincidence apparatus was designed and built. This instrument consisted of a cooled 4.5 cm diameter semiconductor detector for {alpha}-particle detection and a 3 cm diameter by 2.7 cm long Ge(Li) detector for {gamma}-ray analysis. The Ge(Li) detector could also be replaced with a NaI(Tl) detector. Cf{sup 249} conversion electrons were measured with a cooled Si(Li) detector coupled with an internal FET preamplifier. On the basis of the present work and previous information, energy-level diagrams of the daughter nuclei have been constructed. The levels have been grouped into rotational bands built on Nilsson single-particle states. Because of identification of several rotational members of the bands, definite Nilsson quantum number assignments have been made in most cases. The alpha intensity calculations of Poggenburg were found quite helpful in making these assignments. A strong Coriolis effect was observed in the Am{sup 245} levels populated by the alpha groups of Bk{sup 249}. Calculations were made with Nilsson wave-functions, and these were found to agree with the experimental results. The Coriolis interaction was found important in almost all cases; the effect was very noticeable in the level spacings between the rotational

  9. Determination of boron by ICP-AES in normal and malignant cells incubated 'in vitro' with fructose 10BPA

    International Nuclear Information System (INIS)

    This paper describes the development and optimization of methodology for total boron concentration in cell cultures coming from fixation and accumulation of this element by normal and malignant cells. On account of sample mass and low volume resulting from dilution, generally about 1 mL, a procedure for automatic injection of micro volumes was designed, developed and optimized. Iron interference was carefully studied. Linear calibration curves were obtained for 50 to 2500 ng B/mL range. Determination limits were 10 and 20 ng B/mL for B 249.772 nm and 249.677 nm, respectively. Repeatability, expressed as relative standard deviation was better than 5% for a 100 ng B/mL. Recovery of analyte added to real samples ranged between 95 and 103%. The method was applied to studies on F-98 cells (rat glioma) and normal glia in BNCT project frame. (author)

  10. Disperse Red 1 (textile dye) induces cytotoxic and genotoxic effects in mouse germ cells.

    Science.gov (United States)

    Fernandes, Fábio Henrique; Bustos-Obregon, Eduardo; Salvadori, Daisy Maria Fávero

    2015-06-01

    Disperse Red 1 (DR1), which is widely used in the textile industry, is an azo dye that contributes to the toxicity and pollution of wastewater. To assess the toxic effects of DR1 on reproduction, sexually mature male mice (Mus musculus, strain CF-1) were orally (gavage) treated with single doses of the compound at 20, 100 and 500 mg/kg body weight. Testicular features and sperm parameters were evaluated 8.3, 16.6 and 24.9 days after treatments. In addition to testicular toxicity caused by the dye, the data clearly showed an increased frequency of sperm with abnormal morphology and decreased fertility. An increased amount of DNA damage was also detected in testis cells 16.6 and 24.9 days after treatments with 100 and 500 mg/kg. This study demonstrated the toxic and genotoxic effects of DR1, indicating the harmful activity of this dye on reproductive health. PMID:25883024

  11. Generation of an actinide isotopes cross section set for fast reactor calculations using data from ENDL and ENDF/B-IV

    International Nuclear Information System (INIS)

    A Bondarenko format 25-group cross section set of actinide isotopes was generated for the fuel cycle evaluation and the incineration study in fast reactor systems. Evaluated Nuclear Data Library of Lawrence Livermore Laboratory (U.S.) was used as the source data. The actinide isotopes treated are the following 28: Th-232, U-233, U-234, U-235, U-236, U-237, Pu-238, Pu-239, Pu-240, Pu-241, Pu-242, Pu-243, Am-241, Am-242, Am-243, Cm-242, Cm-243, Cm-245, Cm-246, Cm-247, Cm-248, Bk-249, Cf-249, Cf-250, Cf-251, Cf-252 and a pseudo-fission product. ENDF/B-IV was used for U-238. The set was then collapsed to one energy group using a large LMFBR core spectrum for the comparison with other one-group sets. (author)

  12. Discovery of the new element Z=117 and confirmation of 115

    International Nuclear Information System (INIS)

    The discovery of the new chemical element with atomic number Z=117 is presented. The isotopes 293117 and 294117 were produced in fusion reactions between 48Ca and 249Bk. The 249Bk was produced in the High Flux Isotope Reactor and chemically separated at Oak Ridge. Decay chains involving eleven new nuclei were identified by means of the Dubna Gas-Filled Recoil Separator. The measured decay properties show a strong rise of stability for superheavy nuclei toward N=184.The reaction 243Am+48Ca was studied at three energies. Twenty one decay chains of 288115 and one decay chain of 289115 were observed to confirm the earlier discoveries of Z=115 and 117. (authors)

  13. An integrated catalog of reference genes in the human gut microbiome

    DEFF Research Database (Denmark)

    Li, Junhua; Jia, Huijue; Cai, Xianghang;

    2014-01-01

    Many analyses of the human gut microbiome depend on a catalog of reference genes. Existing catalogs for the human gut microbiome are based on samples from single cohorts or on reference genomes or protein sequences, which limits coverage of global microbiome diversity. Here we combined 249 newly ...... signatures. This expanded catalog should facilitate quantitative characterization of metagenomic, metatranscriptomic and metaproteomic data from the gut microbiome to understand its variation across populations in human health and disease.......Many analyses of the human gut microbiome depend on a catalog of reference genes. Existing catalogs for the human gut microbiome are based on samples from single cohorts or on reference genomes or protein sequences, which limits coverage of global microbiome diversity. Here we combined 249 newly...

  14. Spectrophotometric determination of tranexamic acid using vanillin

    Institute of Scientific and Technical Information of China (English)

    EM.A.Rind; M.G.H.Laghari; A.H.Memon; U.R.Mughal; F. Almani; N.Me-mon; M.Y.Khuhawar; M.L.Maheshwari

    2009-01-01

    A new spectrophotometric method has been examined for the determination of the tranexamic acid (TA)by derivatization with vanillin(VAN).The molar absorptivity of TA was calculated 25 160 L·mol-1·cm-1at λ max 354 nm and obeyed the Beer's law within 0.5-2.5 μg·mL-1.The color reaction was highly stable and didnot show any change in absorbance up to 24 h.The method was applied for the analysis of TA from capsules,injections and tooth pastes.The amounts of TA found in capsules,injections and tooth pastes of various pharmaceutical companies were observed with 249.0-250.9 mg/capsule,249.3-250.7 mg/injection and 0.048%-0.049%in tooth pastes with relative standard deviation(RSD)0.2%-5.0%(n=3).

  15. Recent progress in 8igenomic research of liver cancer

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Along the course of occurrence and development of liver cancer,the corresponding somatic cells accumulate some important genetic variations.These variations may be divided into two categories.For the genetic changes closely related to etiology of liver cancer,the well-known cases include insertion and integration of the hepatitis B virus(HBV) DNA after infection,and mutations at site 249 of the tumor suppressor gene p53 induced by exposure to aflatoxin B1.The secondary genetic changes include amplification and deletion of certain chromosome regions,mutations in p53 at the sites other than 249,as well as the mutational activation of the Wnt/β-catenin signal pathway.The tumor cells with these genetic variations may gradually become the dominant clones under evolutionary selection.Besides,identification of genetic susceptible against risk of liver malignancy is also an important aspect of research in this field.

  16. Separation of 248Cm (III) from 252Cf (III) and its use in time resolved fluorescence spectroscopic (TRFS) studies

    International Nuclear Information System (INIS)

    The present report gives a description of the methodology for the separation of 248Cm(III) from decayed 252Cf (III) waste solution. The waste solution was first assayed for 252Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248Cm (III) from 252Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246Cm and 248Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252Cf. The gamma ray abundances of 249Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)

  17. Discovery of the New Element Z=117 and Confirmation of 115

    Directory of Open Access Journals (Sweden)

    Oganessian Yu. Ts.

    2011-10-01

    Full Text Available The discovery of the new chemical element with atomic number Z=117 is presented. The isotopes 293 117 and 294117 were produced in fusion reactions between 48Ca and 249Bk. The 249Bk was produced in the High Flux Isotope Reactor and chemically separated at Oak Ridge. Decay chains involving eleven new nuclei were identified by means of the Dubna Gas-Filled Recoil Separator. The measured decay properties show a strong rise of stability for superheavy nuclei toward N=184.The reaction 243Am+48Ca was studied at three energies. Twenty one decay chains of 288115 and one decay chain of 289115 were observed to confirm the earlier discoveries of Z=115 and 117.

  18. 17 CFR 229.512 - (Item 512) Undertakings.

    Science.gov (United States)

    2010-04-01

    ... statement to include any financial statements required by “Item 8.A. of Form 20-F (17 CFR 249.220f)” at the... with Item 1100(c)(1) of Regulation AB (17 CFR 229.1100(c)(1)) shall be deemed to be a new registration... CFR 229.1105), information provided in response to that Item pursuant to Rule 312 of Regulation...

  19. Role of hepatitis C virus in chronic liver disease occurring after orthotopic liver transplantation.

    OpenAIRE

    Pastore, M; Willems, M.; Cornu, C.; Buts, Jean-Paul; REDING, Raymond; de Ville de Goyet, J; Rahier, Jacques; Otte, Jean-Bernard; Yapo, Séverin; Sokal, Etienne

    1995-01-01

    Paediatric orthotopic liver transplant recipients may develop chronic hepatitis after surgery. To investigate the role of hepatitis C virus in this pathology a cohort of 249 paediatric orthotopic liver transplant recipients was studied. Sixteen children (6.4%) were found to have chronic hepatitis C virus hepatitis after orthotopic liver transplantation. All but one of them had serum transaminase values which were persistently raised two to eight times the upper limit of normal. Thirteen were ...

  20. The relationship between the rate of melatonin excretion and sleep consolidation for locomotive engineers in natural sleep settings

    OpenAIRE

    Roach, Gregory D.; Reid, Kathryn J.; Ferguson, Sally; Dawson, Drew

    2006-01-01

    Background: The aim of the study was to examine the role that melatonin production plays in the regulation of sleep consolidation in a population of shiftworkers working and sleeping in their natural environments.Methods: 253 locomotive engineers (249 male, 4 female, mean age = 39.7 years) participated in the study for a 2-week period whilst working their normal roster patterns. Participants recorded details for all sleep periods in a sleep diary and collected urine samples during each day's ...

  1. Optic Nerve Avulsion after Blunt Trauma

    Directory of Open Access Journals (Sweden)

    Hacı Halil Karabulut

    2014-05-01

    Full Text Available Optic nerve avulsion is an uncommon presentation of ocular trauma with a poor prognosis. It can be seen as complete or partial form due to the form of trauma. We assessed the complete optic nerve avulsion in a 16-year-old female patient complaining of loss of vision in her left eye after a traffic accident. (Turk J Ophthalmol 2014; 44: 249-51

  2. Platelet Factor 4/Heparin Antibodies in Blood Bank Donors

    OpenAIRE

    Hursting, Marcie J; Pai, Poulomi J.; McCracken, Julianna E.; Hwang, Fred; Suvarna, Shayela; Lokhnygina, Yuliya; Bandarenko, Nicholas; Arepally, Gowthami M.

    2010-01-01

    Platelet factor 4 (PF4)/heparin antibody, typically associated with heparin therapy, is reported in some heparin-naive people. Seroprevalence in the general population, however, remains unclear. We prospectively evaluated PF4/heparin antibody in approximately 4,000 blood bank donors using a commercial enzyme-linked immunosorbent assay for initial and then repeated (confirmatory) testing. Antibody was detected initially in 249 (6.6%; 95% confidence interval [CI], 5.8%-7.4%) of 3,795 donors and...

  3. Kulturní památky jako pravopisný problém

    Czech Academy of Sciences Publication Activity Database

    Černá, Anna

    Bratislava: Veda, 2014 - (Ondrejovič, S.; Satinská, L.; Vrábľová, J.), s. 249-255 ISBN 978-80-224-1416-6. [Slovník a jeho používatelia. Smolenice (SK), 08.12.2012-10.12.2012] R&D Projects: GA ČR GAP406/11/2017 Institutional support: RVO:68378092 Keywords : capital letter * orthography * cultural heritage sites * monuments * astronomical clock Subject RIV: AI - Linguistics

  4. Preliminary organizational culture scale focused on artifacts

    OpenAIRE

    Bonavia, Tomas

    2006-01-01

    In this preliminary study, an organizational culture scale was developed to assess cultural artifacts according to Schein´s typology (1985). It includes a set of cultural artifacts to measure the extent to which an organization is more or less traditional. A total of 249 managers from a range of different companies responded to the items. Preliminary analysis yielded a one-dimensional scale with 14 items with high internal consistency and homogeneity.

  5. Poslední den odsouzence

    Czech Academy of Sciences Publication Activity Database

    Hrbata, Zdeněk

    Academia : Praha, 2011 - (Peisertová, L.; Petrbok, V.; Randák, J.), s. 243-249 ISBN 978-80-200-1900-4. [Zločin a trest v české kultuře 19. století. Plzeň (CZ), 25.02.2010-27.02.2010] Institutional research plan: CEZ:AV0Z90560517 Keywords : French literature * Hugo, Victor * prison * execution Subject RIV: AJ - Letters, Mass-media, Audiovision

  6. Polygenic risk for externalizing disorders: Gene-by-development and gene-by-environment effects in adolescents and young adults

    OpenAIRE

    Salvatore, Jessica E.; Aliev, Fazil; Bucholz, Kathleen; Agrawal, Arpana; Hesselbrock, Victor; Hesselbrock, Michie; Bauer, Lance; Kuperman, Samuel; Marc A Schuckit; Kramer, John; Edenberg, Howard J.; Foroud, Tatiana M.; Dick, Danielle M

    2014-01-01

    In this project, we aimed to bring large-scale gene identification findings into a developmental psychopathology framework. Using a family-based sample, we tested whether polygenic scores for externalizing disorders—based on single nucleotide polymorphism weights derived from genome-wide association study results in adults (n = 1,249)—predicted externalizing disorders, subclinical externalizing behavior, and impulsivity-related traits adolescents (n = 248) and young adults (n = 207), and whet...

  7. Preschool and Educational Technology: Evaluating a Tablet-Based Math Curriculum in Mexico City

    OpenAIRE

    Garduno, Ana Eugenia

    2016-01-01

    This study examines the effect of an intervention called Native Numbers on the development of number sense and quantitative skills in low-SES preschool children (ages 5 to 6) in Mexico City, using a randomized control trial (RCT). Native Numbers (NN) is a math curriculum built as an application for iPads that includes activities on number concepts, relations, ordering and counting. The study was conducted in 2014, with eight participating schools and an analytic sample of 249 students. The in...

  8. M-Commerce service systems implementation

    OpenAIRE

    Asmahan Altaher

    2012-01-01

    Mobile commerce supports automated banking services. However, the implementation of m-commerce services systems has become increasingly important in today’s dynamic banking environment. This research studied the relationships between technology acceptance model and m- commerce services. The results of the survey on 249 respondents in several Jordan banks revealed that technology acceptance model had a significant impact on m-commerce services. The results led to the recommendation that the te...

  9. Nonconformity problem in 3D Grid decomposition

    Czech Academy of Sciences Publication Activity Database

    Kolcun, Alexej

    2002-01-01

    Roč. 10, č. 1 (2002), s. 249-253. ISSN 1213-6972. [International Conference in Central Europe on Computer Graphics, Visualization and Computer Vision 2002/10./. Plzeň, 04.02.2002-08.02.2002] R&D Projects: GA ČR GA105/99/1229; GA ČR GA105/01/1242 Institutional research plan: CEZ:AV0Z3086906 Keywords : structured mesh * decomposition * nonconformity Subject RIV: BA - General Mathematics

  10. Analisis Faktor Untuk Mengetahui Hambatan Dalam Penggunaan Kontrasepsi Implan Di Desa Suka Maju Kecamatan Sunggal Kabupaten Deli Serdang Tahun 2015

    OpenAIRE

    Nasution, Pratiwi

    2016-01-01

    It is estimated that Indonesia is the fifth country in the world with the population of 249 million. The amount of population in Indonesia is increasing; therefore, Family Planning program is used as the method to curb the population growth. If it is viewed from the contraceptive method proposed by the government, implant contraception method has fewer interested people although it has long term effectiveness. The objective of the researchwas to find out some obstacles in using implant contra...

  11. Happiness and Depression in Adolescence after Maternal Smoking during Pregnancy: Birth Cohort Study

    OpenAIRE

    Menezes, Ana Maria Baptista; Murray, Joseph; László, Mitzi; Wehrmeister, Fernando C.; Hallal, Pedro C; Gonçalves, Helen; Assunção, Maria Cecilia F.; Menezes, Carolina Baptista; Fernando C. Barros

    2013-01-01

    Background Prenatal cigarette smoke exposure may have adverse psychological effects on offspring. The objective was to assess the association between parental smoking during pregnancy and offspring happiness at age 18, as well as depression. Methodology Participants were part of a birth cohort study in Pelotas, Brazil (5,249 participants). Happiness was measured by the Subjective Happiness Scale, a Likert-like scale with four questions generating a score from 1 to 7, with ≥ 6 indicating "happ...

  12. Stimulant ADHD medication and risk for substance abuse

    OpenAIRE

    Chang, Z.(Texas A&M University, College Station, TX, 77843, USA); Lichtenstein, P.; Halldner, L; D'Onofrio, B; Serlachius, E.; Fazel, S.; Långström, N.; Larsson, H

    2013-01-01

    Background: There are persistent concerns of long-term effects of stimulant ADHD medication on the development of substance abuse. Methods: Using Swedish national registers, we studied all individuals born between 1960 and 1998 and diagnosed with ADHD (26,249 men and 12,504 women). We investigated the association between stimulant ADHD medication in 2006 and substance abuse during 2009. Substance abuse was indexed by substance-related death, crime, or hospital visits. Results: ADHD medication...

  13. 2006年欧洲萨托利防务展轻武器撷英(下)

    Institute of Scientific and Technical Information of China (English)

    王正和(编译)

    2006-01-01

    IWI公司的伽利尔狙击步枪(配用新型枪托);美国AAI公司的LSAT计划轻机枪概念模型;比利时FN米尼米7.62mm轻机枪;美国M240 E6钛通用机枪;美国新型M249班用机枪。

  14. The chemical characteristics of soil which determine phosphorus partitioning in highly calcareous soils

    OpenAIRE

    ANA TOPALOVIC; LIDIJA B. PFENDT; NATALIJA PEROVIC; DRAGANA DJORDJEVIC; SNEZANA TRIFUNOVIC; PETAR A. PFENDT

    2006-01-01

    Phosphorus fractions from three highly calcareous soils (average, 24.9 ± 4.8 %CO32-) from sampling sites with aMediterranean climate were isolated by sequential extraction. In order to provide a more reliable basis for the definition of the obtained P-fractions, principal component analysis was applied and from the chemical characteristics of the 14 investigated soils, those characteristics which define the content and association features of the P-fractions were assessed. The soils are chara...

  15. Gairo virus, a novel arenavirus of the widespread Mastomys natalensis: Genetically divergent, but ecologically similar to Lassa and Morogoro viruses

    Czech Academy of Sciences Publication Activity Database

    Gryseels, S.; Rieger, T.; Oestereich, L.; Cuypers, B.; Borremans, B.; Makundi, R.; Leirs, H.; Günther, S.; Goüy de Bellocq, Joëlle

    2015-01-01

    Roč. 476, February (2015), s. 249-256. ISSN 0042-6822 R&D Projects: GA ČR GCP502/11/J070; GA MŠk EE2.3.20.0303 Institutional support: RVO:68081766 Keywords : Arenavirus * Mastomys natalensis * Tanzania * Virology * Phylogeny * Ecology * Zoonotic infections * Hemorrhagic fevers Subject RIV: EE - Microbiology, Virology Impact factor: 3.321, year: 2014

  16. Cadmium-induced inhibition of photosynthesis and long-term acclimation to cadmium stress in the hyperaccumulator Thlaspi caerulescens

    Czech Academy of Sciences Publication Activity Database

    Küpper, H.; Parameswaran, A.; Leitenmaier, B.; Trtílek, M.; Šetlík, Ivan

    2007-01-01

    Roč. 175, - (2007), s. 655-674. ISSN 0028-646X R&D Projects: GA MŠk ME 138 Grant ostatní: GA MŠk(CZ) VS96085 Institutional research plan: CEZ:AV0Z50200510 Source of funding: V - iné verejné zdroje Keywords : hyperaccumulators * phytoremediation * photosystem II Subject RIV: EE - Microbiology, Virology Impact factor: 5.249, year: 2007

  17. 12 CFR 563d.802 - Description of business.

    Science.gov (United States)

    2010-01-01

    ... return on equity and assets, item 7(d)(5), should include a line item for “dividend payout ratio...-business portion of: (1) Registration statements filed on Form 10 (item 1) (17 CFR 249.210), (2) Proxy and... Schedule 14A and item 1 of Schedule 14C) (17 CFR 240.14a-101 and 240.14c-101), and (3) Annual reports...

  18. Gas scrubbers used in pollution control. Volume 4. 1977-March, 1980 (citations from the Engineering Index Data Base). Report for 1977-Mar 80

    Energy Technology Data Exchange (ETDEWEB)

    Cavagnaro, D.M.

    1980-03-01

    The citations from a worldwide literature survey relate to particle and gas scrubbers. The reports discuss design, performance, gas flow characteristics, and chemistry of the pollutants. Pollution control of SO2, NOx, CO, CO2, hydrocarbons, and particles is considered. (This updated bibliography contains 249 abstracts, 84 of which are new entries to the previous edition.) Volume 2, 1974-1975, NTIS/PS-77/0192, and Volume 3, 1976, NTIS/PS-78/0255.

  19. Thomson parabola spectrometry for gold laser generated plasmas

    Czech Academy of Sciences Publication Activity Database

    Torrisi, L.; Cutroneo, M.; Andó, L.; Ullschmied, Jiří

    2013-01-01

    Roč. 20, č. 2 (2013), 023106-023106. ISSN 1070-664X R&D Projects: GA MŠk LM2010014 Institutional research plan: CEZ:AV0Z20430508 Keywords : acceleration * ions * Thomson parabola spectrometry * PALS laser * laser targets * gold ions Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.249, year: 2013 http://pop.aip.org/resource/1/phpaen/v20/i2/p023106_s1

  20. Detection of optics disc glaucoma damages using image analysis and artifical neural net

    Czech Academy of Sciences Publication Activity Database

    Pluháček, F.; Pospíšil, Jaroslav; Kuběna, T.; Marešová, K.

    Washington : SPIE The International Society for Optical Engineering, 2003 - (Boccara, A.), s. 240-249 ISBN 0-8194-5013-8. ISSN 1605-7422. - (Proceedings of SPIE. OSA Biomedical Optics. 5143). [Novel Optical Instrumentation for Biomedical Applications. Munich (DE), 24.06.2003-25.06.2003] Institutional research plan: CEZ:AV0Z1010921 Keywords : glaucoma * image analysis * statistical evaluation * neural net * visual field Subject RIV: BH - Optics, Masers, Lasers